BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27031_g1_i1 len=2228 path=[2206:0-2227]

Length=2228
                                                                      Score     E

ref|XP_009793116.1|  PREDICTED: protein MLP1-like isoform X1            781   0.0      
ref|XP_004235934.1|  PREDICTED: factor of DNA methylation 1             772   0.0      
ref|XP_009763380.1|  PREDICTED: myosin type-2 heavy chain 1-like        770   0.0      
ref|XP_009605544.1|  PREDICTED: myb-like protein X isoform X2           769   0.0      
ref|XP_009605543.1|  PREDICTED: myb-like protein X isoform X1           768   0.0      
ref|XP_009626788.1|  PREDICTED: coiled-coil domain-containing pro...    768   0.0      
ref|XP_006341360.1|  PREDICTED: myosin-9-like                           761   0.0      
gb|EYU21722.1|  hypothetical protein MIMGU_mgv1a002818mg                735   0.0      
emb|CDO98219.1|  unnamed protein product                                732   0.0      
ref|XP_011073344.1|  PREDICTED: factor of DNA methylation 1             729   0.0      
ref|XP_002267381.1|  PREDICTED: factor of DNA methylation 1             721   0.0      Vitis vinifera
ref|XP_002267670.1|  PREDICTED: factor of DNA methylation 1 isofo...    718   0.0      Vitis vinifera
emb|CAN83544.1|  hypothetical protein VITISV_021077                     717   0.0      Vitis vinifera
ref|XP_010656778.1|  PREDICTED: factor of DNA methylation 1 isofo...    717   0.0      
gb|KHG15531.1|  suppressor of gene silencing 3                          704   0.0      
ref|XP_008361182.1|  PREDICTED: putative leucine-rich repeat-cont...    701   0.0      
ref|XP_010678967.1|  PREDICTED: factor of DNA methylation 1-like        698   0.0      
ref|XP_007023402.1|  XH/XS domain-containing protein                    691   0.0      
ref|XP_008375509.1|  PREDICTED: putative leucine-rich repeat-cont...    687   0.0      
ref|XP_008228782.1|  PREDICTED: interaptin-like                         687   0.0      
ref|XP_003531733.1|  PREDICTED: protein MLP1-like isoform X1            686   0.0      
gb|KDP41984.1|  hypothetical protein JCGZ_27002                         685   0.0      
ref|XP_003530299.1|  PREDICTED: structural maintenance of chromos...    684   0.0      
ref|XP_007214938.1|  hypothetical protein PRUPE_ppa002776mg             682   0.0      
ref|XP_006465197.1|  PREDICTED: myosin-10-like                          679   0.0      
ref|XP_006427593.1|  hypothetical protein CICLE_v10025142mg             679   0.0      
ref|XP_002527307.1|  conserved hypothetical protein                     670   0.0      Ricinus communis
ref|XP_007135809.1|  hypothetical protein PHAVU_010G160300g             664   0.0      
ref|XP_007135808.1|  hypothetical protein PHAVU_010G160300g             664   0.0      
gb|KDO42995.1|  hypothetical protein CISIN_1g006762mg                   664   0.0      
emb|CAN62667.1|  hypothetical protein VITISV_028278                     656   0.0      Vitis vinifera
ref|XP_008454606.1|  PREDICTED: putative leucine-rich repeat-cont...    653   0.0      
ref|XP_008454609.1|  PREDICTED: putative leucine-rich repeat-cont...    652   0.0      
ref|XP_008461480.1|  PREDICTED: putative leucine-rich repeat-cont...    651   0.0      
emb|CBI40115.3|  unnamed protein product                                646   0.0      
ref|XP_010063555.1|  PREDICTED: CAP-Gly domain-containing linker ...    648   0.0      
gb|AES86419.2|  XH/XS domain protein                                    648   0.0      
ref|XP_004139640.1|  PREDICTED: uncharacterized protein LOC101205093    648   0.0      
ref|XP_003604222.1|  hypothetical protein MTR_4g006760                  646   0.0      
ref|XP_003610367.1|  hypothetical protein MTR_4g131350                  645   0.0      
ref|XP_002303841.1|  XH domain-containing family protein                639   0.0      Populus trichocarpa [western balsam poplar]
gb|KEH32486.1|  XH/XS domain protein                                    636   0.0      
ref|XP_010092186.1|  hypothetical protein L484_013504                   627   0.0      
ref|XP_010101455.1|  hypothetical protein L484_012877                   612   0.0      
ref|XP_009793120.1|  PREDICTED: protein GRIP-like isoform X2            598   0.0      
gb|KDO42997.1|  hypothetical protein CISIN_1g006762mg                   598   0.0      
ref|XP_010265641.1|  PREDICTED: factor of DNA methylation 1-like ...    600   0.0      
ref|XP_004303249.1|  PREDICTED: uncharacterized protein LOC101303532    597   0.0      
ref|XP_010678965.1|  PREDICTED: factor of DNA methylation 1-like        593   0.0      
ref|XP_004510284.1|  PREDICTED: uncharacterized protein PFB0145c-...    586   0.0      
ref|XP_010937610.1|  PREDICTED: factor of DNA methylation 1-like        582   0.0      
ref|XP_010537880.1|  PREDICTED: factor of DNA methylation 1-like        582   0.0      
ref|XP_008799862.1|  PREDICTED: MAR-binding filament-like protein 1     571   0.0      
gb|KGN44516.1|  hypothetical protein Csa_7G323110                       568   0.0      
ref|XP_010497500.1|  PREDICTED: factor of DNA methylation 1             563   0.0      
ref|XP_006416865.1|  hypothetical protein EUTSA_v10007054mg             563   0.0      
ref|XP_002890136.1|  XH/XS domain-containing protein                    563   0.0      
ref|NP_173043.1|  factor of DNA methylation 1                           562   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EPS59185.1|  hypothetical protein M569_15623                         556   0.0      
ref|XP_009149026.1|  PREDICTED: nuclear mitotic apparatus protein 1     555   0.0      
ref|NP_567176.2|  XH/XS domain-containing protein                       553   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008802711.1|  PREDICTED: paramyosin, long form-like              552   0.0      
ref|XP_006306990.1|  hypothetical protein CARUB_v10008566mg             552   0.0      
ref|XP_010476691.1|  PREDICTED: factor of DNA methylation 1-like        553   0.0      
ref|XP_009416142.1|  PREDICTED: uncharacterized protein LOC103996844    548   0.0      
emb|CDY52860.1|  BnaA09g56520D                                          533   7e-177   
ref|XP_009117794.1|  PREDICTED: myosin-11-like                          533   8e-177   
ref|XP_010910789.1|  PREDICTED: factor of DNA methylation 1-like        530   9e-176   
emb|CDY33370.1|  BnaC05g12130D                                          540   8e-175   
ref|XP_008784591.1|  PREDICTED: uncharacterized protein LOC103703501    522   1e-172   
emb|CDY35048.1|  BnaA06g10580D                                          509   3e-168   
ref|XP_004968083.1|  PREDICTED: synaptonemal complex protein 1-like     510   4e-168   
ref|XP_010472874.1|  PREDICTED: factor of DNA methylation 5-like        506   3e-166   
ref|XP_010256908.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      503   4e-165   
ref|NP_178194.1|  FACTOR OF DNA METHYLATION 5                           500   5e-164   Arabidopsis thaliana [mouse-ear cress]
gb|AAF02798.1|AF195115_18  F5I10.22 gene product                        494   2e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389833.1|  hypothetical protein EUTSA_v10018261mg             492   5e-161   
ref|XP_006300857.1|  hypothetical protein CARUB_v10019950mg             492   9e-161   
emb|CDX67967.1|  BnaA07g20070D                                          491   1e-160   
ref|XP_009104485.1|  PREDICTED: myosin-9-like                           485   3e-158   
ref|XP_010417660.1|  PREDICTED: factor of DNA methylation 5-like        485   4e-158   
ref|XP_002278500.1|  PREDICTED: protein INVOLVED IN DE NOVO 2 iso...    484   1e-157   Vitis vinifera
emb|CDX79353.1|  BnaC06g19500D                                          483   3e-157   
ref|XP_010429902.1|  PREDICTED: factor of DNA methylation 5-like        482   4e-157   
ref|XP_002443867.1|  hypothetical protein SORBIDRAFT_07g003550          481   9e-157   Sorghum bicolor [broomcorn]
ref|XP_006659121.1|  PREDICTED: putative leucine-rich repeat-cont...    478   2e-155   
ref|XP_002533154.1|  conserved hypothetical protein                     474   4e-154   Ricinus communis
ref|XP_010658558.1|  PREDICTED: protein INVOLVED IN DE NOVO 2 iso...    475   5e-154   
gb|EEC71144.1|  hypothetical protein OsI_02969                          471   5e-153   Oryza sativa Indica Group [Indian rice]
ref|XP_002456013.1|  hypothetical protein SORBIDRAFT_03g028860          471   7e-153   Sorghum bicolor [broomcorn]
ref|NP_001043655.1|  Os01g0633200                                       471   1e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009387522.1|  PREDICTED: uncharacterized protein LOC103974422    471   1e-152   
ref|XP_006644407.1|  PREDICTED: intracellular protein transport p...    469   3e-152   
ref|XP_004972828.1|  PREDICTED: synaptonemal complex protein 1-li...    468   1e-151   
ref|XP_004972827.1|  PREDICTED: synaptonemal complex protein 1-li...    468   2e-151   
gb|AGT17258.1|  X1 protein                                              463   6e-150   
ref|XP_003569414.1|  PREDICTED: factor of DNA methylation 1-like        462   2e-149   
ref|XP_010232023.1|  PREDICTED: factor of DNA methylation 1-like ...    461   2e-149   
ref|XP_007009298.1|  XH/XS domain-containing protein, putative is...    462   3e-149   
gb|AGT16789.1|  hypothetical protein SHCRBa_009_B01_R_10                461   4e-149   
ref|XP_011091511.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           461   1e-148   
gb|KDP44945.1|  hypothetical protein JCGZ_01445                         460   1e-148   
ref|NP_001168342.1|  putative XH domain family protein                  459   3e-148   Zea mays [maize]
gb|AGT16810.1|  transcription factor                                    459   4e-148   
ref|XP_004240949.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           459   4e-148   
ref|XP_003569416.1|  PREDICTED: factor of DNA methylation 1-like        459   4e-148   
emb|CDP00105.1|  unnamed protein product                                460   4e-148   
ref|XP_006362466.1|  PREDICTED: myosin-2 heavy chain-like isoform X1    459   1e-147   
ref|XP_006362467.1|  PREDICTED: myosin-2 heavy chain-like isoform X2    457   1e-147   
dbj|BAD21477.1|  putative X1                                            456   4e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007009299.1|  XH/XS domain-containing protein, putative is...    455   2e-146   
ref|XP_006645454.1|  PREDICTED: centrosomal protein of 128 kDa-like     452   2e-146   
gb|EEE56772.1|  hypothetical protein OsJ_06333                          457   2e-146   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB21190.1|  putative transcription factor                          452   2e-146   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002316281.2|  XH/XS domain-containing family protein             457   4e-146   Populus trichocarpa [western balsam poplar]
ref|XP_010108755.1|  hypothetical protein L484_011413                   455   4e-146   
gb|KHG06632.1|  KilA-N domain-containing protein                        451   4e-145   
gb|KHG15173.1|  Forkhead-associated domain-containing 1                 451   5e-145   
ref|XP_011027214.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           454   6e-145   
gb|EMS54623.1|  hypothetical protein TRIUR3_33647                       451   2e-144   
ref|NP_001146275.1|  putative transcription factor                      449   2e-144   Zea mays [maize]
ref|XP_010690719.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           448   6e-144   
ref|XP_010265647.1|  PREDICTED: factor of DNA methylation 1-like ...    445   7e-144   
ref|XP_003566895.1|  PREDICTED: factor of DNA methylation 1             446   1e-143   
ref|XP_010265646.1|  PREDICTED: factor of DNA methylation 1-like ...    445   2e-143   
ref|XP_008461675.1|  PREDICTED: flagellar attachment zone protein 1     447   2e-143   
ref|XP_004147687.1|  PREDICTED: uncharacterized protein LOC101219429    447   3e-143   
ref|XP_006435548.1|  hypothetical protein CICLE_v10030937mg             447   3e-143   
ref|XP_007220898.1|  hypothetical protein PRUPE_ppa002712mg             446   6e-143   
gb|KDO69291.1|  hypothetical protein CISIN_1g0065972mg                  445   1e-142   
gb|KEH34701.1|  XH/XS domain protein                                    444   3e-142   
ref|NP_001169159.1|  putative XH domain family protein                  439   6e-142   Zea mays [maize]
ref|XP_004503147.1|  PREDICTED: myosin-11-like isoform X1               443   6e-142   
ref|XP_010067411.1|  PREDICTED: coiled-coil domain-containing pro...    443   7e-142   
gb|KHN17925.1|  hypothetical protein glysoja_017976                     442   1e-141   
ref|XP_003538408.1|  PREDICTED: putative leucine-rich repeat-cont...    442   1e-141   
gb|KGN50554.1|  hypothetical protein Csa_5G182100                       447   1e-141   
gb|KCW65539.1|  hypothetical protein EUGRSUZ_G02937                     440   9e-141   
ref|XP_009343557.1|  PREDICTED: myosin heavy chain, cardiac muscl...    440   1e-140   
gb|EYU17877.1|  hypothetical protein MIMGU_mgv1a002871mg                439   3e-140   
emb|CBI40114.3|  unnamed protein product                                428   3e-140   
ref|XP_008343538.1|  PREDICTED: myosin-2 heavy chain-like               438   7e-140   
ref|XP_010234409.1|  PREDICTED: factor of DNA methylation 1-like ...    437   1e-139   
ref|XP_010234408.1|  PREDICTED: factor of DNA methylation 1-like ...    437   1e-139   
ref|XP_008354129.1|  PREDICTED: myosin-2 heavy chain-like               437   2e-139   
ref|XP_007163408.1|  hypothetical protein PHAVU_001G232400g             436   3e-139   
ref|XP_008233634.1|  PREDICTED: LOW QUALITY PROTEIN: CAP-Gly doma...    435   6e-139   
dbj|BAK05532.1|  predicted protein                                      433   1e-138   
ref|XP_009357740.1|  PREDICTED: myosin heavy chain, cardiac muscl...    434   2e-138   
ref|XP_008371804.1|  PREDICTED: WEB family protein At4g27595, chl...    432   1e-137   
dbj|BAH20228.1|  AT1G80790                                              428   2e-137   Arabidopsis thaliana [mouse-ear cress]
gb|EMS50669.1|  hypothetical protein TRIUR3_29122                       426   5e-137   
ref|XP_006300858.1|  hypothetical protein CARUB_v10019950mg             427   1e-136   
ref|XP_004307495.1|  PREDICTED: uncharacterized protein LOC101306757    429   1e-136   
ref|XP_009799105.1|  PREDICTED: golgin candidate 4                      428   4e-136   
emb|CDM83432.1|  unnamed protein product                                424   6e-136   
ref|XP_009589398.1|  PREDICTED: golgin candidate 4                      427   8e-136   
gb|EMT32524.1|  hypothetical protein F775_28173                         423   1e-135   
ref|XP_010940184.1|  PREDICTED: factor of DNA methylation 1-like        437   1e-135   
gb|AAV69067.1|  X1                                                      423   2e-135   Zea mays subsp. mexicana [annual teosinte]
gb|EMT07790.1|  hypothetical protein F775_28070                         426   2e-135   
gb|EMT17491.1|  hypothetical protein F775_14734                         443   2e-135   
gb|AAV69069.1|  X1                                                      423   3e-135   Zea luxurians [Florida teosinte]
gb|EMT09583.1|  hypothetical protein F775_10228                         424   6e-135   
ref|XP_006431940.1|  hypothetical protein CICLE_v10000571mg             425   6e-135   
gb|AAV69068.1|  X1                                                      421   1e-134   Zea mays subsp. parviglumis [Balsas teosinte]
dbj|BAJ90280.1|  predicted protein                                      423   2e-134   
gb|EMS57892.1|  hypothetical protein TRIUR3_23802                       424   3e-134   
ref|XP_006491884.1|  PREDICTED: calponin homology domain-containi...    422   4e-134   
gb|AAL35831.2|AF434705_1  putative transcription factor X1              422   5e-134   Triticum monococcum [einkorn wheat]
ref|XP_007156380.1|  hypothetical protein PHAVU_003G281400g             422   7e-134   
ref|XP_006585879.1|  PREDICTED: myosin heavy chain, clone 203-lik...    421   3e-133   
gb|KHN27026.1|  hypothetical protein glysoja_039182                     417   1e-131   
gb|AAB94013.1|  gene X-like protein                                     420   5e-130   Sorghum bicolor [broomcorn]
dbj|BAJ94618.1|  predicted protein                                      411   5e-130   
ref|XP_006575506.1|  PREDICTED: uncharacterized protein LOC100806...    421   7e-129   
ref|XP_006599359.1|  PREDICTED: uncharacterized protein PFB0765w-...    409   2e-128   
ref|NP_001042014.1|  Os01g0147700                                       409   3e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006595902.1|  PREDICTED: uncharacterized protein LOC100790...    419   4e-128   
gb|EAZ10533.1|  hypothetical protein OsJ_00365                          409   5e-128   Oryza sativa Japonica Group [Japonica rice]
gb|EMS57088.1|  hypothetical protein TRIUR3_02882                       411   6e-128   
gb|EAY72526.1|  hypothetical protein OsI_00387                          408   1e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_006575503.1|  PREDICTED: uncharacterized protein LOC100806...    420   1e-127   
ref|XP_003545257.1|  PREDICTED: uncharacterized protein LOC100790...    419   3e-127   
ref|XP_010651011.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           404   4e-127   
ref|XP_006655910.1|  PREDICTED: myosin-9-like                           405   9e-127   
gb|KHN41100.1|  hypothetical protein glysoja_013442                     416   2e-126   
emb|CDM82421.1|  unnamed protein product                                404   4e-126   
ref|XP_008655632.1|  PREDICTED: centrosomal protein of 128 kDa-like     404   5e-126   
ref|XP_006391023.1|  hypothetical protein EUTSA_v10019728mg             401   6e-126   
ref|XP_008673715.1|  PREDICTED: intraflagellar transport protein ...    403   6e-126   
ref|XP_004968205.1|  PREDICTED: uncharacterized protein LOC101778142    403   6e-126   
ref|XP_007009300.1|  XH/XS domain-containing protein, putative is...    398   2e-125   
ref|XP_007009301.1|  XH/XS domain-containing protein, putative is...    398   2e-125   
ref|XP_007009302.1|  XH/XS domain-containing protein isoform 5          397   2e-125   
ref|XP_006846222.1|  hypothetical protein AMTR_s00012p00230440          399   4e-125   
gb|EYU24614.1|  hypothetical protein MIMGU_mgv1a004328mg                395   9e-125   
ref|XP_003568833.1|  PREDICTED: factor of DNA methylation 1-like        399   3e-124   
gb|EMT16997.1|  hypothetical protein F775_14651                         400   2e-123   
ref|XP_002455202.1|  hypothetical protein SORBIDRAFT_03g006150          394   3e-122   Sorghum bicolor [broomcorn]
emb|CDP09063.1|  unnamed protein product                                390   1e-121   
gb|EMT15579.1|  hypothetical protein F775_11438                         390   2e-121   
ref|XP_010520107.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      388   1e-120   
dbj|BAJ97190.1|  predicted protein                                      389   2e-120   
ref|XP_010922973.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      382   2e-120   
gb|EMT14402.1|  hypothetical protein F775_20219                         393   3e-120   
ref|XP_003557426.1|  PREDICTED: factor of DNA methylation 1-like        386   2e-119   
ref|NP_001041898.1|  Os01g0126600                                       376   2e-119   Oryza sativa Japonica Group [Japonica rice]
gb|EMS45500.1|  hypothetical protein TRIUR3_12203                       384   3e-119   
gb|EMS64523.1|  hypothetical protein TRIUR3_35150                       387   4e-119   
ref|XP_006488337.1|  PREDICTED: myosin-2 heavy chain-like isoform X1    383   6e-119   
gb|KDO72840.1|  hypothetical protein CISIN_1g038527mg                   381   4e-118   
ref|XP_004161917.1|  PREDICTED: uncharacterized LOC101219429            380   6e-118   
ref|XP_006424841.1|  hypothetical protein CICLE_v10029911mg             383   9e-118   
gb|KHN07563.1|  hypothetical protein glysoja_019670                     378   1e-117   
ref|XP_006378650.1|  XH/XS domain-containing family protein             381   1e-117   
ref|NP_001054677.1|  Os05g0153200                                       379   2e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007141865.1|  hypothetical protein PHAVU_008G232300g             391   4e-117   
ref|XP_006435547.1|  hypothetical protein CICLE_v10030937mg             376   4e-117   
ref|XP_006486475.1|  PREDICTED: intracellular protein transport p...    377   6e-117   
gb|EEE62370.1|  hypothetical protein OsJ_17159                          379   1e-116   Oryza sativa Japonica Group [Japonica rice]
gb|KDO69293.1|  hypothetical protein CISIN_1g0065972mg                  375   1e-116   
ref|XP_002444012.1|  hypothetical protein SORBIDRAFT_07g005860          373   2e-116   Sorghum bicolor [broomcorn]
ref|XP_003616411.1|  Transcription factor X1-like protein               389   3e-116   
gb|KHG17770.1|  suppressor of gene silencing 3 -like protein            386   4e-116   
ref|XP_010232024.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-lik...    373   4e-116   
ref|XP_010503501.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      375   7e-116   
ref|XP_002875916.1|  XH/XS domain-containing protein                    375   7e-116   
gb|EAY96594.1|  hypothetical protein OsI_18500                          372   5e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_006431941.1|  hypothetical protein CICLE_v10000571mg             370   5e-115   
ref|XP_004490889.1|  PREDICTED: uncharacterized protein LOC101499...    385   7e-115   
gb|EPS61376.1|  hypothetical protein M569_13419                         371   2e-114   
ref|XP_010426360.1|  PREDICTED: protein INVOLVED IN DE NOVO 2           371   3e-114   
ref|XP_006846214.1|  hypothetical protein AMTR_s00012p00226630          370   7e-114   
ref|NP_190436.2|  XH/XS domain-containing protein                       370   1e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08088.1|  BnaA06g16380D                                          369   9e-113   
ref|XP_009149803.1|  PREDICTED: myosin-11                               367   1e-112   
ref|XP_006292435.1|  hypothetical protein CARUB_v10018651mg             366   2e-112   
emb|CAB62356.1|  putative protein                                       360   4e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81740.1|  BnaC08g38610D                                          356   5e-110   
tpg|DAA50216.1|  TPA: putative XH domain family protein                 361   7e-110   
ref|XP_010106492.1|  hypothetical protein L484_025250                   355   3e-108   
emb|CDP10823.1|  unnamed protein product                                357   7e-108   
ref|XP_011035877.1|  PREDICTED: factor of DNA methylation 4             354   4e-107   
ref|XP_008457475.1|  PREDICTED: centrosomal protein of 83 kDa           354   8e-107   
gb|KDP20451.1|  hypothetical protein JCGZ_05296                         353   8e-107   
ref|XP_008384852.1|  PREDICTED: calponin homology domain-containi...    353   1e-106   
ref|XP_003559697.1|  PREDICTED: factor of DNA methylation 4-like        350   2e-106   
ref|XP_006575505.1|  PREDICTED: uncharacterized protein LOC100806...    360   5e-106   
ref|XP_003568908.1|  PREDICTED: factor of DNA methylation 1-like        348   6e-106   
ref|XP_009150181.1|  PREDICTED: uncharacterized protein LOC103873521    349   6e-106   
ref|XP_004145335.1|  PREDICTED: uncharacterized LOC101207144            351   8e-106   
gb|AAM22638.2|AF434195_1  X1                                            340   1e-105   Zea mays [maize]
ref|XP_004154410.1|  PREDICTED: uncharacterized protein LOC101207144    352   1e-105   
gb|KHN20923.1|  hypothetical protein glysoja_009231                     358   2e-105   
gb|KGN65727.1|  hypothetical protein Csa_1G522530                       352   6e-105   
dbj|BAD52538.1|  putative transcription factor X1                       337   6e-105   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06773.1|  hypothetical protein F775_17939                         345   1e-104   
gb|EYU37790.1|  hypothetical protein MIMGU_mgv1a002821mg                345   2e-104   
dbj|BAE99100.1|  hypothetical protein                                   339   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010920577.1|  PREDICTED: factor of DNA methylation 1-like        336   2e-104   
ref|XP_004165825.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    348   4e-104   
ref|XP_010321721.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      343   5e-104   
ref|XP_008223681.1|  PREDICTED: uncharacterized protein PFB0765w        345   9e-104   
ref|XP_010685748.1|  PREDICTED: factor of DNA methylation 4             342   1e-103   
gb|EYU21705.1|  hypothetical protein MIMGU_mgv1a020880mg                330   3e-103   
ref|XP_009610604.1|  PREDICTED: uncharacterized protein LOC104104...    354   3e-103   
ref|XP_009791210.1|  PREDICTED: uncharacterized protein LOC104238...    354   4e-103   
ref|XP_007206603.1|  hypothetical protein PRUPE_ppa020716mg             342   6e-103   
ref|XP_002464269.1|  hypothetical protein SORBIDRAFT_01g015250          340   9e-103   Sorghum bicolor [broomcorn]
ref|XP_003610364.1|  hypothetical protein MTR_4g131310                  335   1e-102   
ref|XP_006345969.1|  PREDICTED: uncharacterized protein LOC102583...    348   1e-102   
gb|EMT16668.1|  hypothetical protein F775_11900                         341   2e-102   
ref|XP_010520104.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      339   2e-102   
ref|XP_009353657.1|  PREDICTED: uncharacterized protein LOC103944909    340   8e-102   
gb|KHN04171.1|  hypothetical protein glysoja_032667                     332   3e-101   
ref|XP_006345968.1|  PREDICTED: uncharacterized protein LOC102583...    347   3e-101   
ref|XP_006345966.1|  PREDICTED: uncharacterized protein LOC102583...    348   8e-101   
ref|XP_008375623.1|  PREDICTED: uncharacterized protein LOC103438859    327   8e-101   
gb|EMS65455.1|  hypothetical protein TRIUR3_13658                       333   5e-100   
ref|XP_006407322.1|  hypothetical protein EUTSA_v10020282mg             332   1e-99    
ref|XP_006366492.1|  PREDICTED: interaptin-like                         332   2e-99    
gb|EYU43462.1|  hypothetical protein MIMGU_mgv1a002657mg                332   3e-99    
emb|CDY42155.1|  BnaC05g40640D                                          331   3e-99    
emb|CDX77918.1|  BnaC03g53010D                                          329   6e-99    
emb|CDY37917.1|  BnaA06g19000D                                          329   6e-99    
ref|XP_004977060.1|  PREDICTED: myosin heavy chain, clone 203-like      329   2e-98    
ref|XP_011089476.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-lik...    328   3e-97    
ref|XP_011089473.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-lik...    328   4e-97    
gb|EEC75682.1|  hypothetical protein OsI_12489                          323   6e-97    
ref|XP_002882779.1|  hypothetical protein ARALYDRAFT_318024             325   7e-97    
ref|XP_010486975.1|  PREDICTED: factor of DNA methylation 3             325   1e-96    
gb|ABB89773.1|  At3g12550-like protein                                  325   2e-96    
ref|XP_010465028.1|  PREDICTED: factor of DNA methylation 3-like        324   2e-96    
ref|XP_006404228.1|  hypothetical protein EUTSA_v10010188mg             322   9e-96    
ref|XP_006350773.1|  PREDICTED: uncharacterized protein LOC102596562    325   1e-95    
ref|XP_010499136.1|  PREDICTED: factor of DNA methylation 3-like        321   3e-95    
ref|XP_004239795.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      330   2e-94    
ref|XP_009146609.1|  PREDICTED: uncharacterized protein LOC103870246    319   2e-94    
ref|XP_006595025.1|  PREDICTED: myosin-11-like isoform X1               319   4e-94    
emb|CDY35898.1|  BnaA07g00890D                                          307   8e-94    
tpg|DAA58436.1|  TPA: putative XH domain family protein                 312   1e-93    
ref|NP_187861.2|  XH/XS domain-containing protein                       317   1e-93    
ref|XP_009768237.1|  PREDICTED: uncharacterized protein LOC104219279    318   2e-93    
emb|CDY08424.1|  BnaA05g26600D                                          315   4e-93    
ref|XP_009597794.1|  PREDICTED: interaptin-like                         314   5e-92    
ref|XP_010523138.1|  PREDICTED: factor of DNA methylation 4             314   1e-91    
gb|EYU18979.1|  hypothetical protein MIMGU_mgv1a025152mg                313   2e-91    
emb|CDY33798.1|  BnaA09g46040D                                          309   3e-91    
gb|AAG51004.1|AC069474_3  unknown protein; 49125-46422                  310   3e-91    
ref|XP_006297188.1|  hypothetical protein CARUB_v10013193mg             309   6e-91    
ref|XP_006491885.1|  PREDICTED: calponin homology domain-containi...    305   9e-91    
ref|XP_009761116.1|  PREDICTED: cingulin-like                           306   5e-90    
ref|XP_010043544.1|  PREDICTED: myosin-4-like                           307   1e-89    
ref|XP_006597269.1|  PREDICTED: uncharacterized protein PFB0765w-...    304   2e-88    
ref|XP_006597270.1|  PREDICTED: uncharacterized protein PFB0765w-...    303   2e-88    
ref|XP_002440617.1|  hypothetical protein SORBIDRAFT_09g004150          303   3e-88    
gb|KCW85560.1|  hypothetical protein EUGRSUZ_B023591                    303   3e-88    
ref|XP_009610608.1|  PREDICTED: uncharacterized protein LOC104104...    311   5e-88    
ref|XP_009610603.1|  PREDICTED: uncharacterized protein LOC104104...    311   5e-88    
ref|XP_009791213.1|  PREDICTED: uncharacterized protein LOC104238...    311   6e-88    
ref|XP_009791218.1|  PREDICTED: uncharacterized protein LOC104238...    311   6e-88    
ref|XP_009791212.1|  PREDICTED: uncharacterized protein LOC104238...    311   7e-88    
ref|XP_009610606.1|  PREDICTED: uncharacterized protein LOC104104...    311   7e-88    
ref|XP_007150328.1|  hypothetical protein PHAVU_005G144400g             304   1e-87    
gb|EAY85442.1|  hypothetical protein OsI_06823                          297   2e-87    
ref|XP_009613957.1|  PREDICTED: cingulin-like                           294   2e-86    
ref|XP_002526601.1|  conserved hypothetical protein                     293   4e-85    
ref|XP_002457444.1|  hypothetical protein SORBIDRAFT_03g007450          281   6e-85    
ref|XP_007016399.1|  XH/XS domain-containing protein, putative is...    288   2e-84    
ref|XP_004487000.1|  PREDICTED: cingulin-like protein 1-like            293   3e-84    
gb|KEH39446.1|  XH/XS domain protein                                    288   1e-82    
ref|XP_006369526.1|  hypothetical protein POPTR_0001s24750g             285   1e-82    
gb|ACF22790.1|  gene X-like protein                                     290   2e-82    
ref|NP_172834.1|  SGS3-like protein FDM4                                285   4e-81    
gb|KHN33379.1|  hypothetical protein glysoja_005421                     278   9e-81    
ref|XP_009118027.1|  PREDICTED: uncharacterized protein LOC103843080    283   3e-80    
ref|XP_007016397.1|  XH/XS domain-containing protein, putative is...    278   3e-80    
ref|XP_010495608.1|  PREDICTED: factor of DNA methylation 4-like        282   4e-80    
ref|XP_002890022.1|  XH/XS domain-containing protein                    280   3e-79    
ref|XP_010476408.1|  PREDICTED: factor of DNA methylation 4-like ...    278   2e-78    
ref|XP_008362754.1|  PREDICTED: uncharacterized protein LOC103426447    262   2e-78    
ref|XP_010476407.1|  PREDICTED: factor of DNA methylation 4-like ...    278   2e-78    
emb|CDY26616.1|  BnaA09g46610D                                          277   3e-78    
ref|XP_006306867.1|  hypothetical protein CARUB_v10008414mg             276   7e-78    
gb|KHN30167.1|  hypothetical protein glysoja_010545                     270   8e-78    
emb|CDY16109.1|  BnaC08g40140D                                          274   3e-77    
ref|XP_010458844.1|  PREDICTED: LOW QUALITY PROTEIN: factor of DN...    273   9e-77    
gb|KEH39445.1|  XH/XS domain protein                                    271   3e-76    
emb|CDY05861.1|  BnaC08g20380D                                          270   6e-76    
emb|CDY16058.1|  BnaC08g40650D                                          270   1e-75    
ref|XP_010911457.1|  PREDICTED: factor of DNA methylation 5-like        253   3e-75    
ref|XP_010911713.1|  PREDICTED: factor of DNA methylation 1-like        253   4e-75    
ref|XP_010459126.1|  PREDICTED: factor of DNA methylation 1-like        263   6e-75    
ref|XP_004242072.2|  PREDICTED: factor of DNA methylation 4-like        256   1e-73    
gb|KDO41499.1|  hypothetical protein CISIN_1g047081mg                   255   6e-73    
ref|XP_007016398.1|  XH/XS domain-containing protein, putative is...    251   6e-71    
gb|KEH39385.1|  XH/XS domain protein, putative                          254   2e-70    
ref|XP_006417088.1|  hypothetical protein EUTSA_v10006952mg             254   5e-70    
gb|KEH29632.1|  XH/XS domain protein                                    253   2e-69    
ref|XP_003638053.1|  Gene X-like protein                                251   3e-69    
ref|XP_006282252.1|  hypothetical protein CARUB_v10028526mg             246   2e-68    
ref|XP_006598038.1|  PREDICTED: interaptin-like                         244   1e-67    
ref|XP_010322357.1|  PREDICTED: factor of DNA methylation 4-like        236   2e-66    
dbj|BAH30638.1|  hypothetical protein                                   234   5e-64    
gb|EMT22338.1|  hypothetical protein F775_15062                         231   2e-63    
ref|XP_010456975.1|  PREDICTED: factor of DNA methylation 3-like        224   5e-62    
ref|NP_200747.1|  XH/XS domain-containing protein                       228   7e-62    
ref|XP_010454940.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      227   2e-61    
ref|XP_010232950.1|  PREDICTED: factor of DNA methylation 1-like        226   2e-61    
ref|XP_010483561.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      225   7e-61    
ref|XP_004499526.1|  PREDICTED: uncharacterized protein LOC101512210    214   8e-61    
gb|AAD30546.1|  transcriptional regulator                               214   2e-59    
ref|XP_004294497.1|  PREDICTED: uncharacterized protein LOC101294442    222   3e-59    
ref|NP_192027.1|  XH/XS domain-containing protein                       219   1e-58    
ref|XP_010443691.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      216   1e-57    
ref|XP_010678966.1|  PREDICTED: factor of DNA methylation 5-like        216   2e-57    
ref|XP_009120446.1|  PREDICTED: structural maintenance of chromos...    215   2e-57    
gb|KHF99781.1|  Valine--tRNA ligase                                     211   1e-56    
gb|EEC69939.1|  hypothetical protein OsI_00386                          210   1e-56    
gb|AAB61019.1|  contains weak similarity to nebulin                     213   2e-56    
gb|AAM22637.1|AF434194_1  X1                                            204   3e-56    
ref|XP_006400966.1|  hypothetical protein EUTSA_v10013147mg             211   9e-56    
ref|XP_006391678.1|  hypothetical protein EUTSA_v10024003mg             201   2e-55    
emb|CDX80273.1|  BnaC09g34690D                                          207   2e-54    
gb|AAO60001.1|  putative XS domain containing protein                   202   2e-53    
dbj|BAD68892.1|  X1-like                                                193   4e-53    
emb|CDY33034.1|  BnaA10g12400D                                          201   1e-52    
ref|NP_192087.2|  XH/XS domain-containing protein                       200   1e-52    
ref|XP_010106489.1|  hypothetical protein L484_025247                   195   4e-52    
ref|XP_006341361.1|  PREDICTED: median body protein-like                186   2e-51    
ref|XP_010931277.1|  PREDICTED: factor of DNA methylation 5-like ...    190   3e-51    
gb|AAO38006.1|  putative transcription factor                           187   5e-51    
ref|XP_010931274.1|  PREDICTED: factor of DNA methylation 1-like ...    191   7e-51    
ref|XP_001777897.1|  predicted protein                                  199   7e-51    
ref|XP_010429907.1|  PREDICTED: factor of DNA methylation 5-like        186   2e-50    
ref|XP_010272851.1|  PREDICTED: factor of DNA methylation 4-like        184   8e-49    
ref|XP_010485238.1|  PREDICTED: factor of DNA methylation 4-like        190   2e-48    
ref|XP_010241796.1|  PREDICTED: factor of DNA methylation 1-like        189   2e-48    
ref|XP_007009224.1|  XH/XS domain-containing protein, putative          184   2e-48    
gb|KHM99086.1|  hypothetical protein glysoja_050156                     177   6e-48    
gb|AAC72860.1|  contains similarity to ribosomal protein L7Ae (Pf...    186   4e-47    
gb|KHG08146.1|  Nif-specific regulatory                                 181   5e-47    
ref|XP_010690753.1|  PREDICTED: factor of DNA methylation 5-like        182   6e-47    
ref|XP_010429908.1|  PREDICTED: factor of DNA methylation 5-like        176   8e-47    
ref|XP_009610609.1|  PREDICTED: uncharacterized protein LOC104104...    186   8e-46    
gb|KEH39444.1|  XH/XS domain protein                                    178   1e-45    
gb|KEH32517.1|  XH/XS domain protein                                    173   2e-45    
ref|XP_007207033.1|  hypothetical protein PRUPE_ppb023971mg             172   3e-45    
ref|XP_009791219.1|  PREDICTED: uncharacterized protein LOC104238...    184   5e-45    
gb|KHN12113.1|  hypothetical protein glysoja_048283                     171   5e-45    
gb|AAD22640.1|AC007138_4  hypothetical protein                          176   1e-44    
ref|XP_010472879.1|  PREDICTED: factor of DNA methylation 1-like        169   5e-44    
ref|XP_006602003.1|  PREDICTED: microtubule-associated tumor supp...    172   5e-44    
ref|XP_006841392.1|  hypothetical protein AMTR_s02578p00002400          171   1e-43    
ref|XP_010658561.1|  PREDICTED: factor of DNA methylation 5-like ...    172   1e-43    
ref|XP_010658559.1|  PREDICTED: factor of DNA methylation 5-like ...    171   2e-43    
ref|XP_004293066.1|  PREDICTED: uncharacterized protein LOC101303195    171   3e-43    
gb|EMT28948.1|  hypothetical protein F775_22883                         165   3e-43    
gb|EMS49993.1|  hypothetical protein TRIUR3_32685                       169   4e-43    
emb|CDY53226.1|  BnaA02g19420D                                          165   5e-43    
gb|EMT13639.1|  hypothetical protein F775_24890                         174   5e-43    
emb|CDP00108.1|  unnamed protein product                                172   6e-43    
ref|XP_002864631.1|  predicted protein                                  172   9e-43    
ref|XP_010417664.1|  PREDICTED: factor of DNA methylation 5-like        164   3e-42    
emb|CAN81646.1|  hypothetical protein VITISV_010798                     167   3e-42    
emb|CDY69135.1|  BnaAnng29410D                                          165   5e-42    
emb|CDP07770.1|  unnamed protein product                                165   5e-42    
emb|CDY63974.1|  BnaC02g46630D                                          162   9e-42    
ref|XP_006846220.1|  hypothetical protein AMTR_s00012p00229720          165   1e-41    
gb|KDO41498.1|  hypothetical protein CISIN_1g037047mg                   160   1e-41    
gb|EEC69937.1|  hypothetical protein OsI_00381                          166   2e-41    
ref|XP_010690702.1|  PREDICTED: factor of DNA methylation 2-like        160   3e-41    
gb|EYU24613.1|  hypothetical protein MIMGU_mgv1a013548mg                158   2e-40    
ref|XP_002457445.1|  hypothetical protein SORBIDRAFT_03g007460          160   2e-40    
gb|EMT01206.1|  hypothetical protein F775_16922                         161   2e-40    
emb|CDY68592.1|  BnaAnng27750D                                          158   2e-40    
gb|KEH34705.1|  XH/XS domain protein                                    158   6e-40    
gb|EMS51933.1|  hypothetical protein TRIUR3_15169                       163   8e-40    
ref|XP_010419381.1|  PREDICTED: factor of DNA methylation 5-like        156   9e-40    
ref|XP_004294519.1|  PREDICTED: uncharacterized protein LOC101300705    158   2e-39    
ref|XP_008660210.1|  PREDICTED: uncharacterized protein LOC103639...    160   4e-39    
ref|XP_006302778.1|  hypothetical protein CARUB_v10020898mg             154   7e-39    
ref|XP_002875517.1|  predicted protein                                  154   2e-38    
emb|CDP00109.1|  unnamed protein product                                150   7e-38    
gb|KCW85557.1|  hypothetical protein EUGRSUZ_B02356                     154   1e-37    
ref|XP_009128392.1|  PREDICTED: uncharacterized protein PF11_0207       152   1e-37    
ref|XP_010478264.1|  PREDICTED: factor of DNA methylation 2-like        155   2e-37    
ref|XP_006645498.1|  PREDICTED: uncharacterized protein LOC102715808    155   2e-37    
gb|KEH34706.1|  XH/XS domain protein                                    154   2e-37    
ref|XP_004969258.1|  PREDICTED: uncharacterized protein LOC101768...    147   3e-37    
ref|XP_010429909.1|  PREDICTED: factor of DNA methylation 5-like        150   5e-37    
gb|EMT02372.1|  hypothetical protein F775_12527                         152   5e-37    
ref|XP_010034355.1|  PREDICTED: uncharacterized protein LOC104423588    149   7e-37    
ref|XP_010690736.1|  PREDICTED: factor of DNA methylation 1-like ...    149   1e-36    
emb|CDY68705.1|  BnaAnng28060D                                          147   1e-36    
gb|EMS67897.1|  hypothetical protein TRIUR3_24560                       155   3e-36    
ref|XP_001783710.1|  predicted protein                                  155   3e-36    
ref|XP_010690731.1|  PREDICTED: factor of DNA methylation 1-like ...    149   3e-36    
ref|XP_011089483.1|  PREDICTED: protein INVOLVED IN DE NOVO 2-like      148   3e-36    
ref|XP_010690742.1|  PREDICTED: factor of DNA methylation 1-like ...    148   3e-36    
emb|CDY01551.1|  BnaC07g35410D                                          145   3e-36    
gb|KFK36321.1|  hypothetical protein AALP_AA4G107500                    152   6e-36    
gb|EMS62541.1|  hypothetical protein TRIUR3_25973                       145   7e-36    
emb|CDM81288.1|  unnamed protein product                                149   2e-35    
emb|CDY27826.1|  BnaC09g28530D                                          143   3e-35    
ref|XP_004969257.1|  PREDICTED: uncharacterized protein LOC101768...    142   7e-35    
gb|EMS58631.1|  hypothetical protein TRIUR3_15740                       145   1e-34    
ref|XP_004968194.1|  PREDICTED: uncharacterized protein LOC101774612    146   1e-34    
ref|NP_001042013.1|  Os01g0147400                                       146   2e-34    
gb|EMT25049.1|  hypothetical protein F775_00149                         147   3e-34    
ref|XP_006603103.1|  PREDICTED: intracellular protein transport p...    147   3e-34    
ref|NP_001050601.2|  Os03g0596400                                       138   5e-34    
emb|CDM81241.1|  unnamed protein product                                146   6e-34    
ref|NP_566849.2|  XH domain-containing protein                          143   9e-34    
ref|XP_010460676.1|  PREDICTED: factor of DNA methylation 1-like        142   3e-33    
ref|XP_008223671.1|  PREDICTED: protein bfr2-like                       140   4e-33    
ref|XP_010474507.1|  PREDICTED: factor of DNA methylation 5-like        136   4e-32    
emb|CDM81289.1|  unnamed protein product                                132   5e-32    
gb|EMS60036.1|  hypothetical protein TRIUR3_01024                       140   8e-32    
ref|XP_006486472.1|  PREDICTED: myosin heavy chain, cardiac muscl...    138   1e-31    
ref|XP_006486471.1|  PREDICTED: myosin heavy chain, cardiac muscl...    138   2e-31    
gb|EAY72523.1|  hypothetical protein OsI_00384                          134   2e-31    
ref|XP_009601726.1|  PREDICTED: uncharacterized protein LOC104096...    135   4e-31    
ref|XP_002874349.1|  hypothetical protein ARALYDRAFT_910798             129   4e-31    
ref|XP_006435549.1|  hypothetical protein CICLE_v10033798mg             135   6e-31    
gb|EYU18986.1|  hypothetical protein MIMGU_mgv1a011844mg                132   1e-30    
ref|XP_010316797.1|  PREDICTED: factor of DNA methylation 1-like        136   1e-30    
ref|XP_009137118.1|  PREDICTED: uncharacterized protein LOC103861167    130   1e-30    
ref|XP_004968196.1|  PREDICTED: uncharacterized protein LOC101775413    128   2e-30    
gb|KHN32844.1|  hypothetical protein glysoja_048275                     134   2e-30    
gb|KFK42457.1|  hypothetical protein AALP_AA2G259200                    132   4e-30    
ref|XP_009601722.1|  PREDICTED: uncharacterized protein LOC104096...    131   9e-30    
ref|XP_008660211.1|  PREDICTED: uncharacterized protein LOC103639...    131   2e-29    
ref|XP_007207781.1|  hypothetical protein PRUPE_ppa026045mg             124   5e-29    
ref|XP_004287122.1|  PREDICTED: uncharacterized protein LOC101311119    130   5e-29    
ref|XP_002531434.1|  conserved hypothetical protein                     127   6e-29    
gb|KFK23204.1|  hypothetical protein AALP_AAs44791U000100               122   8e-29    
ref|XP_002531437.1|  conserved hypothetical protein                     125   2e-28    
gb|EPS57463.1|  hypothetical protein M569_17354                         127   3e-28    



>ref|XP_009793116.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793117.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793118.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009793119.1| PREDICTED: protein MLP1-like isoform X1 [Nicotiana sylvestris]
Length=635

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/619 (66%), Positives = 513/619 (83%), Gaps = 6/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I E+KEKPYEELR+GK +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  16    IYEFKEKPYEELRTGKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYL+ DL ++A+P+P RAV PE        L+CWPWTG+VVN+SK+ ANG
Sbjct  76    KQKANHLALAKYLQTDLVNEADPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              ++++++YWL++FS Y   EVK F D+++R S+ +++  SDW G+K+A+ FE +FEA   
Sbjct  136   RSLDDKEYWLRKFSIYMPSEVKFFYDNQARVSEAIVRFNSDWTGFKSAMEFEKSFEASHC  195

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+EW A+RS P  ++YGW A+ DDY AEGA+G YLRE  +LKTI+DL+ EE  DK K++
Sbjct  196   SKQEWKADRSCPGPNIYGWVAREDDYIAEGAIGEYLREKGKLKTISDLINEETHDKKKVV  255

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             +NL NE+D+KNENL  L TRFN   LSLS+M+EEKD LHRAF+EESRKMQRLAREHVQ+V
Sbjct  256   ANLANEIDMKNENLDKLQTRFNLNTLSLSQMLEEKDMLHRAFFEESRKMQRLAREHVQKV  315

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LD+W+RELNKRE LTEREK KLD+EKK+NDERNS+L+MAS EQ
Sbjct  316   LLEQEMLSVELESKKKKLDAWSRELNKREALTEREKQKLDDEKKQNDERNSALQMASAEQ  375

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADENVLRL+EE KREKE AL+KILELE++IDA+QKLEMEI ELKGKL+VM+H+GG+DD
Sbjct  376   RKADENVLRLVEEQKREKEEALRKILELEREIDARQKLEMEIAELKGKLEVMKHLGGNDD  435

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +AVQ KIKEM E+L +K+E+M D++ +N  L+ KERQSNDELQ+AR+ LI GL +++ SG
Sbjct  436   AAVQNKIKEMNEELKQKMEEMDDMESLNQTLLAKERQSNDELQDARRTLIDGLKEIVTSG  495

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             RS IGI+RMGEID KAF N  KQR  + EA++KALELCSLWQE +K  +WHPF+ + + +
Sbjct  496   RSQIGIKRMGEIDAKAFQNALKQRLPSAEAEIKALELCSLWQENLKAQDWHPFKTVMVDE  555

Query  509   -RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                E++I+E+DE L KLKEEWG+EI  AV  A++E+ EYN SGRY+I ELWNFKEGRKAT
Sbjct  556   SHVERMIDENDESLQKLKEEWGDEIFNAVTTALKEIEEYNPSGRYIINELWNFKEGRKAT  615

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV S+IFKQLKTHKRKR
Sbjct  616   LKEVTSYIFKQLKTHKRKR  634



>ref|XP_004235934.1| PREDICTED: factor of DNA methylation 1 [Solanum lycopersicum]
 ref|XP_010318733.1| PREDICTED: factor of DNA methylation 1 [Solanum lycopersicum]
Length=634

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/619 (66%), Positives = 515/619 (83%), Gaps = 6/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I E+KEKPYEELR+GK KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16    IFEFKEKPYEELRTGKLKVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYLE DL ++AEP+P+RAV PE      + L+ WPWTGI VNVSK+ ANG
Sbjct  76    KQKANHLALAKYLETDLVNEAEPIPKRAVTPEHSEAEKDKLFFWPWTGIFVNVSKETANG  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              + ++++YWLK+FS Y   EVK+FCD+++R S+ +++  S+W G+K A+ FE +FEA   
Sbjct  136   RSPDDKEYWLKKFSMYMPLEVKLFCDNQARVSEAIVRFNSNWTGFKGAMEFEKSFEASHC  195

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+EW + R  P  ++YGW A+ DDY+AEGA+G YLRET +LKTI+DL++EE + + K++
Sbjct  196   SKQEWKSLRKCPGPNLYGWVAREDDYKAEGALGEYLRETGELKTISDLMKEETQGRKKVV  255

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             +NL NE+D+KNENL  L T+FN   LSL +M+ EKD LHR+F+EESRKMQRLAREHVQ+V
Sbjct  256   ANLANEIDMKNENLDELQTKFNLNTLSLRQMLAEKDMLHRSFFEESRKMQRLAREHVQKV  315

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LDSW RELNKRE LTEREK KLDEEKK+ND RNS+L+MAS EQ
Sbjct  316   LMEQEMLSIELESKKKKLDSWVRELNKREALTEREKQKLDEEKKQNDVRNSALQMASVEQ  375

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADENVLRL+EE KREKE AL+KILELE+DIDAKQKLEMEI ELKGKL+VM+H+GG+DD
Sbjct  376   RKADENVLRLVEEQKREKEEALKKILELERDIDAKQKLEMEIAELKGKLEVMKHLGGNDD  435

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +AVQ KIKEM E+L +K+E+M  ++ +N  L++KERQSNDELQ+AR+ L +GL ++L+S 
Sbjct  436   AAVQNKIKEMNEELKDKMEEMDGMESLNQTLLMKERQSNDELQDARRTLKEGLIEVLSSA  495

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R+HIGI+RMGEID KAF N  KQ+F  +EA++KA+EL SLWQEK+KDP+WHPF+ I I +
Sbjct  496   RAHIGIKRMGEIDSKAFQNALKQKFPNQEAEIKAVELLSLWQEKIKDPDWHPFKTIMIDE  555

Query  509   -RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                E++I+E+DEEL KLK+E+G+EI  AV  A++E+ EYN SGRY IPELWNFKEGRKAT
Sbjct  556   SNVERVIDENDEELGKLKQEFGDEIYDAVTVALKEIEEYNPSGRYAIPELWNFKEGRKAT  615

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+S+IFKQ+K  KRKR
Sbjct  616   LKEVISYIFKQVKAQKRKR  634



>ref|XP_009763380.1| PREDICTED: myosin type-2 heavy chain 1-like [Nicotiana sylvestris]
 ref|XP_009763381.1| PREDICTED: myosin type-2 heavy chain 1-like [Nicotiana sylvestris]
Length=632

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/619 (65%), Positives = 509/619 (82%), Gaps = 7/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+Y EKPY+ELR+GKYKVKGPNG LRCPFCAG+KKQDYKYK+LLQHA+G GKG A    
Sbjct  15    INDYIEKPYQELRTGKYKVKGPNGSLRCPFCAGRKKQDYKYKELLQHASGAGKG-ARLGA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALA YLE DL ++AEP+P RAV PE        ++CWPWT +VVN+SK+ A+G
Sbjct  74    KQKANHLALAMYLESDLANEAEPVPPRAVTPERTEAEQTEVFCWPWTAVVVNMSKETADG  133

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              +V+ ++YWLK+FS Y+  E+ +F D++   S+ ++    +W G+ NA+ FE +FEA   
Sbjct  134   ESVDNKEYWLKKFSLYKPLEIMLFHDNQVLVSEAIVTFDRNWTGFNNAMEFEKSFEARRC  193

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SKKEW A +S PSS++YGW A+ DD+ AEGA+G YLR   +LKTI+DL++EE +D++K++
Sbjct  194   SKKEWCAHKSCPSSNIYGWVAREDDFRAEGAIGEYLRGKGELKTISDLIKEETQDRNKVV  253

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             + L NE+D++NENL  L  +FN K LSL +M+EEKD LHR+F+EE+RKMQRLAREHVQ+V
Sbjct  254   ATLANEIDMENENLDELQIQFNLKTLSLRQMLEEKDILHRSFFEETRKMQRLAREHVQKV  313

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             LHEQE L+ ELE+KKKQLD W+RELNKRE LTEREK KLDEEK++ND RNS+L+MAS EQ
Sbjct  314   LHEQEMLSVELERKKKQLDIWSRELNKRETLTEREKQKLDEEKQKNDVRNSALQMASAEQ  373

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADENVLRL+EEHKREKE AL+KILELE++ D KQKLEMEI ELKGKL+VM+H+GGDDD
Sbjct  374   RKADENVLRLVEEHKREKEEALRKILELERENDTKQKLEMEIAELKGKLEVMKHLGGDDD  433

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +AVQ KIKEM E+L  K+E+M DL+ +N  L+ KER+SNDELQ+AR+ LI GL++LL SG
Sbjct  434   AAVQNKIKEMNEELVGKMEEMDDLESLNQTLLAKERRSNDELQDARRTLITGLNELLTSG  493

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             RSHIGIRRMGEID KAF N CKQRF  EEA++KALELCSLWQEK+KD +WHPF+   + +
Sbjct  494   RSHIGIRRMGEIDSKAFQNACKQRFPNEEAEIKALELCSLWQEKIKDSDWHPFKTFMVDE  553

Query  509   -RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + E++I+E+DE L KLKEEWG+EI  AV +A++E+ EYN SGRYVIPELWNFKE RKAT
Sbjct  554   SKAEKVIDENDEALKKLKEEWGDEIYNAVTEALKEIEEYNPSGRYVIPELWNFKEQRKAT  613

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKE +SFIFKQLKTHKRKR
Sbjct  614   LKEAISFIFKQLKTHKRKR  632



>ref|XP_009605544.1| PREDICTED: myb-like protein X isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009605546.1| PREDICTED: myb-like protein X isoform X2 [Nicotiana tomentosiformis]
Length=635

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/619 (66%), Positives = 505/619 (82%), Gaps = 6/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I E+KEKPYEELR+ K +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  16    IYEFKEKPYEELRTEKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYL+ DL ++ EP+P RAV PE        L+CWPWTG+VVN+SK+ ANG
Sbjct  76    KQKANHLALAKYLQTDLVNEVEPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              ++++++YWL++FS Y   E K F D+++R S+ +++  SDW G+K A+ FE +FE    
Sbjct  136   RSLDDKEYWLRKFSIYIPSEAKFFYDNQARVSEAIVRFNSDWTGFKGAMEFEMSFETSHC  195

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+EW A+RS P  ++YGW A+ DDY AEGAVG YLRE  +LK I+DL+ EE  DK K++
Sbjct  196   SKREWKADRSCPGPNIYGWVAREDDYIAEGAVGEYLREKGKLKKISDLINEEIHDKKKVV  255

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             +NL NE+D+KNENL  L TRFN   LSLS+M+EEKD LH AF+EESRKMQRLAREHVQ+V
Sbjct  256   ANLANEIDMKNENLDELQTRFNLNTLSLSQMLEEKDMLHHAFFEESRKMQRLAREHVQKV  315

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LD+W+RELNKRE LTEREK KLD+EKK+NDERNS+L+MAS EQ
Sbjct  316   LLEQEMLSVELESKKKKLDAWSRELNKREALTEREKQKLDDEKKQNDERNSALQMASVEQ  375

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADENVLRL+EE KREKE AL+KILELE++IDA+QKLEMEI E KGKL+VM+H+G +DD
Sbjct  376   RKADENVLRLVEEQKREKEKALRKILELEREIDARQKLEMEIAEFKGKLEVMKHLGSNDD  435

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +AVQ KIKEM E+L +K+E+M D++ +N  L+ KERQSNDELQ+AR  LI GL ++L SG
Sbjct  436   AAVQNKIKEMNEELKQKMEEMDDMESLNQTLLAKERQSNDELQDARHALIDGLKEMLTSG  495

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             RS IGI+RMGEID KAF N  KQR  + EAD+KALELCSLWQEK+K  +WHPF+ + + +
Sbjct  496   RSQIGIKRMGEIDAKAFQNALKQRLPSAEADIKALELCSLWQEKLKAQDWHPFKTVMVDE  555

Query  509   -RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              R E++I+E+DE L KLKEEWG+EI  AV  A++E+ EYN SGRY+I ELWNFKEGRKAT
Sbjct  556   SRVERVIDENDEALQKLKEEWGDEIYNAVTTALKEIEEYNPSGRYIINELWNFKEGRKAT  615

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV S+IFKQLKTHKRKR
Sbjct  616   LKEVTSYIFKQLKTHKRKR  634



>ref|XP_009605543.1| PREDICTED: myb-like protein X isoform X1 [Nicotiana tomentosiformis]
Length=647

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/619 (66%), Positives = 505/619 (82%), Gaps = 6/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I E+KEKPYEELR+ K +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  28    IYEFKEKPYEELRTEKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  87

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYL+ DL ++ EP+P RAV PE        L+CWPWTG+VVN+SK+ ANG
Sbjct  88    KQKANHLALAKYLQTDLVNEVEPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  147

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              ++++++YWL++FS Y   E K F D+++R S+ +++  SDW G+K A+ FE +FE    
Sbjct  148   RSLDDKEYWLRKFSIYIPSEAKFFYDNQARVSEAIVRFNSDWTGFKGAMEFEMSFETSHC  207

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+EW A+RS P  ++YGW A+ DDY AEGAVG YLRE  +LK I+DL+ EE  DK K++
Sbjct  208   SKREWKADRSCPGPNIYGWVAREDDYIAEGAVGEYLREKGKLKKISDLINEEIHDKKKVV  267

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             +NL NE+D+KNENL  L TRFN   LSLS+M+EEKD LH AF+EESRKMQRLAREHVQ+V
Sbjct  268   ANLANEIDMKNENLDELQTRFNLNTLSLSQMLEEKDMLHHAFFEESRKMQRLAREHVQKV  327

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LD+W+RELNKRE LTEREK KLD+EKK+NDERNS+L+MAS EQ
Sbjct  328   LLEQEMLSVELESKKKKLDAWSRELNKREALTEREKQKLDDEKKQNDERNSALQMASVEQ  387

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADENVLRL+EE KREKE AL+KILELE++IDA+QKLEMEI E KGKL+VM+H+G +DD
Sbjct  388   RKADENVLRLVEEQKREKEKALRKILELEREIDARQKLEMEIAEFKGKLEVMKHLGSNDD  447

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +AVQ KIKEM E+L +K+E+M D++ +N  L+ KERQSNDELQ+AR  LI GL ++L SG
Sbjct  448   AAVQNKIKEMNEELKQKMEEMDDMESLNQTLLAKERQSNDELQDARHALIDGLKEMLTSG  507

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             RS IGI+RMGEID KAF N  KQR  + EAD+KALELCSLWQEK+K  +WHPF+ + + +
Sbjct  508   RSQIGIKRMGEIDAKAFQNALKQRLPSAEADIKALELCSLWQEKLKAQDWHPFKTVMVDE  567

Query  509   -RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              R E++I+E+DE L KLKEEWG+EI  AV  A++E+ EYN SGRY+I ELWNFKEGRKAT
Sbjct  568   SRVERVIDENDEALQKLKEEWGDEIYNAVTTALKEIEEYNPSGRYIINELWNFKEGRKAT  627

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV S+IFKQLKTHKRKR
Sbjct  628   LKEVTSYIFKQLKTHKRKR  646



>ref|XP_009626788.1| PREDICTED: coiled-coil domain-containing protein 150-like [Nicotiana 
tomentosiformis]
Length=632

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/619 (65%), Positives = 510/619 (82%), Gaps = 7/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+Y EKPY+ELR+GKYKVKGPNG LRCPFCAG+KKQDYKY +LLQHA+G GKG A    
Sbjct  15    INDYIEKPYQELRTGKYKVKGPNGSLRCPFCAGRKKQDYKYNELLQHASGAGKG-ARLGA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYLE DL ++AEP+P RAV PE        ++CWPWT +VVN+SK+ A+G
Sbjct  74    KQKANHLALAKYLESDLANEAEPVPPRAVTPERTEAEQTEVFCWPWTAVVVNISKETADG  133

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              +V++++YWLK+FS Y+  E+ +F D+++  S+ ++    +W G+ NA+ FE +FEA   
Sbjct  134   ESVDDKEYWLKKFSLYKPLEIVLFHDNQALVSEAIVTFDRNWTGFNNAMEFEKSFEARRC  193

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SKKEW A +S PSS++YGW  + DD+ AEGA+G YLR   +LKTI+DL++EE +D++K++
Sbjct  194   SKKEWCAHKSCPSSNIYGWVTREDDFRAEGAIGEYLRGKGELKTISDLIKEETQDRNKVV  253

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             + L NE+D++NENL  L  +FN K LSL +M+EEKD LHR+F+EE+RKMQRLAREHVQ+V
Sbjct  254   ATLANEIDMENENLDELQIQFNLKTLSLRQMLEEKDILHRSFFEETRKMQRLAREHVQKV  313

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             LHEQE L+ ELE+KKKQLD W+RELNKRE LTEREK KLDEEK++ND RNS+L+MAS EQ
Sbjct  314   LHEQEMLSVELERKKKQLDIWSRELNKRETLTEREKQKLDEEKQKNDVRNSALQMASAEQ  373

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADENVLRL+EEHKREKE AL+KILELE++ D KQKLEMEI ELKGKL+VM+H+GGDDD
Sbjct  374   RKADENVLRLVEEHKREKEEALRKILELERENDTKQKLEMEIAELKGKLEVMKHLGGDDD  433

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +AVQ KIKEM E+L  K+E+M+DL+ +N  L+ KER+SNDELQ+AR+ LI GL++LL SG
Sbjct  434   AAVQNKIKEMNEELVGKMEEMEDLESLNQTLLAKERRSNDELQDARRTLITGLNELLTSG  493

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             RSHIGIRRMGEI+ KAF N CKQRF  EEA++KALELCSLWQEK+KD +WHPF+   + +
Sbjct  494   RSHIGIRRMGEIESKAFQNACKQRFPNEEAEIKALELCSLWQEKIKDSDWHPFKTFMVDE  553

Query  509   -RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + E++I+EDDE L KLKEEWG+EI  AV +A++E+ EYN SGRYVIPE+WN KE RKAT
Sbjct  554   SKAEKVIDEDDEALKKLKEEWGDEIYNAVTEALKEIEEYNPSGRYVIPEMWNSKEQRKAT  613

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKE +SFIFKQLKTHKRKR
Sbjct  614   LKEAISFIFKQLKTHKRKR  632



>ref|XP_006341360.1| PREDICTED: myosin-9-like [Solanum tuberosum]
Length=635

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/619 (66%), Positives = 508/619 (82%), Gaps = 6/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I E+KEKPYEELR GK KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16    IFEFKEKPYEELRKGKLKVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYLE DL ++AEP+P+RAV PE      + L+ WPWTGI VNVSK+ ANG
Sbjct  76    KQKANHLALAKYLETDLVNEAEPIPKRAVTPERSESEKDELFFWPWTGIFVNVSKETANG  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              + ++++YWLK+FS Y   EVK+FCD+++  S+ V++  SDW G+K A+ FE +FEA   
Sbjct  136   RSPDDKEYWLKKFSLYMPLEVKLFCDNQATVSEAVVRFNSDWTGFKGAMEFEKSFEASHC  195

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+EW + R  P  ++YGW A+ DDY  EGA+G YLRE  +LKTI+DL++EE + + +++
Sbjct  196   SKQEWKSHRDCPGPNLYGWVAREDDYITEGALGEYLREKGELKTISDLIKEETQGRKEVV  255

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             +NL NE+D+KNENL  L T+FN   LSL +M+ EKD LHR+F+EESRKMQRLAREHVQ+V
Sbjct  256   ANLANEIDMKNENLDELQTKFNLNTLSLRQMLAEKDMLHRSFFEESRKMQRLAREHVQKV  315

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LDSW RELNKRE LTEREK KLDEEKK+ND RNS+L+MAS EQ
Sbjct  316   LLEQEMLSLELESKKKKLDSWGRELNKREALTEREKQKLDEEKKQNDVRNSALQMASVEQ  375

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KAD +VLRL+EE KREKE AL+KILELE+DIDAKQKLEMEI ELKGKL+VM+H+GG+DD
Sbjct  376   RKADVSVLRLVEEQKREKEEALKKILELERDIDAKQKLEMEIAELKGKLEVMKHLGGNDD  435

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +AVQ KIKEM E+L +K+E+M  ++ +N  L+LKERQSNDELQ+AR+ L +GL ++L+S 
Sbjct  436   AAVQNKIKEMNEELKDKMEEMDGMESLNQTLLLKERQSNDELQDARRTLKEGLLEVLSSA  495

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R+HIGI+RMGEID KAF    KQ+F  +EA++KA+EL SLWQEK+KDP+WHPF+ I I +
Sbjct  496   RAHIGIKRMGEIDSKAFQTALKQKFPNQEAEIKAVELLSLWQEKIKDPDWHPFKTIMIDE  555

Query  509   -RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                E++I+E+DEEL KLK+E G+EI  AV  A++E+ EYN SGRY IPELWNFKEGRKAT
Sbjct  556   SNVERVIDENDEELGKLKQELGDEIYDAVTVALKEIEEYNPSGRYAIPELWNFKEGRKAT  615

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+S+IFKQLKT KRKR
Sbjct  616   LKEVISYIFKQLKTQKRKR  634



>gb|EYU21722.1| hypothetical protein MIMGU_mgv1a002818mg [Erythranthe guttata]
Length=634

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/619 (64%), Positives = 494/619 (80%), Gaps = 7/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             INEYKEKPYE L++G +KV+GPNG  RCPFCAGKKKQDY++  L QHA GV KGSA+R  
Sbjct  16    INEYKEKPYELLKAGTHKVRGPNGSFRCPFCAGKKKQDYQFNHLYQHAIGVAKGSASRGA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-----AVAPEDNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALA +LE DL ++A P PQ      A  PE + LYCWPW GIVVN+ K+  NG
Sbjct  76    KQKANHLALATFLENDLANEAPPQPQPTVPVPAAKPEQSELYCWPWVGIVVNILKEAKNG  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
               V+  DYW K+FSKY+  E+KIF DD   T+QVV++  +DW G+KNA+ FE +FEA  H
Sbjct  136   DCVDSSDYWSKKFSKYKPVEIKIFWDDDRSTAQVVLRFDNDWTGFKNAMEFEKSFEAGGH  195

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SKKEW   R+SP S++YGWFA+ DDY+ EG VG YLR+  +LKTI+DL+QE  +D++KI+
Sbjct  196   SKKEWDGRRNSPGSNIYGWFAREDDYKTEGPVGDYLRKNGELKTISDLVQEATKDRNKIV  255

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
               L NE+DLKNENL  L  ++NEK LSLSRM+EEKD LHR+FYEE+RK+QR++REH++RV
Sbjct  256   GTLVNEIDLKNENLDELQIKYNEKTLSLSRMLEEKDELHRSFYEETRKLQRVSREHIKRV  315

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE LN ELE KKK+LDSW++ELNKRE LTERE+ KL+EEK +ND RN+SL++AS+EQ
Sbjct  316   LDEQEMLNVELENKKKRLDSWSKELNKREALTERERQKLEEEKTKNDMRNNSLQLASEEQ  375

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KAD+NVLRL+EE KREKE AL+K+LELE+++D KQKLEMEI+ELKGKL+VM+HMGG DD
Sbjct  376   RKADKNVLRLVEEQKREKEEALKKVLELERNLDEKQKLEMEIEELKGKLEVMKHMGG-DD  434

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +AVQ+KI  M EQL EK +D+  L+++N  L+LKERQSNDELQEARK LI+GL ++L S 
Sbjct  435   AAVQQKIDSMNEQLQEKKDDLDGLEDLNKQLLLKERQSNDELQEARKELIEGLQEMLISS  494

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-NIH  513
             R +IGI+RMGEID KAF N CK RF  EEAD+K +ELCSLWQEK+K P+WHPFRV+ +  
Sbjct  495   RVNIGIKRMGEIDEKAFKNACKLRFPPEEADIKTVELCSLWQEKMKHPDWHPFRVVEDSK  554

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                +  I EDDE LS LK EWG+++  AV  A++E++EYN SG Y +PELWNFKE RKAT
Sbjct  555   GNCQNYIKEDDELLSGLKNEWGDDVYDAVTTALKEMHEYNPSGCYSVPELWNFKENRKAT  614

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+S+IF QLKT KRKR
Sbjct  615   LKEVISYIFAQLKTLKRKR  633



>emb|CDO98219.1| unnamed protein product [Coffea canephora]
Length=677

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/620 (63%), Positives = 506/620 (82%), Gaps = 10/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I +YKEKP EEL+SGK+KVKGPNG LRCPFCAGKKKQDYKYKDLLQHATGV KGSANRS 
Sbjct  61    IKDYKEKPLEELKSGKFKVKGPNGTLRCPFCAGKKKQDYKYKDLLQHATGVSKGSANRSA  120

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP------EDNNLYCWPWTGIVVNVSKDNAN  1773
              QKA H+ALA+YLE DL ++AEP P R   P      E N LYCWPWTG+VVN+  +  +
Sbjct  121   IQKAKHLALAEYLETDLVNEAEPQPLRVTPPAVADTSEQNELYCWPWTGVVVNILNETKS  180

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             G AV+   +WL +FSKY+  EVK+F DD+ + +Q V+K  +DW G++NA+ FE +FE + 
Sbjct  181   GKAVDSSAFWLNKFSKYKPLEVKVFWDDECQIAQAVVKFDNDWIGFRNAMEFEKSFEGDH  240

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             HSKKEW  ++++ +S ++GW A+ DDY +EG +G YLR+T +LKT+ DL++E   D++K+
Sbjct  241   HSKKEWIDQKTNSASGIFGWSARADDYYSEGPIGKYLRDTGELKTVADLVKEAVNDRNKV  300

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NLTNE+DLKNENL+ L T++NEK LSLSRM+EEKD LHRAF EE RKMQRLA +HV++
Sbjct  301   VANLTNEIDLKNENLNKLRTKYNEKTLSLSRMLEEKDMLHRAFCEERRKMQRLAHDHVKK  360

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE LNSEL+ KKK+LD W++ELNKRE LTERE+ KLDEEK++ND RN++L+MAS E
Sbjct  361   ILDEQEKLNSELDSKKKKLDYWSKELNKREALTERERQKLDEEKQKNDMRNNALQMASVE  420

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KADENVLRL+EE KREKE AL+KIL+LE+D++AKQKLEMEI+EL+GKL+VM+H+G  D
Sbjct  421   QRKADENVLRLVEEQKREKEEALKKILDLERDLNAKQKLEMEIEELRGKLEVMKHLG--D  478

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D+AVQ+KIKEM E+L+EK+E+MK ++++   LV KERQSNDELQEARK LI GLS++L  
Sbjct  479   DAAVQKKIKEMTEELNEKVEEMKSVEDLYQTLVTKERQSNDELQEARKELISGLSEMLTR  538

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             GR+HIG++RMGEID K F   CKQR+  ++ D KALELCSLWQE++KDP+W+PF+++ + 
Sbjct  539   GRAHIGVKRMGEIDPKTFEGECKQRYP-DDYDYKALELCSLWQERLKDPDWYPFQIVRVD  597

Query  512   DRPEQ-IINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
                 Q I++EDDE+L +L+ EWGE I  A+  A+++++EYN+SGRYV+ ELWNFK+ RKA
Sbjct  598   SENHQKILDEDDEKLRELRSEWGENIYLAITMALKDIDEYNSSGRYVVSELWNFKDDRKA  657

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+ FIFKQLKT KRKR
Sbjct  658   TLKEVIGFIFKQLKTLKRKR  677



>ref|XP_011073344.1| PREDICTED: factor of DNA methylation 1 [Sesamum indicum]
Length=635

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/619 (62%), Positives = 490/619 (79%), Gaps = 6/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             INEYKEKPYE L++G YKVKGPNG LRCPFCAGKKKQDY+Y  LLQHA GV KGSA+RS 
Sbjct  16    INEYKEKPYELLKAGTYKVKGPNGSLRCPFCAGKKKQDYQYNHLLQHAIGVAKGSASRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-----AVAPEDNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALA +LE DL ++AEPLPQ      A  PE + LYCWPW GIV N+  +  N 
Sbjct  76    KQKANHLALATFLENDLANEAEPLPQHTAPLPAAKPEKSELYCWPWVGIVANILNEPKNS  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
               +    YWL +FSKY+  E++IF DD+  T+Q V++  +DW G+KNA+ FE +FEA   
Sbjct  136   DCLASRGYWLNKFSKYKPIEIEIFWDDQQHTAQAVLRFDNDWTGFKNAMEFEKSFEANGR  195

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SKKEW   R+ P  ++YGWFA+ DDY+ EG VG YLR   +LKTI+DL+QE  +D++K++
Sbjct  196   SKKEWNDRRTCPGPNIYGWFAREDDYKLEGPVGDYLRRKAELKTISDLIQEATKDRNKVV  255

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
              NL NEL+LKNENL  L  ++NEK LSLSRM+EEKD LHR+FYEE+RK+QR+AREH++RV
Sbjct  256   GNLVNELELKNENLDQLQIKYNEKTLSLSRMLEEKDELHRSFYEETRKLQRIAREHIKRV  315

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE LN ELE KK++LDSWN+ELNKRE LTERE+ KL+EEK +ND RN++L++AS+EQ
Sbjct  316   LDEQEMLNYELENKKRRLDSWNKELNKREALTERERQKLEEEKAKNDLRNNALQLASEEQ  375

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADENVLRL+EE +REKE AL+K+LELE+++D KQKLE+EI+ELKGKL+VM+HMGGDDD
Sbjct  376   RKADENVLRLVEEQQREKEEALKKVLELERNLDEKQKLELEIEELKGKLEVMKHMGGDDD  435

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
               +Q+KI +M +QL EK +D++ L+++N  L+ KERQSNDELQEARK LI+ L D+L+S 
Sbjct  436   GVIQQKIDKMNQQLAEKKDDLEGLEDLNQQLLAKERQSNDELQEARKELIEALKDMLSSS  495

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R +IGI+RMGEID KAF N CK+RF   EA++KA E+ SLWQEK+K+P WHPF++I    
Sbjct  496   RVNIGIKRMGEIDEKAFKNACKERFPPGEAEMKAAEVVSLWQEKLKNPEWHPFQIIEDEK  555

Query  509   RPEQ-IINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                Q +I EDDE L  LKEEWG+ +  AV  A++E++EYN SG YV+PELWNFKE RKAT
Sbjct  556   GNHQSLIKEDDELLQGLKEEWGDAVYDAVTVALKELHEYNPSGCYVVPELWNFKENRKAT  615

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+++IF QLKT KRKR
Sbjct  616   LKEVIAYIFAQLKTLKRKR  634



>ref|XP_002267381.1| PREDICTED: factor of DNA methylation 1 [Vitis vinifera]
 ref|XP_010656777.1| PREDICTED: factor of DNA methylation 1 [Vitis vinifera]
Length=626

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/620 (61%), Positives = 495/620 (80%), Gaps = 16/620 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16    IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76    KQKANHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQK  134

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             N        YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  135   NA-------YWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  187

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              HSKKEW  ++  P S++YGW A+ DDY +EG VG YLR+T +LKTI+D+++  K+D++ 
Sbjct  188   RHSKKEWNVQKQHPGSNIYGWVARADDYISEGPVGEYLRKTGELKTISDIVEAAKQDRNT  247

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             I++NL NE+DLKNENL  L  ++NEK++SLSRM+EEKD LH AFYEE+RKMQRLAR+HVQ
Sbjct  248   IVANLANEIDLKNENLDELQYKYNEKSMSLSRMLEEKDKLHHAFYEETRKMQRLARDHVQ  307

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE LN EL+ K+K+LD+W++ELNKRE LTEREK KLD+EKK+N++RN+SL+MAS 
Sbjct  308   RILGEQEKLNYELDSKRKELDNWSKELNKREALTEREKQKLDDEKKKNNDRNNSLQMASI  367

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KADENVL+L+EE KREKE AL KIL+LEK +DAKQKLEMEI+E+KGKL VM+H+G +
Sbjct  368   EQRKADENVLKLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIEEIKGKLQVMKHLGDE  427

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ K+KEM E+L+EK+ +M++L+ +N  L++KERQSNDELQ AR  LI GL D+L 
Sbjct  428   DDTAVQNKMKEMNEELEEKVGEMENLESLNQTLIVKERQSNDELQAARTELITGLKDML-  486

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             SGR++IG++RMGE+D K F N CKQRFS EEA+V+A  L SLWQ+ +K P WHPF+++ +
Sbjct  487   SGRTNIGLKRMGELDEKPFLNTCKQRFSLEEANVQAYTLVSLWQDNLKKPEWHPFKIVEV  546

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
                  +IINE+DE+L KLK+EWG+EI  AV K+++E+NEYN SGRY + ELWNFKEGRKA
Sbjct  547   EGETLEIINEEDEKLQKLKQEWGDEIYMAVTKSLKEINEYNPSGRYTVFELWNFKEGRKA  606

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+ +I K +KT KRKR
Sbjct  607   TLKEVIQYILKNMKTLKRKR  626



>ref|XP_002267670.1| PREDICTED: factor of DNA methylation 1 isoform X2 [Vitis vinifera]
Length=633

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/620 (62%), Positives = 492/620 (79%), Gaps = 9/620 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16    IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76    KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  134

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             NG  + +  YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  135   NGNDLGDSAYWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  194

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              HSKKEW  ++  P S++YGW A+ DDY +EG VG YLR T +LKTI+D+++  K+D++ 
Sbjct  195   RHSKKEWNVQKQHPGSNIYGWVARADDYSSEGPVGEYLRNTGELKTISDIVEAAKQDRNT  254

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             I++NL NE+DLKNENL  L  ++NEK++SLSRM+EEKD LH AFYEE+RKMQRLAR+HV+
Sbjct  255   IVANLANEIDLKNENLDELQYKYNEKSMSLSRMLEEKDKLHHAFYEETRKMQRLARDHVR  314

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE LN EL+ K+K+LDSW +ELNKRE LTEREK KLD+EKK+N+ERN+SL+MAS 
Sbjct  315   RILEEQEKLNYELDSKRKELDSWCKELNKREALTEREKQKLDDEKKKNNERNNSLQMASI  374

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVL+L+EE KREKE AL KIL+LEK +DAKQKLEMEI+E+KGKL VM+H+G +
Sbjct  375   EQKKADENVLKLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIEEIKGKLQVMKHLGDE  434

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ K+KEM E L+EK+ +M++L+ +N  L++KERQSNDELQ AR  LI GL D+L 
Sbjct  435   DDTAVQNKMKEMNEDLEEKVGEMENLESLNQTLIVKERQSNDELQAARTELITGLKDML-  493

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             SGR++IG++RMGEI+ K F    KQRFS EEA+V+A  L SLWQE +K P WHPF+++ +
Sbjct  494   SGRTNIGLKRMGEIEEKPFVKTYKQRFSLEEANVQAYTLVSLWQENLKKPEWHPFKIVEV  553

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               +  +IINE+DE+L KLK+EWG+EI  AV  +++E+NEYN SGRY + ELWNFKEGRKA
Sbjct  554   EGKTLEIINEEDEKLQKLKQEWGDEIYMAVTTSLKEINEYNPSGRYPVIELWNFKEGRKA  613

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+ +I K LKT KRKR
Sbjct  614   TLKEVIQYILKNLKTLKRKR  633



>emb|CAN83544.1| hypothetical protein VITISV_021077 [Vitis vinifera]
Length=633

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/620 (61%), Positives = 491/620 (79%), Gaps = 9/620 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY YKDLLQHA+GV KGSANRS 
Sbjct  16    IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYXYKDLLQHASGVAKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76    KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  134

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             NG  + +  YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  135   NGNDLGDSAYWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  194

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              HS+KEW  ++  P S++YGW A+ DDY +EG VG YLR T +LKTI+D+++  K+D++ 
Sbjct  195   RHSRKEWNVQKQHPGSNIYGWVARADDYSSEGPVGEYLRNTGELKTISDIVERAKQDRNT  254

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             I++NL NE+DLKNENL  L  ++NEK++SLSRM+EEKD LH AFYEE+RKMQ LAR+HV+
Sbjct  255   IVANLANEIDLKNENLDELQYKYNEKSMSLSRMLEEKDKLHHAFYEETRKMQXLARDHVR  314

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE LN EL+ K+K+LDSW +ELNKRE LTEREK KLD+EKK+N+ERN+SL+MAS 
Sbjct  315   RILEEQEKLNYELDSKRKELDSWCKELNKREALTEREKQKLDDEKKKNNERNNSLQMASI  374

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVL+L+EE KREKE AL KIL+LEK +DAKQKLEMEI+E+KGKL VM+H+G +
Sbjct  375   EQKKADENVLKLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIEEIKGKLQVMKHLGDE  434

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ K+KEM E L+EK+ +M++L+ +N  L++KERQSNDELQ AR  LI GL D+L 
Sbjct  435   DDTAVQNKMKEMNEDLEEKVGEMENLESLNQTLIVKERQSNDELQAARTELITGLKDML-  493

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             SGR++IG++RMGEI+ K F N  KQRFS EEA+V+A  L SLWQE +K P WHPF+++ +
Sbjct  494   SGRTNIGLKRMGEIEEKPFVNTYKQRFSPEEANVQAYTLVSLWQENLKKPEWHPFKIVEV  553

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               +  +IINE+DE+L KLK+EWG+EI  AV  +++E+NEYN SGRY + ELWNFKEGRKA
Sbjct  554   EGKTLEIINEEDEKLQKLKQEWGDEIYMAVTTSLKEINEYNPSGRYPVIELWNFKEGRKA  613

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+ +I K LKT KRKR
Sbjct  614   TLKEVIQYILKNLKTLKRKR  633



>ref|XP_010656778.1| PREDICTED: factor of DNA methylation 1 isoform X1 [Vitis vinifera]
 ref|XP_010656779.1| PREDICTED: factor of DNA methylation 1 isoform X1 [Vitis vinifera]
Length=657

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/620 (62%), Positives = 492/620 (79%), Gaps = 9/620 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  40    IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  99

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQK NH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  100   KQKVNHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQM  158

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             NG  + +  YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  159   NGNDLGDSAYWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  218

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              HSKKEW  ++  P S++YGW A+ DDY +EG VG YLR T +LKTI+D+++  K+D++ 
Sbjct  219   RHSKKEWNVQKQHPGSNIYGWVARADDYSSEGPVGEYLRNTGELKTISDIVEAAKQDRNT  278

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             I++NL NE+DLKNENL  L  ++NEK++SLSRM+EEKD LH AFYEE+RKMQRLAR+HV+
Sbjct  279   IVANLANEIDLKNENLDELQYKYNEKSMSLSRMLEEKDKLHHAFYEETRKMQRLARDHVR  338

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE LN EL+ K+K+LDSW +ELNKRE LTEREK KLD+EKK+N+ERN+SL+MAS 
Sbjct  339   RILEEQEKLNYELDSKRKELDSWCKELNKREALTEREKQKLDDEKKKNNERNNSLQMASI  398

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVL+L+EE KREKE AL KIL+LEK +DAKQKLEMEI+E+KGKL VM+H+G +
Sbjct  399   EQKKADENVLKLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIEEIKGKLQVMKHLGDE  458

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ K+KEM E L+EK+ +M++L+ +N  L++KERQSNDELQ AR  LI GL D+L 
Sbjct  459   DDTAVQNKMKEMNEDLEEKVGEMENLESLNQTLIVKERQSNDELQAARTELITGLKDML-  517

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             SGR++IG++RMGEI+ K F    KQRFS EEA+V+A  L SLWQE +K P WHPF+++ +
Sbjct  518   SGRTNIGLKRMGEIEEKPFVKTYKQRFSLEEANVQAYTLVSLWQENLKKPEWHPFKIVEV  577

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               +  +IINE+DE+L KLK+EWG+EI  AV  +++E+NEYN SGRY + ELWNFKEGRKA
Sbjct  578   EGKTLEIINEEDEKLQKLKQEWGDEIYMAVTTSLKEINEYNPSGRYPVIELWNFKEGRKA  637

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+ +I K LKT KRKR
Sbjct  638   TLKEVIQYILKNLKTLKRKR  657



>gb|KHG15531.1| suppressor of gene silencing 3 [Gossypium arboreum]
Length=633

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/619 (61%), Positives = 491/619 (79%), Gaps = 8/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             INEYKEKPYEE+RSGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16    INEYKEKPYEEIRSGKYKVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAV------APEDNNLYCWPWTGIVVNVSKDNAN  1773
             KQ+ANH+ALAKYLEIDL  +A+   +  V       PE   LY WPW GI++N+  ++ N
Sbjct  76    KQRANHLALAKYLEIDLASEADETSRPTVPQVVDQTPEQTELYVWPWMGIIMNIVAESKN  135

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
                + ++ YWLKRF+KY+   V+ F ++   T Q ++   SDWNG+ NA  FE AFE+E 
Sbjct  136   IDTLHDKGYWLKRFAKYKPINVQCFWNEVDLTGQAIVVFNSDWNGFVNATQFEKAFESER  195

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             HSKK W   ++   S++YGW A+ DDY+++G +G YLR+  +L+TI+ ++QE  +D++ +
Sbjct  196   HSKKHWNGRQTQLGSNIYGWCARADDYQSDGPIGDYLRKVGKLQTISGIVQEAAQDRNSV  255

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NLT ++DL NENL  L  ++NE  +SLSRM+EEKD LH AF EE+RKMQRLAR++V+R
Sbjct  256   VANLTTKIDLTNENLDELQYKYNETTMSLSRMLEEKDRLHLAFIEETRKMQRLARDNVRR  315

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE LN ELE KK+++D+W RELNKRE LTERE+ KLDEEKK+N+ERN+SL++AS E
Sbjct  316   ILEEQEKLNHELETKKRKIDNWTRELNKRETLTERERQKLDEEKKKNNERNNSLQLASME  375

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADENVLRL+EE KREKE AL+KIL LEK +D KQKLEMEI++LKGKL VM+H+ G D
Sbjct  376   QKKADENVLRLVEEQKREKEEALKKILLLEKQLDIKQKLEMEIEDLKGKLQVMKHL-GQD  434

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D+AVQ+K++EM  +L EKI+D++DL+  N AL+ KERQSNDELQEARK+LIQGL +LL +
Sbjct  435   DAAVQKKMEEMNNELQEKIDDLQDLESTNKALIYKERQSNDELQEARKVLIQGLPELLGN  494

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              R++IG++RMGE+D KAFH+ CK RF ++EA+++A  LCS WQE +K+P+WHPF+VI   
Sbjct  495   -RTNIGLKRMGELDPKAFHDTCKSRFPSDEAEIQATTLCSSWQENLKNPDWHPFKVIVEG  553

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
               P++I+NE+DE+L+ LK EWGEEI  AV+ A++E+NEYN SGRYVI ELWNFKE RKAT
Sbjct  554   GNPKEILNEEDEKLTNLKLEWGEEIYNAVVTALKELNEYNPSGRYVISELWNFKENRKAT  613

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEVV ++ + +KT KRKR
Sbjct  614   LKEVVGYVVRNIKTAKRKR  632



>ref|XP_008361182.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
 ref|XP_008361190.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=634

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/619 (60%), Positives = 492/619 (79%), Gaps = 7/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+EYK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDLLQHA+GV KGSA R+ 
Sbjct  16    IHEYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLLQHASGVAKGSALRNA  75

Query  1934  KQKANHVALAKYLEIDL---GDQAE-PLPQRAVAPEDN--NLYCWPWTGIVVNVSKDNAN  1773
             KQKANH+ALA YLE DL   GDQ + P     VA ++   +LY WPWTGIVVN+     +
Sbjct  76    KQKANHLALALYLENDLASEGDQVQRPTLPAPVAQQEKQEDLYVWPWTGIVVNIVSQPKD  135

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             G  + +  YW+++FSKY+  EV+  C++ +  +  V+    DWNG+ NA  FE  FE +C
Sbjct  136   GKDLLDSGYWMRKFSKYKPSEVRTLCNEGNPAACAVVYFSKDWNGFGNATDFEKTFETDC  195

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
              SKK+W A +  P S +YGW A+ DDY ++G +G +LR+T +L+T++D++QE  R ++ +
Sbjct  196   QSKKDWNARKEQPGSSIYGWCARADDYHSQGQIGEFLRKTGELRTVSDIVQEAARKRNDV  255

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +++L NE+D+ NENL  L  ++NE+ LSLSRM+EEKD LH  F +E+RKMQ++AR +VQR
Sbjct  256   VASLANEIDMTNENLDELRYKYNERTLSLSRMLEEKDRLHNDFVKETRKMQQMARNNVQR  315

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE LN ELE KKK+LDSW++ELNKRE LTERE+ KLDE+KK+ND+RN+SL++AS+E
Sbjct  316   ILEEQEKLNYELESKKKKLDSWSKELNKREALTERERQKLDEDKKKNDDRNNSLQLASEE  375

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADE+VLRL+E  KREKE AL KILELEK +DAKQKLEMEI+ELKGKL+VM+H+G  D
Sbjct  376   QKKADESVLRLVEMQKREKEDALNKILELEKQLDAKQKLEMEIEELKGKLEVMKHLGDQD  435

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D AVQ KIKEM+++L EK+++++DL+ +N  L+ KERQSNDELQEARK LI GLS++L S
Sbjct  436   DDAVQSKIKEMEDELGEKVDELEDLESLNQTLITKERQSNDELQEARKELIVGLSEML-S  494

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             GRS+IGI+RMG++D K F N CK+RF+ E+A V+A  LCSLWQ+ + +P+WHPF+VI ++
Sbjct  495   GRSNIGIKRMGDLDQKPFMNTCKERFTLEKAQVQASTLCSLWQDNLTNPDWHPFKVITVN  554

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
             + P++I++E+DE+L  LKEEWG EI   V+ A++E+N+YN SGRYVI ELWNFKEGRKAT
Sbjct  555   EEPKEILDEEDEKLRNLKEEWGNEIHECVVTALKELNDYNPSGRYVISELWNFKEGRKAT  614

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+SF+ K +KT KRKR
Sbjct  615   LKEVISFVLKSIKTLKRKR  633



>ref|XP_010678967.1| PREDICTED: factor of DNA methylation 1-like [Beta vulgaris subsp. 
vulgaris]
Length=631

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/620 (60%), Positives = 490/620 (79%), Gaps = 11/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EY EKPY+ LR+G YKVK  NG L+CPFCAGKKKQ+Y +KDL QHA+GV KG+A+RS 
Sbjct  16    IEEYVEKPYQALRTGTYKVKNANGTLKCPFCAGKKKQEYGFKDLYQHASGVAKGAAHRSA  75

Query  1934  KQKANHVALAKYLEIDLG-------DQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  1776
             KQKA H+ALA+YLE+D+G         AEP PQ     E+  +YCWPW G+VVN+  D  
Sbjct  76    KQKAIHLALARYLEVDMGFGSAQNSGAAEPEPQPIEQKEE--VYCWPWIGVVVNIVDDGK  133

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              G  + +  +W+K FSKY+   V++F D++ +  Q V+  + +W G+KNA  FE +F+A 
Sbjct  134   AGKQLADGGFWMKTFSKYKPLGVEVFHDEQEQIVQAVVHFEKEWTGFKNAGDFEKSFQAG  193

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KKEW A++ + SS +YGWFA+ DDY AEG +G YLR+  +L+TI D++Q  K  +D+
Sbjct  194   RHGKKEWIADKENLSSGIYGWFARADDYHAEGQMGDYLRKNCELRTIADVMQMGK--QDE  251

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             I+ +L N++DLKN+NL  + ++ NEK +SLSRM+EEKD LH+AFYEE+RKMQRLAR+HVQ
Sbjct  252   IVVDLANQIDLKNQNLDEMQSKVNEKAMSLSRMLEEKDKLHQAFYEETRKMQRLARDHVQ  311

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE +N ELE KK+QLD   REL+KREVLTERE+ KL+E+K++NDERN+SL+MAS 
Sbjct  312   RILSEQENMNHELESKKRQLDWRTRELSKREVLTERERQKLEEDKQQNDERNNSLQMASV  371

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVLRL+EE KREKE AL+KIL+LEK++DA+QKL++EI+ELKGKL+VM+H+G D
Sbjct  372   EQKKADENVLRLVEEQKREKEEALKKILQLEKELDARQKLQLEIEELKGKLEVMKHLGDD  431

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ K+KEM E+L+ KIEDM DL+ MN  LV+K+RQSNDELQEAR +LI  L D+L 
Sbjct  432   DDAAVQRKMKEMTEELERKIEDMSDLEAMNQTLVIKQRQSNDELQEARTVLITALLDILQ  491

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R++IGI+RMGEID +AF   CK+RF+ +EA +KA E CSLWQE +KDP WHPFR+I  
Sbjct  492   SNRTNIGIKRMGEIDERAFVAECKKRFTVDEALIKASEGCSLWQENLKDPAWHPFRIIEH  551

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
             + + +++INEDDE+L KLKE+WG+E+  AV  A++E+NEYN SGRYVI ELWN+KEGRKA
Sbjct  552   NGKTDEVINEDDEKLKKLKEQWGDEVYQAVTVALKELNEYNPSGRYVINELWNYKEGRKA  611

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             T+KEVV++IFK LKT KRKR
Sbjct  612   TVKEVVNYIFKNLKTLKRKR  631



>ref|XP_007023402.1| XH/XS domain-containing protein [Theobroma cacao]
 gb|EOY26024.1| XH/XS domain-containing protein [Theobroma cacao]
Length=633

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/619 (60%), Positives = 487/619 (79%), Gaps = 8/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+Y EKPYE+L+SGKY+VK  NG LRCPFCAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16    INDYIEKPYEQLKSGKYQVKALNGSLRCPFCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAE----PLPQRAV--APEDNNLYCWPWTGIVVNVSKDNAN  1773
              QKANH+ALAKYLEIDL  +A+    P   R V   PE N+LY WPW GI++N+  ++ +
Sbjct  76    IQKANHLALAKYLEIDLASEADQTLRPAVPRPVNQTPEQNDLYVWPWMGIILNIVAESKD  135

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               A+ ++ YWLK+F+KY+  EV+ F +++  T Q ++K  +DWNG+ NA  FE  F  E 
Sbjct  136   KNALHDQGYWLKKFAKYKPLEVQSFWNEQDLTGQAILKFNNDWNGFMNATEFEKVFVTEL  195

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
              SKK W  +++   S++YGW A+ DDY+++G +G YLR+  +L+TI+D++QE  +D++ +
Sbjct  196   RSKKHWNEKQTHLGSNIYGWCARADDYQSDGPIGEYLRKVGKLRTISDIVQEAAQDRNNV  255

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL   +DL NENL  L  ++NE  +SLSRM+EEKD LH AF EE+RKMQRLAR++V+R
Sbjct  256   VANLATRIDLTNENLEELQYKYNETTMSLSRMLEEKDKLHLAFIEETRKMQRLARDNVRR  315

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE LN ELE KK+++D WN+ELNKRE LTERE+ KLDE+KK+N+ERN+SL +AS E
Sbjct  316   ILEEQEKLNYELETKKRKIDYWNKELNKREALTERERQKLDEDKKKNNERNNSLLLASME  375

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADENVLRL+EE KREKE AL+KIL+LEK +D KQKLEMEI+ELKGKL VM+H+ G D
Sbjct  376   QKKADENVLRLVEEQKREKEEALKKILQLEKQLDVKQKLEMEIEELKGKLQVMKHL-GQD  434

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D+ VQ+K++EM  +L EKIED++D++  N AL++KERQSNDELQEARK+LIQGL +LL  
Sbjct  435   DAVVQKKMEEMNNELKEKIEDLQDMESTNQALIVKERQSNDELQEARKVLIQGLRELL-G  493

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              R +IG++RMGE+D KAF N CK RFS +EA V+A  LCSLW+E +K+P WHPF++IN  
Sbjct  494   ARVNIGLKRMGELDEKAFQNTCKLRFSPDEAAVQATTLCSLWEENLKNPEWHPFKIINEG  553

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                ++I+NE+DE+L  LK+EWGE I  AV+ A +E+NEYN SGRYVI ELWNFKE RKAT
Sbjct  554   GNHKEIVNEEDEKLRNLKQEWGEGIYEAVVTAFKELNEYNPSGRYVISELWNFKENRKAT  613

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+++I K +KT KRKR
Sbjct  614   LKEVINYIVKNIKTAKRKR  632



>ref|XP_008375509.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=634

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/620 (58%), Positives = 486/620 (78%), Gaps = 9/620 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+EYK+KPYE LR GKYKVKGPNG LRCPFCAGKKKQDYK+ +L QHA+GV KGSA R+ 
Sbjct  16    IHEYKDKPYELLREGKYKVKGPNGTLRCPFCAGKKKQDYKFNELFQHASGVAKGSALRNA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALA YLE DL  + E + QR + P       +  +LY WPWTGIVVN+     
Sbjct  76    KQKANHLALAIYLENDLASEGEQI-QRPILPAPVTQQEKQEDLYVWPWTGIVVNIVSQPK  134

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             +G  + +  YW+++FSK +  EV    ++    +  V+    DW+G+ +A  FE  FE +
Sbjct  135   DGKDLLDSGYWMRKFSKCKPSEVHTLWNEGDPAACAVVYFSKDWSGFGSATDFEKMFETD  194

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
             C SKK+W A +  P S +YGW A+ DDY ++G +G +LR+T +L+T++D++QE  R ++ 
Sbjct  195   CQSKKDWNARKEQPGSSIYGWCARADDYHSQGQIGEFLRKTGELRTVSDIVQEAARKRND  254

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++++L N++D+ NENL  L  ++NE+ LSLSRM+EEKD LH  F +E+RKMQ++AR +VQ
Sbjct  255   VVASLANKIDMTNENLDELRYKYNERTLSLSRMLEEKDRLHNDFVKETRKMQQMARNNVQ  314

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE LN ELE KKK+LD+W++ELNKRE +TERE+ KLDE+KK+NDERN+SL++AS+
Sbjct  315   RILEEQEKLNYELESKKKKLDTWSKELNKREAVTERERQKLDEDKKKNDERNNSLQLASE  374

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADE+VLRL+EE KREKE AL KILELEK +DAKQKLEMEI+ELKGKL+VM+H+G  
Sbjct  375   EQKKADESVLRLVEEQKREKEDALNKILELEKQLDAKQKLEMEIEELKGKLEVMKHLGDQ  434

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ KIKEM+++L EK+++++DL+ +N  L+ KERQSNDELQEARK LI GLS++L 
Sbjct  435   DDAAVQSKIKEMEDELGEKVDELEDLESLNQTLITKERQSNDELQEARKELIAGLSEML-  493

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             SGRS+IGI+RMG++D K F N CK+RF+ EEA V+A  LCSLWQ+ + +P+WHPF+VI +
Sbjct  494   SGRSNIGIKRMGDLDQKPFMNTCKERFTLEEAQVQASTLCSLWQDNLTNPDWHPFKVITV  553

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
             ++ P++I++E+DE+L  L+EEWG EI   V+ A++E+N+YN SGRYVI ELWNFKEGRKA
Sbjct  554   NEEPKEILDEEDEKLRNLREEWGNEIHECVVTALKELNDYNPSGRYVISELWNFKEGRKA  613

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+SF+ K +KT KRKR
Sbjct  614   TLKEVISFVLKSIKTLKRKR  633



>ref|XP_008228782.1| PREDICTED: interaptin-like [Prunus mume]
 ref|XP_008228783.1| PREDICTED: interaptin-like [Prunus mume]
Length=635

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/619 (59%), Positives = 482/619 (78%), Gaps = 8/619 (1%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVK  1932
             N+YK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDL QHA+GVGKGSANRS K
Sbjct  17    NDYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLFQHASGVGKGSANRSAK  76

Query  1931  QKANHVALAKYLEIDLGDQAE----PLPQRAVAPEDN---NLYCWPWTGIVVNVSKDNAN  1773
             QKANH+ALA YLE DL  +A+    PL    VAP++    +LY WPWTGIVVN+     +
Sbjct  77    QKANHLALAIYLENDLASEADQIQRPLLPTPVAPQEKQEEDLYVWPWTGIVVNIVIQPKD  136

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             G  + +  YWL++FSKY+  EV  F +++   +  V+    DW+G+ NA  FE  FE +C
Sbjct  137   GKDLLDSRYWLRKFSKYKPSEVHTFLNEEEPAACAVVCFSKDWSGFGNATDFEKMFETDC  196

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK+W A +  P S +YGW A+ DDY ++G +G +LRE  +L+T++D++QE  ++++ +
Sbjct  197   HGKKDWNARKQQPGSSIYGWCARADDYHSQGLMGTFLREEGKLRTVSDIVQEAAQNRNDV  256

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +++L N++D+ NENL  L  ++NE  +SLSRM+EEKD LH  F EE+RKMQR AR++V+R
Sbjct  257   VASLANKIDMTNENLDELRYKYNENTMSLSRMLEEKDKLHNDFVEETRKMQRTARDNVRR  316

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE LN ELE KK++LDSW++ELNKRE LTERE+ KLDE+KK+ND+RN+SL +AS E
Sbjct  317   ILDEQEKLNYELESKKRKLDSWSKELNKREALTERERQKLDEDKKKNDQRNNSLHLASVE  376

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADENVLRL+EE KREKE AL KILELEK +DAKQKLEMEI+E+KGKL+VM+H+G  D
Sbjct  377   QKKADENVLRLVEEQKREKEDALNKILELEKQLDAKQKLEMEIEEIKGKLEVMKHLGDQD  436

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D AVQ+KIKEM ++L+EK+++++DL+ +N  L+ KERQSNDELQ+ARK LI GL  +L+ 
Sbjct  437   DDAVQKKIKEMNDELEEKVDELEDLESLNQTLITKERQSNDELQKARKELIAGLRGMLDV  496

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              RSHI I+RMG++D K F+NVCK+RFS EEA V+A  LCSLWQ+ +   +WHPF++I + 
Sbjct  497   -RSHIQIKRMGDLDYKPFYNVCKERFSDEEAQVQASTLCSLWQDNLTKTDWHPFKIITVD  555

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                ++IINE+DE+L  LKEEWG EI   V+ A++E+NEYN SGRY + ELWN KEGRKAT
Sbjct  556   GNAQEIINEEDEKLRNLKEEWGHEIYECVVTALKELNEYNPSGRYAVSELWNVKEGRKAT  615

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+S+I  ++KT KRKR
Sbjct  616   LKEVISYILSKIKTLKRKR  634



>ref|XP_003531733.1| PREDICTED: protein MLP1-like isoform X1 [Glycine max]
 ref|XP_006585612.1| PREDICTED: protein MLP1-like isoform X2 [Glycine max]
 gb|KHN38029.1| hypothetical protein glysoja_007071 [Glycine soja]
Length=629

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/620 (59%), Positives = 476/620 (77%), Gaps = 14/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EY EKPYE+LR+GKYKVK  NG LRCP+CAGKKKQ++KYKDLLQHA+GVGKGSANRS 
Sbjct  16    IEEYAEKPYEQLRAGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLLQHASGVGKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN-------LYCWPWTGIVVNVSKDNA  1776
             +QKANH+ALAKYLE DL  +AE + QR   P+  N       LY WPWTGI+VN+     
Sbjct  76    QQKANHLALAKYLETDLASEAESI-QRPAPPQAVNQPLLQEDLYVWPWTGIIVNIK----  130

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              G +++   YWLK F+K+   + +IF  D    ++ V+   +DWNG+ NA  FE +FEA 
Sbjct  131   -GKSIDS-GYWLKEFAKFRPIDFRIFLKDDDLIAEAVVDFNNDWNGFMNASEFEKSFEAA  188

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W + +    S++YGW A+ DDY   G +G YLR   +L+T++D++QE    ++ 
Sbjct  189   RHGKKDWNSRKLEAGSNIYGWVAREDDYNCGGPIGEYLRNKGRLRTVSDIVQEASVSRNN  248

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             I++NLTNE+++ NENL  +  +FNEK +SLSRM+EEKD LH AF EESR MQR AR  V+
Sbjct  249   IVTNLTNEIEITNENLDKMQYKFNEKTMSLSRMLEEKDKLHNAFEEESRNMQRRARNEVR  308

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE L+SELE+KK++LDSW+R+LNKRE LT++EK KLDE+KK+ D RN SL++ASK
Sbjct  309   RILDEQEKLSSELEEKKRKLDSWSRDLNKREALTDQEKKKLDEDKKKKDLRNESLQLASK  368

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQK ADENVLRL+EE KREKE A  KIL+LEK +DAKQKLEMEI+ELKGKL VM+H+G +
Sbjct  369   EQKIADENVLRLVEEQKREKEEAYNKILQLEKQLDAKQKLEMEIEELKGKLQVMKHLGDE  428

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ KIKEM ++L EK++++++++ MN  L++KERQSNDELQEARK LI GL D+LN
Sbjct  429   DDAAVQNKIKEMNDELQEKVDNLENMEAMNQTLIVKERQSNDELQEARKELINGLDDMLN  488

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
               R++IG++RMGE+D K F N CK+RF  EEA  K +ELCSLWQE VK+  WHPF+V+ +
Sbjct  489   GPRTNIGLKRMGELDQKIFVNNCKKRFPLEEAGTKGVELCSLWQENVKNSAWHPFKVVTV  548

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
              D+PE IINE+DE+L  LK+EWG+EI +AV+ A++E+NEYNASG Y + ELWNFKE RKA
Sbjct  549   DDKPENIINEEDEKLRSLKQEWGDEIYSAVVTALKEINEYNASGGYTVKELWNFKEKRKA  608

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+++I   +K  KRKR
Sbjct  609   TLKEVINYIMDHIKPLKRKR  628



>gb|KDP41984.1| hypothetical protein JCGZ_27002 [Jatropha curcas]
Length=636

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/622 (60%), Positives = 485/622 (78%), Gaps = 10/622 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+YK+KPYEEL+SGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHA+GV KGSANRS 
Sbjct  16    INDYKDKPYEELKSGKYKVK-VNGSLRCPFCAGKKKQDYKYKDLLQHASGVAKGSANRSG  74

Query  1934  KQKANHVALAKYLEIDLGDQAE-------PLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALA YLE DL D+ +       P P      ++ +++ WPW GIVVN+  +  
Sbjct  75    KQKANHLALAIYLETDLTDEVDQSQRPVLPQPVNPTPEQEMDVFVWPWMGIVVNIVNEAK  134

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             +  A+++  YWLK+F+ Y+  ++  F  ++ +T   V+K  +DWNG+ NA  FE +FE  
Sbjct  135   DRNALQDSGYWLKKFALYKPLDIYTFWSEEDQTGMAVLKFNNDWNGFINATEFEKSFETS  194

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              HSKK W   +++P S +YGW A+ DDY+ EG VG YLR+  +L+TI+ ++QE    ++ 
Sbjct  195   HHSKKNWKELKANPGSTIYGWCARADDYDTEGLVGEYLRKEGKLRTISGIVQEATESRNV  254

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++++L N++D  NENL  L  ++NEK +SLSRM+EEKD LH AF EE+RKMQRLAR++V 
Sbjct  255   VVAHLANKIDQTNENLDELQYKYNEKTMSLSRMLEEKDKLHYAFLEETRKMQRLARDNVH  314

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE ++ ELE KK++LDSW++ELNKRE LTERE+ KLDEEKK+NDERN+SL++AS 
Sbjct  315   RILEEQENMSEELEAKKRKLDSWSKELNKREALTERERQKLDEEKKQNDERNNSLQLASI  374

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVLRL+EE KREKE AL KIL+LE  +DAKQKLEMEIQELKGKL VM+H+G +
Sbjct  375   EQKKADENVLRLVEEQKREKEEALNKILQLEMQLDAKQKLEMEIQELKGKLQVMKHLGDE  434

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ K+KEM ++L++K++D+ D++ +N  L+ KERQSNDELQEARK LI GL D L 
Sbjct  435   DDTAVQNKMKEMNDELEQKVDDLADVESLNQTLITKERQSNDELQEARKELILGLKDTLA  494

Query  695   SG-RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-  522
             S  R++IGI+RMGEID KAF N CKQ+F+TEEA V+A  LCSLWQE +KDPNWHPF+++ 
Sbjct  495   SSVRTNIGIKRMGEIDQKAFLNTCKQKFATEEAQVQASTLCSLWQENLKDPNWHPFKIVT  554

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
             +   + E+I++E+DE+L  LK+EWG +I  AV+ A++E+NEYN SGRYV PELWNFKEGR
Sbjct  555   DAEGKHEEIVDEEDEKLQNLKQEWGGDIYMAVVTALKEINEYNPSGRYVTPELWNFKEGR  614

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             KATLKEV+ +I K +KT KRKR
Sbjct  615   KATLKEVIGYIVKNIKTLKRKR  636



>ref|XP_003530299.1| PREDICTED: structural maintenance of chromosomes protein 2-like 
isoform X1 [Glycine max]
 ref|XP_006583096.1| PREDICTED: structural maintenance of chromosomes protein 2-like 
isoform X2 [Glycine max]
Length=629

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/619 (59%), Positives = 474/619 (77%), Gaps = 12/619 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EY EKPYE+LR+GKYKVK  NG LRCP+CAGKKKQ++KYKDLLQHA+GVGKGSANRS 
Sbjct  16    IEEYAEKPYEQLRAGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLLQHASGVGKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP-EDNNLYCWPWTGIVVNVSKDNAN  1773
             +QKANH+ALAKYLE DL  +AEP     LPQ    P    +LY WPWTGI+VN+      
Sbjct  76    QQKANHLALAKYLETDLACEAEPIQRPALPQAVNQPLHQEDLYVWPWTGIIVNIK-----  130

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             G +++   YWLK F+K+   + +IF  D    +  V+   +DWNG+ NA  FE +FEA  
Sbjct  131   GKSIDS-GYWLKEFAKFRPIDFRIFLKDDDLIAGAVVDFNNDWNGFMNASDFEKSFEAAR  189

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK+W + +    S++YGW A+ DDY   G +G YLR   +L+T+TD++QE    ++ I
Sbjct  190   HGKKDWNSRKLEAGSNIYGWVAREDDYNCGGPIGEYLRNKGRLRTVTDIVQEASESRNSI  249

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NLTNE+++ NENL  +  +FNEK +SLSRM+EEKD LH AF EESR MQR AR  V+R
Sbjct  250   VTNLTNEIEITNENLDKMQYKFNEKTMSLSRMLEEKDKLHNAFEEESRNMQRRARNEVRR  309

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE L+SELE+KK++LDSW+R+LNKRE LT++EK KL+E+ K+ D RN SL++ASKE
Sbjct  310   ILDEQEKLSSELEEKKRKLDSWSRDLNKREALTDQEKKKLEEDNKKKDLRNESLQLASKE  369

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QK ADENVLRL+EE KREKE A  KIL+LEK +DAKQKLEMEI+ELKGKL VM+H+G +D
Sbjct  370   QKIADENVLRLVEEQKREKEEAYNKILQLEKQLDAKQKLEMEIEELKGKLQVMKHLGDED  429

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D+AVQ KIKEM ++L EK++++++++ MN  L++KERQSNDELQEARK LI+GL D+LN+
Sbjct  430   DAAVQNKIKEMNDELQEKVDNLENMEAMNQTLIVKERQSNDELQEARKELIKGLDDMLNA  489

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              R+ IG++RMGE+D K F N CK+RF  EEA  K +ELCSLWQE VK+  WHPF+V+ + 
Sbjct  490   PRTKIGLKRMGELDQKVFVNNCKKRFPLEEAGTKGVELCSLWQENVKNSAWHPFKVVTVD  549

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
             D+ E IINE+DE+L  LK EWG+EI +AV+ A++E+NEYNASG Y + ELWNFK+ RKAT
Sbjct  550   DKAENIINEEDEKLRSLKHEWGDEIYSAVVTALKEINEYNASGGYTVVELWNFKDNRKAT  609

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+++I + +K  KRKR
Sbjct  610   LKEVINYIMEHIKPLKRKR  628



>ref|XP_007214938.1| hypothetical protein PRUPE_ppa002776mg [Prunus persica]
 gb|EMJ16137.1| hypothetical protein PRUPE_ppa002776mg [Prunus persica]
Length=635

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/619 (59%), Positives = 481/619 (78%), Gaps = 8/619 (1%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVK  1932
             N+YK+KPYE+LR GKYKVKGPNG LRCPFCAGKKKQDYK+KDL QHA+GVGKGSANRS K
Sbjct  17    NDYKDKPYEQLREGKYKVKGPNGTLRCPFCAGKKKQDYKFKDLFQHASGVGKGSANRSAK  76

Query  1931  QKANHVALAKYLEIDLGDQAE----PLPQRAVAPEDN---NLYCWPWTGIVVNVSKDNAN  1773
             QKANH+ALA YLE DL  +A+    PL    VAP++    +LY WPWTGIVVN+     +
Sbjct  77    QKANHIALAIYLENDLASEADQIQRPLLPTPVAPQEKQEEDLYVWPWTGIVVNIVSQPKD  136

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             G  + +  YWL++FSKY+  EV  F +++   +  V+    DW+G+ NA  FE  FE +C
Sbjct  137   GKDLLDSRYWLRKFSKYKPSEVHTFLNEEEPAACAVVCFSKDWSGFGNATDFEKMFETDC  196

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK+W A +  P S +YGW A+ DDY ++G +G +LRE  +L+T++D++QE  ++++ +
Sbjct  197   HGKKDWNARKQLPGSSIYGWCARADDYHSQGPMGTFLREEGKLRTVSDIVQEAAQNRNDV  256

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +++L N++D+ NENL  L  ++NE  +SLSRM+EEKD LH  F EE+RKMQR AR++V+R
Sbjct  257   VASLANKIDMTNENLDELRYKYNENTMSLSRMLEEKDKLHNDFVEETRKMQRTARDNVRR  316

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE LN ELE KK++LDSW++ELNKRE LTERE+ KLDE+KK+ND+RN+SL +AS E
Sbjct  317   ILDEQEKLNYELESKKRKLDSWSKELNKREALTERERQKLDEDKKKNDQRNNSLHLASVE  376

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADENVLRL+EE KREKE AL KILELEK +DAKQKLEMEI+E+KGKL+VM+H+G  D
Sbjct  377   QKKADENVLRLVEEQKREKEDALNKILELEKQLDAKQKLEMEIEEIKGKLEVMKHLGDQD  436

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D AVQ+KIKEM ++L+EK+++++DL+ +N  L+ KERQSNDELQ+ARK LI GL  +L+ 
Sbjct  437   DDAVQKKIKEMNDELEEKVDELEDLESLNQTLITKERQSNDELQKARKELIAGLRGMLDV  496

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              RS I I+RMG++D K F+NVCK+RFS EEA V+A  LCSLWQ+ +   +WHPF++I + 
Sbjct  497   -RSLIQIKRMGDLDYKPFYNVCKERFSDEEAQVQASTLCSLWQDNLTKTDWHPFKIITVD  555

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                ++IINE+DE+L  LKEEWG EI   V+ A++E+NEYN SGRY + ELWN KEGRKAT
Sbjct  556   GNAQEIINEEDEKLWNLKEEWGHEIYECVVTALKELNEYNPSGRYAVSELWNVKEGRKAT  615

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+S+I  ++KT KRKR
Sbjct  616   LKEVISYILSKIKTLKRKR  634



>ref|XP_006465197.1| PREDICTED: myosin-10-like [Citrus sinensis]
 gb|KDO42996.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=632

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/620 (58%), Positives = 488/620 (79%), Gaps = 11/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16    INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALAKYLE+DL    +  PQR V P       E  +LY WPW GI+VN+  +  
Sbjct  75    KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             +  +  +  YWLKRF+ ++  EV+IF ++++ T+Q V+K  +DWNG+  A  FE AF+A+
Sbjct  134   DRGSFLDSGYWLKRFAVFKPVEVRIFWNEENPTAQAVVKFNNDWNGFMQASDFEKAFDAD  193

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                K+ W A + SP   +YGWFA+ DD  +EG +G YLR+  +L+T++D++QE+ + K  
Sbjct  194   HQGKRHWIARKESPGLRIYGWFARADDNTSEGPIGEYLRQEGKLRTVSDIVQEDAQSKIH  253

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++++L +++D+KNE+LS L  +FNE  +SLSRM+EEKD LH AF EE+RKMQRLAR++V+
Sbjct  254   VVAHLASKIDMKNEDLSELQCKFNETTMSLSRMLEEKDRLHYAFVEETRKMQRLARDNVR  313

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE L+ ELE KKK+LDSW+++LNKRE LTERE+ KLD ++++ND RN+SL++AS 
Sbjct  314   RILEEQEKLSCELETKKKKLDSWSKQLNKREALTERERQKLDADRQQNDLRNNSLQLASM  373

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEI++LKGKL+VM+H+G +
Sbjct  374   EQKKADENVLRLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIEDLKGKLEVMKHLGDE  433

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ+K+KEM ++L+ KI+D+ +++ +N  L+ KERQSNDELQEAR+ LIQGLSDL+ 
Sbjct  434   DDAAVQKKMKEMNDELESKIDDLDEMESLNKTLIAKERQSNDELQEARRELIQGLSDLIG  493

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             + R++IG++R+GEID K F + CK +F  EEA V+A  LCSLWQE +K   WHPF++I++
Sbjct  494   A-RTNIGVKRLGEIDPKPFQDACKNKFPLEEAQVEASTLCSLWQENLKATEWHPFKIIHV  552

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
                P++II+E+DE++  LKE  G+EI  AV  A++E+NEYN SGRYVIP+LWNFKEGRKA
Sbjct  553   EGTPKEIIDEEDEKIKSLKEL-GDEIYMAVTTALKELNEYNPSGRYVIPDLWNFKEGRKA  611

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+S+I   ++  KRKR
Sbjct  612   TLKEVISYIVGNIRRLKRKR  631



>ref|XP_006427593.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 ref|XP_006427594.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 gb|ESR40833.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
 gb|ESR40834.1| hypothetical protein CICLE_v10025142mg [Citrus clementina]
Length=634

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/620 (58%), Positives = 488/620 (79%), Gaps = 11/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16    INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALAKYLE+DL    +  PQR V P       E  +LY WPW GI+VN+  +  
Sbjct  75    KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             +  +  +  YWLKRF+ ++  EV+IF ++++ T+Q V+K  +DWNG+  A  FE AF+A+
Sbjct  134   DRGSFLDSGYWLKRFAVFKPVEVRIFWNEENPTAQAVVKFNNDWNGFMQASDFEKAFDAD  193

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                K+ W A + SP   +YGWFA+ DD  +EG +G YLR+  +L+T++D++QE+ + K  
Sbjct  194   HQGKRHWIARKESPGLRIYGWFARADDNTSEGPIGEYLRQEGKLRTVSDIVQEDAQSKIH  253

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++++L +++D+KNE+LS L  +FNE  +SLSRM+EEKD LH AF EE+RKMQRLAR++V+
Sbjct  254   VVAHLASKIDMKNEDLSELQCKFNETTMSLSRMLEEKDRLHYAFVEETRKMQRLARDNVR  313

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE L+ ELE KKK+LDSW+++LNKRE LTERE+ KLD ++++ND RN+SL++AS 
Sbjct  314   RILEEQEKLSCELETKKKKLDSWSKQLNKREALTERERQKLDADRQQNDLRNNSLQLASM  373

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEI++LKGKL+VM+H+G +
Sbjct  374   EQKKADENVLRLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIEDLKGKLEVMKHLGDE  433

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ+K+KEM ++L+ KI+D+ +++ +N  L+ KERQSNDELQEAR+ LIQGLSDL+ 
Sbjct  434   DDAAVQKKMKEMNDELESKIDDLDEMESLNKTLIAKERQSNDELQEARRELIQGLSDLIG  493

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             + R++IG++R+GEID K F + CK +F  EEA V+A  LCSLWQE +K   WHPF++I++
Sbjct  494   A-RTNIGVKRLGEIDPKPFQDACKNKFPLEEAQVEASTLCSLWQENLKATEWHPFKIIHV  552

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
                P++II+E+DE++  LKE  G+EI  AV  A++E+NEYN SGRYVIP+LWNFKEGRKA
Sbjct  553   EGTPKEIIDEEDEKIKSLKEL-GDEIYMAVTTALKELNEYNPSGRYVIPDLWNFKEGRKA  611

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+S+I   ++  KRKR
Sbjct  612   TLKEVISYIVGNIRRLKRKR  631



>ref|XP_002527307.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35059.1| conserved hypothetical protein [Ricinus communis]
Length=637

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/623 (59%), Positives = 485/623 (78%), Gaps = 11/623 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+YKEKPY EL+SGKYKVK  NG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRS 
Sbjct  16    INDYKEKPYGELKSGKYKVK-VNGTLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRSA  74

Query  1934  KQKANHVALAKYLEIDLGDQAE-----PLPQRA-VAPEDNNLYCWPWTGIVVNVSKDNAN  1773
             KQKANHVALA YLE DL D+++      LP+     P+  +L+  PW GIVVN+  +  +
Sbjct  75    KQKANHVALAIYLENDLADESDQSHRPALPKPVNPTPQQVDLFVKPWMGIVVNIVTEGKD  134

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               A+ +  YWLK+F++Y+  EV  F  +  +T Q V+K   DWNG+ NA  FE +FE   
Sbjct  135   SNALHDNAYWLKKFAQYKPSEVSTFWSEHEQTGQAVLKFNDDWNGFMNATEFEKSFETLH  194

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             HSKK+W   +++P S +YGW A+ DD+++EG +G +LR+  +L+TI+ +++E    ++ +
Sbjct  195   HSKKDWKERKTNPGSSMYGWCARADDHDSEGPIGDFLRKKGKLRTISGIVEEATESRNSV  254

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +++L+N++D  N+NL  L  ++NEK +SLSRM+EEKD LH AF EE+RKMQR AR++V+R
Sbjct  255   VAHLSNKIDQTNKNLDDLQYKYNEKTMSLSRMLEEKDKLHYAFIEETRKMQRHARDNVRR  314

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE LN ELE KK++LDSW++ELNKRE LTERE+ KLDEEKK+ND++N+SL++AS E
Sbjct  315   ILEEQENLNDELESKKRKLDSWSKELNKREALTERERQKLDEEKKKNDDQNNSLQLASME  374

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEI+ELKGKL V++H+G  D
Sbjct  375   QKKADENVLRLVEEQKREKEEALNKILQLEKQLDAKQKLEMEIEELKGKLQVIKHLGDQD  434

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D+AVQ K+KEM ++L++K ED  D++ +++ LV+KERQSNDELQ+ARK LI GL D+L+S
Sbjct  435   DAAVQRKMKEMADELEQKEEDFGDMENLHHTLVVKERQSNDELQDARKELIAGLGDMLSS  494

Query  692   -GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI--  522
               R++IGI+RMGEID K F N CKQ+F  EEA V+A  LCSLWQE +KD +W PF+++  
Sbjct  495   VVRTNIGIKRMGEIDQKPFLNTCKQKFPLEEAQVQATTLCSLWQENLKDSSWQPFKIVPD  554

Query  521   -NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
               +  +  +I++E+DE+L  LK EWG+EI  AV+ A++E+NEYNASGRY+ PELWNFKEG
Sbjct  555   AEVEGKVNEIVDEEDEKLQNLKLEWGDEIYNAVVTALKEINEYNASGRYITPELWNFKEG  614

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             RKATLKEV+ +I K +KT KRKR
Sbjct  615   RKATLKEVIGYIVKNIKTLKRKR  637



>ref|XP_007135809.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
 gb|ESW07803.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
Length=629

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/620 (58%), Positives = 469/620 (76%), Gaps = 14/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I +Y EKPYE LR+GKYKVK  NG LRCP+CAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  16    IYDYSEKPYELLRAGKYKVKNLNGTLRCPYCAGKKKQDYKYKDLLQHASGVGKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP--EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALAKYLE DL  +AEP     LPQ    P  +++  Y WPWTGI+VN+     
Sbjct  76    KQKANHLALAKYLETDLASEAEPIQNPALPQAVNQPSQQEDLYYVWPWTGIIVNIK----  131

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              G +++   +WLK F+++   +  IF  D   T+Q V+    DWNG+ NA  FE +FE  
Sbjct  132   -GKSIDSR-HWLKEFAQFRPNDFHIFMKDGDMTAQAVMDFNKDWNGFINASEFEKSFETA  189

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W++ R    S++YGW A+ DDY   G +G YLR    L+T++D++QE    ++ 
Sbjct  190   RHCKKDWSS-RKLDDSNIYGWVAREDDYNCGGPIGEYLRNKGTLRTVSDIVQEASESRNS  248

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             I++NLT E++L NENL  + ++FNE+ +SLSRM+EEKD LH AF EESR MQR AR  V+
Sbjct  249   IVTNLTKEIELTNENLDKMQSKFNERTMSLSRMLEEKDKLHNAFEEESRNMQRKARNEVR  308

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE L+SEL+ K+++LDSW+R+LNKREVLT++E+ KL E+KK+ D RN SL +ASK
Sbjct  309   RILDEQEKLSSELDDKRRKLDSWSRDLNKREVLTDQERQKLAEDKKKKDLRNESLLLASK  368

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQK ADENVLRL+EE KREKE A  KIL LEK +DAKQKLEMEI+ELKGKL VM+H+G +
Sbjct  369   EQKIADENVLRLVEEQKREKEEAYNKILLLEKQLDAKQKLEMEIEELKGKLQVMKHLGDE  428

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ+KIKEM ++L EKIE+++ ++ MN  L++KERQSNDELQEARK LI+GL D+LN
Sbjct  429   DDTAVQKKIKEMNDELQEKIENLESVETMNQTLIVKERQSNDELQEARKELIKGLEDMLN  488

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
               RS+IG++RMGE+D   F   CK+RFS EE   K +ELCSLWQE VK+  WHPF+V+ +
Sbjct  489   GPRSNIGLKRMGELDQNVFVAKCKERFSPEEYGTKGVELCSLWQENVKNSAWHPFKVVVV  548

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
              + PE  I+E+D++L  LK+EWG+EI +AV+ A+ E+NEYNASG Y + ELWNFKE RKA
Sbjct  549   DNNPENSIDENDDKLRSLKQEWGDEIYSAVVTALTEINEYNASGGYTVVELWNFKEKRKA  608

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+++I  ++K +KRKR
Sbjct  609   TLKEVITYIMDRIKPNKRKR  628



>ref|XP_007135808.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
 gb|ESW07802.1| hypothetical protein PHAVU_010G160300g [Phaseolus vulgaris]
Length=640

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/620 (58%), Positives = 469/620 (76%), Gaps = 14/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I +Y EKPYE LR+GKYKVK  NG LRCP+CAGKKKQDYKYKDLLQHA+GVGKGSANRS 
Sbjct  27    IYDYSEKPYELLRAGKYKVKNLNGTLRCPYCAGKKKQDYKYKDLLQHASGVGKGSANRSA  86

Query  1934  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAP--EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALAKYLE DL  +AEP     LPQ    P  +++  Y WPWTGI+VN+     
Sbjct  87    KQKANHLALAKYLETDLASEAEPIQNPALPQAVNQPSQQEDLYYVWPWTGIIVNIK----  142

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              G +++   +WLK F+++   +  IF  D   T+Q V+    DWNG+ NA  FE +FE  
Sbjct  143   -GKSIDSR-HWLKEFAQFRPNDFHIFMKDGDMTAQAVMDFNKDWNGFINASEFEKSFETA  200

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W++ R    S++YGW A+ DDY   G +G YLR    L+T++D++QE    ++ 
Sbjct  201   RHCKKDWSS-RKLDDSNIYGWVAREDDYNCGGPIGEYLRNKGTLRTVSDIVQEASESRNS  259

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             I++NLT E++L NENL  + ++FNE+ +SLSRM+EEKD LH AF EESR MQR AR  V+
Sbjct  260   IVTNLTKEIELTNENLDKMQSKFNERTMSLSRMLEEKDKLHNAFEEESRNMQRKARNEVR  319

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE L+SEL+ K+++LDSW+R+LNKREVLT++E+ KL E+KK+ D RN SL +ASK
Sbjct  320   RILDEQEKLSSELDDKRRKLDSWSRDLNKREVLTDQERQKLAEDKKKKDLRNESLLLASK  379

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQK ADENVLRL+EE KREKE A  KIL LEK +DAKQKLEMEI+ELKGKL VM+H+G +
Sbjct  380   EQKIADENVLRLVEEQKREKEEAYNKILLLEKQLDAKQKLEMEIEELKGKLQVMKHLGDE  439

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ+KIKEM ++L EKIE+++ ++ MN  L++KERQSNDELQEARK LI+GL D+LN
Sbjct  440   DDTAVQKKIKEMNDELQEKIENLESVETMNQTLIVKERQSNDELQEARKELIKGLEDMLN  499

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
               RS+IG++RMGE+D   F   CK+RFS EE   K +ELCSLWQE VK+  WHPF+V+ +
Sbjct  500   GPRSNIGLKRMGELDQNVFVAKCKERFSPEEYGTKGVELCSLWQENVKNSAWHPFKVVVV  559

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
              + PE  I+E+D++L  LK+EWG+EI +AV+ A+ E+NEYNASG Y + ELWNFKE RKA
Sbjct  560   DNNPENSIDENDDKLRSLKQEWGDEIYSAVVTALTEINEYNASGGYTVVELWNFKEKRKA  619

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+++I  ++K +KRKR
Sbjct  620   TLKEVITYIMDRIKPNKRKR  639



>gb|KDO42995.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=632

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/620 (58%), Positives = 487/620 (79%), Gaps = 11/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16    INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALAKYLE+DL    +  PQR V P       E  +LY WPW GI+VN+  +  
Sbjct  75    KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             +  +  +  YWLKRF+ ++  EV+IF ++++ T+Q V+K  +DWNG+  A  FE AF+A+
Sbjct  134   DRGSFLDSGYWLKRFAVFKPVEVRIFWNEENPTAQAVVKFNNDWNGFMQASDFEKAFDAD  193

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                K+ W A + SP   +YGWFA+ DD  +EG +G YLR+  +L+T++D++QE+ + K  
Sbjct  194   HQGKRHWIARKESPGLRIYGWFARADDNTSEGPIGEYLRQEGKLRTVSDIVQEDAQSKIH  253

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++++L +++D+KNE+LS L  +FNE  +SLSRM+EEKD LH AF EE+RKMQRLAR++V+
Sbjct  254   VVAHLASKIDMKNEDLSELQCKFNETTMSLSRMLEEKDRLHYAFVEETRKMQRLARDNVR  313

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE L+ ELE KKK+LDSW+++LNKRE LTERE+ KLD ++++ND RN+SL++AS 
Sbjct  314   RILEEQEKLSCELETKKKKLDSWSKQLNKREALTERERQKLDADRQQNDLRNNSLQLASM  373

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVLRL+EE K EKE AL KIL+LEK +DAKQKLEMEI++LKGKL+VM+H+G +
Sbjct  374   EQKKADENVLRLVEEQKVEKEEALSKILQLEKQLDAKQKLEMEIEDLKGKLEVMKHLGDE  433

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ+K+KEM ++L+ KI+D+ +++ +N  L+ KERQSNDELQEAR+ LIQGLSDL+ 
Sbjct  434   DDAAVQKKMKEMNDELESKIDDLDEMESLNKTLIAKERQSNDELQEARRELIQGLSDLIG  493

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             + R++IG++R+GEID K F + CK +F  EEA V+A  LCSLWQE +K   WHPF++I++
Sbjct  494   A-RTNIGVKRLGEIDPKPFQDACKNKFPLEEAQVEASTLCSLWQENLKATEWHPFKIIHV  552

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
                P++II+E+DE++  LKE  G+EI  AV  A++E+NEYN SGRYVIP+LWNFKEGRKA
Sbjct  553   EGTPKEIIDEEDEKIKSLKEL-GDEIYMAVTTALKELNEYNPSGRYVIPDLWNFKEGRKA  611

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+S+I   ++  KRKR
Sbjct  612   TLKEVISYIVGNIRRLKRKR  631



>emb|CAN62667.1| hypothetical protein VITISV_028278 [Vitis vinifera]
Length=626

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/643 (55%), Positives = 467/643 (73%), Gaps = 62/643 (10%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16    IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALAKYLE DL  +++  P RAV P       E ++L+ WPWTGI+ N+  +  
Sbjct  76    KQKANHLALAKYLETDLASESDQAP-RAVEPKPVTRTQEQDDLFVWPWTGIITNIVTEQK  134

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             NG  + +  YWLK+FSK++  EV  F +D  +T+  +++  +DW G+ NA  FE AFEA+
Sbjct  135   NGNDLGDSAYWLKKFSKHKPLEVHTFWNDMDQTALAIVRFNNDWTGFMNATAFEKAFEAD  194

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              HSKKEW  ++  P S++YGW A+ DDY +EG VG YLR+T +LKTI+D+++  K+D++ 
Sbjct  195   RHSKKEWNVQKQHPGSNIYGWVARADDYISEGPVGEYLRKTGELKTISDIVEAAKQDRNT  254

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYE--------------  1278
             I++NL NE+DLKNENL  L  ++NEK++SLSRM+EEKD LH AFYE              
Sbjct  255   IVANLANEIDLKNENLDELQYKYNEKSMSLSRMLEEKDKLHHAFYEGFAPDSINLCLWMW  314

Query  1277  ---------ESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTere  1125
                       +RKMQRLAR+HVQR+L EQE LN EL+ K+K+LD+W++ELNKRE LT   
Sbjct  315   RLFICAFVSXTRKMQRLARDHVQRILGEQEKLNYELDSKRKELDNWSKELNKREALT---  371

Query  1124  klkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAK  945
                                   +E++K D+      E+ KREKE AL KIL+LEK +DAK
Sbjct  372   ---------------------EREKQKLDD------EKKKREKEEALSKILQLEKQLDAK  404

Query  944   QKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKE  765
             QKLEMEI+E+KGKL VM+H+G +DD+AVQ K+KEM E+L+EK+ +M++L+ +N  L++KE
Sbjct  405   QKLEMEIEEIKGKLQVMKHLGDEDDTAVQNKMKEMNEELEEKVGEMENLESLNQTLIVKE  464

Query  764   RQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKAL  585
             RQSNDELQ AR  LI GL D+L SGR++IG++RMGE+D K F N CKQRFS EEA+V+A 
Sbjct  465   RQSNDELQAARTELITGLKDML-SGRTNIGLKRMGELDEKPFLNTCKQRFSLEEANVQAY  523

Query  584   ELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEV  405
              L SLWQ+ +K P WHPF+++ +     +IINE+DE+L KLK+EWG+EI  AV K+++E+
Sbjct  524   TLVSLWQDNLKKPEWHPFKIVEVEGETLEIINEEDEKLQKLKQEWGDEIYMAVTKSLKEI  583

Query  404   NEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             NEYN SGRY + ELWNFKEGRKATLKEV+ +I K +KT KRKR
Sbjct  584   NEYNPSGRYTVFELWNFKEGRKATLKEVIQYILKNMKTLKRKR  626



>ref|XP_008454606.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Cucumis melo]
 ref|XP_008454607.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Cucumis melo]
Length=633

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/618 (57%), Positives = 465/618 (75%), Gaps = 7/618 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  17    INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  76

Query  1934  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G+++N+       
Sbjct  77    KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEKELYVWPWMGVILNIEAGEDRN  136

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
             T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE   H
Sbjct  137   TVCDSA-YWIKKFAKYRPLDVYIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFETNDH  195

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+ W  +  S S  +YGW A+ DDY +   +G +LR+  +L+T++D++ E  R ++ ++
Sbjct  196   SKRNWKTKTDS-SLDIYGWCARADDYNSNEPIGEFLRQRGKLRTVSDIVNEATRSRNTVV  254

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
              NLT+E+DL NENL  L  ++NEK +SLSRM+ EKD LH+AF EE+RK QRLAR +VQR+
Sbjct  255   ENLTHEIDLTNENLDELHYKYNEKTMSLSRMLAEKDQLHQAFVEETRKTQRLARNNVQRI  314

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LDSW+++LNKRE LTE E+ KLDEEKK+ND RN+SL++AS EQ
Sbjct  315   LEEQENLHQELEAKKKKLDSWSKQLNKREALTELERQKLDEEKKKNDMRNNSLQLASMEQ  374

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             ++ADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEIQELKGKL VM+H+   DD
Sbjct  375   RRADENVLRLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIQELKGKLQVMKHLEDQDD  434

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
               VQ+K+KEM + LD+K+ED+ DL E+N  LV KER+SNDELQEARK LI GL D  ++ 
Sbjct  435   EGVQQKMKEMGDDLDQKVEDLNDLQELNRTLVTKERESNDELQEARKELISGLQDQSSNA  494

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R +IGI+RMG+ID K F N CKQ+FS +EA V+A  LCSLWQ+ + DPNWHPF+V+ I  
Sbjct  495   RVNIGIKRMGDIDIKPFQNTCKQKFSPDEAMVQASTLCSLWQDNLTDPNWHPFKVVTIDG  554

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
               ++ I+EDDE+L  LK+EWG+EI  AV+ A++E+NEYN SGRY +PELWNFKE RKATL
Sbjct  555   DSQENIDEDDEKLKGLKQEWGDEIYNAVVTALKEMNEYNPSGRYSVPELWNFKEDRKATL  614

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEV+++I K +K+ KRKR
Sbjct  615   KEVINYIVKSIKSLKRKR  632



>ref|XP_008454609.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X2 [Cucumis melo]
Length=632

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/618 (57%), Positives = 465/618 (75%), Gaps = 7/618 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16    INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  1934  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G+++N+       
Sbjct  76    KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEKELYVWPWMGVILNIEAGEDRN  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
             T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE   H
Sbjct  136   TVCDSA-YWIKKFAKYRPLDVYIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFETNDH  194

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+ W   ++  S  +YGW A+ DDY +   +G +LR+  +L+T++D++ E  R ++ ++
Sbjct  195   SKRNWKT-KTDSSLDIYGWCARADDYNSNEPIGEFLRQRGKLRTVSDIVNEATRSRNTVV  253

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
              NLT+E+DL NENL  L  ++NEK +SLSRM+ EKD LH+AF EE+RK QRLAR +VQR+
Sbjct  254   ENLTHEIDLTNENLDELHYKYNEKTMSLSRMLAEKDQLHQAFVEETRKTQRLARNNVQRI  313

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LDSW+++LNKRE LTE E+ KLDEEKK+ND RN+SL++AS EQ
Sbjct  314   LEEQENLHQELEAKKKKLDSWSKQLNKREALTELERQKLDEEKKKNDMRNNSLQLASMEQ  373

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             ++ADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEIQELKGKL VM+H+   DD
Sbjct  374   RRADENVLRLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIQELKGKLQVMKHLEDQDD  433

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
               VQ+K+KEM + LD+K+ED+ DL E+N  LV KER+SNDELQEARK LI GL D  ++ 
Sbjct  434   EGVQQKMKEMGDDLDQKVEDLNDLQELNRTLVTKERESNDELQEARKELISGLQDQSSNA  493

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R +IGI+RMG+ID K F N CKQ+FS +EA V+A  LCSLWQ+ + DPNWHPF+V+ I  
Sbjct  494   RVNIGIKRMGDIDIKPFQNTCKQKFSPDEAMVQASTLCSLWQDNLTDPNWHPFKVVTIDG  553

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
               ++ I+EDDE+L  LK+EWG+EI  AV+ A++E+NEYN SGRY +PELWNFKE RKATL
Sbjct  554   DSQENIDEDDEKLKGLKQEWGDEIYNAVVTALKEMNEYNPSGRYSVPELWNFKEDRKATL  613

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEV+++I K +K+ KRKR
Sbjct  614   KEVINYIVKSIKSLKRKR  631



>ref|XP_008461480.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Cucumis melo]
 ref|XP_008461481.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Cucumis melo]
Length=632

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/619 (58%), Positives = 464/619 (75%), Gaps = 9/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16    INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN------LYCWPWTGIVVNVSKDNAN  1773
             KQKANH+ALAKYLE +L  +A+   QR   P  ++      LY WPW G++VN+      
Sbjct  76    KQKANHLALAKYLENELASEADQ-TQRPTPPTPSSQDSEKELYVWPWMGVIVNIEVGEDR  134

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
              T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE   
Sbjct  135   NTVCDSA-YWIKKFAKYRPLDVFIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFETND  193

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             HSK+ W  +  S S  +YGW A+ DDY +   +G +LR+  +L+T++D++ E  R ++ +
Sbjct  194   HSKRNWKTKTDS-SLDIYGWCARADDYNSNEPIGEFLRQRGKLRTVSDIVNEATRSRNTV  252

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             + NLT+E+DL NENL  L  ++NEK +SLSRM+ EKD LH+AF EE+RK QRLAR +VQR
Sbjct  253   VENLTHEIDLTNENLDELHYKYNEKTMSLSRMLAEKDQLHQAFVEETRKTQRLARNNVQR  312

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE L+ ELE KKK+LDSW+++LNKRE LTE E+ KLDEEKK+ND RN+SL++AS E
Sbjct  313   ILEEQENLHQELEAKKKKLDSWSKQLNKREALTELERQKLDEEKKKNDMRNNSLQLASME  372

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q++ADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEIQELKGKL VM+H+   D
Sbjct  373   QRRADENVLRLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIQELKGKLQVMKHLEDQD  432

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D  VQ+K+KEM + LD+K+ED+ DL E+N  LV KER+SNDELQEARK LI GL D  ++
Sbjct  433   DEGVQQKMKEMGDDLDQKVEDLNDLQELNRTLVTKERESNDELQEARKELISGLQDQSSN  492

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              R +IGI+RMG+ID K F N CKQ+FS +EA V+A  LCSLWQ+ + DPNWHPF+V+ I 
Sbjct  493   ARVNIGIKRMGDIDIKPFQNTCKQKFSPDEAMVQASTLCSLWQDNLTDPNWHPFKVVTID  552

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
                ++ I+EDDE+L  LK+EWG+EI  AV+ A++E+NEYN SGRY +PELWNFKE RKAT
Sbjct  553   GDSQENIDEDDEKLKGLKQEWGDEIYNAVVTALKEMNEYNPSGRYSVPELWNFKEDRKAT  612

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+++I K +K+ KRKR
Sbjct  613   LKEVINYIVKSIKSLKRKR  631



>emb|CBI40115.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/613 (59%), Positives = 461/613 (75%), Gaps = 49/613 (8%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EYKEKPYE+L++GKYKVKG NG LRCPFCAGKKKQDY+YKDLLQHA+GV KGSANRS 
Sbjct  16    IVEYKEKPYEQLKTGKYKVKGTNGTLRCPFCAGKKKQDYRYKDLLQHASGVAKGSANRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEE  1755
             KQK NH+ALAKYLE DL  +++  P RAV P+       P T                E+
Sbjct  76    KQKVNHLALAKYLETDLASESDQAP-RAVEPK-------PVT-------------RTQEQ  114

Query  1754  EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEW  1575
             +D ++                             +DW G+ NA  FE AFEA+ HSKKEW
Sbjct  115   DDLFV---------------------------FNNDWTGFMNATAFEKAFEADRHSKKEW  147

Query  1574  TAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTN  1395
               ++  P S++YGW A+ DDY +EG VG YLR T +LKTI+D+++  K+D++ I++NL N
Sbjct  148   NVQKQHPGSNIYGWVARADDYSSEGPVGEYLRNTGELKTISDIVEAAKQDRNTIVANLAN  207

Query  1394  ELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQE  1215
             E+DLKNENL  L  ++NEK++SLSRM+EEKD LH AFYEE+RKMQRLAR+HV+R+L EQE
Sbjct  208   EIDLKNENLDELQYKYNEKSMSLSRMLEEKDKLHHAFYEETRKMQRLARDHVRRILEEQE  267

Query  1214  TLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADE  1035
              LN EL+ K+K+LDSW +ELNKRE LTEREK KLD+EKK+N+ERN+SL+MAS EQKKADE
Sbjct  268   KLNYELDSKRKELDSWCKELNKREALTEREKQKLDDEKKKNNERNNSLQMASIEQKKADE  327

Query  1034  NVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQE  855
             NVL+L+EE KREKE AL KIL+LEK +DAKQKLEMEI+E+KGKL VM+H+G +DD+AVQ 
Sbjct  328   NVLKLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIEEIKGKLQVMKHLGDEDDTAVQN  387

Query  854   KIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIG  675
             K+KEM E L+EK+ +M++L+ +N  L++KERQSNDELQ AR  LI GL D+L SGR++IG
Sbjct  388   KMKEMNEDLEEKVGEMENLESLNQTLIVKERQSNDELQAARTELITGLKDML-SGRTNIG  446

Query  674   IRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQI  495
             ++RMGEI+ K F    KQRFS EEA+V+A  L SLWQE +K P WHPF+++ +  +  +I
Sbjct  447   LKRMGEIEEKPFVKTYKQRFSLEEANVQAYTLVSLWQENLKKPEWHPFKIVEVEGKTLEI  506

Query  494   INeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVS  315
             INE+DE+L KLK+EWG+EI  AV  +++E+NEYN SGRY + ELWNFKEGRKATLKEV+ 
Sbjct  507   INEEDEKLQKLKQEWGDEIYMAVTTSLKEINEYNPSGRYPVIELWNFKEGRKATLKEVIQ  566

Query  314   FIFKQLKTHKRKR  276
             +I K LKT KRKR
Sbjct  567   YILKNLKTLKRKR  579



>ref|XP_010063555.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063556.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063557.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063558.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 ref|XP_010063559.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Eucalyptus 
grandis]
 gb|KCW70793.1| hypothetical protein EUGRSUZ_F03952 [Eucalyptus grandis]
 gb|KCW70794.1| hypothetical protein EUGRSUZ_F03952 [Eucalyptus grandis]
Length=633

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/619 (57%), Positives = 480/619 (78%), Gaps = 8/619 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I ++ +KPY+ELRSGK+KVKGPNG LRCPFC GKKKQDY+YK+L QHA GVGKGSANRS 
Sbjct  16    ILDHVDKPYDELRSGKFKVKGPNGSLRCPFCTGKKKQDYRYKELYQHAAGVGKGSANRSG  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR------AVAPEDNNLYCWPWTGIVVNVSKDNAN  1773
             KQKANH+ALAKYLE DL  +A+  PQ       A  P+ + ++ WPWTG++ N+  D ++
Sbjct  76    KQKANHLALAKYLETDLASEADQPPQPVVPQPSAQTPQQDEVFVWPWTGVIANILVDKSS  135

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
                + +  YWL +F+KY+  EV +F ++  ++++ V++    W G+KNA  FE  FE E 
Sbjct  136   EKELVDSAYWLTKFTKYKPLEVHVFLNEDGQSAKAVVRFNDHWEGFKNATEFEKEFETEN  195

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK W  +++ P S  YGW A+ DDY+A+G VG YLR+T +L+T+ D++QE  +   +I
Sbjct  196   HGKKGWNLQKAEPGSSTYGWRAQSDDYDADGPVGDYLRKTGKLRTVLDIVQEATQSSHRI  255

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +++L N++D  NE L  L +++NEK LSL+RM+EEKD LH AF EE+R+MQRL R+ +Q 
Sbjct  256   VAHLANKIDSTNETLQQLQSKYNEKTLSLTRMLEEKDKLHSAFVEETRRMQRLQRDRIQG  315

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L EQE L++ELEKKK+++DSW++ELNKRE LTERE+ KLDE+KK+ND +NSSL++AS E
Sbjct  316   ILFEQEKLSNELEKKKRKIDSWSKELNKRETLTERERQKLDEDKKKNDVKNSSLQLASME  375

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QK+ADENVLRL+EE KREKE AL KILELE+ +DAKQKLEMEI+ELKGK++VM+H+   D
Sbjct  376   QKRADENVLRLVEEQKREKEEALSKILELERQLDAKQKLEMEIEELKGKVEVMKHLEDQD  435

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D AVQ+K+KEM E+L EK +++ +L+++NN L +KER SNDELQEARK LIQGLS++L +
Sbjct  436   DEAVQKKMKEMNEELKEKKDELTNLEDLNNTLWIKERLSNDELQEARKELIQGLSEVLGA  495

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
               + IGIRRMGE+D K F   CK+RFS +EA ++A +LCSLWQ +V +  WHPFR I I 
Sbjct  496   S-ADIGIRRMGELDDKPFLTACKKRFSAQEAPMQASKLCSLWQSQV-NSQWHPFRTIEID  553

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + + ++ E+D++L KLKEEWG+E+C+AV+ A++E+NEYN SG YV+ ELWNFKE RKAT
Sbjct  554   GKAQAMLVEEDDKLQKLKEEWGDEVCSAVVTALKELNEYNPSGMYVVSELWNFKEKRKAT  613

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV++FI K++KT KRKR
Sbjct  614   LKEVIAFIAKKIKTPKRKR  632



>gb|AES86419.2| XH/XS domain protein [Medicago truncatula]
Length=626

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/612 (57%), Positives = 469/612 (77%), Gaps = 14/612 (2%)
 Frame = -1

Query  2096  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKANH  1917
             KPYEELR+GKYKVK  NG LRCP+C+GKKKQ++KYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  22    KPYEELRAGKYKVKNNNGTLRCPYCSGKKKQEFKYKDLLQHASGVGKGSANRSTKQKANH  81

Query  1916  VALAKYLEIDLGDQAEPLPQRA-----VAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEE  1752
             +ALAK+L  DL ++A+ +P+ A     V P     Y WPWTGI+VN+SK + +G      
Sbjct  82    LALAKFLRTDLANEADQVPRPALTVAVVQPVQVENYVWPWTGILVNISKSHDSG------  135

Query  1751  DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWT  1572
              Y  K F+KY+   V  F  D +  S  VI   +DWNG+ NA   E  FE +   KK+W 
Sbjct  136   -YLQKEFAKYKPLAVHTFLMDGN--SVAVIDFNNDWNGFMNASELEKCFETKRRGKKDWN  192

Query  1571  AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNE  1392
             +     SS +YGW A+ DDY   G +G YLR   +L+TI+D++QE  + ++ I+ NL NE
Sbjct  193   SMDLQDSSEIYGWVAREDDYNCPGLIGEYLRNKGRLRTISDIVQEASQSRNSIVENLANE  252

Query  1391  LDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQET  1212
             +D+ NENL+ +  R+NEK +SLSRM+EEKD LH AF EESR MQR AR+ V+R+L EQE 
Sbjct  253   IDITNENLNKMQYRYNEKTMSLSRMLEEKDKLHSAFVEESRSMQRKARDEVRRILEEQEK  312

Query  1211  LNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADEN  1032
             L++EL++K ++LD+W+R+LNKREVLT++E+ KL+E+KK+ D RN SL++ASKEQK ADEN
Sbjct  313   LSNELDEKMRKLDTWSRDLNKREVLTDQERQKLEEDKKKKDVRNQSLQLASKEQKIADEN  372

Query  1031  VLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEK  852
             V RL+EE KREKE AL KIL+LEK +DAKQKLEMEI+EL+GKL VM+H+G  DD+A+++K
Sbjct  373   VFRLVEEQKREKEEALNKILQLEKQLDAKQKLEMEIEELRGKLQVMKHLGDQDDTAIKKK  432

Query  851   IKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGI  672
             ++EM  +L++KIE ++D++ MN+ L++KERQSNDELQEARK LI+GL+++L   +++IG 
Sbjct  433   MEEMNSELEDKIESLEDMESMNSTLIVKERQSNDELQEARKELIEGLNEMLTGAKTNIGT  492

Query  671   RRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQII  492
             +RMG++D K F N CK+RFS++EA +KA+ELCSLWQE VK+  WHPF+V++ +D P  +I
Sbjct  493   KRMGDLDQKVFVNACKKRFSSDEAGIKAVELCSLWQENVKNSAWHPFKVVSQNDNPVSVI  552

Query  491   NeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSF  312
             +E+DE+L KLK+EWG+EI +AV+ A++EVNEYN SG Y + ELWNFKE RKATLKEV+++
Sbjct  553   DEEDEKLQKLKKEWGDEIYSAVVTALKEVNEYNPSGGYTVWELWNFKENRKATLKEVITY  612

Query  311   IFKQLKTHKRKR  276
             I   +K  KRKR
Sbjct  613   IVDHMKQLKRKR  624



>ref|XP_004139640.1| PREDICTED: uncharacterized protein LOC101205093 [Cucumis sativus]
 ref|XP_004168328.1| PREDICTED: uncharacterized LOC101205093 [Cucumis sativus]
Length=632

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/618 (57%), Positives = 462/618 (75%), Gaps = 7/618 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16    INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  1934  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G++VN+       
Sbjct  76    KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEQELYVWPWMGVIVNIEAGEDRN  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
             T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE   H
Sbjct  136   TVCDSA-YWIKKFAKYRPLDVYIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFETNDH  194

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+ W   ++  S  +YGW A+ DDY +   +G +LR+  +L+T++D++ E  + ++ ++
Sbjct  195   SKRNWKT-KTGSSLDIYGWCARADDYNSNEPIGEFLRQRGKLRTVSDIVNEATQSRNTVV  253

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
              NLT+++DLKNENL  L   +NEK +SLSRM+ EKD LH AF EE+RK QRLAR +VQR+
Sbjct  254   ENLTHKIDLKNENLEELHCEYNEKTMSLSRMLAEKDQLHHAFVEETRKTQRLARNNVQRI  313

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LDSW+++LNKRE LTE E+ KLDEEKK+ND RN+SL++AS EQ
Sbjct  314   LEEQENLHQELEAKKKKLDSWSKQLNKREALTELERQKLDEEKKKNDMRNNSLQLASMEQ  373

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             ++ADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEIQELKGKL VM+H+   DD
Sbjct  374   RRADENVLRLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIQELKGKLQVMKHLEDQDD  433

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
               VQ+K+KEM + LD+K+ED+ DL E+N  LV KER+SNDELQEARK LI GL D  ++ 
Sbjct  434   EGVQQKMKEMGDDLDQKVEDLNDLQELNRTLVTKERESNDELQEARKELISGLQDQSSNA  493

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R +IGI+RMG+ID K F N CK +FS +EA V+A  LCSLWQ+ + DPNWHPF+V+ I  
Sbjct  494   RVNIGIKRMGDIDIKPFQNTCKHKFSPDEAMVQASTLCSLWQDNLTDPNWHPFKVVTIDG  553

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
               ++ I+EDDE+L  LK+EWG EI  AV+ A++E+NEYN SGRY +PELWNFKE RKATL
Sbjct  554   DSQENIDEDDEKLKGLKQEWGGEIYNAVVTALKEMNEYNPSGRYSVPELWNFKEDRKATL  613

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEV+++I K +K+ KRKR
Sbjct  614   KEVINYIVKSIKSLKRKR  631



>ref|XP_003604222.1| hypothetical protein MTR_4g006760 [Medicago truncatula]
Length=657

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/612 (57%), Positives = 469/612 (77%), Gaps = 14/612 (2%)
 Frame = -1

Query  2096  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKANH  1917
             KPYEELR+GKYKVK  NG LRCP+C+GKKKQ++KYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  53    KPYEELRAGKYKVKNNNGTLRCPYCSGKKKQEFKYKDLLQHASGVGKGSANRSTKQKANH  112

Query  1916  VALAKYLEIDLGDQAEPLPQRA-----VAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEE  1752
             +ALAK+L  DL ++A+ +P+ A     V P     Y WPWTGI+VN+SK + +G      
Sbjct  113   LALAKFLRTDLANEADQVPRPALTVAVVQPVQVENYVWPWTGILVNISKSHDSG------  166

Query  1751  DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWT  1572
              Y  K F+KY+   V  F  D +  S  VI   +DWNG+ NA   E  FE +   KK+W 
Sbjct  167   -YLQKEFAKYKPLAVHTFLMDGN--SVAVIDFNNDWNGFMNASELEKCFETKRRGKKDWN  223

Query  1571  AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNE  1392
             +     SS +YGW A+ DDY   G +G YLR   +L+TI+D++QE  + ++ I+ NL NE
Sbjct  224   SMDLQDSSEIYGWVAREDDYNCPGLIGEYLRNKGRLRTISDIVQEASQSRNSIVENLANE  283

Query  1391  LDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQET  1212
             +D+ NENL+ +  R+NEK +SLSRM+EEKD LH AF EESR MQR AR+ V+R+L EQE 
Sbjct  284   IDITNENLNKMQYRYNEKTMSLSRMLEEKDKLHSAFVEESRSMQRKARDEVRRILEEQEK  343

Query  1211  LNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADEN  1032
             L++EL++K ++LD+W+R+LNKREVLT++E+ KL+E+KK+ D RN SL++ASKEQK ADEN
Sbjct  344   LSNELDEKMRKLDTWSRDLNKREVLTDQERQKLEEDKKKKDVRNQSLQLASKEQKIADEN  403

Query  1031  VLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEK  852
             V RL+EE KREKE AL KIL+LEK +DAKQKLEMEI+EL+GKL VM+H+G  DD+A+++K
Sbjct  404   VFRLVEEQKREKEEALNKILQLEKQLDAKQKLEMEIEELRGKLQVMKHLGDQDDTAIKKK  463

Query  851   IKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGI  672
             ++EM  +L++KIE ++D++ MN+ L++KERQSNDELQEARK LI+GL+++L   +++IG 
Sbjct  464   MEEMNSELEDKIESLEDMESMNSTLIVKERQSNDELQEARKELIEGLNEMLTGAKTNIGT  523

Query  671   RRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQII  492
             +RMG++D K F N CK+RFS++EA +KA+ELCSLWQE VK+  WHPF+V++ +D P  +I
Sbjct  524   KRMGDLDQKVFVNACKKRFSSDEAGIKAVELCSLWQENVKNSAWHPFKVVSQNDNPVSVI  583

Query  491   NeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSF  312
             +E+DE+L KLK+EWG+EI +AV+ A++EVNEYN SG Y + ELWNFKE RKATLKEV+++
Sbjct  584   DEEDEKLQKLKKEWGDEIYSAVVTALKEVNEYNPSGGYTVWELWNFKENRKATLKEVITY  643

Query  311   IFKQLKTHKRKR  276
             I   +K  KRKR
Sbjct  644   IVDHMKQLKRKR  655



>ref|XP_003610367.1| hypothetical protein MTR_4g131350 [Medicago truncatula]
 gb|AES92564.1| XH/XS domain protein [Medicago truncatula]
Length=682

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/619 (57%), Positives = 471/619 (76%), Gaps = 18/619 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y +KPY+EL+ GKYKVK  NG LRCP+CAGKKKQ++KYKDL+QHATGV KGSANR+ KQK
Sbjct  72    YSDKPYKELKDGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLMQHATGVSKGSANRNAKQK  131

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNVSKDNANGT  1767
             ANH+ALAKYLE DL ++A+ +P  A+A       P+  N Y WPWTGI+VN+ K N N +
Sbjct  132   ANHLALAKYLETDLVNEADQIPPPALAEAVNQPVPQVEN-YVWPWTGIIVNI-KSNFNDS  189

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
                   YWLK F+KY   +V +F  D    +Q V+   +DWNG+ NA  FE +FE + H 
Sbjct  190   G-----YWLKEFAKYRPLDVHVFFMDGD--TQAVVDFNNDWNGFMNASEFEKSFETKHHG  242

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             KK+W ++    SS +YGW A+ DDY   G +G YLR   +L+T++D++QE    ++ I+ 
Sbjct  243   KKDWNSKDMQASSDIYGWVAREDDYNCGGPIGEYLRNKGRLRTVSDIVQEASESRNSIVE  302

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             NL NE+D+ NENL+ +  ++NEK +SLSRM+EEKD LH AF EESR MQR ARE V+R+L
Sbjct  303   NLANEIDITNENLNKMQYKYNEKTMSLSRMLEEKDRLHNAFVEESRSMQRKAREEVRRIL  362

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              EQE L +EL++K ++LD+W+R+LNKREVLT++E+ KL+E+KK+ D RN SL +ASKEQK
Sbjct  363   EEQEKLRNELDEKMRKLDTWSRDLNKREVLTDQERQKLEEDKKKKDSRNESLLLASKEQK  422

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
              ADENV RL+EE KREKE AL KIL+LEK +DAKQKLEMEI+ELKGKL VM+H+G  DD 
Sbjct  423   IADENVFRLVEEQKREKEEALNKILQLEKQLDAKQKLEMEIEELKGKLQVMKHLGDQDDE  482

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS-G  690
             A+++K++EM  +L +KIE ++D++ MN  L++KERQSNDELQEARK LI+GL+++L    
Sbjct  483   AIKKKMEEMSTELADKIESLEDMESMNQTLIVKERQSNDELQEARKELIKGLNEMLTGIN  542

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRF-STEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             +++IG +RMG++D K F  VCK+RF S EEA +KA+ELCS+WQE VK+  WHPF+V+ ++
Sbjct  543   KTNIGTKRMGDLDEKVFVQVCKKRFVSQEEAGMKAMELCSVWQENVKNSAWHPFKVVRVN  602

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
             D  E +INE+DE+L KLK+EWG+EI +AV  A++EVNEYN SG Y + ELWNFKE RKAT
Sbjct  603   DTHESVINEEDEKLKKLKQEWGDEIYSAVETALKEVNEYNPSGGYSVHELWNFKEQRKAT  662

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+++I + +K  KRKR
Sbjct  663   LKEVITYIVEHMKQLKRKR  681



>ref|XP_002303841.1| XH domain-containing family protein [Populus trichocarpa]
 gb|EEE78820.1| XH domain-containing family protein [Populus trichocarpa]
Length=626

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/616 (57%), Positives = 469/616 (76%), Gaps = 16/616 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             YK+KP E+LRSG  +VK  NG LRCPFCAGKKKQDYKYKDLLQHATGV KGSA+RS KQK
Sbjct  19    YKDKPLEDLRSGNLRVK-VNGFLRCPFCAGKKKQDYKYKDLLQHATGVSKGSASRSGKQK  77

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANGTA  1764
             ANH+ALA+YLEI+L ++AE  P++ V       PE   L+ WPW GI+VN+++   N   
Sbjct  78    ANHLALARYLEIELANEAEQTPRQVVPQPIKPPPEQQELFVWPWMGILVNLTEQRDN---  134

Query  1763  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSK  1584
                 +YW+K+F++Y+  E   F +++  ++Q +++   DW+G+ NA  FE  F+   H K
Sbjct  135   ----EYWMKKFAEYKPLEFCTFLNEEDHSTQAIVRFNRDWDGFMNATRFEQLFDNANHGK  190

Query  1583  KEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSN  1404
             K+W   ++ P S +YGW A+ DD++++G +G YLR   +L TI  ++QE    ++ ++++
Sbjct  191   KDWKTRKTQPGSSIYGWRARADDHDSDGPIGEYLRREGRLNTIPAIVQESNESRNTVVAH  250

Query  1403  LTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLH  1224
             L +++D  N+NL  L   FNEKN+SL RM+EEKD LH AF EE+RKMQR ARE+V RVL 
Sbjct  251   LADKIDEANKNLDKLHYNFNEKNMSLRRMLEEKDKLHYAFVEETRKMQRHARENVHRVLA  310

Query  1223  EQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKK  1044
             EQE LN ELE KKK+LD W++ELNKRE +TERE+ KLD+EKK+ND RNSSL++AS EQ+K
Sbjct  311   EQEKLNDELESKKKKLDFWSKELNKRETVTERERQKLDDEKKKNDTRNSSLQLASMEQRK  370

Query  1043  ADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSA  864
             ADENVLRL+EE KREKE AL+KIL+LEK +DAKQKLEMEIQE+KGKL VM+H+G  DD+A
Sbjct  371   ADENVLRLVEEQKREKEEALKKILQLEKQLDAKQKLEMEIQEIKGKLLVMKHLGDQDDAA  430

Query  863   VQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS  684
             VQ+K++EMK++L +K +D  D++ +N  L++KERQSNDELQ+ARK LI GL D+L + R+
Sbjct  431   VQKKVEEMKDELSQKEDDFTDMESLNQTLIIKERQSNDELQQARKNLIVGLGDMLGA-RT  489

Query  683   HIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRP  504
              IG++RMGEID K FHN CK+RF  E+  + A   CSLWQEK+K+P WHPF+VI++    
Sbjct  490   LIGLKRMGEIDEKPFHNACKERFP-EDPLLHASTQCSLWQEKLKNPAWHPFKVIDVDGNA  548

Query  503   EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKE  324
             +QI+NE+DEEL  LK+EWG+EI  AV+ A+ E+ EYN SGRYV+ ELWNFKEGRKATLKE
Sbjct  549   KQILNEEDEELRNLKKEWGDEIYTAVVTALNELEEYNPSGRYVVSELWNFKEGRKATLKE  608

Query  323   VVSFIFKQLKTHKRKR  276
             V+++I K + T KRK+
Sbjct  609   VIAYIVKNINTLKRKK  624



>gb|KEH32486.1| XH/XS domain protein [Medicago truncatula]
Length=629

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/620 (57%), Positives = 468/620 (75%), Gaps = 20/620 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y +KPY+EL+ GKYKVK  NG LRCP+CAGKKKQ++KYKDL+QHATGV KGSANR+ KQK
Sbjct  19    YSDKPYKELKDGKYKVKNLNGTLRCPYCAGKKKQEFKYKDLMQHATGVSKGSANRNAKQK  78

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAV-------APEDNNLYCWPWTGIVVNV-SKDNANG  1770
             ANH+ALAK+LE DL ++A+ +P   +       AP+  N Y WPWTGI+VN+ SK N +G
Sbjct  79    ANHLALAKFLETDLANEADQIPPPPLTEAVNQPAPQVEN-YVWPWTGIIVNIKSKLNDSG  137

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
                    YWLK F+KY   +V +F  D    +Q V+   +DWNG+ NA  FE +FE + H
Sbjct  138   -------YWLKEFAKYRPLDVHVFFMDGD--TQAVVDFNNDWNGFMNASEFEKSFETKHH  188

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
              KK+W ++    SS +YGW A+ DDY   G +G YLR   +L+TI+D++QE    ++ I+
Sbjct  189   GKKDWNSKDMQASSDIYGWVAREDDYNCGGPIGEYLRNKGRLRTISDIVQEASESRNSIV  248

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
              NL NE+D+ NENL+ +  ++NEK +SLSRM+EEKD LH AF EESR MQR ARE V+R+
Sbjct  249   ENLANEIDITNENLNKMQYKYNEKTMSLSRMLEEKDRLHNAFVEESRSMQRKAREEVRRI  308

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L +EL++K ++LD+W+R+LNKREVLT++E+ KL+E+KK+ D RN SL +ASKEQ
Sbjct  309   LEEQEKLRNELDEKMRKLDTWSRDLNKREVLTDQERQKLEEDKKKKDSRNESLLLASKEQ  368

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             K ADENV RL+EE KREKE AL KIL+LEK +DAKQKLEMEI+ELKGKL VM+H+G  DD
Sbjct  369   KIADENVFRLVEEQKREKEEALNKILQLEKQLDAKQKLEMEIEELKGKLQVMKHLGDQDD  428

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN-S  693
              AV++K++EM  +L +KIE ++D++ MN  L+ KERQSNDELQEARK LI GL+++L  +
Sbjct  429   EAVKKKMEEMSTELADKIESLEDMESMNQTLIDKERQSNDELQEARKELIAGLNEMLTGN  488

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRF-STEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
              +++IG +RMG++D K F NVCK+RF S EEA +KA+ELCS WQE VK+  WHPF+V+  
Sbjct  489   NKTNIGTKRMGDLDQKVFVNVCKKRFLSEEEAGMKAMELCSFWQENVKNSAWHPFKVVRE  548

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
             +D    ++NE+DE+L KLK+EWG+EI +AV  A++EVNEYN SG Y + ELWNFKE RKA
Sbjct  549   NDSHVSVMNEEDEKLKKLKQEWGDEIYSAVETALKEVNEYNPSGGYAVYELWNFKEQRKA  608

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEV+++I + +K  KRKR
Sbjct  609   TLKEVITYIVEHMKQLKRKR  628



>ref|XP_010092186.1| hypothetical protein L484_013504 [Morus notabilis]
 gb|EXB50412.1| hypothetical protein L484_013504 [Morus notabilis]
Length=632

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/618 (56%), Positives = 468/618 (76%), Gaps = 11/618 (2%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             +Y EKPY +LR G YKVKG NG L+CPFCAGKKKQDYK+KDLLQHA+GV KGSANRS KQ
Sbjct  18    DYAEKPYGQLRDGTYKVKGANGTLKCPFCAGKKKQDYKFKDLLQHASGVSKGSANRSAKQ  77

Query  1928  KANHVALAKYLEIDL-GDQAE---PLPQRAVA--PEDNNLYCWPWTGIVVNVSKDNANGT  1767
             KANH+ALAKYLE +L G+ A+   P+  R V    E +N Y WPWTGI+VN+     +G 
Sbjct  78    KANHLALAKYLEAELAGEVAQTELPVVSRPVLQHTEQDNRYVWPWTGIIVNIVGGGNDGL  137

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
             +     +WL +FSK +   V+ F + K RTS+ +++ + DWNG+ NA  FE   E +   
Sbjct  138   SFPNSSHWLTKFSKCKPSSVQTFWNGKDRTSEAIVEFEGDWNGFMNATQFEKILENDGRG  197

Query  1586  KKEWT-AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             KK W         S++YGW A+ DDY ++G +G YLR+  QL+TI+D+ +E  ++++ ++
Sbjct  198   KKSWMDVPEMRRGSNIYGWCARADDYNSQGLIGEYLRQKGQLRTISDIDREAAQNRNTVV  257

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             ++L  ++D+ NENL  L  ++NEK +S+SR++EEK++LH AF EE+RKMQR+ARE+V++V
Sbjct  258   AHLATKIDMTNENLDELQYKYNEKTMSMSRILEEKESLHLAFIEETRKMQRIARENVEKV  317

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L++ELE+KKK++DSW++ELNKRE  TERE+ +LDEEK++N+  NSSLE+AS EQ
Sbjct  318   LAEQEKLSNELERKKKKIDSWSKELNKREAQTERERTQLDEEKQKNNVINSSLELASMEQ  377

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             K+ADEN  RL+EE KREKE AL K+L+LEK +DAKQKLEMEI+ELKGKL VMEH+G DD+
Sbjct  378   KRADENFCRLVEEQKREKEEALNKVLQLEKQLDAKQKLEMEIEELKGKLQVMEHLGKDDE  437

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
              AVQ K+KEM ++L EKI++M DL+ +N  L+ KER++NDELQEARK LI   +DLL + 
Sbjct  438   -AVQAKMKEMNDELKEKIDNMDDLESLNQTLLTKERETNDELQEARKALIAA-TDLL-TA  494

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             ++HIGI+RMG++D K F  VC++R S EE +++   LCSLW EK+KDP+WHP +V+ I+ 
Sbjct  495   KTHIGIKRMGDLDEKPFIKVCRER-SLEEPELQGSTLCSLWAEKLKDPSWHPLKVVTING  553

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
               +++I+E+DE+L  L+EEWG+EI  AV+ A +E+NEYN SGRY + ELWNFKEGRKATL
Sbjct  554   NHQEVIDEEDEQLRNLREEWGDEIYTAVVTAFKEINEYNPSGRYTVLELWNFKEGRKATL  613

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEV++F    +K  KRKR
Sbjct  614   KEVIAFALMNMKQLKRKR  631



>ref|XP_010101455.1| hypothetical protein L484_012877 [Morus notabilis]
 gb|EXB88438.1| hypothetical protein L484_012877 [Morus notabilis]
Length=632

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/617 (54%), Positives = 459/617 (74%), Gaps = 11/617 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y EKPY +LR G YKVKG NG LRCPFCAGKKKQDYK+KDLLQHA+GV KGSANRS KQK
Sbjct  19    YAEKPYGQLRGGTYKVKGANGTLRCPFCAGKKKQDYKFKDLLQHASGVSKGSANRSAKQK  78

Query  1925  ANHVALAKYLEIDLGDQAE----PLPQRAVA--PEDNNLYCWPWTGIVVNVSKDNANGTA  1764
             ANH+ALAKYL+ +L  +      P   R V    E +N Y WPWTGI+VN+     +G +
Sbjct  79    ANHLALAKYLDAELAGEVARTELPAISRPVLQHTEQDNQYVWPWTGIIVNIVGGGNDGLS  138

Query  1763  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSK  1584
               +  +WL +FSK +   V+ F + K RTS+ +++ + DWNG+ NA  FE   E     K
Sbjct  139   FPDSSHWLTKFSKCKPSRVQTFWNGKDRTSEAIVEFEGDWNGFMNATQFEKILENYGRGK  198

Query  1583  KEWT-AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             K W     +   S++YGW A+ DDY ++  +G YLR+  QL+TI+D+ +E  +++  +++
Sbjct  199   KSWMDVPETRRGSNIYGWCARADDYNSQRPIGEYLRQKGQLRTISDIDREAAQNRYTVVA  258

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             +L   +D+ N+NL  L  ++ EK +S+SR++EEK++LH AF EE+RKMQR+ARE+ ++VL
Sbjct  259   HLATRIDMTNKNLDKLQYKYIEKTVSMSRILEEKESLHLAFIEETRKMQRIARENFEKVL  318

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              EQE L+++LE+KKK++DSW++ELNKRE  TERE+ +LDEEK++N+  NSSLE+AS EQK
Sbjct  319   AEQEKLSNDLERKKKKIDSWSKELNKREAQTERERTQLDEEKQKNNVINSSLELASMEQK  378

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             +ADEN  RL+EE KREKE AL K+L+LEK +DAKQKLEMEI+ELKGKL VMEH+G DD+ 
Sbjct  379   RADENFCRLVEEQKREKEEALNKVLQLEKQLDAKQKLEMEIEELKGKLQVMEHLGKDDE-  437

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
             AVQ K+KEM ++L EKI++M DL+ +N  L+ KER++NDELQEARK LI   +DLL + +
Sbjct  438   AVQAKMKEMNDELKEKIDNMDDLESLNQTLLTKERETNDELQEARKALIAA-TDLL-TAK  495

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDR  507
             +HIGI+RMG++D K F  VC++R S EE +++   LCSLW EK+KDP+WHP +V+ I+  
Sbjct  496   THIGIKRMGDLDEKPFIKVCRER-SLEEPELQGSTLCSLWTEKLKDPSWHPLKVVTINGN  554

Query  506   PEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLK  327
              +++I+E+DE+L  L+EEWG+EI  AV+ A +E+NEYN SGRY + ELWNFKEGRKATLK
Sbjct  555   HQEVIDEEDEQLRNLREEWGDEIYTAVVTAFKEINEYNPSGRYTVLELWNFKEGRKATLK  614

Query  326   EVVSFIFKQLKTHKRKR  276
             EV++F    +K  KRKR
Sbjct  615   EVIAFALMNMKQLKRKR  631



>ref|XP_009793120.1| PREDICTED: protein GRIP-like isoform X2 [Nicotiana sylvestris]
Length=501

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/470 (67%), Positives = 394/470 (84%), Gaps = 5/470 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I E+KEKPYEELR+GK +VKGPNG LRCPFCAGKKKQDYKYKDLLQHATGVGKGSANR  
Sbjct  30    IYEFKEKPYEELRTGKLRVKGPNGSLRCPFCAGKKKQDYKYKDLLQHATGVGKGSANRRA  89

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-----DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYL+ DL ++A+P+P RAV PE        L+CWPWTG+VVN+SK+ ANG
Sbjct  90    KQKANHLALAKYLQTDLVNEADPIPARAVTPERSEPEKTELFCWPWTGVVVNISKEAANG  149

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              ++++++YWL++FS Y   EVK F D+++R S+ +++  SDW G+K+A+ FE +FEA   
Sbjct  150   RSLDDKEYWLRKFSIYMPSEVKFFYDNQARVSEAIVRFNSDWTGFKSAMEFEKSFEASHC  209

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+EW A+RS P  ++YGW A+ DDY AEGA+G YLRE  +LKTI+DL+ EE  DK K++
Sbjct  210   SKQEWKADRSCPGPNIYGWVAREDDYIAEGAIGEYLREKGKLKTISDLINEETHDKKKVV  269

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             +NL NE+D+KNENL  L TRFN   LSLS+M+EEKD LHRAF+EESRKMQRLAREHVQ+V
Sbjct  270   ANLANEIDMKNENLDKLQTRFNLNTLSLSQMLEEKDMLHRAFFEESRKMQRLAREHVQKV  329

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LD+W+RELNKRE LTEREK KLD+EKK+NDERNS+L+MAS EQ
Sbjct  330   LLEQEMLSVELESKKKKLDAWSRELNKREALTEREKQKLDDEKKQNDERNSALQMASAEQ  389

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADENVLRL+EE KREKE AL+KILELE++IDA+QKLEMEI ELKGKL+VM+H+GG+DD
Sbjct  390   RKADENVLRLVEEQKREKEEALRKILELEREIDARQKLEMEIAELKGKLEVMKHLGGNDD  449

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             +AVQ KIKEM E+L +K+E+M D++ +N  L+ KERQSNDELQ+AR+ LI
Sbjct  450   AAVQNKIKEMNEELKQKMEEMDDMESLNQTLLAKERQSNDELQDARRTLI  499



>gb|KDO42997.1| hypothetical protein CISIN_1g006762mg [Citrus sinensis]
Length=557

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/540 (58%), Positives = 425/540 (79%), Gaps = 10/540 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             INEY EKPYEELR+GKYKV+  NG LRCPFC+GKKKQDYK+KDLLQHA+GVGKGSANRS 
Sbjct  16    INEYLEKPYEELRAGKYKVR-VNGTLRCPFCSGKKKQDYKHKDLLQHASGVGKGSANRSA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+ALAKYLE+DL    +  PQR V P       E  +LY WPW GI+VN+  +  
Sbjct  75    KQKANHLALAKYLEVDLAGGVDK-PQRPVLPQPVNQNPEQEDLYVWPWMGIIVNIVMETK  133

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             +  +  +  YWLKRF+ ++  EV+IF ++++ T+Q V+K  +DWNG+  A  FE AF+A+
Sbjct  134   DRGSFLDSGYWLKRFAVFKPVEVRIFWNEENPTAQAVVKFNNDWNGFMQASDFEKAFDAD  193

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                K+ W A + SP   +YGWFA+ DD  +EG +G YLR+  +L+T++D++QE+ + K  
Sbjct  194   HQGKRHWIARKESPGLRIYGWFARADDNTSEGPIGEYLRQEGKLRTVSDIVQEDAQSKIH  253

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++++L +++D+KNE+LS L  +FNE  +SLSRM+EEKD LH AF EE+RKMQRLAR++V+
Sbjct  254   VVAHLASKIDMKNEDLSELQCKFNETTMSLSRMLEEKDRLHYAFVEETRKMQRLARDNVR  313

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L EQE L+ ELE KKK+LDSW+++LNKRE LTERE+ KLD ++++ND RN+SL++AS 
Sbjct  314   RILEEQEKLSCELETKKKKLDSWSKQLNKREALTERERQKLDADRQQNDLRNNSLQLASM  373

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEI++LKGKL+VM+H+G +
Sbjct  374   EQKKADENVLRLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIEDLKGKLEVMKHLGDE  433

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD+AVQ+K+KEM ++L+ KI+D+ +++ +N  L+ KERQSNDELQEAR+ LIQGLSDL+ 
Sbjct  434   DDAAVQKKMKEMNDELESKIDDLDEMESLNKTLIAKERQSNDELQEARRELIQGLSDLIG  493

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             + R++IG++R+GEID K F + CK +F  EEA V+A  LCSLWQE +K   WHPF++I++
Sbjct  494   A-RTNIGVKRLGEIDPKPFQDACKNKFPLEEAQVEASTLCSLWQENLKATEWHPFKIIHV  552



>ref|XP_010265641.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265643.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265644.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265645.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Nelumbo 
nucifera]
Length=633

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/621 (52%), Positives = 461/621 (74%), Gaps = 11/621 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16    INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  1779
             KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76    KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               G A    ++  K  SKY    V+     +  T   ++    +W G+++A+ FE  FE 
Sbjct  134   EEGRASGSANWLAKELSKYRPLSVQTSWSQQDHTMFAIVDFGKEWTGFRDAMEFEKDFET  193

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             + H KKEW+ +R    S++YGWFA+VDDY +EG +G YLR   +LKTI+ ++QE+ + ++
Sbjct  194   DHHGKKEWSEQRMHHGSNIYGWFARVDDYNSEGPIGDYLRNQGELKTISSIVQEKTQQEN  253

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              ++++LTN LD+ NEN+  L ++ NEK++SLSR++EEK+ LH+ + EE RK+ R+AR H 
Sbjct  254   SMVASLTNVLDVTNENIDELQSKCNEKSMSLSRLVEEKERLHQEYNEERRKLYRIARNHT  313

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             +R++ E + L   L+ ++K L+   +EL K E L ERE+  LDEE ++N  +N+ L+MAS
Sbjct  314   RRIIEESDKLRDSLDYRRKNLEQRQKELAKLEALNERERKGLDEEMQKNAVKNNLLQMAS  373

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQKKADENVLRL+EE KREKEAA+ K+L+LEK +DAKQKLE+EI ELKGKL VM+HM G
Sbjct  374   MEQKKADENVLRLMEEQKREKEAAMNKLLQLEKQLDAKQKLELEIAELKGKLQVMKHMEG  433

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             +DD  +Q+K+KEM ++L+EK+E+M +++++N  L+ KER SNDELQEAR+ LI GL+D+L
Sbjct  434   EDDIGIQKKLKEMADELEEKMEEMVNMEDLNQTLIAKERASNDELQEARQELISGLTDIL  493

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
              +GR++IGI+RMGE+D K F    K+R  +++A++++ +LCSLWQE +++P+WHPF+++ 
Sbjct  494   -AGRTNIGIKRMGELDEKPFQVAFKKRLPSDKAEMESTKLCSLWQEYLREPSWHPFKIVE  552

Query  518   IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  339
                +  +II+E+DE+L  L+E++G EI  AV+ A+ E+NEYN SGRY +PELWNFKEGRK
Sbjct  553   SEGQATEIIDEEDEKLKVLREKFGNEIYEAVVTALWEMNEYNPSGRYPVPELWNFKEGRK  612

Query  338   ATLKEVVSFIFKQLKTHKRKR  276
             ATLKEV+ +I K +K+ KRK+
Sbjct  613   ATLKEVIDYICKNIKSCKRKK  633



>ref|XP_004303249.1| PREDICTED: uncharacterized protein LOC101303532 [Fragaria vesca 
subsp. vesca]
Length=612

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/589 (57%), Positives = 446/589 (76%), Gaps = 12/589 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             INEYK+KPYE+LRSGK KVKGP G LRCPFCAGKKKQDYKYKDLLQH++GV KGSANRS 
Sbjct  21    INEYKDKPYEQLRSGKLKVKGPYGTLRCPFCAGKKKQDYKYKDLLQHSSGVAKGSANRSA  80

Query  1934  KQKANHVALAKYLEIDLGDQAE----PLPQRAVA----PEDNNLYCWPWTGIVVNVSKDN  1779
              QKANH+ALA YLE +L  +A+    P P + V     PED  LY WPWTG+V N+    
Sbjct  81    VQKANHLALALYLEKELASEADHIQRPAPPKPVVNDEKPED--LYVWPWTGVVANILLSQ  138

Query  1778  A-NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
               +G  + +  YWL +FSKY+  +V  F +++ + +  V+    DWNG+ NA  FE  F 
Sbjct  139   PKDGKDLLDSGYWLNKFSKYKPVDVHTFFNEEEQAAGAVVFFSKDWNGFGNATDFEKMFI  198

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             ++ H K+ W A +  P S +YGW A+ DDY+++G VG +LR+  QLKT++D++QE  + K
Sbjct  199   SKSHGKEHWNARKQHPGSSIYGWCARSDDYDSQGPVGEFLRKRGQLKTVSDIVQEAAQSK  258

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             + ++ NL N++D  NENL  L  ++NE  LSLSRM++EKD LH AF EESR+MQ ++R++
Sbjct  259   NSVVENLANKIDKTNENLDELRYKYNEDALSLSRMLDEKDRLHNAFVEESRRMQHMSRDN  318

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
             V+R+L EQE LN ELE KKK+LD W +ELNKRE +TERE+ KLDE+KK+NDERN+SL++A
Sbjct  319   VRRILDEQEKLNCELESKKKKLDLWRKELNKREAVTERERQKLDEDKKKNDERNNSLQLA  378

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             S EQKKADE+VLRL E+ KREK  AL KIL+LE  ++AKQK+EMEI+ELKGKL+VM+H+G
Sbjct  379   SAEQKKADESVLRLFEQQKREKVDALDKILQLETQLNAKQKVEMEIEELKGKLEVMKHLG  438

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
               DD AVQ+K++ MK++L EKIE+++ L+ +N  L++KERQSNDELQEARK LI GLS++
Sbjct  439   DQDDDAVQKKMEVMKQELGEKIEELEALESLNQTLMIKERQSNDELQEARKELIAGLSEM  498

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
             L  G++HIGI+RMGE+D K F + CK +FS EEA V+A  LCSLWQE +KDP+WHPFRVI
Sbjct  499   L-VGQAHIGIKRMGELDQKPFLDACKSKFSLEEAQVQAFTLCSLWQENLKDPDWHPFRVI  557

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  375
                 + E++I+E+DE+L KLKEEWG +I   V+ A++E+NEYN SG  V
Sbjct  558   EKEGKAEELIDEEDEKLHKLKEEWGLDIHDCVVTALKEMNEYNPSGSCV  606



>ref|XP_010678965.1| PREDICTED: factor of DNA methylation 1-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/618 (52%), Positives = 467/618 (76%), Gaps = 5/618 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I EY E PYE LRSG Y V    G LRCPFCAGKKKQ+Y  KDL QHA+GV KG+A+RS 
Sbjct  16    IEEYAEIPYEALRSGTYNVWSIRGALRCPFCAGKKKQEYALKDLHQHASGVAKGAAHRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN-----LYCWPWTGIVVNVSKDNANG  1770
              QKA H+ALA+YLE+DLG  +    Q A    + +     L CWPW GIVVN+  +   G
Sbjct  76    IQKATHLALARYLEVDLGFGSVQASQPAEPKPEPDEPEEELLCWPWIGIVVNIMNEAETG  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
               + + ++W+K FSKY+   V++F D++ +T++ +++ + + NG+KNA  FE +FE + H
Sbjct  136   KQLADSEFWMKTFSKYKPLGVEVFQDEEEKTAKAIVQFEKELNGHKNAHDFEKSFEVDLH  195

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SKK+W A   +  SH+YGW A+ DDY A+G +G YLR+  +LKT ++++++ K+  + I+
Sbjct  196   SKKDWIANGGNVGSHIYGWRARADDYNAKGQIGEYLRKNTELKTFSEIIRKGKQGIETIV  255

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
              +L NE+D++N+NL  + +  NEK++SL+RM+EEKD L +AFY E++ MQR+A+++VQ++
Sbjct  256   VSLANEIDMQNQNLVEMQSMVNEKSMSLNRMLEEKDELLQAFYAETQGMQRVAKDNVQKM  315

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L E+E +  +LE K+K+LD    EL+KRE LTE EK KL+EEK++N ERN+SL MAS EQ
Sbjct  316   LQEREKMFHDLESKRKELDQRTSELSKREALTELEKQKLEEEKRQNAERNNSLYMASMEQ  375

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             + ADENVLRL+++HKRE+E AL+KIL+LEK++D KQ+L++EI+ELKGKL+VM+H+G D+D
Sbjct  376   QIADENVLRLVKQHKREEEEALKKILQLEKELDEKQRLQLEIEELKGKLEVMKHLGDDND  435

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
              AV+ K+K+M E+L+++I+++ +L+ +N  L++K+RQSNDELQ AR  LI GL ++L S 
Sbjct  436   IAVKTKMKDMAEELNDRIDELNNLEALNQTLMVKQRQSNDELQPARAELIAGLLEILQSN  495

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R++IG++RMGEID KAF   CK+++  +EA +KA + CSLWQ+ + DP WHPF++I  + 
Sbjct  496   RTNIGVKRMGEIDEKAFVMQCKKKYKGDEALMKASKGCSLWQKYLGDPAWHPFKIIETNG  555

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
             + E+IINE+DE+L +LK +WG E+  AV  A++E+NEYN SGRYV+ ELWN+KEGRKAT+
Sbjct  556   KNEEIINEEDEKLKRLKAQWGNEVYRAVTVALQELNEYNPSGRYVVNELWNYKEGRKATV  615

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEVVS++FK LK  KRK+
Sbjct  616   KEVVSYVFKNLKALKRKK  633



>ref|XP_004510284.1| PREDICTED: uncharacterized protein PFB0145c-like [Cicer arietinum]
Length=586

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/543 (57%), Positives = 413/543 (76%), Gaps = 14/543 (3%)
 Frame = -1

Query  2096  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKANH  1917
             KPYE+L++GKYKVK  NG LRCP+C+GKKKQDYKYKDLLQHA+GVGKGSANRS KQKANH
Sbjct  22    KPYEQLKAGKYKVKNFNGTLRCPYCSGKKKQDYKYKDLLQHASGVGKGSANRSAKQKANH  81

Query  1916  VALAKYLEIDLGDQAEPLPQRAVAP-------EDNNLYCWPWTGIVVNVSKDNANGTAVE  1758
             +ALAKYLE DL ++A+ +P+ A          +D N Y WPWTGI+VN+       + + 
Sbjct  82    LALAKYLETDLANEADQIPRPASTQAVNQPVQQDEN-YVWPWTGIIVNIK------SQLH  134

Query  1757  EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKE  1578
             +  YWLK F+KY   +V+IF  D    +Q VI   +DWNG+ NA  FE +FEA+   KK+
Sbjct  135   DSRYWLKEFAKYRPLDVRIFLMDGDVAAQAVIDFHNDWNGFMNASEFEKSFEAKRLGKKD  194

Query  1577  WTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLT  1398
             W +     +S +YGW A+ DDY   G +G YLR   +L+T++D++QE    ++ I+ NL 
Sbjct  195   WKSRELQANSDIYGWVAREDDYNCGGPIGDYLRNKGRLRTVSDIVQEASESRNSIVDNLA  254

Query  1397  NELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQ  1218
             NE+D+ NENL+ +  ++NEK +SLSRM+EEKD LH AF EESR MQR ARE V+R+L EQ
Sbjct  255   NEIDITNENLNKMQYKYNEKTMSLSRMLEEKDKLHNAFVEESRSMQRKAREEVRRILEEQ  314

Query  1217  ETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKAD  1038
             E L++EL++K+++LDSW+R+LNKREVLT++E+ KL+E+KK+ D RN SL +ASKEQK AD
Sbjct  315   EKLSNELDEKRRKLDSWSRDLNKREVLTDQERQKLEEDKKKKDSRNESLLLASKEQKIAD  374

Query  1037  ENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQ  858
             ENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEI+ELKGKL VM+H+G  DD+A++
Sbjct  375   ENVLRLVEEQKREKEEALNKILQLEKQLDAKQKLEMEIEELKGKLQVMKHLGDQDDAAIK  434

Query  857   EKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHI  678
             +K++EM E+L++KIE + +++ MN  L++KERQSNDELQEARK LI+GL+D+L   +++I
Sbjct  435   KKMEEMNEELEDKIESLDNMESMNKTLIIKERQSNDELQEARKELIEGLNDMLTGPKTNI  494

Query  677   GIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQ  498
             G +RMG++D K F   CK+RF  EEA +K +ELCSLWQE VK+  WHPF+VI + DR E 
Sbjct  495   GTKRMGDLDQKVFVTACKKRFPLEEAGIKGVELCSLWQENVKNSAWHPFKVIRVDDRHES  554

Query  497   IIN  489
             +IN
Sbjct  555   VIN  557



>ref|XP_010937610.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=631

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/620 (52%), Positives = 447/620 (72%), Gaps = 11/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+ K Y+ L+SGK+KVK  +   RCPFC G+KKQDY++ +LLQHATGVG  ++NR  
Sbjct  16    IDDYETKLYQLLKSGKFKVKNEDNTFRCPFCVGRKKQDYRHNELLQHATGVG--ASNREA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDN------NLYCWPWTGIVVNVSKDNAN  1773
             K KANH ALAK L+ DL D A PL Q     +D+      + + WPW GI+VNV  +  N
Sbjct  74    KVKANHRALAKLLKDDLADAAGPLKQLISIEQDSTSKPKQDQFVWPWMGILVNVPTEWKN  133

Query  1772  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             G  V E    LK + S++   +V    + +  T   ++    DW G K+A+ FEN F+A 
Sbjct  134   GKQVGESGNRLKEQLSRFNPLKVIPLWNYRGHTGNAIVDFSKDWGGLKDAMSFENYFDAN  193

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                KK+W  E   P S +YGW A+ DDY ++G VG +LR+   LKT+TDL +EE R  DK
Sbjct  194   HFGKKDW-CETKDPGSDIYGWVARADDYNSKGPVGEHLRKNGDLKTVTDLSKEESRKTDK  252

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             +++NL N++++KN++L  L  ++NE N+SL +M+EE+D L + + EE RKMQ LAREH +
Sbjct  253   LVANLANQIEVKNKHLQELECKYNESNMSLDKMMEERDQLLQFYNEEIRKMQCLAREHSR  312

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+  E  TL ++L+ K+++LD  + +L+K     + E++KL++EK++N  +NSSL+MAS 
Sbjct  313   RIFEENATLKAQLDAKQRELDLRSDQLDKLVAQNDIERMKLNDEKQKNAIKNSSLQMASM  372

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADENVLRLIEE KREKEAAL+KI++LEK +DAKQKLE+EIQ+L GKL VM HMGG+
Sbjct  373   EQKKADENVLRLIEEQKREKEAALKKIIQLEKQLDAKQKLELEIQQLTGKLQVMRHMGGE  432

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DDSAV++K++EM E+L EKIE+M+ L+ +N ALV+KER SNDELQEAR  LI+GL ++L 
Sbjct  433   DDSAVKQKMEEMSEELKEKIEEMESLEALNQALVVKERMSNDELQEARTELIRGLKEILG  492

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
               +S IGI+RMGE+D KAF + CK++F+ ++AD+KA   CS WQE +KDPNWHP++++ I
Sbjct  493   K-KSDIGIKRMGELDDKAFQSACKRKFAEDDADIKAAVFCSEWQEYLKDPNWHPYKIVTI  551

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               + +++INEDDE+L  L E   EE   AV  A+ E+NEYN SGRYVIPELWN+KEGRKA
Sbjct  552   DGKTQEVINEDDEKLLALMELLDEEAYEAVTTALLEINEYNPSGRYVIPELWNYKEGRKA  611

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKEVV F+  + KTHKRKR
Sbjct  612   TLKEVVQFVLNKWKTHKRKR  631



>ref|XP_010537880.1| PREDICTED: factor of DNA methylation 1-like [Tarenaya hassleriana]
Length=633

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/620 (54%), Positives = 455/620 (73%), Gaps = 8/620 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+EY EKPY+ L+SGK+KVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV +GSANRS 
Sbjct  16    IDEYSEKPYKLLQSGKFKVK-VNGTLRCPFCSGKKKQDYKYKELFAHASGVARGSANRSA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNAN  1773
             KQKANH+ALA YLE DL   AE LP   V       P+  ++Y WPW GIVVN    + +
Sbjct  75    KQKANHLALANYLEKDLAGDAERLPCPPVPLSKQLEPKPGDIYVWPWMGIVVNPVNRSDD  134

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               ++ +  YWLKR SK+    V+ F +++     V++K   DWNG+ NA  FE  FE E 
Sbjct  135   KESLLDSGYWLKRLSKFTPLGVESFWNEQDSEVDVIVKFNRDWNGFVNATEFEKEFETER  194

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
               KK+   +R    S  YGW A+ DDY++ G +G YL +  +L TI+D+++E  +D++ +
Sbjct  195   CGKKDLAVKRGDFGSKGYGWVARADDYKSSGPIGEYLSKEGKLSTISDIVEEALQDRNSV  254

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             L +LT ++ L NE+L+ L  +++ + +SLSR+++EKD LH  F  E +KMQ+++R+++QR
Sbjct  255   LESLTTKIALTNEDLNKLQYKYDVEAMSLSRVLQEKDNLHGIFLIERKKMQKISRDNIQR  314

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L E+E L+ ELE+K ++L  W+REL K+E LTE E+ KL+E+KK++D  N SL++AS+E
Sbjct  315   ILAEKERLSDELEEKMRKLKGWSRELEKKEALTEIERKKLEEDKKKSDIMNCSLQLASQE  374

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QK+ADENVLRL+ EHKR+KE AL+KILELEK +D KQKLEMEIQELKGKL VM+H+   D
Sbjct  375   QKRADENVLRLVNEHKRQKEEALKKILELEKQLDTKQKLEMEIQELKGKLQVMKHLEDQD  434

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D AV++K+KEM E+L+EK  +++D++ MN  L+ KERQSNDE+Q ARK LI GL +LL +
Sbjct  435   DEAVKQKMKEMNEELEEKKSELEDMELMNTHLMTKERQSNDEIQVARKALIAGLPELLGN  494

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G ++IG++RMGEID K F  VCKQRF  EEA ++A  LCS WQE +KDP WHPF++    
Sbjct  495   G-TNIGVKRMGEIDDKPFQVVCKQRFPPEEAVIQAATLCSQWQENLKDPAWHPFKITTYG  553

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              +  ++ +E+DE+L KLKEEWGEE+  AV  A+EE+NEYN SGRYV+PELWNFKEGRKAT
Sbjct  554   GKATEVADEEDEKLKKLKEEWGEEVQNAVKTALEELNEYNGSGRYVVPELWNFKEGRKAT  613

Query  332   LKEVVSFIFKQLKTHKRKRH  273
             LKEV+++I   +K  KRKR+
Sbjct  614   LKEVIAYIANSIKNLKRKRN  633



>ref|XP_008799862.1| PREDICTED: MAR-binding filament-like protein 1 [Phoenix dactylifera]
Length=632

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/622 (51%), Positives = 448/622 (72%), Gaps = 14/622 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+ K YE L+SGK+KVK  +   RCPFC G+KKQDY++ +LLQHATG+G  ++NR  
Sbjct  16    IDDYETKLYELLKSGKFKVKNEDNTFRCPFCVGRKKQDYRHNELLQHATGLG--ASNREA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVA--------PEDNNLYCWPWTGIVVNVSKDN  1779
               KANH ALAK L+ DL D+A P P++ ++        P+ ++ + WPW GI+VNV  + 
Sbjct  74    IVKANHRALAKLLKDDLADEAGP-PKQLISIEQNSTSKPKQDDQFVWPWMGILVNVPTEW  132

Query  1778  ANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
              +G  V E    LK + S +   +V    + +  T   ++    DW G K+A+ FEN F+
Sbjct  133   KDGRQVGESGNRLKEQLSGFNPLKVIPLWNYRGHTGNAIVDFSKDWGGLKDAMSFENHFD  192

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             A    KK+W  ER  P S +YGW A+ DDY ++G VG YLR+   +KT+TDL +EE R  
Sbjct  193   ANHFGKKDWY-ERKDPGSDIYGWVARADDYNSKGPVGEYLRKNGDIKTVTDLSKEESRKT  251

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             DK+++NL N++++KN++L  L  ++NE N+SL +M+EE+D L + + EE RKMQ LAREH
Sbjct  252   DKLVANLANQIEVKNKHLQELECKYNESNMSLDKMMEERDQLLQFYNEEIRKMQCLAREH  311

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
              +++  E   L ++L+ K+ +LD  + +L+K     + E++KL++E+++N  +NSSL+MA
Sbjct  312   SRKIFEENAMLKAQLDAKQSELDLRSNQLDKLVAQNDIERMKLNDERQKNAMKNSSLQMA  371

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             S EQKKADENVLRLIEE KRE+EAAL+KIL+LEK +DAKQKLE+EIQ+LKGKL VM+HMG
Sbjct  372   SMEQKKADENVLRLIEEQKREQEAALKKILQLEKQLDAKQKLELEIQQLKGKLQVMKHMG  431

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
             G+DDSAV++K++EM E+L EKIE+M+ L+ +N  LV+KER SNDELQEAR  LI+GL ++
Sbjct  432   GEDDSAVKKKMEEMSEELKEKIEEMESLEALNQTLVVKERMSNDELQEARNELIKGLKEI  491

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
             L   +  IGI+RMGE+DGKAF + CK++F+ ++AD+KA E CS WQE +KDPNWHP++++
Sbjct  492   LGK-KFDIGIKRMGELDGKAFQSACKRKFAEDDADIKAAEFCSEWQEYLKDPNWHPYKIV  550

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
              I  + +++INEDDE+L  LKE  G E   AV  A+ E+NEYN SGRY IPELWN+ EGR
Sbjct  551   TIDGKSKEVINEDDEKLIVLKELLGNEAYEAVTTALLEINEYNPSGRYAIPELWNYIEGR  610

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             KATLKEVV ++  + KT KRKR
Sbjct  611   KATLKEVVQYVLNKWKTQKRKR  632



>gb|KGN44516.1| hypothetical protein Csa_7G323110 [Cucumis sativus]
Length=561

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/538 (57%), Positives = 399/538 (74%), Gaps = 7/538 (1%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+Y EKPYE+LR+GK  VK  NG LRCPFC GKKKQDYKYKDLLQHA+GV KGS NR+ 
Sbjct  16    INDYAEKPYEQLRTGKLVVKTANGILRCPFCMGKKKQDYKYKDLLQHASGVSKGSKNRNA  75

Query  1934  KQKANHVALAKYLEIDLGDQAE----PLPQRAVAPE-DNNLYCWPWTGIVVNVSKDNANG  1770
             KQKANH+ALAKYLE +L  +A+    P P   ++ + +  LY WPW G++VN+       
Sbjct  76    KQKANHLALAKYLENELASEADQTQRPTPPTPISQDSEQELYVWPWMGVIVNIEAGEDRN  135

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
             T  +   YW+K+F+KY   +V IF +D    +Q +++  +DWNG+ NA  FE  FE   H
Sbjct  136   TVCDSA-YWIKKFAKYRPLDVYIFWNDNEPKAQAIVEFNNDWNGFVNATDFEKLFETNDH  194

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK+ W   ++  S  +YGW A+ DDY +   +G +LR+  +L+T++D++ E  + ++ ++
Sbjct  195   SKRNWKT-KTGSSLDIYGWCARADDYNSNEPIGEFLRQRGKLRTVSDIVNEATQSRNTVV  253

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
              NLT+++DLKNENL  L   +NEK +SLSRM+ EKD LH AF EE+RK QRLAR +VQR+
Sbjct  254   ENLTHKIDLKNENLEELHCEYNEKTMSLSRMLAEKDQLHHAFVEETRKTQRLARNNVQRI  313

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE L+ ELE KKK+LDSW+++LNKRE LTE E+ KLDEEKK+ND RN+SL++AS EQ
Sbjct  314   LEEQENLHQELEAKKKKLDSWSKQLNKREALTELERQKLDEEKKKNDMRNNSLQLASMEQ  373

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             ++ADENVLRL+EE KREKE AL KIL+LEK +DAKQKLEMEIQELKGKL VM+H+   DD
Sbjct  374   RRADENVLRLVEEQKREKEEALSKILQLEKQLDAKQKLEMEIQELKGKLQVMKHLEDQDD  433

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
               VQ+K+KEM + LD+K+ED+ DL E+N  LV KER+SNDELQEARK LI GL D  ++ 
Sbjct  434   EGVQQKMKEMGDDLDQKVEDLNDLQELNRTLVTKERESNDELQEARKELISGLQDQSSNA  493

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             R +IGI+RMG+ID K F N CK +FS +EA V+A  LCSLWQ+ + DPNWHPF+V+ I
Sbjct  494   RVNIGIKRMGDIDIKPFQNTCKHKFSPDEAMVQASTLCSLWQDNLTDPNWHPFKVVTI  551



>ref|XP_010497500.1| PREDICTED: factor of DNA methylation 1 [Camelina sativa]
 ref|XP_010497504.1| PREDICTED: factor of DNA methylation 1 [Camelina sativa]
Length=636

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/622 (52%), Positives = 440/622 (71%), Gaps = 11/622 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y E PY  L++G YKVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV KGSA RS 
Sbjct  16    IDDYSETPYMLLQNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHASGVSKGSATRSA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLP---------QRAVAPEDNNLYCWPWTGIVVNVSKD  1782
             KQKANH+ALAK+LE +L   AEP P         +  V P   ++Y WPW GIV+N   D
Sbjct  75    KQKANHLALAKFLENELAGHAEPAPRPPPVPPQFEETVEPNPRDVYVWPWMGIVLNPLTD  134

Query  1781  NANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
               +  A+   +YWL R SK++  EV  F  ++     V+ K  SDW G+  A   E  FE
Sbjct  135   TDDKEALLSSEYWLNRLSKFKPVEVNAFWVEQDSIVGVIAKFTSDWGGFACATELEKEFE  194

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
              + HSKKEWT       S  YGW A+  DY ++G +G YL    +L+T++D+ QE+++D+
Sbjct  195   NQGHSKKEWTERTGDSESKAYGWCARAQDYYSQGPIGEYLSREGKLRTVSDISQEKEQDR  254

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             + +L  LT  + + N++LS +   ++   +SL R+++EK  LH AF  E++KMQ  +R H
Sbjct  255   NIVLDELTKMIAMTNDDLSKVQYSYHRTAMSLQRVLDEKRNLHEAFANETKKMQETSRRH  314

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
             +QRVL++++ L+ EL++K + L+S  ++L K+E LTE E+ KLDEEKK+++  N SL +A
Sbjct  315   IQRVLYDKDKLSDELDRKMRDLESRAKQLEKQEALTELERQKLDEEKKKSEAMNKSLLLA  374

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             S+EQKKADE+VLRL+EEHKR+ E AL KIL LEK +D KQ LEMEIQELKGKL VM+H+G
Sbjct  375   SREQKKADESVLRLVEEHKRQNEDALNKILLLEKQLDTKQTLEMEIQELKGKLQVMKHLG  434

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
              DDD AV++K++EM ++L+EK  +++ L++MN+ L+ KERQSNDE+Q ARK LI GL  L
Sbjct  435   NDDDEAVKKKMQEMNDELEEKKSELEGLEQMNSDLMTKERQSNDEIQAARKKLITGLIGL  494

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
             L +  + IG++RMGE+D K F NVCK R+S  EA V+A  LCS WQE +K+P+WHPF+ +
Sbjct  495   LGA-ETDIGVKRMGEVDEKPFLNVCKLRYSANEATVEAATLCSTWQENLKNPSWHPFKRV  553

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
                 R +++++E+DE+L KLK EWGE +  AV  A+EE+NEYNASGRY  PELWNFKEGR
Sbjct  554   GSGGRVKEVVDEEDEQLKKLKREWGEAVHNAVKTALEEMNEYNASGRYATPELWNFKEGR  613

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             KATLKEV+SFI + +KT KRKR
Sbjct  614   KATLKEVISFISENIKTLKRKR  635



>ref|XP_006416865.1| hypothetical protein EUTSA_v10007054mg [Eutrema salsugineum]
 gb|ESQ35218.1| hypothetical protein EUTSA_v10007054mg [Eutrema salsugineum]
Length=633

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/616 (52%), Positives = 443/616 (72%), Gaps = 8/616 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y E PY  L++GKYKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGSANRS KQK
Sbjct  19    YSEIPYLMLQTGKYKVK-VNGNLRCPFCSGKKKQDYKYKELIAHASGVSKGSANRSAKQK  77

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGTA  1764
             ANH+ALAKYLE +L   AEP+P+  V   D       ++Y WPW GIV+N  K+  +  A
Sbjct  78    ANHLALAKYLENELAGDAEPVPRPPVPQLDESEAKPGDIYVWPWMGIVINPLKETDDKEA  137

Query  1763  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSK  1584
             + +  YWLK  S++   EV  F  ++     V+ K  SDW+G+ +A   E  FE +  SK
Sbjct  138   LLDSAYWLKELSRFNPIEVNAFWVEQDSAVGVIAKFNSDWSGFASATELEEEFENKGCSK  197

Query  1583  KEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSN  1404
             KEWT +R    S  YGW A+ +DY +EG +G YL +   L+TI+D+ QE+ +D++ +L  
Sbjct  198   KEWTEKRGDSESKAYGWCARAEDYNSEGPIGEYLSKEGTLRTISDISQEKAQDRNSVLDE  257

Query  1403  LTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLH  1224
             L++ + + NE+L+ +   +N+  +SL R+++EK TLH A+ +E++KMQR++   +QR+L 
Sbjct  258   LSDIIAMTNEDLNKVQYSYNKTAMSLQRVLDEKKTLHEAYADETKKMQRMSLLKIQRILA  317

Query  1223  EQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKK  1044
             ++E L+  LE K  QL +W+++L+K E LTE+E+ KLDEEKK++D  N SL++AS+EQK 
Sbjct  318   DKERLSDLLESKMVQLQTWSKQLDKEEALTEQERQKLDEEKKKSDAMNISLQLASREQKI  377

Query  1043  ADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSA  864
             ADE+VLRL+EEHKR+KE AL KIL+LE  +D KQ LEMEIQELKGKL VM+H+G DDD A
Sbjct  378   ADESVLRLVEEHKRQKEEALNKILQLETQLDTKQTLEMEIQELKGKLQVMKHLGDDDDEA  437

Query  863   VQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS  684
             V+ K+KEM ++L+EK  +++DL++MN+ L+ KERQSN E+Q ARK LI GL+ LL +  +
Sbjct  438   VKLKMKEMTDELEEKKSELEDLEQMNSDLMTKERQSNLEIQAARKKLIAGLTGLLGAN-T  496

Query  683   HIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRP  504
              IG++RMGE+D   F NVCKQR+S +EA ++A  LCS WQ+ V D +W PF+      + 
Sbjct  497   DIGVKRMGELDEIPFLNVCKQRYSADEASIEAATLCSTWQKNVNDISWQPFKHEGTGYKA  556

Query  503   EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKE  324
              ++++E+DE+L KLK EWGEE+  AV  A+EE+NEYN SGRY+ PELWNFK GRKATLKE
Sbjct  557   TEVVDENDEKLKKLKGEWGEEVHNAVKTALEELNEYNGSGRYITPELWNFKVGRKATLKE  616

Query  323   VVSFIFKQLKTHKRKR  276
             V++FI   +KT KRKR
Sbjct  617   VITFISNDIKTVKRKR  632



>ref|XP_002890136.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66395.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=635

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/618 (51%), Positives = 448/618 (72%), Gaps = 10/618 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y E PY  LR+G YKVK  NG LRCPFC+GKKKQDYKYK+L  HATGV KGSA+RS KQK
Sbjct  19    YSETPYLLLRNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHATGVSKGSASRSAKQK  77

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  1770
             ANH+ALAK+LE +L   AEP+P+            P  +++Y WPW  IV+N  K+  + 
Sbjct  78    ANHLALAKFLENELAGYAEPVPRPPVVPPQFDETEPNPHDVYVWPWMAIVLNPLKETDDK  137

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
               + +  +WLK  SK++  EV  F  ++     V+ K  SDW+G+ +A   E  FE +  
Sbjct  138   ELLLDSAFWLKTLSKFKPIEVNAFWLEQDSIVGVIAKFHSDWSGFASATELEKEFETQGS  197

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SKKEWT       S  YGW A+ +D+ ++  +G YL +  QL+T++D+LQE+ +D++ +L
Sbjct  198   SKKEWTERSGDSESKAYGWCARAEDFNSQDPIGEYLSKEGQLRTVSDVLQEKVQDRNTVL  257

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
               L+N + + NE+L+ +   +N+  +SL R+++EK +LH AF +E++KMQ+++  H+Q++
Sbjct  258   DELSNMIAMTNEDLNKVQYSYNKTAMSLQRVLDEKKSLHEAFADETKKMQQMSLRHIQKI  317

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L+++E L+ EL++K + L+S  ++L+K+E LTE EK KLDE+K+++D  N SL++AS+EQ
Sbjct  318   LYDKERLSDELDRKMRDLESRAKQLDKQEALTELEKQKLDEDKRKSDAMNKSLQLASREQ  377

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             KKADE+VLRL+EEHKR+KE AL KIL LEK +D KQ LEMEIQELKGKL VM+H+G DDD
Sbjct  378   KKADESVLRLVEEHKRQKEDALNKILLLEKQLDTKQTLEMEIQELKGKLQVMKHLGDDDD  437

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
              AV++K++EM ++L EK  +++ L+EMN+ L+ KER+SNDE+Q ARK LIQGL+ LL + 
Sbjct  438   EAVKKKMQEMNDELKEKKSELEGLEEMNSVLMTKERESNDEIQAARKKLIQGLTGLLGA-  496

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
              + IG++RMGE++ K F +VCK R+S  +A V+A  LCS WQE +K+P+W PF+     D
Sbjct  497   ETDIGVKRMGELNEKPFLDVCKLRYSANDATVEAATLCSTWQENLKNPSWQPFKREGTGD  556

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
             R +++++EDDE+L KLK EWGEE+  AV  A+ E+NEYNASGRY  PELWNFKEGRKATL
Sbjct  557   RAKEMVDEDDEQLKKLKGEWGEEVHNAVKTALGEMNEYNASGRYTTPELWNFKEGRKATL  616

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEV++FI  ++K+ KRKR
Sbjct  617   KEVITFISTEIKSLKRKR  634



>ref|NP_173043.1| factor of DNA methylation 1 [Arabidopsis thaliana]
 sp|Q9S9P3.1|FDM1_ARATH RecName: Full=Factor of DNA methylation 1; AltName: Full=Protein 
IDN2 PARALOG 1; AltName: Full=Protein IDN2-LIKE 1 [Arabidopsis 
thaliana]
 gb|AAF18488.1|AC010924_1 Contains similarity to gb|AF136530 transcriptional regulator 
from Zea mays. ESTs gb|F14071, gb|Z26823, gb|AI998935 come from 
this gene [Arabidopsis thaliana]
 gb|AEE29382.1| factor of DNA methylation 1 [Arabidopsis thaliana]
Length=634

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/619 (51%), Positives = 438/619 (71%), Gaps = 10/619 (2%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             +Y E PY  LR G YKVK  NG LRCPFCAGKKKQDYKYK+L  HATGV KGSA RS  Q
Sbjct  17    DYSETPYRLLRDGTYKVK-VNGQLRCPFCAGKKKQDYKYKELYAHATGVSKGSATRSALQ  75

Query  1928  KANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNAN  1773
             KANH+ALA +LE +L   AEP+P+            P  +N+Y WPW GIVVN  K+  +
Sbjct  76    KANHLALAMFLENELAGYAEPVPRPPVVPPQLDETEPNPHNVYVWPWMGIVVNPLKEADD  135

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
                + +  YWL+  SK++  EV  F  ++     V+ K   DW+G+  A   E  FE + 
Sbjct  136   KELLLDSAYWLQTLSKFKPIEVNAFWVEQDSIVGVIAKFNGDWSGFAGATELEKEFETQG  195

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
              SKKEWT       S  YGW A+ DD+E++G +G YL +  QL+T++D+ Q+  +D++ +
Sbjct  196   SSKKEWTERSGDSESKAYGWCARADDFESQGPIGEYLSKEGQLRTVSDISQKNVQDRNTV  255

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             L  L++ + + NE+L+ +   +N   +SL R+++EK  LH+AF +E++KMQ+++  H+Q+
Sbjct  256   LEELSDMIAMTNEDLNKVQYSYNRTAMSLQRVLDEKKNLHQAFADETKKMQQMSLRHIQK  315

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L+++E L++EL++K + L+S  ++L K E LTE ++ KLDE+K+++D  N SL++AS+E
Sbjct  316   ILYDKEKLSNELDRKMRDLESRAKQLEKHEALTELDRQKLDEDKRKSDAMNKSLQLASRE  375

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADE+VLRL+EEH+R+KE AL KIL LEK +D KQ LEMEIQELKGKL VM+H+G DD
Sbjct  376   QKKADESVLRLVEEHQRQKEDALNKILLLEKQLDTKQTLEMEIQELKGKLQVMKHLGDDD  435

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D AVQ+K+KEM ++LD+K  +++ L+ MN+ L+ KERQSNDE+Q ARK LI GL+ LL +
Sbjct  436   DEAVQKKMKEMNDELDDKKAELEGLESMNSVLMTKERQSNDEIQAARKKLIAGLTGLLGA  495

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
               + IG++RMGE+D K F +VCK R+S  EA V+A  LCS WQE +K+P+W PF+     
Sbjct  496   -ETDIGVKRMGELDEKPFLDVCKLRYSANEAAVEAATLCSTWQENLKNPSWQPFKHEGTG  554

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
             D  E++++EDDE+L KLK EWG+E+  AV  A+ E+NEYNASGRY  PELWNFKEGRKAT
Sbjct  555   DGAEEVVDEDDEQLKKLKREWGKEVHNAVKTALVEMNEYNASGRYTTPELWNFKEGRKAT  614

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV++FI   +K  KRKR
Sbjct  615   LKEVITFISNDIKILKRKR  633



>gb|EPS59185.1| hypothetical protein M569_15623 [Genlisea aurea]
Length=616

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/623 (49%), Positives = 418/623 (67%), Gaps = 50/623 (8%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+EYK KPYE L+SG YK+KGPNG LRCPFCAGKKKQDY+Y  L QHA GV KG+A +S 
Sbjct  34    IDEYKAKPYELLKSGFYKIKGPNGVLRCPFCAGKKKQDYQYNHLYQHAIGVAKGTA-KSA  92

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN----LYCWPWTGIVVNVSKDNANGT  1767
             KQ+ANH+ALA YLE D   +AEP+   A  PE +     LYCWPW GI+VN+ +    G 
Sbjct  93    KQRANHLALANYLEHDKPAEAEPMILPA-PPEKSEQGELLYCWPWIGIIVNIRRRGQIGE  151

Query  1766  A-VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
               +    YWL ++SKY+  EV++F D     +Q V++  +DW+G+KNA+ FE +F     
Sbjct  152   GNLGSTSYWLNKYSKYKPLEVELFWDGDESNAQAVMRFGNDWDGFKNALEFEKSFAVGGK  211

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             S+KEW  E    SS +YGWFA+  DY++EG VG YLR   +LKTIT+++ E  +D  K++
Sbjct  212   SRKEW--ESCENSSDIYGWFARDHDYKSEGPVGNYLRSKSELKTITEVVHEANKDTKKVV  269

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
              NL  E+D+ NE+L AL T++N++ LSL+R+++EKD LHR+F EE+RK+QR+AREHV+RV
Sbjct  270   GNLVEEIDMNNESLDALQTQYNQRTLSLTRLLQEKDDLHRSFCEETRKLQRMAREHVRRV  329

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L EQE LNS  E+                                    N SL+MA++EQ
Sbjct  330   LDEQEMLNSNEER------------------------------------NKSLQMATEEQ  353

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +K D NV  L+EE KREK  AL+K+L+LE+ +  +QKLEMEI +L+GKL++++HMGG D+
Sbjct  354   RKTDVNVQHLLEEQKREKAEALRKVLDLERRVGERQKLEMEIVDLEGKLEIIKHMGGHDE  413

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
              AVQ KIK M E+L ++ + +  L++    L+ +ERQ+ DELQ  RKLL++ LS   ++ 
Sbjct  414   EAVQLKIKSMNEELQDRNDRLSFLEDTYTQLLQRERQNTDELQICRKLLVESLSPTPSNS  473

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R  IG++R+GEID  AF N CKQ+   EE D +A +L S+WQEK+KDP WHPFR++   +
Sbjct  474   RVSIGVKRVGEIDESAFKNACKQKLPPEEVDFEAAKLTSMWQEKLKDPGWHPFRIVTDGN  533

Query  509   -----RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
                  R  +   ED E L +L++EWG+E   AV KA +E++EYN SG YV  ELWNFKE 
Sbjct  534   GDSKARYAEEFREDYESLQELRKEWGDEAYVAVAKASKEIHEYNPSGCYVTNELWNFKED  593

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             RKATLKEVV+FI  Q+KT KRKR
Sbjct  594   RKATLKEVVAFIISQVKTLKRKR  616



>ref|XP_009149026.1| PREDICTED: nuclear mitotic apparatus protein 1 [Brassica rapa]
 ref|XP_009149027.1| PREDICTED: nuclear mitotic apparatus protein 1 [Brassica rapa]
Length=636

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/621 (51%), Positives = 446/621 (72%), Gaps = 15/621 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y E PY  L++GKYKVK  NG LRCPFC+ KKKQDYKYK+L+ HA+GV KGSA+RS KQK
Sbjct  19    YSETPYLLLQNGKYKVK-VNGTLRCPFCSNKKKQDYKYKELMAHASGVSKGSASRSAKQK  77

Query  1925  ANHVALAKYLEIDLGDQAE----------PLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  1776
             ANH+ALA+YL+ +L   AE           L +    P    +Y WPW GI+V+  K+  
Sbjct  78    ANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKP--GEVYVWPWMGIIVSPLKETD  135

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             +  A+ +   WLK  S+++  EV  F  ++     VV K  SDW+G+ +A   E  FE+ 
Sbjct  136   DKEALLDSACWLKELSRFKPVEVHAFWVEQGLIVGVVAKFNSDWSGFASATELEKEFESI  195

Query  1595  CHSKKEWTAERSSPS-SHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
               SKKEW  +R   S S  YGW A+ +DY +EG +G YL +  +L+T++D+ QE+ +D++
Sbjct  196   GCSKKEWVEKRGGGSVSKAYGWCARAEDYHSEGPIGEYLSKEGKLRTVSDISQEKAQDRN  255

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              +L  L++ + + NE+L+ +   +N+  +SL R+++EK TLH A+  E++KMQ+++   +
Sbjct  256   SVLEQLSDIIAMTNEDLNKVQYSYNKTAMSLKRVLDEKKTLHEAYANETKKMQQMSILSI  315

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             Q++L+++E L++ELEKK ++L  W++ L+K+E LTE E+ KLDEEKK+ND  N SL++AS
Sbjct  316   QKILNDKERLSNELEKKMQKLSEWSKALDKKEALTELERQKLDEEKKKNDAMNISLQLAS  375

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQKKADE+VLRL+EEHKR+KE AL KIL+LE  +D KQ LEMEIQELKGKL VM+H+G 
Sbjct  376   HEQKKADESVLRLVEEHKRQKEEALSKILQLETQLDTKQTLEMEIQELKGKLQVMKHLGD  435

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             DDD AV++K+KEM ++L++K  +++ L++MN+AL+ KERQSNDE+Q ARK LI GL+ LL
Sbjct  436   DDDEAVKQKMKEMNDELEDKKSELEGLEQMNSALMTKERQSNDEIQAARKKLIAGLTGLL  495

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
              +  + IG++RMGE+D K F NVCK+RFS +EA V+A  LCS WQE +KD +W PFR   
Sbjct  496   GA-ETDIGVKRMGELDEKPFLNVCKKRFSEDEATVEAATLCSTWQENLKDSSWQPFRREG  554

Query  518   IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  339
               D+ +++++EDDE+L KLK EWGEE+  AV  A+EE+NEYNASGRY   ELWNFK GRK
Sbjct  555   TGDKAKEVVDEDDEQLKKLKGEWGEEVHNAVKTALEEMNEYNASGRYTTSELWNFKVGRK  614

Query  338   ATLKEVVSFIFKQLKTHKRKR  276
             ATLKEV++FI   +KT KRKR
Sbjct  615   ATLKEVINFISNDIKTVKRKR  635



>ref|NP_567176.2| XH/XS domain-containing protein [Arabidopsis thaliana]
 sp|F4JH53.1|FDM2_ARATH RecName: Full=Factor of DNA methylation 2; AltName: Full=Protein 
IDN2 PARALOG 2; AltName: Full=Protein IDN2-LIKE 2 [Arabidopsis 
thaliana]
 gb|AEE81871.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=635

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/618 (51%), Positives = 431/618 (70%), Gaps = 9/618 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y + PY  LRS  Y     NG LRCPFC GKKKQDYKYK+L  HATGV KGSA RS  QK
Sbjct  18    YSKTPYHLLRSETYYKVKVNGRLRCPFCVGKKKQDYKYKELHAHATGVSKGSATRSALQK  77

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  1770
             +NH+ALAK+LE DL   AEPLP+            P  +N+Y WPW GIVVN  K+  + 
Sbjct  78    SNHLALAKFLENDLAGYAEPLPRPPVVPPLLDETEPNPHNVYVWPWMGIVVNPLKETDDK  137

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
               + +  YWL+  SK++  EV  F  ++     V+ K  SDW+G+  A   E  FE +  
Sbjct  138   ELLLDSVYWLQTLSKFKPVEVNAFWVEQDSIVGVIAKFDSDWSGFAAATELEKEFETQGS  197

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
              KKEWT       S  YGW A+ DD++++G +G YL +   L+T++D+LQ   +D++ +L
Sbjct  198   CKKEWTERSGDSESKAYGWCARADDFQSQGPIGEYLSKEGTLRTVSDILQNNVQDRNTLL  257

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
               L+N +D+ NE+L+     +N   +SL R+++EK  LH+AF EE++KMQ+++  H+QR+
Sbjct  258   DVLSNMIDMTNEDLNKAQHSYNRTAMSLQRVLDEKKNLHQAFAEETKKMQQMSLRHIQRI  317

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L+++E L +EL++K + L+S  ++L K E LTE E+ KLDE+K+++D  N SL++AS+EQ
Sbjct  318   LYDKEKLRNELDRKMRDLESRAKQLEKHEALTELERQKLDEDKRKSDAMNKSLQLASREQ  377

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             KKADE+VLRL+EEH+R+KE AL KIL LEK +D KQ LEMEIQELKGKL VM+H+G DDD
Sbjct  378   KKADESVLRLVEEHQRQKEDALNKILLLEKQLDTKQTLEMEIQELKGKLQVMKHLGDDDD  437

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
              AVQ K+KEM ++LD+K  +++DL+ MN+ L+ KERQSNDE+Q AR+ +I GL+ LL + 
Sbjct  438   EAVQTKMKEMNDELDDKKAELEDLESMNSVLMTKERQSNDEIQAARQKMIAGLTGLLGA-  496

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
              S IG++RMGE+D K F +VCK R+S  EA V+A  LCS W+E +K+P+W PF+     D
Sbjct  497   ESDIGVKRMGELDEKPFLDVCKLRYSANEARVEAATLCSTWKENLKNPSWQPFKREGTGD  556

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
               E++++EDDE+L KLK EWG+E+  AV  A+ E+NEYNASGRY   ELWNFKEGRKATL
Sbjct  557   GAEEVVDEDDEQLKKLKREWGKEVHNAVKAALVEMNEYNASGRYPTSELWNFKEGRKATL  616

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEV++FI   +K  KRKR
Sbjct  617   KEVITFISTDIKNLKRKR  634



>ref|XP_008802711.1| PREDICTED: paramyosin, long form-like [Phoenix dactylifera]
 ref|XP_008802712.1| PREDICTED: paramyosin, long form-like [Phoenix dactylifera]
Length=631

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/619 (51%), Positives = 439/619 (71%), Gaps = 11/619 (2%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVK  1932
             ++Y+EK Y  L+ GK KVK  +   +CPFCAGKKKQDY YKDLLQHA GVG  ++NR+ K
Sbjct  17    DDYEEKFYLYLKDGKLKVKNTDSTYKCPFCAGKKKQDYNYKDLLQHANGVG--ASNRTAK  74

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANG  1770
              KA+H ALA+YL+ D  + +    Q  +       P+D + + WPW GI+VNV  +  NG
Sbjct  75    VKADHRALARYLKNDFAEASSSSMQLMIVQHHPFKPKDEDQFVWPWMGILVNVPTEYKNG  134

Query  1769  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               V E    LK   S++   +V    + +  T   ++    DW G+K+A+ FEN+F+A+ 
Sbjct  135   RYVGESGNKLKEHLSRFNPLKVHPLWNFRGHTGNAIVDFNKDWTGFKDAMAFENSFDAQR  194

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
               K++W  ER    + +YGW A+  DY + G +G +LR+   LKT+ DL  EE R  DK+
Sbjct  195   LGKRDWN-ERRHRGTEIYGWVARAVDYNSTGPIGDHLRKNGDLKTVNDLTTEETRKTDKL  253

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL +++++KN++L  L  ++NE  LSL RM+E++D L RA+ EE +KMQR++REH +R
Sbjct  254   VANLASQIEVKNKHLQELECKYNETTLSLDRMMEDRDKLLRAYNEEMQKMQRISREHSRR  313

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +  + E L +EL+ K+K+LD   ++L+K  V  E ++ KLD EK++N  ++SSL++AS E
Sbjct  314   IFEDNEKLWAELDSKRKELDLRRKQLDKLAVQNEIDRRKLDVEKQKNAMKDSSLQLASME  373

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADE+VLRL+EE KREKEAAL+KIL+LEK +DAKQKLE+EIQ+L+G+L VM+HMG ++
Sbjct  374   QKKADEDVLRLVEEQKREKEAALKKILKLEKQLDAKQKLELEIQQLRGQLQVMKHMGSEE  433

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             DS V++K++EM EQL EK+E+M+DL+ +N  LV+KER SNDELQEARK LI GL ++L S
Sbjct  434   DSEVKKKMEEMSEQLKEKVEEMEDLEALNQTLVVKERMSNDELQEARKELISGLKEML-S  492

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              R+ IGI+RMGE+D   F   C QRFS +EA V A  LCS WQ++++ P WHPF+V  + 
Sbjct  493   TRTSIGIKRMGELDETPFKIACNQRFSKDEAAVNAAMLCSKWQDELRKPEWHPFKVTIVD  552

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              +P+++I EDDE+L  LKEE G+E+   V  A+ E+NEYN SGRYVIPELWNFKEGRKAT
Sbjct  553   GKPQEVIQEDDEKLQALKEELGDEVYKVVTTALLEMNEYNPSGRYVIPELWNFKEGRKAT  612

Query  332   LKEVVSFIFKQLKTHKRKR  276
             L EVV +I +Q KTHKRKR
Sbjct  613   LTEVVRYIMRQWKTHKRKR  631



>ref|XP_006306990.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 ref|XP_006306991.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 gb|EOA39888.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
 gb|EOA39889.1| hypothetical protein CARUB_v10008566mg [Capsella rubella]
Length=633

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/616 (51%), Positives = 434/616 (70%), Gaps = 8/616 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y E PY  L++G YKVK  NG LRCPFC+GKKKQDYKYK+L  HA+GV KGSA RS KQK
Sbjct  19    YSETPYLLLQNGSYKVK-VNGQLRCPFCSGKKKQDYKYKELYAHASGVSKGSATRSAKQK  77

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRA------VAPEDNNLYCWPWTGIVVNVSKDNANGTA  1764
             ANH+ALAK+L+ +L   AEP+P           P    +Y WPW GIV+N  KD      
Sbjct  78    ANHLALAKFLDNELAGHAEPVPPPPVPQLDKTKPNPGEVYVWPWMGIVLNPLKDADEKEV  137

Query  1763  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSK  1584
             +    YW +R SK++  EV  F  ++     V+ K  SDW+G+ NA   E  FE E  SK
Sbjct  138   LLTSAYWFERLSKFKPIEVNAFWVEQDSIVGVIAKFISDWSGFANAAALEKEFENEGCSK  197

Query  1583  KEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSN  1404
             KEWT       S  YGW A+ +DY ++G +G YL +  +L+T++D+ QE+ +D++ +L  
Sbjct  198   KEWTERSGVAESKAYGWCAREEDYNSQGPIGEYLSKEGKLRTVSDISQEKTQDRNVVLEE  257

Query  1403  LTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLH  1224
             L+  + + NE+LS +   +N   +SL R+++EK  LH AF EE++KMQ+++   +Q++L+
Sbjct  258   LSTMIAMTNEDLSNIQYSYNRTAMSLQRVLDEKKNLHEAFAEETKKMQQMSLRKIQKILN  317

Query  1223  EQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKK  1044
             ++E L+ EL++K + L+S  ++L+K+E LTE E+ KLDEEK+++D  N SL +AS EQKK
Sbjct  318   DKEKLSDELDRKMRDLESRAKQLDKQEALTELERQKLDEEKRKSDAMNKSLLLASHEQKK  377

Query  1043  ADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSA  864
             +DE+VLRL+EEHKR+KE AL KIL LEK +D KQ LEMEIQELKGKL VM+H+G DDD A
Sbjct  378   SDESVLRLVEEHKRQKEDALNKILLLEKQLDTKQTLEMEIQELKGKLQVMKHLGNDDDEA  437

Query  863   VQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS  684
             V++K++EM E L+EK  +++ L+ MN+ L+ KER+SNDE+Q ARK LI  L+ LL +  +
Sbjct  438   VKQKMQEMNETLEEKKSELEGLEHMNSVLMTKERESNDEIQAARKKLIAVLTVLLGA-ET  496

Query  683   HIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRP  504
              IG++RMGE+D K F NVCK+R+S  EA V+A  LCS WQE +K+P+W PF+     D+ 
Sbjct  497   EIGVKRMGELDEKPFLNVCKRRYSANEATVEAATLCSTWQENLKNPSWLPFKREGTGDKV  556

Query  503   EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKE  324
             +++++E+DE+L KL+ EWGEE+  AV  A+EE+NEYNASGRY  PELWNFKEGRKATLKE
Sbjct  557   KEVVDEEDEQLKKLRREWGEEVHNAVKTALEEMNEYNASGRYTTPELWNFKEGRKATLKE  616

Query  323   VVSFIFKQLKTHKRKR  276
             V+ FI   +KT KRKR
Sbjct  617   VICFISDNIKTLKRKR  632



>ref|XP_010476691.1| PREDICTED: factor of DNA methylation 1-like [Camelina sativa]
Length=636

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/619 (51%), Positives = 439/619 (71%), Gaps = 11/619 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y E PY  L++G YKV   NG LRCPFC+GKKKQDYKYK+L  HATGV KGSA RS KQK
Sbjct  19    YSETPYLLLQNGSYKVI-VNGQLRCPFCSGKKKQDYKYKELYAHATGVSKGSATRSAKQK  77

Query  1925  ANHVALAKYLEIDLGDQAEPLP---------QRAVAPEDNNLYCWPWTGIVVNVSKDNAN  1773
             ANH+ALAK+LE +L   AEP+P         +  + P   ++Y WPW GIV+N   D  +
Sbjct  78    ANHLALAKFLENELAGHAEPVPRPPPVPPQLEETLEPNPRDVYVWPWMGIVLNPLTDTDD  137

Query  1772  GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               A+   +YWL R SK++  EV  F  ++     V+ K  SDW G+  A   E  FE + 
Sbjct  138   KEALLSSEYWLNRLSKFKPVEVNAFWVEQDSIVGVIAKFTSDWGGFACATELEKEFENQG  197

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             HSKKEWT       S  YGW A+  DY ++G +G YL    +L+T++D+ QE+++D++ +
Sbjct  198   HSKKEWTERTGDSESKAYGWCARAQDYYSQGPIGEYLCREGKLRTVSDISQEKEQDRNIV  257

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             L  LT  + + N++LS +   +N   +SL R+++EK  LH AF +E++KMQ+++  H+QR
Sbjct  258   LDELTTMIAMTNDDLSKVQYSYNRTEMSLQRVLDEKKHLHAAFADETKKMQQMSLRHIQR  317

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             VL+++E  + EL++K + L++  ++L K+E +TE EK KLDEEKK+++  N SL +AS+E
Sbjct  318   VLYDKEKQSDELDRKMRDLEARTKQLEKQEAITELEKQKLDEEKKKSEAMNKSLLLASRE  377

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKADE+VLRL+EEHKR+ E AL KIL LEK +D KQ LEMEIQELKGKL VM+H+G DD
Sbjct  378   QKKADESVLRLVEEHKRQNEDALNKILLLEKQLDTKQTLEMEIQELKGKLQVMKHLGNDD  437

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D AV++K++EM ++L+EK  +++ L++MN+ L+ KERQSNDE+Q ARK LI+GL+ LL +
Sbjct  438   DEAVKKKMQEMNDELEEKKSELEGLEQMNSDLMTKERQSNDEIQAARKKLIKGLTGLLGA  497

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
               + IG++RMGE+D K F NVCK R+S  EA V+A  LCS WQE +K+P+W PF+ +   
Sbjct  498   -ETDIGVKRMGELDEKPFLNVCKLRYSANEATVEAATLCSTWQENLKNPSWLPFKRVGSG  556

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              R +++++E+DE+L KLK EWGE +  AV  A+EE+NEYNASGRY  PELWNFKEGRKAT
Sbjct  557   GRVKEVVDEEDEQLKKLKREWGEAVHNAVKTALEEMNEYNASGRYATPELWNFKEGRKAT  616

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+SFI + +KT KRKR
Sbjct  617   LKEVISFISENIKTLKRKR  635



>ref|XP_009416142.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416143.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416144.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416145.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416146.1| PREDICTED: uncharacterized protein LOC103996844 [Musa acuminata 
subsp. malaccensis]
Length=630

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/623 (50%), Positives = 439/623 (70%), Gaps = 17/623 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             + EY+EK Y  L++G++ V+  +   RCPFC+GKKKQDY YKDLLQHATG+G  ++NR  
Sbjct  15    VPEYEEKIYLRLKAGQFIVRNTDKTCRCPFCSGKKKQDYNYKDLLQHATGIG--ASNRKG  72

Query  1934  KQKANHVALAKYLEIDLGDQA---------EPLPQRAVAPEDNNLYCWPWTGIVVNVSKD  1782
             K KA H ALAKYL  D+ D           +P P ++ + ED   + WPW G+VVNV  +
Sbjct  73    KVKATHRALAKYLNNDITDTTCSSEQLVVFQPKPSKSTS-EDQ--FVWPWMGVVVNVPTE  129

Query  1781  NANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  1605
               NG  V E    LK + S++   +V    + +  T   ++    DW G+K+A+ FEN F
Sbjct  130   FKNGQYVGESGNRLKEQLSRFHPLKVHPLWNHRGHTGIAIMDFTKDWTGFKDAMAFENNF  189

Query  1604  EAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRD  1425
             EAE + K+ W  E+    S +YGW A+ DDY + G VG YLR+   LK++ DL  EE R 
Sbjct  190   EAEHYGKRNWL-EKKQRGSDIYGWVARADDYNSAGPVGDYLRKNGDLKSVADLATEESRK  248

Query  1424  KDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLARE  1245
              D++++NL +++++KN++L  L  ++NE  +SL +M+EE+D+L +A+ EE RKMQ LAR+
Sbjct  249   TDRLVANLASQIEVKNKHLQELECKYNETTISLDKMMEERDSLLQAYNEEIRKMQHLARD  308

Query  1244  HVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM  1065
             H +++L E E L SEL+ K+++L+    +L+K     + +K KLD+E+++N  +N+SL++
Sbjct  309   HSRKILTENEKLRSELDSKRQELEMRRNQLDKLVAQNDVDKRKLDDERQKNAMKNNSLQL  368

Query  1064  ASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHM  885
             A+ EQKKADENVL+L+E+HKREKEAAL+KIL+LEK +D KQKLE+EIQ+LKG+L +M+HM
Sbjct  369   ATMEQKKADENVLKLLEDHKREKEAALKKILKLEKQLDQKQKLELEIQQLKGQLQIMKHM  428

Query  884   GGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD  705
              GD+D+ V++KI EM EQL EKIE+M DL+ +N  LV+KER+SNDELQEARK LIQGL D
Sbjct  429   EGDEDATVKKKIDEMSEQLKEKIEEMDDLEALNQTLVVKERKSNDELQEARKALIQGLGD  488

Query  704   LLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV  525
             LL S RS I I+RMGE+D   F   CKQRFS +EA++KA E CS WQ ++K P WHPF++
Sbjct  489   LLGS-RSLIAIKRMGELDDGPFLPACKQRFSKDEAEIKAAEYCSHWQHELKKPEWHPFKI  547

Query  524   INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
             ++   +P++ I EDDE+L  LKEE G+ +  AV  A+ E+NEYN SGRY IPELWN K  
Sbjct  548   VDTDGKPQEFIKEDDEKLRALKEELGDAVYKAVTTALLEMNEYNPSGRYPIPELWNSKAE  607

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             RKATL EV+++I KQ KT+KRKR
Sbjct  608   RKATLTEVINYILKQWKTYKRKR  630



>emb|CDY52860.1| BnaA09g56520D [Brassica napus]
Length=638

 Score =   533 bits (1373),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 305/619 (49%), Positives = 438/619 (71%), Gaps = 11/619 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21    YSQKPYLKLQTGHYKVK-VNGTLRCPFCSGKKKQDYKYKELIAHASGVSKGSVSRSAKQK  79

Query  1925  ANHVALAKYLEIDL-GDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANGT  1767
             ANH+ALAKYLE +L GD AE LP+  +       P+  ++Y WPW GIV+N  K+  +  
Sbjct  80    ANHLALAKYLETELAGDHAEGLPRPYLPLSNESEPKPGDVYVWPWMGIVMNPLKETDDDK  139

Query  1766  AVEEED-YWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              V  +  YWLKR S+++  +V +F  ++     VV +  SDW+G+ +A   E  FE E  
Sbjct  140   EVLLDSWYWLKRLSRFKPVDVNVFWIEQDCVIAVVAEFNSDWSGFASATELEKEFEREGC  199

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SKKEW  +R    S  YGW A+ +DY +EG +G YL +  +L+T++D+ QE+  D++ +L
Sbjct  200   SKKEWVEKRGESESKAYGWCARAEDYNSEGVIGEYLSKEGKLRTVSDISQEKAEDRNSVL  259

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
               L++ +D+ NE+L+ +   +NE  + L R+ ++K  L  A+ EE++KM +++   +Q++
Sbjct  260   EELSSMIDMTNEDLNKVQYSYNETAMLLKRVKDQKKNLEEAYAEETKKMHQMSMRSIQKI  319

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L ++E L++ELE K  +L +W++EL K+E LTE E+ KLDEEKK+ND  N SL++AS EQ
Sbjct  320   LEDKERLSNELEAKMLRLKNWSKELEKKEALTELERQKLDEEKKKNDAMNISLKLASHEQ  379

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KAD+NVLRL+EEHKR+K+ A+ KILEL+  +D KQ LEMEIQELKGKL VM+H+G  DD
Sbjct  380   EKADQNVLRLVEEHKRQKDEAMSKILELKTQLDTKQTLEMEIQELKGKLQVMKHLGDADD  439

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
              AV++ +KEM ++L+++  D++ L++MN+ L+ KERQSN E+Q ARK LI  L+ LL + 
Sbjct  440   EAVKQTMKEMNDKLEDRKSDLEQLEQMNSDLMTKERQSNFEIQAARKTLIARLTGLLGA-  498

Query  689   RSHIGIRRMGEIDG-KAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              S IG++RMGE++  + F N CK+R+S +EA V+ + LCS WQ+ + D  W PF+     
Sbjct  499   ESDIGVKRMGELENLEPFLNACKKRYSADEAMVEGVTLCSTWQKNINDSTWQPFKREGTG  558

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
             D+  ++++E+DE+L KLK EWGEE+  AV  A+EE+NEYN SGRY  PELWNF+ GRKAT
Sbjct  559   DKAIEVVDEEDEKLKKLKGEWGEEVHNAVKTALEEMNEYNPSGRYSTPELWNFEAGRKAT  618

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+SFI   +K  KRKR
Sbjct  619   LKEVISFISNDMKPVKRKR  637



>ref|XP_009117794.1| PREDICTED: myosin-11-like [Brassica rapa]
 ref|XP_009117795.1| PREDICTED: myosin-11-like [Brassica rapa]
 ref|XP_009117796.1| PREDICTED: myosin-11-like [Brassica rapa]
Length=638

 Score =   533 bits (1373),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 305/619 (49%), Positives = 438/619 (71%), Gaps = 11/619 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21    YSQKPYLKLQTGHYKVK-VNGTLRCPFCSGKKKQDYKYKELIAHASGVSKGSVSRSAKQK  79

Query  1925  ANHVALAKYLEIDL-GDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANGT  1767
             ANH+ALAKYLE +L GD AE LP+  +       P+  ++Y WPW GIV+N  K+  +  
Sbjct  80    ANHLALAKYLETELAGDHAEGLPRPYLPLSNESEPKPGDVYVWPWMGIVMNPLKETDDDK  139

Query  1766  AVEEED-YWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              V  +  YWLKR S+++  +V +F  ++     VV +  SDW+G+ +A   E  FE E  
Sbjct  140   EVLLDSWYWLKRLSRFKPVDVNVFWIEQDCVIAVVAEFNSDWSGFASATELEKEFEREGC  199

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SKKEW  +R    S  YGW A+ +DY +EG +G YL +  +L+T++D+ QE+  D++ +L
Sbjct  200   SKKEWVEKRGESESKAYGWCARAEDYNSEGVIGEYLSKEGKLRTVSDISQEKAEDRNSVL  259

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
               L++ +D+ NE+L+ +   +NE  + L R+ ++K  L  A+ EE++KM +++   +Q++
Sbjct  260   EELSSMIDMTNEDLNKVQYSYNETAMLLKRVKDQKKNLEEAYAEETKKMHQMSMRSIQKI  319

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             L ++E L++ELE K  +L +W++EL K+E LTE E+ KLDEEKK+ND  N SL++AS EQ
Sbjct  320   LEDKERLSNELEAKMLRLKNWSKELEKKEALTELERQKLDEEKKKNDAMNISLKLASHEQ  379

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KAD+NVLRL+EEHKR+K+ A+ KILEL+  +D KQ LEMEIQELKGKL VM+H+G  DD
Sbjct  380   EKADQNVLRLVEEHKRQKDEAMSKILELKTQLDTKQTLEMEIQELKGKLQVMKHLGDADD  439

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
              AV++ +KEM ++L+++  D++ L++MN+ L+ KERQSN E+Q ARK LI  L+ LL + 
Sbjct  440   EAVKQTMKEMNDKLEDRKSDLEQLEQMNSDLMTKERQSNFEIQAARKTLIARLTGLLGA-  498

Query  689   RSHIGIRRMGEIDG-KAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              S IG++RMGE++  + F N CK+R+S +EA V+ + LCS WQ+ + D  W PF+     
Sbjct  499   ESDIGVKRMGELENLEPFLNACKKRYSADEAMVEGVTLCSTWQKNINDSTWQPFKREGTG  558

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
             D+  ++++E+DE+L KLK EWGEE+  AV  A+EE+NEYN SGRY  PELWNF+ GRKAT
Sbjct  559   DKAIEVVDEEDEKLKKLKGEWGEEVHNAVKTALEEMNEYNPSGRYSTPELWNFEAGRKAT  618

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKEV+SFI   +K  KRKR
Sbjct  619   LKEVISFISNDMKPVKRKR  637



>ref|XP_010910789.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=625

 Score =   530 bits (1365),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 308/623 (49%), Positives = 436/623 (70%), Gaps = 23/623 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             ++EY+E  Y  L++GK +V+ P+G  RCPFCAGKKKQ+Y YKDLLQHATGVG  S +R  
Sbjct  16    LDEYEEDYYRVLKTGKQRVRNPDGTFRCPFCAGKKKQEYLYKDLLQHATGVG-ASNSRRA  74

Query  1934  KQKANHVALAKYLEIDLGDQA-----EPLPQ--RAVAPEDNNLYCWPWTGIVVNVSKDNA  1776
             K+KA H A A++L+ DL D A      P+ Q  +A  P D+ L+ WPW G+++NV     
Sbjct  75    KEKATHRAFARFLKTDLADAAGCSQFAPVEQEQQAPKPSDDELFVWPWMGVLINV-----  129

Query  1775  NGTAVEEEDYWL-KRFSKYEAQEVKIFCDD--KSRTSQVVIKLKSDWNGYKNAILFENAF  1605
                  EE  + L ++ S +   +V    +   +S     V++   DW G+K+A+ FEN F
Sbjct  130   ---PAEEGGFKLGEKISDFNPIDVIPLGEGICQSERGAAVVRFNKDWGGFKDAMDFENHF  186

Query  1604  EAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRD  1425
             +A    KK+W       S   YGW A+ DDY ++  VG++L++  +L+TI+D+ +EE ++
Sbjct  187   KASHRGKKDWNESVGDGSGMFYGWIARDDDYNSKDIVGHHLQKHGELRTISDVAKEESKE  246

Query  1424  KDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLARE  1245
               KI++ L N++++KN+ L  L  R+N   LSL+R++EEKD LH+A+ EE R MQR+ARE
Sbjct  247   TGKIVAILANQIEVKNKYLQDLEFRYNVTALSLNRIMEEKDKLHQAYNEEMRNMQRMARE  306

Query  1244  HVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM  1065
             +  R+  E + L SEL+ K+K+LD   +EL+K EV  + EK KLD EK++    NSSLE+
Sbjct  307   NAHRIFEENQKLRSELDMKRKELDLRCKELDKLEVQNDSEKRKLDNEKQKTALENSSLEL  366

Query  1064  ASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHM  885
             AS EQKKADE+VLRL+E+ KREKEAAL KIL+LEK +D KQKL++EI++LKG L VMEH+
Sbjct  367   ASIEQKKADEDVLRLVEDQKREKEAALAKILQLEKQLDQKQKLQLEIEQLKGTLRVMEHL  426

Query  884   GGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD  705
              G+DD+ +++K   M+E  ++  E+   L+ +N  L+ KER+SNDELQEARK LI GL D
Sbjct  427   KGEDDTDMEKK---MEELTEKLEEEKNILESLNATLISKERKSNDELQEARKELIMGLDD  483

Query  704   LLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV  525
             LLN GR+ IGI+RMGE+D K FHN C++R+  ++AD KA ELC+ WQE++K P+WHP+++
Sbjct  484   LLN-GRTLIGIKRMGELDEKPFHNACRKRYKADDADTKAAELCTSWQEELKQPSWHPYKI  542

Query  524   INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
             ++  +   +II+EDDE+L  L  E G+++C AV  A+ E+NEYN SGRYVIPELWNFKEG
Sbjct  543   VHDDEGAREIIDEDDEKLKNLWIELGDDVCNAVKTALIEINEYNPSGRYVIPELWNFKEG  602

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             RKAT+KEV+ +IFKQ K +KRKR
Sbjct  603   RKATMKEVIQYIFKQWKNNKRKR  625



>emb|CDY33370.1| BnaC05g12130D [Brassica napus]
Length=1005

 Score =   540 bits (1391),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 322/641 (50%), Positives = 452/641 (71%), Gaps = 34/641 (5%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y E PY  L++GKYKVK  NG LRCPFC+ KKKQDYKYK+L+ HA+GV KGSA+RS KQK
Sbjct  367   YSETPYLLLQNGKYKVK-VNGTLRCPFCSNKKKQDYKYKELMAHASGVSKGSASRSAKQK  425

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYCWPWTGIVVNVSKDNANG  1770
             ANH+ALA+YL+ +L   AEPLP+    P   N        +Y WPW GI+++   +  + 
Sbjct  426   ANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKPGEVYVWPWMGIIISPLNETDDK  485

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              A+ +   WLK  S+++  EV  F  ++  T  VV K  SDW+G+ +A   E  FE+   
Sbjct  486   EALLDPACWLKELSRFKPVEVHAFWVEQGLTVGVVAKFNSDWSGFASATELEKEFESIGC  545

Query  1589  SKKEWTAERS--SPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
             SKKEW  +R   S S   YGW A+ +DY +EG +G YL +  +L+T++D+ QE+ +D++ 
Sbjct  546   SKKEWMEKRGGDSVSKKAYGWCARAEDYHSEGPIGEYLSKEGKLRTVSDISQEKAQDRNS  605

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             +L  L++ + + NE+L+ +   +N+  +SL R+++EK TLH A+  E++KMQ+++   +Q
Sbjct  606   VLEQLSDIIAMTNEDLNKVQYSYNKTAMSLKRVLDEKKTLHEAYANETKKMQQMSILSIQ  665

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             ++L+++E L++ELEKK ++L  W++ L+K+E LTE E+ KLDEEKK+ND  N SL++AS 
Sbjct  666   KILNDKERLSNELEKKMQKLSEWSKALDKKEALTELERQKLDEEKKKNDAMNISLQLASH  725

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQKKADE+VLRL+EEHKR+KE AL KIL+LE  +D KQ LEMEIQELKGKL VM+H+G D
Sbjct  726   EQKKADESVLRLVEEHKRQKEEALSKILQLETQLDTKQTLEMEIQELKGKLQVMKHLGDD  785

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD AV++K+KEM ++L++K  +++ L++MN+AL+ KERQSNDE+Q ARK LI GL+ LL 
Sbjct  786   DDEAVKQKMKEMNDELEDKKSELEGLEQMNSALMTKERQSNDEIQAARKKLIAGLTGLLG  845

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV---  525
             +  + IG++RMGE+D K F NVCK+RFS +EA V+A  LCS WQE +KD +W PF+    
Sbjct  846   A-ETDIGVKRMGELDEKPFLNVCKKRFSEDEATVEAATLCSTWQENLKDSSWQPFKREGT  904

Query  524   ------------------INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNE  399
                               +N+ ++PE +++EDDE+L KLK EWGEE+  AV  A+EE+NE
Sbjct  905   GDKAKACSLSHCLLPLSELNMLEKPE-VVDEDDEQLKKLKGEWGEEVHNAVKTALEEMNE  963

Query  398   YNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             YNASGRY   ELWNFK GRKATLKEV++FI   +KT KRKR
Sbjct  964   YNASGRYTTSELWNFKVGRKATLKEVINFISNDIKTVKRKR  1004



>ref|XP_008784591.1| PREDICTED: uncharacterized protein LOC103703501 [Phoenix dactylifera]
 ref|XP_008784593.1| PREDICTED: uncharacterized protein LOC103703501 [Phoenix dactylifera]
Length=625

 Score =   522 bits (1344),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 308/623 (49%), Positives = 434/623 (70%), Gaps = 23/623 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             ++EY+E  Y  L++G ++VK P+G  RCPFCAGKKKQ+Y YKDLLQHATGVG  S +R  
Sbjct  16    LDEYEEDYYIVLKTGNHRVKNPDGTFRCPFCAGKKKQEYLYKDLLQHATGVG-ASNSRRA  74

Query  1934  KQKANHVALAKYLEIDLGD-----QAEPLPQRAVAPE--DNNLYCWPWTGIVVNVSKDNA  1776
             K+KA H A A++L+ DL D     Q  P+ Q   AP+  D+ L+ WPW G+++NV     
Sbjct  75    KEKATHRAFARFLKTDLADAAGSSQLSPVEQEQHAPKPCDDELFVWPWMGLLINV-----  129

Query  1775  NGTAVEEEDYWL-KRFSKYEAQEVKIFCDD--KSRTSQVVIKLKSDWNGYKNAILFENAF  1605
                 VEE  + L ++ S +   +V    +   +S     V++   DW+G+K+A+ FEN F
Sbjct  130   ---PVEEGGFKLGEKISDFNPVDVIPLGEGICQSERGAAVVRFNKDWSGFKDAMAFENHF  186

Query  1604  EAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRD  1425
             +A    KK+W       S   YGW A+ DDY ++  VG++L+   +L+TI+D+ +EE ++
Sbjct  187   KASHRGKKDWNESVGDGSGMFYGWIARDDDYNSKDIVGHHLQRHGELRTISDVAKEESKE  246

Query  1424  KDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLARE  1245
               KI++ L N++++KN+ L  L  R+N   LSL+R++EEKD LH+A+ EE R MQR+ARE
Sbjct  247   TGKIVAILANQIEVKNKYLQDLEFRYNVTALSLNRIMEEKDKLHQAYNEEMRNMQRMARE  306

Query  1244  HVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM  1065
             +  R+  E + L SEL+ K+K+LD   +EL+K EV  + EK KLD EK++    NSSLE+
Sbjct  307   NAHRIFEENQKLRSELDMKRKELDLRCKELDKLEVQNDSEKKKLDNEKQKTALENSSLEL  366

Query  1064  ASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHM  885
             AS EQKKADE+VLRL+E+ KREKEAAL KIL+LEK +D KQKL++EI++LKG L VMEH+
Sbjct  367   ASIEQKKADEDVLRLVEDQKREKEAALAKILQLEKQLDQKQKLQLEIEQLKGTLRVMEHL  426

Query  884   GGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD  705
              G+DD+ +++K   M+E  ++  E+   L+ +N  L+ KER+SNDELQEARK LI GL D
Sbjct  427   KGEDDTDMEKK---MEELTEKLEEERSILESLNATLISKERKSNDELQEARKELIMGLDD  483

Query  704   LLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV  525
             LL S R+ IGI+RMGE+D K F N C++R+  E+AD KA ELCS WQE++K P+WHP+++
Sbjct  484   LL-SARALIGIKRMGELDEKPFQNACRKRYKAEDADTKAAELCSSWQEELKIPSWHPYKI  542

Query  524   INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
             +N  +   +II+EDDE+L  L  E G+++  AV  A+ E+N+YN SGRYVIPELWNFKEG
Sbjct  543   VNDDEGAREIIDEDDEKLKNLWIELGDDVYNAVKIALMEINDYNPSGRYVIPELWNFKEG  602

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             RKAT+KEV+ +IFKQ K +KRKR
Sbjct  603   RKATMKEVIQYIFKQWKNNKRKR  625



>emb|CDY35048.1| BnaA06g10580D [Brassica napus]
Length=598

 Score =   509 bits (1312),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 291/599 (49%), Positives = 415/599 (69%), Gaps = 36/599 (6%)
 Frame = -1

Query  1976  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAE----------PLPQRAVAPEDNNL  1827
             HA+GV KGSA+RS KQKANH+ALA+YL+ +L   AE           L +    P    +
Sbjct  3     HASGVSKGSASRSAKQKANHLALARYLQNELAGDAEPLPRPPPVPPQLNESEAKP--GEV  60

Query  1826  YCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSD  1647
             Y WPW GI+V+  K+  +  A+ +   WLK  S+++  EV  F  ++     VV K  SD
Sbjct  61    YVWPWMGIIVSPLKETDDKEALLDSACWLKELSRFKPVEVHAFWVEQGLIVGVVAKFNSD  120

Query  1646  WNGYKNAILFENAFEAECHSKKEWTAERSSPS-SHVYGWFAKVDDYEAEGAVGYYLRETR  1470
             W+G+ +A   E  FE+   SKKEW  +R   S S  YGW A+ +DY +EG +G YL +  
Sbjct  121   WSGFASATELEKEFESIGCSKKEWVEKRGGGSVSKAYGWCARAEDYHSEGPIGEYLSKEG  180

Query  1469  QLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHR  1290
             +L+T++D+ QE+ +D++ +L  L++ + + NE+L+ +   +N+  +SL R+++EK TLH 
Sbjct  181   KLRTVSDISQEKAQDRNSVLEQLSDIIAMTNEDLNKVQYSYNKTAMSLKRVLDEKKTLHE  240

Query  1289  AFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkld  1110
             A+  E++KMQ+++   +Q++L+++E L++ELEKK ++L  W++ L+K+E LTE E+ KLD
Sbjct  241   AYANETKKMQQMSILSIQKILNDKERLSNELEKKMQKLSEWSKALDKKEALTELERQKLD  300

Query  1109  eekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEM  930
             EEKK+ND  N SL++AS EQKKADE+VLRL+EEHKR+KE AL KIL+LE  +D KQ LEM
Sbjct  301   EEKKKNDAMNISLQLASHEQKKADESVLRLVEEHKRQKEEALSKILQLETQLDTKQTLEM  360

Query  929   EIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSND  750
             EIQELKGKL VM+H+G DDD AV++K+KEM ++L++K  +++ L++MN+AL+ KERQSND
Sbjct  361   EIQELKGKLQVMKHLGDDDDEAVKQKMKEMNDELEDKKSELEGLEQMNSALMTKERQSND  420

Query  749   ELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSL  570
             E+Q ARK LI GL+ LL +  + IG++RMGE+D K F NVCK+RFS +EA V+A  LCS 
Sbjct  421   EIQAARKKLISGLTGLLGA-ETDIGVKRMGELDEKPFLNVCKKRFSEDEATVEAATLCST  479

Query  569   WQEKVKDPNWHPFRV---------------------INIHDRPEQIINeddeelsklkeE  453
             WQE +KD +W PF+                      +N+ ++PE +++EDDE+L KLK E
Sbjct  480   WQENLKDSSWQPFKREGTGDKAKACSLSHCLLPLFELNMLEKPE-VVDEDDEQLKKLKGE  538

Query  452   WGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             WGEE+  AV  A+EE+NEYNASGRY   ELWNFK GRKATLKEV++FI   +KT KRKR
Sbjct  539   WGEEVHNAVKTALEEMNEYNASGRYTTSELWNFKVGRKATLKEVINFISNDIKTVKRKR  597



>ref|XP_004968083.1| PREDICTED: synaptonemal complex protein 1-like [Setaria italica]
Length=631

 Score =   510 bits (1314),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 290/620 (47%), Positives = 432/620 (70%), Gaps = 11/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+E + + YE+L+SG  KVK       CPFC  K+K+DY   +LLQHATGVG  +ANR  
Sbjct  16    IDEREAEVYEQLKSGNIKVKDRE-AYSCPFCRDKRKKDYSKSNLLQHATGVG-SAANRQA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNL------YCWPWTGIVVNVSKDNAN  1773
             K KA H ALAKYL+ +    +EP  Q  V  E  NL      + WPW G++VNV  +  N
Sbjct  74    KDKATHRALAKYLKDESARSSEPQTQLTVLIEPQNLGNRDDQFVWPWMGVLVNVPTEWKN  133

Query  1772  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             G  V E    LK + S +  Q+V    + +  T   +++   DW G+KNA+ FEN FEAE
Sbjct  134   GRQVGESGNRLKEQLSHFCPQKVIPLWNYRGHTGNAIVEFAKDWTGFKNALAFENHFEAE  193

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              + K++W  ++    S ++GW A+VDD+  +G +G +LR+   LKT+ DL  E  R  DK
Sbjct  194   GYGKRDWKLKKYR-GSEMFGWVARVDDHRCQGPIGDHLRKNGDLKTVGDLENEGIRKTDK  252

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             +++NL +++++K+ ++  L ++ NE   SL RM+E+++ L + + EE RK+Q++AR H Q
Sbjct  253   LVANLASQIEVKHRHVQELESKCNETTASLDRMMEQREQLLQNYNEEIRKIQQIARRHSQ  312

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R++ E + L SELE K ++LDS ++EL++    ++ ++  L +EK++N  +   L+MA+ 
Sbjct  313   RIIDENQKLRSELESKMQELDSRSKELDELASQSDYDRRNLQQEKEKNQMKTKHLKMATM  372

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+++DENVL+L+EEHKREK+ AL+KIL+L++ +DAKQKLE++IQ+L+GKL+VM+HM G+
Sbjct  373   EQQRSDENVLKLVEEHKREKQVALEKILKLQQQLDAKQKLELDIQQLQGKLEVMKHMPGE  432

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             +DS  ++KIKE+ E L +K ++M+ ++ +N  LV+KER+SNDELQ ARK LI G  +L +
Sbjct  433   EDSESKKKIKELSEDLQDKYDEMEAMESLNQTLVIKERKSNDELQNARKELIAGFKEL-S  491

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
              GR +IGI+RMGE+D KAF N C++R S ++A+V +  LCS W++++++PNWHPF+V+ I
Sbjct  492   VGRINIGIKRMGELDPKAFGNACRKRLSKDDAEVTSAILCSKWEDEIRNPNWHPFKVVLI  551

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               +  ++++E+DE LSKLKEE GEEI   V KA+ E+NEYN SGRY +PELWNFKEGRKA
Sbjct  552   DGKETEVLSEEDENLSKLKEEHGEEIYVLVTKALVEINEYNPSGRYPVPELWNFKEGRKA  611

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKE V  + KQ +THKRKR
Sbjct  612   TLKEAVQHVMKQWRTHKRKR  631



>ref|XP_010472874.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   506 bits (1302),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 287/617 (47%), Positives = 429/617 (70%), Gaps = 10/617 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20    YAEKPYELMKNGNYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  1925  ANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  1767
             ANH ALAKY++ +L GD   P PQ   +         +++Y WPW GIV+   +   N  
Sbjct  79    ANHFALAKYMQNELAGDSDVPRPQIPSSSSKQSQAVVDDVYVWPWMGIVIYPVRRTDNNY  138

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
              + +  YW K+ + ++  EVK    ++     V+ +  S  +G+K+A   E  +E     
Sbjct  139   YLLDSAYWSKKLACFDPFEVKTLWLEQDSVVAVIPQFNSGMSGFKSATELEKEYEIRGCG  198

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             KK+W+ +R    S  YGW A+ DDY ++G++  YL +   L++ +D+ +EE ++K+ ++ 
Sbjct  199   KKDWSDKRGDWRSKTYGWCARSDDYNSQGSIAEYLSKVGTLRSFSDICKEEIQNKNSVVD  258

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             +L N++ + NENL+ +  ++N+K +SL  +++EKD L R +  ES+KMQ  +R+++ R+ 
Sbjct  259   DLANKIAMTNENLNKVQYKYNQKAISLREVLKEKDALDRTYKAESKKMQESSRDNLNRIF  318

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              E+E L +ELE K   L  W++EL+K++ LTE E+ +LDE+KK++D  NSSL++AS EQK
Sbjct  319   REKERLTNELEAKMNNLKIWSKELDKKQALTELERQQLDEDKKKSDVMNSSLQLASLEQK  378

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             K D+ VL L+EEHKR+KE  L KIL+LEK+ D+KQKL+MEIQELKGKL VM+H   DDD 
Sbjct  379   KTDDRVLTLVEEHKRKKEEILNKILQLEKESDSKQKLQMEIQELKGKLQVMKHEDEDDDD  438

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
              V++K+K+MKE L+EK  +++DL+E N+AL++KERQSNDE+QEAR +L   L +LL S R
Sbjct  439   -VKQKMKKMKEDLEEKCSELQDLEEFNSALMIKERQSNDEIQEARAVLTTELRELL-SER  496

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDR  507
             + I ++R+GE+D K F   CKQRF+ EEA V+   LCS WQE +KD  WHPF+ +   D+
Sbjct  497   TIIRVKRVGELDEKPFMRACKQRFTAEEAAVQHAILCSKWQENLKDSAWHPFKHVGTGDK  556

Query  506   PEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLK  327
               ++++E+DE++  L+EEWGEE+  AV  A+EE+NE+N SGRY +P LW+ K+GRKA+LK
Sbjct  557   KTEVVDEEDEQMKNLREEWGEEVKNAVKTALEELNEFNPSGRYSVPVLWHSKQGRKASLK  616

Query  326   EVVSFIFKQLKTHKRKR  276
             EV+ ++ +QLK  K+++
Sbjct  617   EVIDYMTQQLKILKKRK  633



>ref|XP_010256908.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
 ref|XP_010256909.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
 ref|XP_010256910.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Nelumbo nucifera]
Length=642

 Score =   503 bits (1296),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 291/629 (46%), Positives = 439/629 (70%), Gaps = 18/629 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I E+++K Y++L++G Y+VK      RCPFC GK+K+DY Y ++LQHA G+G GS NRSV
Sbjct  16    IEEHEDKSYKKLKNGNYQVKTSGESFRCPFCPGKRKRDYLYMEILQHAAGLGTGSHNRSV  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAV---APEDNNL---YCWPWTGIVVNVSKDNAN  1773
             KQKANH+AL KYL+ ++     P  +RA     P  +N    + WPWTGIVVN+  +  +
Sbjct  76    KQKANHLALXKYLKTEIAPVGGP-SERAAETKPPTGHNHDEKFVWPWTGIVVNLPIEWKD  134

Query  1772  GTAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
             G  V E    L+ + ++  +    V+   + +  +   +++   +W G+ +A+ FE AF+
Sbjct  135   GRYVGESGSRLRDQLARRGFSPVRVQSLWNHRGHSGTALVEFNKNWPGFNDAMSFEKAFQ  194

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             A+ H KK+W A R    S++Y W A+ DDY++ G +G +L++   LKTI++++ EE R  
Sbjct  195   ADHHGKKDWYA-RERRGSNIYAWVARDDDYKSTGIIGEHLQKIGDLKTISEIVAEETRKT  253

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             DK++SNLTN +++KN +L  +  +F+E ++SLS +++EKD L ++F +E + M +  ++H
Sbjct  254   DKLVSNLTNTIEIKNRHLKEMECKFSETSISLSILMDEKDKLQQSFNKEIQMMHQRTQDH  313

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
             + ++  E + L S+LE ++K+L+   +EL KRE   E E+ KL +E+K N ++N SLEMA
Sbjct  314   LHKIYMEHQKLRSDLESQRKELELRGKELEKREAQNESERRKLFDERKENAKKNISLEMA  373

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEH--  888
             + EQKKA+ENVLRL+E+ KR+KE   ++I++LEK +DAKQ LE+EI+ L+G L+VM+H  
Sbjct  374   TLEQKKANENVLRLVEDQKRQKEDLHKRIIQLEKQLDAKQALELEIERLRGSLNVMKHIE  433

Query  887   --MGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQG  714
               MGG++D  V EK++EM  +L EK ++++ L+ +N  LV+KER+SNDEL EARK LI+G
Sbjct  434   GRMGGEEDKKVTEKMEEMMNELKEKEDELEGLEALNQTLVVKERKSNDELVEARKQLIEG  493

Query  713   LSDLLNSGRSH---IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPN  543
             L DL ++ +     IGI+RMG++D K F    K+++S EEA  KA++LCSLW+E +KDP 
Sbjct  494   LKDLTSNRKPSNCLIGIKRMGDLDSKPFFEAVKRKYSEEEAQEKAVDLCSLWEEYLKDPL  553

Query  542   WHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  363
             WHPF+++ I+ + E+IINEDDE+L  LK EWGEE+C AV+ A+ E+NEYN SGRY I EL
Sbjct  554   WHPFKMVMINGKDEEIINEDDEKLKSLKNEWGEEVCKAVVTALMEINEYNPSGRYTISEL  613

Query  362   WNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             WN KEGRKATLKE +++I KQ K HKRK+
Sbjct  614   WNLKEGRKATLKEGIAYILKQWKQHKRKK  642



>ref|NP_178194.1| FACTOR OF DNA METHYLATION 5 [Arabidopsis thaliana]
 sp|Q9SAI1.1|FDM5_ARATH RecName: Full=Factor of DNA methylation 5 [Arabidopsis thaliana]
 gb|AAF14667.1|AC011713_15 Contains similarity to gb|AF136530 transcriptional regulator 
from Zea mays [Arabidopsis thaliana]
 gb|AEE36451.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=634

 Score =   500 bits (1287),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 301/618 (49%), Positives = 436/618 (71%), Gaps = 11/618 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y EKPYE+L +G YKVK  +   RCPFCAGKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19    YYEKPYEKLMNGDYKVKVKD-TFRCPFCAGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  1925  ANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  1767
             ANH ALAKY+E +L GD   P PQ   +  +      +++Y WPW GIV+N  +   N  
Sbjct  78    ANHFALAKYMENELAGDADVPRPQIPSSSTEQSQAVVDDIYVWPWMGIVINPVRRTDNKN  137

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
              + +  YWLK+ +++   EVK    D+     V+ +  S W+G+K+    E  +E     
Sbjct  138   VLLDSAYWLKKLARFNPLEVKTLWLDQESVVAVIPQFNSGWSGFKSVTELEKEYEIRGCG  197

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             +K+W  +R    S  YGW A+ DDY ++G++  YL +  +L++ +D+ +EE ++K  ++ 
Sbjct  198   RKDWIDKRGDWRSKAYGWCARADDYNSQGSIAEYLSKVGKLRSFSDITKEEIQNKSIVVD  257

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             +L N++ + NE+L+ L    NEK LSL R++ EKD L R + +E++KMQ L+RE + R+ 
Sbjct  258   DLANKIAMTNEDLNKLQYMNNEKTLSLRRVLIEKDELDRVYKQETKKMQELSREKINRIF  317

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              E+E L +ELE K   L  W+++L+K++ LTE E+ KLDE+KK++D  NSSL++AS EQK
Sbjct  318   REKERLTNELEAKMNNLKIWSKQLDKKQALTELERQKLDEDKKKSDVMNSSLQLASLEQK  377

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             K D+ VLRL++EHKR+KE  L KIL+LEK++D+KQKL+MEIQELKGKL VM+H   +DD 
Sbjct  378   KTDDRVLRLVDEHKRKKEETLNKILQLEKELDSKQKLQMEIQELKGKLKVMKH-EDEDDE  436

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
              +++K+K+MKE+L+EK  +++DL++ N+AL++KER+SNDE+ EARK LI  L +L+ S R
Sbjct  437   GIKKKMKKMKEELEEKCSELQDLEDTNSALMVKERKSNDEIVEARKFLITELRELV-SDR  495

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFST-EEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             + I ++RMGE++ K F   C+QR +  EEA V+   LCS WQEKVKD  W PF+ +   D
Sbjct  496   NIIRVKRMGELEEKPFMTACRQRCTVEEEAQVQYAMLCSKWQEKVKDSAWQPFKHVGTGD  555

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
             R +++++E+DEE+ KL+EEWGEE+  AV  A+EE+NE+N SGRY +PELWN K+GRKATL
Sbjct  556   RKKEVVDEEDEEIKKLREEWGEEVKNAVKTALEELNEFNPSGRYSVPELWNSKQGRKATL  615

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEV+ +I +Q+KT KR+R
Sbjct  616   KEVIDYITQQVKTLKRRR  633



>gb|AAF02798.1|AF195115_18 F5I10.22 gene product [Arabidopsis thaliana]
 gb|AAB62840.1| A_IG005I10.22 gene product [Arabidopsis thaliana]
 emb|CAB80796.1| AT4g00380 [Arabidopsis thaliana]
Length=662

 Score =   494 bits (1272),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 302/661 (46%), Positives = 415/661 (63%), Gaps = 68/661 (10%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y + PY  LRS  Y     NG LRCPFC GKKKQDYKYK+L  HATGV KGSA RS  QK
Sbjct  18    YSKTPYHLLRSETYYKVKVNGRLRCPFCVGKKKQDYKYKELHAHATGVSKGSATRSALQK  77

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRA--------VAPEDNNLYCWPWTGIVVNVSKDNANG  1770
             +NH+ALAK+LE DL   AEPLP+            P  +N+Y WPW GIVVN  K+  + 
Sbjct  78    SNHLALAKFLENDLAGYAEPLPRPPVVPPLLDETEPNPHNVYVWPWMGIVVNPLKETDDK  137

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
               + +  YWL+  SK++  EV  F  ++     V+ K  SDW+G+  A   E  FE +  
Sbjct  138   ELLLDSVYWLQTLSKFKPVEVNAFWVEQDSIVGVIAKFDSDWSGFAAATELEKEFETQGS  197

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
              KKEWT       S  YGW A+ DD++++G +G YL +   L+T++D+LQ   +D++ +L
Sbjct  198   CKKEWTERSGDSESKAYGWCARADDFQSQGPIGEYLSKEGTLRTVSDILQNNVQDRNTLL  257

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYE---------ESRKMQR  1257
               L+N +D+ NE+L+     +N   +SL R+++EK  LH+AF E          +    R
Sbjct  258   DVLSNMIDMTNEDLNKAQHSYNRTAMSLQRVLDEKKNLHQAFAEGIYSHTDMFPTHIAFR  317

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
             ++  H+QR+L+++E L +EL++K + L+S  ++L K E LTE E+ KLDE+K+++D  N 
Sbjct  318   MSLRHIQRILYDKEKLRNELDRKMRDLESRAKQLEKHEALTELERQKLDEDKRKSDAMNK  377

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL++AS+EQKKADE+VLRL+EEH+                +D KQ LEMEIQELKGKL V
Sbjct  378   SLQLASREQKKADESVLRLVEEHQ----------------LDTKQTLEMEIQELKGKLQV  421

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARK----  729
             M+H+G DDD AVQ K+KEM ++LD+K  +++DL+ MN+ L+ KERQSNDE+Q AR+    
Sbjct  422   MKHLGDDDDEAVQTKMKEMNDELDDKKAELEDLESMNSVLMTKERQSNDEIQAARQKMIA  481

Query  728   ------------------------------LLIQGLSDLLNSGRSHIGIRRMGEIDGKAF  639
                                            LIQGL+ LL +  S IG++RMGE+D K F
Sbjct  482   VQISNALVFLGTDRVAFLPLSSILEYSKDCSLIQGLTGLLGA-ESDIGVKRMGELDEKPF  540

Query  638   HNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklk  459
              +VCK R+S  EA V+A  LCS W+E +K+P+W PF+     D  E++++EDDE+L KLK
Sbjct  541   LDVCKLRYSANEARVEAATLCSTWKENLKNPSWQPFKREGTGDGAEEVVDEDDEQLKKLK  600

Query  458   eEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRK  279
              EWG+E+  AV  A+ E+NEYNASGRY   ELWNFKEGRKATLKEV++FI   +K  KRK
Sbjct  601   REWGKEVHNAVKAALVEMNEYNASGRYPTSELWNFKEGRKATLKEVITFISTDIKNLKRK  660

Query  278   R  276
             R
Sbjct  661   R  661



>ref|XP_006389833.1| hypothetical protein EUTSA_v10018261mg [Eutrema salsugineum]
 gb|ESQ27119.1| hypothetical protein EUTSA_v10018261mg [Eutrema salsugineum]
Length=634

 Score =   492 bits (1267),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 287/614 (47%), Positives = 427/614 (70%), Gaps = 11/614 (2%)
 Frame = -1

Query  2099  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKAN  1920
             EKPY+ L++GKYKVK      RCPFC+GKKKQ YKYK+LL HATGV KGSA+RS KQKAN
Sbjct  22    EKPYKLLKNGKYKVKLREDTFRCPFCSGKKKQHYKYKELLAHATGVAKGSASRSAKQKAN  81

Query  1919  HVALAKYLEIDL-GDQAEPLPQRAV---APE--DNNLYCWPWTGIVVNVSKDNANGTAVE  1758
             H+AL KY+E +L GD   P  Q  +    PE  D+++Y WPW GIV+   +   +   + 
Sbjct  82    HLALRKYMENELAGDAQLPRLQLILYKKQPEAVDSDIYVWPWMGIVIRPLRTTDDKNLLL  141

Query  1757  EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKE  1578
             +  YWLK+ S++   EV     ++     VV K  S  +G+ +A   +  +E +   KK+
Sbjct  142   DSFYWLKKLSRFNPLEVNTLWLEQDSVVAVVSKFNSGMSGFNSATNLDKEYEIKRCGKKD  201

Query  1577  WTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLT  1398
             W+ +     S  YGW A+ DDY ++G++  YL     LK+ +D+ +EE ++ + ++ +L 
Sbjct  202   WSDKIGDWRSKDYGWCARADDYNSQGSIAEYLSTVGSLKSFSDISKEEMQNTNIVVDDLA  261

Query  1397  NELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQ  1218
             N++ + NE+L+ +  ++NEK +SL  ++ EK+ L +A+ +E+++MQ L+R  +  +L E+
Sbjct  262   NKIAMTNEDLNKVQYKYNEKAISLHNVLREKEELDQAYKKETKRMQELSRHKIDEILREK  321

Query  1217  ETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKAD  1038
             E L++ELE K K L  W++ELNK+E LTE E+ +LDE+KK+      +L++ S EQKK D
Sbjct  322   EWLSNELESKMKNLKLWSKELNKKEALTELERQRLDEDKKKI----DALQLVSLEQKKTD  377

Query  1037  ENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQ  858
             +  +RL+EEHKR+KE  L KIL+LEK++D+KQKL+MEIQELKGKL VM HM  +DD  V+
Sbjct  378   DRFVRLVEEHKRKKEETLNKILQLEKELDSKQKLQMEIQELKGKLQVMRHMEDEDDEDVK  437

Query  857   EKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHI  678
             EK+K+M E L+EK  +++DL+E+N+ L++KERQ NDE+QEAR+ LI GL +LL S R++I
Sbjct  438   EKMKKMNEDLEEKCSELQDLEELNSTLMIKERQGNDEIQEAREELITGLRELL-SDRTNI  496

Query  677   GIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQ  498
              I+R+GE+D K F   CK+RF+ EEADV+   LCS WQE +KDP W+PF+ +   D+ ++
Sbjct  497   RIKRLGELDEKPFMKACKERFTGEEADVQHAMLCSKWQENLKDPAWYPFKRVGTGDKMQE  556

Query  497   IINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVV  318
             +++E+DE++  L+EEWGE++  AV +A+EE+NE+N SGRY +P LWNFKE RKATLKEV+
Sbjct  557   VVDEEDEQIRSLREEWGEDVKNAVKRALEELNEFNPSGRYSVPALWNFKEKRKATLKEVI  616

Query  317   SFIFKQLKTHKRKR  276
              ++  Q++    KR
Sbjct  617   EYMTLQIRNLNLKR  630



>ref|XP_006300857.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33755.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
Length=635

 Score =   492 bits (1266),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 287/618 (46%), Positives = 427/618 (69%), Gaps = 11/618 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y +KPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19    YSDKPYELIKNGHYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  1925  ANHVALAKYLEIDLGDQAE-PLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  1767
             ANH ALAKY++ +L   A+ P PQ   +         +++Y WPW GIV+N  +   N  
Sbjct  78    ANHFALAKYMQNELAADADVPRPQIPSSSSKQGQAVVDDIYVWPWMGIVINPVRRTDNNK  137

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
              + +  YWLK+ +++   EVK    ++     V        +G+K+A   E  +E     
Sbjct  138   LLLDSAYWLKKLARFNPLEVKTLWLEQESVVAVFPLFSRGMSGFKSATELEKEYEIRGCG  197

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             KK W  ++   +S  YGW A+ DDY ++G++  YL +  +LK+ +D+ +EE  +K+ ++ 
Sbjct  198   KKNWRDKKGDWTSKAYGWCARADDYNSQGSIAEYLSKVGKLKSFSDICKEEIHNKNSLVD  257

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             +L N++D+ NE L+ +  + NEK +SL R+++EKD L R + EE+++MQ  +R+++ R+ 
Sbjct  258   DLANKIDMTNEYLNKVQYKCNEKAISLRRVLKEKDELDRVYKEETKRMQEFSRDNINRIF  317

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              E+E L++ELE K   L  W+++L+K++ LTE E+ KLDE+KK++D  NSSL++AS+EQK
Sbjct  318   REKERLSNELEAKMNALKIWSKQLDKKQALTELERQKLDEDKKKSDVMNSSLQLASQEQK  377

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             K D+ VL L+EEHKR+KE  L KIL+LEK++D KQKL+MEIQELKGKL VM+H   +DD 
Sbjct  378   KTDDRVLTLVEEHKRKKEETLNKILQLEKELDGKQKLQMEIQELKGKLQVMKH-EDEDDE  436

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
              V++K+KEMKEQL++K  +++DL+E N+AL++KERQSNDE+QEAR  L+      L S R
Sbjct  437   DVKQKMKEMKEQLEDKCSELEDLEETNSALMIKERQSNDEIQEAR-ALLTTELRELLSER  495

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDR  507
             + I ++R+GE++ K F   CKQRF+ EEA V+   LCS WQE +KD  W PF+ +   D+
Sbjct  496   TTIRVKRVGELNEKPFMKACKQRFTGEEAAVQYAILCSKWQENLKDSAWQPFKHVGTGDK  555

Query  506   PEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLK  327
              +++++E+DE++  L+EE GEE+  AV  A+EE+NE+N SGRY +P LWN K+GRKA+LK
Sbjct  556   MKEVVDEEDEQIKNLREELGEEVKNAVKIALEELNEFNPSGRYSVPVLWNSKQGRKASLK  615

Query  326   EVVSFIFKQLKT-HKRKR  276
             EV+ ++ +QLK   KRKR
Sbjct  616   EVIDYMTQQLKILRKRKR  633



>emb|CDX67967.1| BnaA07g20070D [Brassica napus]
Length=639

 Score =   491 bits (1265),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 283/623 (45%), Positives = 431/623 (69%), Gaps = 11/623 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16    IADYSEKPYKQLRDGELKVKLKVDTFKCPFCSGKKKQHYKYKELLAHATGVSKGSAARNC  75

Query  1934  KQKANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+AL+KYL+ +L GD   P  Q  V   +      N++Y WPW GIV++  + N 
Sbjct  76    KQKANHLALSKYLKNELAGDAEPPRLQLTVYSANQSQAVVNDMYVWPWMGIVISPLRGND  135

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             + + + +  YWLK+ +++   EVK    ++     VV +     +G+ +    E  +E +
Sbjct  136   DKSLLLDSAYWLKKLARFNPLEVKTIWVEEDSAVAVVPRFNGGMDGFTSVTELEKEYEVK  195

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                KK+W+ +        YGW A+ DDY  +G +  YL    +L++ +D+ +EE +    
Sbjct  196   RCGKKDWSYKTGDWRFKTYGWCARGDDYNCQGLIAEYLSTVGKLRSFSDISKEEMQKSSI  255

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++ +L +++  KNE+ + +  ++NE+ +SL R++ +K+ L + + EE+++MQ +++ +V 
Sbjct  256   VVDDLADKIAKKNEDYNQVQYKYNEQIISLQRVLRQKEELDQTYKEETKRMQEISQRNVY  315

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L E+E L+ +LE + K LD+W++EL+K++ LTE E+ KL+EEKK+ND  NSSL++AS 
Sbjct  316   RILQEKEMLSKKLEYRMKDLDTWSKELDKKQALTELERQKLEEEKKKNDAVNSSLQLASL  375

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQK+ D+ VL L+EEHKR+K+ AL KI +LE++++ KQKL+MEIQELKGKL VM+H   +
Sbjct  376   EQKRTDDRVLTLVEEHKRKKDEALNKIRQLEEELNNKQKLQMEIQELKGKLKVMKHREDE  435

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD  V+ K+K+M E+L+EK  +++DL++ N+AL++KER+SNDE+QEAR+ LI GLS LL 
Sbjct  436   DDEDVKNKMKKMNEELEEKCSELQDLEDTNSALMIKERESNDEIQEARQELIGGLSGLL-  494

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R++I I+R+GE+D K F   CK++F  EEA+V+   LCS WQE +KD  W+PF+ +  
Sbjct  495   SDRTNIRIKRLGELDEKPFLKACKKKFKGEEAEVQYAILCSKWQETLKDSGWYPFKRVGT  554

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
              D+ +++++E+DE+L  L+EEWGEE+  AV  A+EE+NE+N SGRY +P LWNFKE RKA
Sbjct  555   EDKMKEVVDEEDEQLKSLREEWGEEVLEAVKTALEELNEHNPSGRYSVPALWNFKEKRKA  614

Query  335   TLKEVVSFI---FKQLKTHKRKR  276
             TLKEV+ ++    K LK  KRKR
Sbjct  615   TLKEVIEYMTLQIKNLKNLKRKR  637



>ref|XP_009104485.1| PREDICTED: myosin-9-like [Brassica rapa]
 ref|XP_009104486.1| PREDICTED: myosin-9-like [Brassica rapa]
 ref|XP_009104487.1| PREDICTED: myosin-9-like [Brassica rapa]
Length=639

 Score =   485 bits (1249),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 283/623 (45%), Positives = 433/623 (70%), Gaps = 11/623 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16    IADYSEKPYKQLRDGELKVKVKVDTFKCPFCSGKKKQHYKYKELLAHATGVAKGSAARNC  75

Query  1934  KQKANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNA  1776
             KQKANH+AL+KYL+ +L GD   P  Q  V   +      N++Y WPW GIV++  + N 
Sbjct  76    KQKANHLALSKYLKNELAGDAEPPRLQLTVYSANQSQAVVNDMYVWPWMGIVISPLRGND  135

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             + + + +  YWLK+ +++   EVK    ++     VV +     +G+ +    E  +E +
Sbjct  136   DKSLLLDSAYWLKKLARFNPLEVKTIWVEEDSAVAVVPRFSGGMDGFTSVTELEKEYEVK  195

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                KK+W+ +        YGW A+ DDY  +G++  YL    +L++ +D+ +EE +    
Sbjct  196   RCGKKDWSYKTGDWRFKTYGWCARGDDYNCQGSIAEYLSTVGKLRSFSDISKEEMQKSSI  255

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++ +L +++  KNE+ + +  ++NE+ +SL R++ +K+ L + + EE+++MQ +++ +V 
Sbjct  256   VVDDLADKIAKKNEDYNQVQYKYNEQIISLQRVLRQKEELDQTYKEETKRMQEISQRNVY  315

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L E+E L+ +LE + K LD+W++EL+K++ LTE E+ KL+EEKK+ND  NSSL++AS 
Sbjct  316   RILQEKEMLSKKLEYRMKDLDAWSKELDKKQALTELERQKLEEEKKKNDAVNSSLQLASL  375

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQK+ D+ VL L+E+HKR+K+ AL KI +LE++++ KQKL+MEIQELKGKL VM+H   +
Sbjct  376   EQKRTDDRVLTLVEDHKRKKDEALNKIRQLEEELNNKQKLQMEIQELKGKLKVMKHREDE  435

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD  V++K+K+M E+L+EK  +++DL++ N+AL++KER+SNDE+QEAR+ LI GLS LL 
Sbjct  436   DDEDVKKKMKKMNEELEEKCSELQDLEDTNSALMIKERESNDEIQEARQELIGGLSGLL-  494

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R++I I+R+GE+D K F   CK+RF  EEA+V+   LCS WQE +KD  W+PF+ +  
Sbjct  495   SDRTNIRIKRLGELDEKPFLKACKKRFKGEEAEVQYAILCSKWQETLKDSGWYPFKRVGT  554

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
              D+ +++++E+DE+L  L+EEWGEE+  AV  A+EE+NE+N SGRY +P LWNFKE RKA
Sbjct  555   EDKMKEVVDEEDEQLKSLREEWGEEVLEAVKTALEELNEHNPSGRYSVPALWNFKEKRKA  614

Query  335   TLKEVVSFI---FKQLKTHKRKR  276
             TLKEV+ ++    K LK  KRKR
Sbjct  615   TLKEVIEYMTLQIKNLKNLKRKR  637



>ref|XP_010417660.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   485 bits (1248),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 279/618 (45%), Positives = 421/618 (68%), Gaps = 10/618 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20    YAEKPYELMKNGNYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  1925  ANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  1767
             ANH ALAKY++ +L GD   P PQ   +         +++Y WPW GIV+   +      
Sbjct  79    ANHFALAKYMQNELAGDSDLPRPQIPSSSSKQSQAVVDDVYVWPWMGIVIYPVRRTDKNY  138

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
              + +  YW K+ + ++  EVK    ++     V+ +  S  +G+K A   E  +E     
Sbjct  139   YLLDSAYWSKKLACFDPFEVKTLWLEQDSVVAVIPQFNSGMSGFKTATELEKEYEIRGCG  198

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             KK+W+ +R    S  YGW A+ DDY ++G++  YL +   L++ +D+ +EE ++K+ ++ 
Sbjct  199   KKDWSDKRGDWRSKAYGWCARSDDYNSQGSIAEYLSKVGTLRSFSDICKEEIQNKNSVVD  258

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             +L N++ + NENL+ +  ++N+K +SL  +++EKD L R +  ES+KMQ  +R+++ R+ 
Sbjct  259   DLANKIAMTNENLNKVQYKYNQKAISLREVLKEKDALDRIYKAESKKMQEFSRDNLNRIF  318

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              E+E L +ELE K   L  W++EL+K++ LTE E+ +LDE+KK++D  NSSL++AS EQK
Sbjct  319   KEKERLTNELEAKMNNLKIWSKELDKKQALTELERQQLDEDKKKSDVMNSSLQLASLEQK  378

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             K D+ VL L+EEHKR+KE  L KIL+LEK++D+KQKL+MEIQELKGKL VM+H   DDD 
Sbjct  379   KTDDRVLTLVEEHKRKKEETLNKILQLEKELDSKQKLQMEIQELKGKLQVMKHEDEDDDD  438

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
               Q+  +  +E  +++ E ++DL+E N  L++KERQSNDE+QEAR +L   L +LL S R
Sbjct  439   VKQKMKEMKEELEEKRSE-LQDLEETNTYLMIKERQSNDEIQEARAVLTTELRELL-SER  496

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDR  507
             + I ++R+GE+D K F   CK+RF+ EEA V+   LCS WQE +KDP W PF+ +   D+
Sbjct  497   TIIRVKRVGELDEKPFMKACKERFTGEEAAVQHAILCSKWQENLKDPAWQPFKHVETGDK  556

Query  506   PEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLK  327
              +++++E+DE++  L+EEWGEE+  AV  A+EE+NE+N SGRY +P LWN K+GRKA+LK
Sbjct  557   KKEVVDEEDEQMKNLREEWGEEVKNAVKTALEELNEFNPSGRYSVPVLWNSKQGRKASLK  616

Query  326   EVVSFIFKQLKTHKRKRH  273
             EV+ ++ +QLK  K+++ 
Sbjct  617   EVIDYMTQQLKILKKRKR  634



>ref|XP_002278500.1| PREDICTED: protein INVOLVED IN DE NOVO 2 isoform X2 [Vitis vinifera]
 emb|CBI31664.3| unnamed protein product [Vitis vinifera]
Length=641

 Score =   484 bits (1246),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 275/619 (44%), Positives = 417/619 (67%), Gaps = 14/619 (2%)
 Frame = -1

Query  2099  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQKA  1923
             +K YEEL++G + VK       CP+C+ KKK+DY YK+LLQHA GVGK S+  RS+K KA
Sbjct  23    DKSYEELKNGNHHVKTSGESFSCPYCSKKKKRDYLYKELLQHAIGVGKSSSEKRSMKDKA  82

Query  1922  NHVALAKYLEIDL-------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTA  1764
             NH+ALAKYLE D+       G  ++P  +  +  + + ++ WPWTG+VVN+  +  +G  
Sbjct  83    NHLALAKYLEKDIMDVDGPSGGPSKPKSEAPLGCDHDEMFVWPWTGVVVNIPTELRDGRY  142

Query  1763  VEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             +      L+       +    V    + +  +    ++   DW G  NA+ FE  +EA+ 
Sbjct  143   IGGSGSKLRDELTARGFNPIRVHPLWNYRGHSGCAAVEFNKDWPGLHNAMSFEKEYEADH  202

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK+W A     S  +Y W A+ DDY+A   +G +LR+   LKTI+D++ EE R + K+
Sbjct  203   HGKKDWIASNGRGSG-LYAWVARADDYKAASIIGEHLRKIGDLKTISDIMAEEARKQSKL  261

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +SNLTN +++KN++L  +    +E ++SL+ +IEEKD LH+A+ EE RK+Q  AR+H Q+
Sbjct  262   VSNLTNVIEVKNKHLEEMKRIVSEASVSLNNLIEEKDKLHQAYNEEIRKIQMSARDHFQK  321

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             + ++ E L  +LE  K++LD   REL KRE   E E+ KL EE ++N  +NSSL++A+ E
Sbjct  322   IFNDHEKLKLQLESHKRELDLRGRELEKREAHNENERKKLCEEIEKNVMKNSSLQLAAVE  381

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KADE V +L E+ K++KE   ++I++LEK +DAKQ LE+EI+ L+G L+VM+HMG D 
Sbjct  382   QQKADEKVYKLAEDQKKQKENLHRRIIQLEKQLDAKQALELEIERLRGTLNVMKHMGDDG  441

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D  + +K+  M + L EK  +++DL+ +N  L++KER+SNDELQEARK LI GL ++  S
Sbjct  442   DMEILKKMDSMLKVLREKEGELEDLEALNQTLIVKERKSNDELQEARKELISGLKEM--S  499

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             GR+HIG++RMGE+D K FH  CK+++   E + +ALELCSLW+E ++D  WHPF+V+ I 
Sbjct  500   GRAHIGVKRMGELDNKPFHEACKRKYGVAEPEERALELCSLWEEFLRDSEWHPFKVVEIE  559

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + + +I+++DE+L  +++E G+E+  AV  A+ E+NEYN SGRY+I ELWN+ EGRKAT
Sbjct  560   GKHQGVIDDNDEKLRSVRDELGDEVYTAVRTALIEINEYNPSGRYIISELWNYGEGRKAT  619

Query  332   LKEVVSFIFKQLKTHKRKR  276
             L+E V+FI ++ KT++ KR
Sbjct  620   LQEGVAFILRKWKTYRDKR  638



>emb|CDX79353.1| BnaC06g19500D [Brassica napus]
Length=639

 Score =   483 bits (1242),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 285/623 (46%), Positives = 429/623 (69%), Gaps = 11/623 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I +Y EKPY++LR G+ KVK      +CPFC+GKKKQ YKYK+LL HATGV KGSA R+ 
Sbjct  16    IADYSEKPYKQLRDGELKVKLKLDTFKCPFCSGKKKQHYKYKELLAHATGVAKGSAARNC  75

Query  1934  KQKANHVALAKYLEIDL-GDQAEPLPQRAVAPEDNN------LYCWPWTGIVVNVSKDNA  1776
             KQKANH+AL+KYL+ +L GD   P  Q  V     N      +Y WPW GIV++  + N 
Sbjct  76    KQKANHLALSKYLKNELAGDAEPPRLQLTVYSSKQNQAVVSDMYVWPWMGIVISPLRGND  135

Query  1775  NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             + T + +  YWLK+ +++   EVK    +      VV +     +G+ +    E  +E +
Sbjct  136   DKTLLLDSAYWLKKLARFNPLEVKTIWVEVDSAVAVVPRFSGGMDGFTSVTELEKEYEVK  195

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                KK+W+ +        YGW A+ DDY ++G++  YL    +L++ +D+ +EE +    
Sbjct  196   RCGKKDWSYKTGDWRFKTYGWCARGDDYNSQGSIAEYLSTVGKLRSFSDISKEEMQKSSI  255

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++ +L +++  KNE+ + +  ++NE+ +SL R+I +KD L + + EE+++MQ +++ +V 
Sbjct  256   VVDDLADKIAKKNEDYNQVQHKYNEQIISLQRLIRQKDELDQTYKEETKRMQEISQRNVY  315

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             R+L E+E L+ +LE + K LD+W++EL+K++ LTE E+ KL+EEKK+ND  NSSL++AS 
Sbjct  316   RILQEKEMLSKKLEDRMKDLDTWSKELDKKQALTELERQKLEEEKKKNDAVNSSLQLASL  375

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQK+ D+ VL L+EEHKR+K+ AL KI +LE++++ KQKL+MEIQELKGKL VM+H   +
Sbjct  376   EQKRTDDRVLTLVEEHKRKKDEALNKIRQLEEELNNKQKLQMEIQELKGKLKVMKHREDE  435

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             DD  V++++K+M E+L+EK  +++DL++ N+AL++KERQSNDE+QEAR+ LI GL   L 
Sbjct  436   DDEDVKKEMKKMNEELEEKCSELQDLEDTNSALMIKERQSNDEIQEARQELIGGLG-GLL  494

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R++I I+R+GE+D K F   CK+RF  EEA+V+   LCS WQE +KD  W+PF+ +  
Sbjct  495   SDRTNIRIKRLGELDEKPFLKACKKRFKGEEAEVQYAILCSKWQETLKDSGWYPFKRVGT  554

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
              D+ +++++E+DE+L  L+EEWGEE+  AV  A+EE+NE+N SGRY +P LWNFKE RKA
Sbjct  555   EDKMKEVVDEEDEQLKSLREEWGEEVLEAVKTALEELNEHNPSGRYSVPALWNFKEKRKA  614

Query  335   TLKEVVSFI---FKQLKTHKRKR  276
             TLKEV+ ++    K LK  KRKR
Sbjct  615   TLKEVIEYMTLQIKNLKNLKRKR  637



>ref|XP_010429902.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
 ref|XP_010429903.1| PREDICTED: factor of DNA methylation 5-like [Camelina sativa]
Length=636

 Score =   482 bits (1241),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 280/617 (45%), Positives = 428/617 (69%), Gaps = 10/617 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y EKPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGS++RS KQK
Sbjct  20    YAEKPYELMKNGTYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSSSRSAKQK  78

Query  1925  ANHVALAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  1767
             ANH ALAKY++ +L GD   P PQ   +         +++Y WPW GIV+   +   N  
Sbjct  79    ANHFALAKYMQNELAGDSDLPRPQIPSSSSKQSQAVVDDVYVWPWMGIVIYPVRRTDNNY  138

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
              + +  YW K+ ++++  EVK    ++     V+ +  S  +G+K+A   E  +E     
Sbjct  139   YLLDSAYWSKKLAEFDPLEVKTIWLEQDSVVAVIPQFNSGMSGFKSATELEKEYEKRGCG  198

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             KK+W+ +R    S  YGW A+ DDY ++G++  YL +  +L++ +D+ +EE ++K+ ++ 
Sbjct  199   KKDWSDKRGDWRSKAYGWCARSDDYNSQGSIAEYLSKVGKLRSFSDICKEEIQNKNIVVD  258

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             +L+N++ + NENL+ +  ++N+K +SL  +++EKD L R + EES+KMQ  +R+++ R+ 
Sbjct  259   DLSNKIAMTNENLNKVQYKYNQKAISLREVLKEKDALDRTYKEESKKMQESSRDNLNRIF  318

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              E+E L +ELE K   L  W++EL+K++ LTE E+ +LDE+KK++D  NSSL++AS + K
Sbjct  319   REKERLTNELEAKMNNLKIWSKELDKKQALTELERQQLDEDKKKSDVMNSSLQLASLKHK  378

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             K D+ VL L+EEHKR+KE  L KIL+LEK+ D+KQKL+MEIQELKGKL VM+H   DDD 
Sbjct  379   KTDDRVLTLVEEHKRKKEEILNKILQLEKESDSKQKLQMEIQELKGKLQVMKHDDEDDDD  438

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
               Q+  +  +E  +++ E ++DL+E N+ L++KERQSNDE+QEAR +L   L +LL S R
Sbjct  439   VKQKMKEMKEELEEKRSE-LQDLEETNSYLMIKERQSNDEIQEARAVLTTELRELL-SER  496

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDR  507
             + I ++R+GE+D K F   CKQRF+ EEA+V+   LCS WQE +KDP WHPF+ +   D+
Sbjct  497   TIIRVKRVGELDEKPFMKACKQRFTAEEAEVQHAILCSKWQENLKDPAWHPFKHVGTGDK  556

Query  506   PEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLK  327
              +++++E+DE++  L+EEWGEE+  AV  A+EE+NE+N SGRY +P LW+ K+GRKA+LK
Sbjct  557   KKEVVDEEDEQMKNLREEWGEEVKNAVKTALEELNEFNPSGRYSVPVLWHSKQGRKASLK  616

Query  326   EVVSFIFKQLKTHKRKR  276
             EV+ ++ +QLK  K+++
Sbjct  617   EVIDYMTQQLKVLKKRK  633



>ref|XP_002443867.1| hypothetical protein SORBIDRAFT_07g003550 [Sorghum bicolor]
 gb|EES13362.1| hypothetical protein SORBIDRAFT_07g003550 [Sorghum bicolor]
Length=626

 Score =   481 bits (1238),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 281/621 (45%), Positives = 417/621 (67%), Gaps = 18/621 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y EK Y +L++GK+  +  +   RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  16    IDDYAEKSYADLKAGKFVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGVG--ASNRAA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPL-PQRAVA-------PEDNNLYCWPWTGIVVNVSKDN  1779
             K KANH ALAK L++D  D A  L P++A+A        +D  ++ WPW GI+ NV  + 
Sbjct  74    KVKANHQALAKLLKVDHADAAATLLPRQAIALSNPPKPVQDLEVFVWPWMGILANVPAEQ  133

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               G         +KR + ++  +V            V++    DW G+KNA+ F+N F++
Sbjct  134   TQGGGA----ILMKRLADFKPVQVTAVYGANGYAGYVIVLFTKDWIGFKNALAFQNYFKS  189

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             +   K EW  E      +V+GW AK +DY+++G VG +L    +LKT+++L QE     D
Sbjct  190   QRLGKLEWE-ETKQHVKYVFGWLAKEEDYKSDGPVGRFLSANGELKTVSELEQEMSSKTD  248

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              +++NLT ++  K++ L  L  + N+ N+SL +++EE D LH+ + EE R MQ  AREH 
Sbjct  249   NLIANLTQQISAKSKYLQELECKCNQMNISLQKVMEESDLLHKRYNEEMRNMQSAAREHT  308

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             QRV  E E L  +L +K+  ++  ++ELN++   T+ E+ KL+EE+K+N ++N SL MA 
Sbjct  309   QRVFQETEKLRKQLAEKESSIERRSKELNEQVAQTDMERRKLEEERKKNADQNDSLNMAR  368

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ+KAD+  LRL+E+HK+EKE AL KIL+LE+ +D KQKLE++I++LKGKL+V++HM G
Sbjct  369   IEQQKADQRALRLLEKHKKEKEDALNKILQLERQVDEKQKLELDIEQLKGKLEVVKHMEG  428

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             +    V+++ +E+  +L+E+IEDM+ L+ +N  LV+KER +NDE+Q+A+K LI GL+DLL
Sbjct  429   EGVD-VKKRSEELTAELNERIEDMEHLEALNQTLVVKERMTNDEIQDAKKELITGLADLL  487

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
                RS+IGI+RMGE+D K F   CKQR+  E+A++KA E  SLWQE +KDPNWHPF+++ 
Sbjct  488   GP-RSNIGIKRMGELDEKPFVLSCKQRYG-EDAEMKAAEFVSLWQEHLKDPNWHPFKIVT  545

Query  518   IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  339
                  EQIIN++DE+L  LK++ GEE+  AV  A+ E+NEYNASG YV+ ELWN KE RK
Sbjct  546   TGSTTEQIINDNDEKLVGLKKQLGEEVYKAVTTALLEINEYNASGSYVVSELWNNKENRK  605

Query  338   ATLKEVVSFIFKQLKTHKRKR  276
             A++ E +  + KQ K  KR+R
Sbjct  606   ASITEAIQHVLKQWKAQKRRR  626



>ref|XP_006659121.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
[Oryza brachyantha]
Length=626

 Score =   478 bits (1229),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 283/622 (45%), Positives = 423/622 (68%), Gaps = 19/622 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y +K Y +L+SGK  V+  N   RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  15    IDDYVDKSYMDLKSGKNVVRLGNEKFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAP  72

Query  1934  KQKANHVALAKYLEIDLGDQAEPLP-QRAVAPE-------DNNLYCWPWTGIVVNVSKDN  1779
             K +ANH+ALA  L+ D  D A  LP Q+ VAP        D  +Y WPW GI+ NV  + 
Sbjct  73    KVRANHMALANLLKNDYTDAAGSLPSQQVVAPSNPPRPLPDQEVYVWPWMGILANVPAEQ  132

Query  1778  ANGTAVEEEDYWLKRFSKYEAQE-VKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
               G         +++ + +       ++C +   T   V++   DW G+KNA+ F+N F+
Sbjct  133   TEGDGAS----LMQQLADFNPLHFTSVYCSEGRYTGYAVVRFSKDWIGFKNALAFQNYFK  188

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             ++   K +W A       +++GW AK +DY++  AVG +L     LKT++DL Q+  R  
Sbjct  189   SQHSGKTDWIAH--GQEKYIFGWLAKEEDYKSGDAVGRFLSANGDLKTVSDLEQDLSRKT  246

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             + ++++L++++  K++ L  L  ++N+ NLS+ R +EE D LH+ + EE R MQ  AREH
Sbjct  247   ETLIASLSHQITAKSKYLVELECKYNQMNLSVKRAMEETDLLHKRYNEEMRNMQSAAREH  306

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
              QR+  E + L  +L+ K+  ++  +++L+K    T+ E+ KL+ E K+N E+N SL MA
Sbjct  307   SQRIFQETDQLRKQLDDKESAIERRSKQLSKFVAQTDMERRKLESEMKKNSEQNDSLHMA  366

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
               EQ+K+D++VL+L+E+HK+EKE AL KIL+LEK +D KQ+LE+EIQ+L+G+L V++HM 
Sbjct  367   RIEQQKSDKSVLKLVEKHKKEKEIALSKILQLEKQLDEKQQLELEIQQLRGRLRVVQHME  426

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
             G+    V++  +E+ E+L+EKIE+M+D++ +N AL++KER++NDELQEA+K LI GLSDL
Sbjct  427   GEG-VDVKKLTEELTEELNEKIEEMEDMEALNQALIIKERETNDELQEAKKELISGLSDL  485

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
             L   RS+IGI+RMGE+D + F   CKQR+  +EA +KA ++CS WQE +KD NWHPF+++
Sbjct  486   LGP-RSNIGIKRMGELDERPFLTACKQRYGADEAVMKAAQICSKWQENLKDANWHPFKIV  544

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
              I  + EQIINEDDE+L  LKEE G+E+ +AVI A+ E+NEYNASG YV+ ELWN KE R
Sbjct  545   TIGGKTEQIINEDDEKLVGLKEELGDEVHSAVITALLEINEYNASGSYVVSELWNNKENR  604

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             KA+++E +  + KQ K H+RKR
Sbjct  605   KASMQEALQHVLKQWKLHRRKR  626



>ref|XP_002533154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29235.1| conserved hypothetical protein [Ricinus communis]
Length=640

 Score =   474 bits (1221),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 277/627 (44%), Positives = 426/627 (68%), Gaps = 22/627 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGK-GSANRS  1938
             ++EY+ + YEEL++G + VK  +    CP+C  K+K++Y Y+DLLQHA+GVG+  S  RS
Sbjct  20    LDEYEAQCYEELKNGTHHVKISDETFTCPYCPKKRKREYLYRDLLQHASGVGRSASKKRS  79

Query  1937  VKQKANHVALAKYLEIDLGDQAEPL-PQRAVAPED----NNLYCWPWTGIVVNVSKDNA-  1776
              K+KANH+AL KYLE D+ D   P  P+    P D    +    WPWTGIV+N+    A 
Sbjct  80    TKEKANHLALVKYLEKDIADLGSPSKPKGESDPLDSCNHDEKIVWPWTGIVINIPTTKAP  139

Query  1775  -----NGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  1611
                    +  +  D  + R   +    V    + +  +   V++   DW G  NA+ FE 
Sbjct  140   DGRFVGASGSKFRDELISR--GFNPTRVHPLWNYRGHSGSAVVEFHKDWPGLHNALSFEK  197

Query  1610  AFEAECHSKKEW--TAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             A+EA+ H KK++  T E+S     VY W A+ DDY+A+  +G +LR+T  LKTI+++++E
Sbjct  198   AYEADHHGKKDYFTTGEKSG----VYCWVARADDYKADNIIGDHLRKTGDLKTISEIMEE  253

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +DK++SNL N +++KN+++  +  +F+E ++SL++++EEKD L +A+ EE RK+Q 
Sbjct  254   EARKQDKLISNLNNIIEIKNKHIQEMQDKFSETSVSLNKLMEEKDRLLQAYNEEIRKIQM  313

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AREH Q++ ++ E L  +++ +K++L+    EL KRE   E ++ KL EE ++N  RNS
Sbjct  314   SAREHFQKIFNDHEKLKLQVDSQKRELEMRGSELEKREAKNENDRRKLSEEIEKNAIRNS  373

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL++A+ EQ+KADENVL+L E+ KR+KE    +I++L+K +DAKQ LE+EI+ L+G L+V
Sbjct  374   SLQLAAFEQQKADENVLKLAEDQKRQKEELHNRIIQLQKQLDAKQALELEIERLRGTLNV  433

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HMG D D  V +K++ + + L EK  +++DL+ +N AL++ ER+SNDELQEARK LI 
Sbjct  434   MKHMGDDGDVEVLQKMETIIQNLREKEGELEDLETLNQALIVSERKSNDELQEARKELIN  493

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             GL ++  S R+ IG++RMGE+D K F    K++++ EEA+V+A ELCSLW E +KDP WH
Sbjct  494   GLKEI--SNRAQIGVKRMGELDSKPFLEAMKRKYTEEEAEVRASELCSLWVEYLKDPGWH  551

Query  536   PFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWN  357
             PF+V  +  + +++I++ DE+L+ LK+E G+E+  AV  AV+E+N+YN SGRY+  ELWN
Sbjct  552   PFKVAMVDGKNKEVIDDKDEKLNGLKDELGDEVYKAVTDAVKEINDYNPSGRYITSELWN  611

Query  356   FKEGRKATLKEVVSFIFKQLKTHKRKR  276
             +KE +KATLKE VSF+ KQ +  KR+R
Sbjct  612   YKEEKKATLKEGVSFLLKQWQIAKRRR  638



>ref|XP_010658558.1| PREDICTED: protein INVOLVED IN DE NOVO 2 isoform X1 [Vitis vinifera]
Length=656

 Score =   475 bits (1222),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 269/634 (42%), Positives = 411/634 (65%), Gaps = 29/634 (5%)
 Frame = -1

Query  2099  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQKA  1923
             +K YEEL++G + VK       CP+C+ KKK+DY YK+LLQHA GVGK S+  RS+K KA
Sbjct  23    DKSYEELKNGNHHVKTSGESFSCPYCSKKKKRDYLYKELLQHAIGVGKSSSEKRSMKDKA  82

Query  1922  NHVALAKYLEIDL-------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTA  1764
             NH+ALAKYLE D+       G  ++P  +  +  + + ++ WPWTG+VVN+  +  +G  
Sbjct  83    NHLALAKYLEKDIMDVDGPSGGPSKPKSEAPLGCDHDEMFVWPWTGVVVNIPTELRDGRY  142

Query  1763  VEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             +      L+       +    V    + +  +    ++   DW G  NA+ FE  +EA+ 
Sbjct  143   IGGSGSKLRDELTARGFNPIRVHPLWNYRGHSGCAAVEFNKDWPGLHNAMSFEKEYEADH  202

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK+W A     S  +Y W A+ DDY+A   +G +LR+   LKTI+D++ EE R + K+
Sbjct  203   HGKKDWIASNGRGSG-LYAWVARADDYKAASIIGEHLRKIGDLKTISDIMAEEARKQSKL  261

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +SNLTN +++KN++L  +    +E ++SL+ +IEEKD LH+A+ EE RK+Q  AR+H Q+
Sbjct  262   VSNLTNVIEVKNKHLEEMKRIVSEASVSLNNLIEEKDKLHQAYNEEIRKIQMSARDHFQK  321

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREV---------------LTereklkldeekk  1098
             + ++ E L  +LE  K++LD   REL KRE                +    ++       
Sbjct  322   IFNDHEKLKLQLESHKRELDLRGRELEKREAHNENERKKLCEEIEKICVNCQVVTLLFCL  381

Query  1097  rndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQE  918
              N  +NSSL++A+ EQ+KADE V +L E+ K++KE   ++I++LEK +DAKQ LE+EI+ 
Sbjct  382   HNVMKNSSLQLAAVEQQKADEKVYKLAEDQKKQKENLHRRIIQLEKQLDAKQALELEIER  441

Query  917   LKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQE  738
             L+G L+VM+HMG D D  + +K+  M + L EK  +++DL+ +N  L++KER+SNDELQE
Sbjct  442   LRGTLNVMKHMGDDGDMEILKKMDSMLKVLREKEGELEDLEALNQTLIVKERKSNDELQE  501

Query  737   ARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEK  558
             ARK LI GL ++  SGR+HIG++RMGE+D K FH  CK+++   E + +ALELCSLW+E 
Sbjct  502   ARKELISGLKEM--SGRAHIGVKRMGELDNKPFHEACKRKYGVAEPEERALELCSLWEEF  559

Query  557   VKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  378
             ++D  WHPF+V+ I  + + +I+++DE+L  +++E G+E+  AV  A+ E+NEYN SGRY
Sbjct  560   LRDSEWHPFKVVEIEGKHQGVIDDNDEKLRSVRDELGDEVYTAVRTALIEINEYNPSGRY  619

Query  377   VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             +I ELWN+ EGRKATL+E V+FI ++ KT++ KR
Sbjct  620   IISELWNYGEGRKATLQEGVAFILRKWKTYRDKR  653



>gb|EEC71144.1| hypothetical protein OsI_02969 [Oryza sativa Indica Group]
Length=629

 Score =   471 bits (1213),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 263/619 (42%), Positives = 421/619 (68%), Gaps = 11/619 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+EY +K Y  L +G++KVK       CPFC+GKKK+D+   +L+QHA+GVG  S NR  
Sbjct  16    IDEYADKFYARLVAGEFKVKDGQ-SYSCPFCSGKKKKDFNINNLIQHASGVGAAS-NRQA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  1770
             K KA H ALAK+L+  L   +    Q AV      P  +  + WPW G++VNV  +  +G
Sbjct  74    KDKATHRALAKHLKNGLTKSSGQQSQTAVVEPQPLPNRDEKFVWPWMGVLVNVPTEWKDG  133

Query  1769  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               +      LK + S++   ++    + +  +   +++   DW+G++NA+ FE+ F  E 
Sbjct  134   RQIGRSGNHLKEQLSRFCPLKIIPLWNFRGHSGNAIVEFGKDWHGFRNALAFEDYFGKEG  193

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             + K++W  E+ +  S+++GW A+ +D+ + G +G +LR+   LKTI DL  E  R  DK+
Sbjct  194   YGKRDWK-EKQNQGSNLFGWVARAEDHTSPGLIGDHLRKNGDLKTINDLENEGARKTDKL  252

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL N++++KN +L  L   +NE+  SL +M+ +++ L + + EE RKMQ+LA+ H Q+
Sbjct  253   VANLANQIEVKNRHLQELEVTYNERTTSLEKMMGQREQLLQKYNEEIRKMQQLAQRHSQK  312

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             ++ E + L SELE K  +L++ ++EL++    ++ ++  +D+EK++N  ++S L++A+ E
Sbjct  313   IIDENQKLRSELESKMSELNTRSKELDEIAAKSDYDRRIIDQEKQKNAIKSSHLKLATLE  372

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q++ADENVL+L+ EHKREKEAA++KIL+LE+ +DAKQKLE++IQ+LKGKL+VM+HM GD+
Sbjct  373   QERADENVLKLVREHKREKEAAVKKILKLEQQVDAKQKLELDIQQLKGKLEVMKHMPGDE  432

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             DSA++ KI E+ E+L EK++++  ++ +N  LV+KER+SN E+Q+ARK L  GL DLL+ 
Sbjct  433   DSALKNKIDELSEELQEKMDELDAMESLNQTLVIKERKSNTEMQDARKELENGLLDLLD-  491

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G+SHIGI+RMGE+D +AF   C++  S E+A++ A  LCS WQ ++K+P+WHPFR + + 
Sbjct  492   GQSHIGIKRMGELDLEAFSKACRKMSSEEDAEITAAILCSKWQAEIKNPDWHPFRFVLVD  551

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + ++II +D +     +E  GE+I   V  A+ E+NEYN SGR+ + ELWNFK+ RKAT
Sbjct  552   GQEKEIIEDDAKLQELKEEH-GEDIYRLVRDALCEINEYNPSGRFPVGELWNFKDKRKAT  610

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKE V F+ +Q + ++RKR
Sbjct  611   LKETVQFVLRQWRANRRKR  629



>ref|XP_002456013.1| hypothetical protein SORBIDRAFT_03g028860 [Sorghum bicolor]
 gb|EES01133.1| hypothetical protein SORBIDRAFT_03g028860 [Sorghum bicolor]
Length=629

 Score =   471 bits (1212),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 274/619 (44%), Positives = 406/619 (66%), Gaps = 11/619 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16    IDDYEGKVYASLMSGGLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAPED----NNLYCWPWTGIVVNVSKDNANG  1770
             K+KA H AL KYL+ DL   +EP P    V P+     +  + WPW GI+VNV  +  +G
Sbjct  75    KEKAAHRALFKYLKNDLAKSSEPQPLVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDG  134

Query  1769  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               + E    LK + S +   +V      +  T   +++   DWNG++NA  FE+ F A  
Sbjct  135   RQIGESGNRLKEQLSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAAGG  194

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
               KK+WT +++   S +YGW A+ +DY + G +  YLR+   LK++ DL +E  R  D++
Sbjct  195   FGKKDWTGKKNQ-GSELYGWLARAEDYNSPGIIADYLRKNGDLKSVNDLAKEGARKTDRL  253

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL N++++KN  L  L ++++E   SL +M+ +++ L +++ EE  KMQ+LAR H Q+
Sbjct  254   VANLANQIEVKNRYLQELESKYSETTASLEKMMGQREQLLQSYNEEISKMQQLARRHSQK  313

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             V+ E + L SELE K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ E
Sbjct  314   VIDENQKLRSELEAKMNDLDVRSKQLDELAAKSDYDRRNLEQEKQKNAIKSSHLKLATLE  373

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KADENVL+L+EE KREK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD+
Sbjct  374   QQKADENVLKLVEEQKREKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGDE  433

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             DSA + KI E+ E L EKI+++  ++ +N  LV+KE +SN ELQEARK L  GL D L+ 
Sbjct  434   DSASKNKINELSEALQEKIDELDGMESLNQTLVIKESKSNIELQEARKELENGLLD-LSG  492

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G++HIGI+RMGE+D KAF   C Q+  TE+A+V A  LCS W+ ++K+P+WHPFRV+ + 
Sbjct  493   GQAHIGIKRMGELDLKAFSKAC-QKERTEDAEVTAAFLCSKWEAEIKNPDWHPFRVVTVD  551

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              +  +II +D +  +  +E  GEEI A V KA+ E+NEY + G Y + ELWNFKE RK T
Sbjct  552   GKEMEIIEDDAKLRALKEEH-GEEIYALVTKALLEINEYKSKGSYPVGELWNFKENRKVT  610

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKE V F+ +Q +T++RKR
Sbjct  611   LKEAVQFVLRQWRTNRRKR  629



>ref|NP_001043655.1| Os01g0633200 [Oryza sativa Japonica Group]
 gb|AAF21887.1|AF101045_2 putative transcription factor X1 [Oryza sativa Japonica Group]
 dbj|BAB90725.1| putative X1 [Oryza sativa Japonica Group]
 dbj|BAF05569.1| Os01g0633200 [Oryza sativa Japonica Group]
 dbj|BAG91243.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55041.1| hypothetical protein OsJ_02725 [Oryza sativa Japonica Group]
Length=629

 Score =   471 bits (1211),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 262/619 (42%), Positives = 421/619 (68%), Gaps = 11/619 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+EY +K Y  L +G++KVK       CPFC+GKKK+D+   +L+QHA+GVG  S NR  
Sbjct  16    IDEYADKFYARLVAGEFKVKDGQ-SYSCPFCSGKKKKDFNINNLIQHASGVGAAS-NRQA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-----PEDNNLYCWPWTGIVVNVSKDNANG  1770
             K KA H ALAK+L+  L   +    Q AV      P  +  + WPW G++VNV  +  +G
Sbjct  74    KDKATHRALAKHLKNGLTKSSGQQSQTAVVEPQPLPNRDEKFVWPWMGVLVNVPTEWKDG  133

Query  1769  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               +      LK + S++   ++    + +  +   +++   DW+G++NA+ FE+ F  E 
Sbjct  134   RQIGRSGNHLKEQLSRFCPLKIIPLWNFRGHSGNAIVEFGKDWHGFRNALAFEDYFGKEG  193

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             + +++W  E+ +  S+++GW A+ +D+ + G +G +LR+   LKTI DL  E  R  DK+
Sbjct  194   YGRRDWK-EKQNQGSNLFGWVARAEDHTSPGLIGDHLRKNGDLKTINDLENEGARKTDKL  252

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL N++++KN +L  L   +NE+  SL +M+ +++ L + + EE RKMQ+LA+ H Q+
Sbjct  253   VANLANQIEVKNRHLQELEVTYNERTTSLEKMMGQREQLLQKYNEEIRKMQQLAQRHSQK  312

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             ++ E + L SELE K  +L++ ++EL++    ++ ++  +D+EK++N  ++S L++A+ E
Sbjct  313   IIDENQKLRSELESKMSELNTRSKELDEIAAKSDYDRRIIDQEKQKNAIKSSHLKLATLE  372

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q++ADENVL+L+ EHKREKEAA++KIL+LE+ +DAKQKLE++IQ+LKGKL+VM+HM GD+
Sbjct  373   QERADENVLKLVREHKREKEAAVKKILKLEQQVDAKQKLELDIQQLKGKLEVMKHMPGDE  432

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             DSA++ KI E+ E+L EK++++  ++ +N  LV+KER+SN E+Q+ARK L  GL DLL+ 
Sbjct  433   DSALKNKIDELSEELQEKMDELDAMESLNQTLVIKERKSNTEMQDARKELENGLLDLLD-  491

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G+SHIGI+RMGE+D +AF   C++  S E+A++ A  LCS WQ ++K+P+WHPFR + + 
Sbjct  492   GQSHIGIKRMGELDLEAFSKACRKMSSEEDAEITAAILCSKWQAEIKNPDWHPFRFVLVD  551

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + ++II +D +     +E  GE+I   V  A+ E+NEYN SGR+ + ELWNFK+ RKAT
Sbjct  552   GQEKEIIEDDAKLQELKEEH-GEDIYRLVRDALCEINEYNPSGRFPVGELWNFKDKRKAT  610

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKE V F+ +Q + ++RKR
Sbjct  611   LKETVQFVLRQWRANRRKR  629



>ref|XP_009387522.1| PREDICTED: uncharacterized protein LOC103974422 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009387523.1| PREDICTED: uncharacterized protein LOC103974422 [Musa acuminata 
subsp. malaccensis]
Length=641

 Score =   471 bits (1211),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 280/650 (43%), Positives = 422/650 (65%), Gaps = 64/650 (10%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             + +Y+E+ Y+ L++G ++++ P+G  RCPFC GKKKQDY++KDLLQHATG+G  S++R  
Sbjct  19    VEDYEEECYQALKTGNHRIRNPDGTFRCPFCTGKKKQDYQFKDLLQHATGIG-ASSSRKG  77

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPE----------------------------  1839
              QKA+H A A++L++DL       P  ++ P                             
Sbjct  78    SQKAHHRAFARFLQLDLA------PSLSLPPALKAAFAAAAAGDPSPIQSPPPSSSSYSA  131

Query  1838  -----DNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDD----K  1686
                  ++ L+ WPW  ++VN     A+G  ++E+   L  F+  +   V +  +D    K
Sbjct  132   SKPPREDELFVWPWMAVLVNAPPGAADGDDLKEK---LSDFNPVDT--VHLHEEDDLNGK  186

Query  1685  SRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEA  1506
             S  + V++K   +W G+KNA+ FEN F A    KKEW   +   S  ++GW A  +DY A
Sbjct  187   STCATVIVKFLKNWGGFKNAMDFENHFRASHRGKKEWAERQGDVSGVLFGWIASAEDYNA  246

Query  1505  EGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSL  1326
              GA+G YL++   LKTI  +++EE ++  KI++ L N++D+KN+ L  L  R+N  + SL
Sbjct  247   GGALGRYLKKHGDLKTILQVIKEESKETGKIVAILANQIDIKNQYLHDLEVRYNTTSHSL  306

Query  1325  SRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKR  1146
             SR++ EKD LH+A+ +E R +QR ARE  +++  E E L  EL+ K+K++D   +EL+K 
Sbjct  307   SRVMGEKDQLHQAYNDEMRNLQRNARETTRKIFDENEKLRMELDLKRKEIDLRCKELDKL  366

Query  1145  EVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILEL  966
             E        + + +KK+ D+    +E+A+  QK+A+E VL+L+E+ K+EKEAAL +IL+L
Sbjct  367   EA-------QNEGDKKKLDDEKQKVELATIVQKEAEEEVLKLVEDQKKEKEAALARILQL  419

Query  965   EKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMN  786
             EK++D KQ+LE+EI+ L   L VM+H+ G +D+ +QE    M+++L+ + E    L+ +N
Sbjct  420   EKELDQKQQLELEIETLNWNLRVMKHLEGQNDADIQE----MEQKLEREREQ---LEFLN  472

Query  785   NALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE  606
             +AL+ KERQSNDELQEARK LI+GL DLL SGR+ IGI+RMGE+D KAF N C++++  E
Sbjct  473   SALISKERQSNDELQEARKELIKGLEDLL-SGRTLIGIKRMGELDEKAFQNACRKKYKAE  531

Query  605   EADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAV  426
             EAD+KA ELCS WQE++K P WHPF+++    + +++I+EDD  L KL  E G+++C AV
Sbjct  532   EADIKAAELCSSWQEELKKPAWHPFKIVTSDGKEQEVIDEDDTNLKKLWIELGDDVCNAV  591

Query  425   IKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
               A+ E+N+YN SGRYVIPELWNFKE RKAT+KEV+  I KQ ++ KRKR
Sbjct  592   KTALVELNDYNPSGRYVIPELWNFKERRKATMKEVIVAILKQWRSQKRKR  641



>ref|XP_006644407.1| PREDICTED: intracellular protein transport protein USO1-like 
[Oryza brachyantha]
Length=629

 Score =   469 bits (1208),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 264/620 (43%), Positives = 420/620 (68%), Gaps = 13/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+ K Y  L +G++KVK       CPFC+GKKK+ Y   +L+QHA+GVG  + NR  
Sbjct  16    IDDYEGKFYARLVAGEFKVKDGE-SYSCPFCSGKKKKAYNLNNLIQHASGVG-AAPNRQA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNL------YCWPWTGIVVNVSKDNAN  1773
             K KA+H ALAK+L+  L   +E LP + V  E   L      + WPW G++VNV  +  +
Sbjct  74    KDKASHRALAKHLKNGLTKSSE-LPAQTVVVEPQPLPSRDEKFVWPWMGVLVNVPTEWKD  132

Query  1772  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             G  +      LK + S++   +V    + +  T   +++   DW+G++NA+ FEN FEAE
Sbjct  133   GRQIGRSGNHLKEQLSRFCPLKVIPLWNFRGHTGNAIVEFGKDWHGFRNALAFENYFEAE  192

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              + K++W  ++ +  S+++GW A+ +D+   G +G +LR+   LKTI DL  E  R  DK
Sbjct  193   GYGKRDWK-QKQNQGSYLFGWVARAEDHSYPGLIGDHLRKNGDLKTINDLENEGARKTDK  251

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             +++NL N++++KN +L  L   + E+  SL +M+ +++ L + + EE RKMQ+LA+ H Q
Sbjct  252   LVANLANQIEVKNRHLQELEVTYTERTASLEKMMGQREQLLQKYNEEIRKMQQLAQRHSQ  311

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             +++ E + L SELE K  +L++ ++EL++    ++ ++  +++EK++N  ++S L++A+ 
Sbjct  312   KIIDENQKLRSELESKMSELNTRSKELDEIAAKSDYDRRIIEQEKQKNAIKSSHLKLATL  371

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ++ADENVL+L+ EHKREKEAA++KIL LE+ +DAKQKLE++IQ+LKGKL+VM+HM GD
Sbjct  372   EQERADENVLKLVREHKREKEAAVRKILRLEEQLDAKQKLELDIQQLKGKLEVMKHMPGD  431

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             +DSA++ KI E+ E+L EK++++  ++ +N  LV+KE +SN E+Q+ARK L  GL D L+
Sbjct  432   EDSALKNKIDELSEELQEKMDELDAMESLNQTLVIKESKSNTEMQDARKELENGLLD-LS  490

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
              GR+HIGI+RMGE+D +AF   C++  S E+  V A  LCS WQ ++K+P+WHPFR + +
Sbjct  491   DGRAHIGIKRMGELDLEAFSKACRKMSSEEDVGVTAAILCSKWQAEIKNPDWHPFRAVLV  550

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               + ++II +D++     +E  GEEI   V KA+ E+NEYN SGR+ + ELWNF++ RKA
Sbjct  551   DGQEKEIIEDDEKLQELKEEH-GEEIYKLVRKALCEINEYNPSGRFPVGELWNFRDDRKA  609

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKE V F+ +Q + ++RKR
Sbjct  610   TLKETVQFVLRQWRANRRKR  629



>ref|XP_004972828.1| PREDICTED: synaptonemal complex protein 1-like isoform X2 [Setaria 
italica]
Length=626

 Score =   468 bits (1203),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 274/621 (44%), Positives = 412/621 (66%), Gaps = 18/621 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y EK Y  L+SGK   +  +   RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  16    IDDYSEKSYLNLKSGKLVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGVG--ASNRAA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQ-RAVA-------PEDNNLYCWPWTGIVVNVSKDN  1779
             K KANH ALAK L+ D  D A  LP  +A+A        +D  ++ WPW GI+ NV  + 
Sbjct  74    KVKANHQALAKLLKEDHADAAATLPPLQAIALSNPPKSVKDEEVFVWPWMGILTNVPAEQ  133

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               G         +K+ + ++  +          T   ++    DW G+KNA+ F+N F++
Sbjct  134   TQGGGA----ILMKQLADFKPLQYTAVYGANGYTGCGIVLFSKDWIGFKNALAFQNFFKS  189

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             +   K +W   R    ++V+GW A  +DY+++  VG +L     LKT++DL QE     D
Sbjct  190   QRLGKMDWKETRRH-GNYVFGWLAGEEDYKSDDPVGMFLSANGDLKTVSDLEQEMSSKTD  248

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              +++NLT ++  +++ +  L  ++N+ NLSL R +EE D LH+ + EE R MQ  AREH 
Sbjct  249   NLIANLTQQMSAQSKYVQELECKWNQMNLSLQRAMEESDLLHKRYNEEMRNMQSAAREHT  308

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             QRV  E + L ++L +K++ +   +R+LN+    T+ E+ KL+EE+K+N ++N SL MA 
Sbjct  309   QRVFQETDKLRTQLVEKERYIQRRSRQLNELVAQTDMERRKLEEERKKNADQNDSLNMAR  368

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ+KADE  L+L+E+HK+EKEAA  KIL+LE+ +D KQKLE++I++LKGKL+V++HM G
Sbjct  369   IEQQKADERALQLLEKHKKEKEAAFNKILQLERQVDEKQKLELDIEQLKGKLEVVKHMEG  428

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             +    V+++ +E+  +L+E+IE+M+DL+ +N  LV+KER +N+E+Q+A+K LI GL++LL
Sbjct  429   EG-VDVKKRSEELTAELNERIEEMEDLESLNQTLVIKERMTNNEIQDAKKELISGLAELL  487

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
                RS+IGI+RMGE+DGK F   CKQR+  ++AD+KA +LCS WQE++KDPNWHPF+++ 
Sbjct  488   GP-RSNIGIKRMGELDGKPFLVACKQRYG-DDADMKAAKLCSSWQEQLKDPNWHPFKIVT  545

Query  518   IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  339
                  EQ+I++ DE+L  LK++ GEE+  AV  A+ E+NEYNASG YV+ ELWN KE RK
Sbjct  546   TGPTAEQVIDDKDEKLVGLKQQLGEEVYKAVTTALLEINEYNASGSYVVSELWNNKENRK  605

Query  338   ATLKEVVSFIFKQLKTHKRKR  276
             A + E +  + KQ K  KR+R
Sbjct  606   ANITEAIQHVLKQWKALKRRR  626



>ref|XP_004972827.1| PREDICTED: synaptonemal complex protein 1-like isoform X1 [Setaria 
italica]
Length=630

 Score =   468 bits (1203),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 274/621 (44%), Positives = 412/621 (66%), Gaps = 18/621 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y EK Y  L+SGK   +  +   RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  20    IDDYSEKSYLNLKSGKLVARLGSDRFRCPFCPGKKKQDYRYNELLQHAVGVG--ASNRAA  77

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQ-RAVA-------PEDNNLYCWPWTGIVVNVSKDN  1779
             K KANH ALAK L+ D  D A  LP  +A+A        +D  ++ WPW GI+ NV  + 
Sbjct  78    KVKANHQALAKLLKEDHADAAATLPPLQAIALSNPPKSVKDEEVFVWPWMGILTNVPAEQ  137

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               G         +K+ + ++  +          T   ++    DW G+KNA+ F+N F++
Sbjct  138   TQGGGA----ILMKQLADFKPLQYTAVYGANGYTGCGIVLFSKDWIGFKNALAFQNFFKS  193

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             +   K +W   R    ++V+GW A  +DY+++  VG +L     LKT++DL QE     D
Sbjct  194   QRLGKMDWKETRRH-GNYVFGWLAGEEDYKSDDPVGMFLSANGDLKTVSDLEQEMSSKTD  252

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              +++NLT ++  +++ +  L  ++N+ NLSL R +EE D LH+ + EE R MQ  AREH 
Sbjct  253   NLIANLTQQMSAQSKYVQELECKWNQMNLSLQRAMEESDLLHKRYNEEMRNMQSAAREHT  312

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             QRV  E + L ++L +K++ +   +R+LN+    T+ E+ KL+EE+K+N ++N SL MA 
Sbjct  313   QRVFQETDKLRTQLVEKERYIQRRSRQLNELVAQTDMERRKLEEERKKNADQNDSLNMAR  372

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ+KADE  L+L+E+HK+EKEAA  KIL+LE+ +D KQKLE++I++LKGKL+V++HM G
Sbjct  373   IEQQKADERALQLLEKHKKEKEAAFNKILQLERQVDEKQKLELDIEQLKGKLEVVKHMEG  432

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             +    V+++ +E+  +L+E+IE+M+DL+ +N  LV+KER +N+E+Q+A+K LI GL++LL
Sbjct  433   EG-VDVKKRSEELTAELNERIEEMEDLESLNQTLVIKERMTNNEIQDAKKELISGLAELL  491

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
                RS+IGI+RMGE+DGK F   CKQR+  ++AD+KA +LCS WQE++KDPNWHPF+++ 
Sbjct  492   GP-RSNIGIKRMGELDGKPFLVACKQRYG-DDADMKAAKLCSSWQEQLKDPNWHPFKIVT  549

Query  518   IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  339
                  EQ+I++ DE+L  LK++ GEE+  AV  A+ E+NEYNASG YV+ ELWN KE RK
Sbjct  550   TGPTAEQVIDDKDEKLVGLKQQLGEEVYKAVTTALLEINEYNASGSYVVSELWNNKENRK  609

Query  338   ATLKEVVSFIFKQLKTHKRKR  276
             A + E +  + KQ K  KR+R
Sbjct  610   ANITEAIQHVLKQWKALKRRR  630



>gb|AGT17258.1| X1 protein [Saccharum hybrid cultivar R570]
 gb|AGT17260.1| X1 protein [Saccharum hybrid cultivar R570]
Length=629

 Score =   463 bits (1192),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 269/619 (43%), Positives = 404/619 (65%), Gaps = 11/619 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16    IDDYEGKIYARLMSGDLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAPED----NNLYCWPWTGIVVNVSKDNANG  1770
             K+KA H AL KYL+ DL    EP P    V P+     +  + WPW GI+VNV  +  +G
Sbjct  75    KEKAAHRALFKYLKNDLTKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDG  134

Query  1769  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               + E    LK + S +   +V      +  T   +++   DWNG++NA  FE+ F A  
Sbjct  135   RQIGESGNRLKEQLSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAAGG  194

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             + KK+WT +++   S +YGW A+ +DY + G +  +LR+   LK++ DL +E  R  D++
Sbjct  195   YGKKDWTGKKNQ-GSELYGWLARAEDYNSPGIIADHLRKNGDLKSVNDLAKEGARKTDRL  253

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL N++++KN  L  L ++++E   SL +M+ +++ L +++ +E  KMQ+LAR H Q+
Sbjct  254   VANLANQIEVKNRYLQELESKYSETTASLEKMMGQREQLLQSYNKEISKMQQLARRHSQK  313

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             ++ E + L SELE K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ E
Sbjct  314   IIDENQKLRSELEAKMNDLDVRSKQLDELAAKSDYDRRNLEQEKQKNAIKSSHLKLATLE  373

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KADENVL+L+EE KREK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD+
Sbjct  374   QQKADENVLKLVEEQKREKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGDE  433

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             DS  + KI E+ E L EKI+++  ++ +N  LV+KE +SN ELQEARK L  GL D L+ 
Sbjct  434   DSESKNKINELSEALQEKIDELDGMESLNQTLVIKESKSNIELQEARKELENGLLD-LSG  492

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G++HIGI+RMGE+D KAF   C Q+  TE+ +V A  LCS W+ ++K+P+WHPFRV+ + 
Sbjct  493   GQAHIGIKRMGELDLKAFSKAC-QKEHTEDTEVTAAFLCSKWEAEIKNPDWHPFRVVTVD  551

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              +  +II +D +  +  +E  GEEI A V KA+ E+NEY + G Y + ELWNFKE RK T
Sbjct  552   GKEMEIIEDDSKLRALKEEH-GEEIYALVTKALLEINEYKSKGSYPVGELWNFKENRKVT  610

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKE V F+ +Q +T++RKR
Sbjct  611   LKEAVQFVLRQWRTNRRKR  629



>ref|XP_003569414.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=628

 Score =   462 bits (1189),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 269/613 (44%), Positives = 409/613 (67%), Gaps = 10/613 (2%)
 Frame = -1

Query  2099  EKPYEELRSGKYKVKGPNGC-LRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKA  1923
             +K Y  L SG  K+   NG    CPFC GKKK+DY   +LLQHA+GVG  + NR  K+KA
Sbjct  21    DKIYARLISGDLKIN--NGASYSCPFCTGKKKKDYNIHNLLQHASGVG-AAPNRPAKEKA  77

Query  1922  NHVALAKYLEIDLGDQAEPLPQRAV---APEDNNLYCWPWTGIVVNVSKDNANGTAVEEE  1752
              H ALAK+L+  L    EP PQ  V    P  N  + WPW G++ NV  +  +G  V E 
Sbjct  78    THRALAKHLKNGLAKPPEPQPQLIVDQPLPNRNEKFVWPWMGVLANVPTEWKDGRQVGES  137

Query  1751  DYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEW  1575
                LK + S++   +V    + +  T   +++   DWNG++NA+ FEN FEAE + +++W
Sbjct  138   GNRLKEQLSRFCPLKVIPLWNFRGHTGNAIVEFAKDWNGFRNALAFENYFEAEGYGRRDW  197

Query  1574  TAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTN  1395
                + +  S ++GW A+ +D+   G +G +LR+   LKTI DL  E  R  DK+ +NL N
Sbjct  198   K-HKQNQRSKLFGWVARAEDHNFPGIIGDHLRKNGDLKTIDDLEDERTRKNDKLEANLAN  256

Query  1394  ELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQE  1215
             ++++KN++L  L  R+NE   SL +M+ ++  L + + EE RKMQ+LA  H Q+++ E +
Sbjct  257   QIEVKNKHLQELECRYNETTASLEKMMGQRQQLLQTYNEEIRKMQQLACRHSQKIIDENQ  316

Query  1214  TLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADE  1035
              L SELE K  +L++ +++L++    +  ++  L++EK++N  ++S L+ A+ EQ++ADE
Sbjct  317   NLRSELESKMSELNARSKQLDELAAKSGYDRKNLEQEKQKNAIKSSHLKSATVEQQRADE  376

Query  1034  NVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQE  855
             NVL+L+ EHKR KE AL KIL LE+ ++AKQ LE++IQ+LKGKL+VM++M G +DS  + 
Sbjct  377   NVLKLVGEHKRAKETALNKILMLEQQLEAKQTLELKIQQLKGKLEVMKYMPGHEDSESKS  436

Query  854   KIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIG  675
             KI E+ E+L +KI+++  ++ +N  LV+KE  S+ ELQEARK L  GL DL + G++HIG
Sbjct  437   KINELSEELQDKIDELDGMESLNQTLVIKESNSSIELQEARKELENGLLDL-SGGQAHIG  495

Query  674   IRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQI  495
             I+RMGE+D KAF N C+Q+ S E+A+V A  LCS W+ ++K+P+WHPF+V+ +  +  +I
Sbjct  496   IKRMGELDLKAFSNACRQKSSKEDAEVTAAILCSKWEAEIKNPDWHPFKVVMVDGKAMEI  555

Query  494   INeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVS  315
             I+  D +L +LKEE G+EI A V KA+ E+N+YNAS RY + ELWNF+E RKA+LKE V 
Sbjct  556   IDAGDAKLQELKEEHGDEIYALVTKALCELNKYNASTRYPVGELWNFREERKASLKEAVQ  615

Query  314   FIFKQLKTHKRKR  276
             F+ +Q + +++KR
Sbjct  616   FVLRQWRMNRKKR  628



>ref|XP_010232023.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Brachypodium 
distachyon]
Length=600

 Score =   461 bits (1186),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 257/568 (45%), Positives = 394/568 (69%), Gaps = 5/568 (1%)
 Frame = -1

Query  1976  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVV  1797
             HA+G G  + NR  + KA H    +  E +   Q+   P+   A   + L+ WPW G++V
Sbjct  31    HASGAG-SADNRQGRDKATHRGSYQNHEKNELPQSSG-PRSQPAQNRDELFVWPWMGVLV  88

Query  1796  NVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAIL  1620
             NV  +   G  V E    LK + S++  Q+V    + +  T   +++   D+ G+K A  
Sbjct  89    NVPTEWKGGRQVGESGNRLKEQLSRFCPQKVVPLWNYRGHTGNAIVEFGKDYKGFKAAFS  148

Query  1619  FENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQ  1440
             FEN FEAE + K++W A++    S ++GW A+VDD    G +G YL++   LKTI DL  
Sbjct  149   FENHFEAEGYGKQDWKAQKHR-GSEMFGWVARVDDQRTPGPIGEYLQKNGDLKTIADLEN  207

Query  1439  EEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQ  1260
             E  R  DK+++NL  ++++K +++  L  ++NE   SL +++EEK+ + + + +E  +MQ
Sbjct  208   EGTRKTDKLVANLAGQIEVKAKHVQELECKYNETTTSLDKVMEEKELILQKYNDEIHEMQ  267

Query  1259  RLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRN  1080
             ++AR H QR++ E + L SELE K + LD  +++L++  V ++ ++  L+ EK+++  + 
Sbjct  268   QVARRHSQRIIDENQKLRSELESKMQNLDLKSKQLDELAVRSDSDRRNLEREKEKHVVKT  327

Query  1079  SSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLD  900
               L+MA+ EQ++ADENVL+L+E+HKREK+AAL +I++LE+ +DAKQKLE+EI++L+GKL+
Sbjct  328   KYLKMAAMEQQRADENVLKLVEKHKREKQAALDEIIKLEQKLDAKQKLELEIKQLQGKLE  387

Query  899   VMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             VM+HM G++DS  + KI E+ E+L EK +DM  ++ ++  L++KER+SNDELQ+ARK LI
Sbjct  388   VMKHMPGEEDSESKRKIDELNEELQEKYDDMDLMESLHQTLLIKERKSNDELQDARKKLI  447

Query  719   QGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNW  540
              GL D + +GR++IGI+RMG++D K+F   CK +FS E+A+V A  LCS WQE++K+P+W
Sbjct  448   DGLRDTI-TGRTNIGIKRMGDLDLKSFAIACKSKFSKEDAEVSASILCSKWQEEIKNPDW  506

Query  539   HPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELW  360
             HPFRV+  + + ++I+ EDDE+L KLKEE+GEE+ A VIKA+ EVNEYN SGRY +PELW
Sbjct  507   HPFRVVMENGKEKEILREDDEKLQKLKEEYGEEVYALVIKALLEVNEYNPSGRYAVPELW  566

Query  359   NFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             N+KEGRKATLKEVV +I KQ +THKRKR
Sbjct  567   NYKEGRKATLKEVVQYILKQWRTHKRKR  594



>ref|XP_007009298.1| XH/XS domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY18108.1| XH/XS domain-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=640

 Score =   462 bits (1189),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 280/629 (45%), Positives = 416/629 (66%), Gaps = 23/629 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16    MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  1782
              K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76    AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  1781  NANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  134   SEDGRSVGESGSKLRDELIRR--GFNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  191

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A++A+ H KKEW A        +Y W A+ DDY++ G +G  LR+T  LKTI+ +++E
Sbjct  192   EKAYQADHHGKKEWCANNDVKFG-LYAWVARADDYKSSGIIGENLRKTSDLKTISGIMEE  250

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +DK++SNLTN ++ KN+++  +  R +E + SL  +++EKD L +A+ EE +K+Q 
Sbjct  251   EARKQDKLVSNLTNIIETKNKHIKEMEARCSETSKSLEVLMDEKDNLLQAYNEEIKKIQL  310

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AREH  R+ ++ E L S+LE  K+ L+    EL KRE L E E+ KL EE ++N  +NS
Sbjct  311   SAREHFLRIFNDHEKLKSQLESHKRDLELRGVELEKREALNESERKKLAEELEQNAVQNS  370

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             +L++AS EQKKADENV++L E+ KR+KE    +I++LEK +D KQ LE+EI++L+G L+V
Sbjct  371   ALQLASLEQKKADENVMKLAEDQKRQKEELHNRIIQLEKQLDQKQALELEIEQLRGSLNV  430

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             + HMG +DD  V  K++   ++L EK  +++D++ +N  L+++ER+SNDELQEARK LI 
Sbjct  431   IRHMGDEDDIEVLRKMEATLKELREKEGELEDVEALNQTLIVRERKSNDELQEARKELIN  490

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             GL ++  S R+HIG++RMGE+D K F  V K+R++ E+A+ +A ELCSLW E +KDP+WH
Sbjct  491   GLKEI--SSRAHIGVKRMGELDSKPFFEVMKRRYNEEQAEERASELCSLWDEYLKDPDWH  548

Query  536   PFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  363
             PF+ I +    E  ++IN++DE+L  L+ + G E+   V  A++E+NEYN SGRY+I EL
Sbjct  549   PFKRIKLEGEEEYQEVINDEDEKLRDLRNQMGNEVYKVVTSAIKEINEYNPSGRYIISEL  608

Query  362   WNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             WN+ EGRKATL+E V ++ K   T KRKR
Sbjct  609   WNYGEGRKATLQEGVIYLLKLWNTAKRKR  637



>gb|AGT16789.1| hypothetical protein SHCRBa_009_B01_R_10 [Saccharum hybrid cultivar 
R570]
Length=629

 Score =   461 bits (1187),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 268/619 (43%), Positives = 405/619 (65%), Gaps = 11/619 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16    IDDYEGKIYARLMSGDLKVKKNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAPED----NNLYCWPWTGIVVNVSKDNANG  1770
             K+KA H AL KYL+ DL    EP P    V P+     +  + WPW G++VNV  +  +G
Sbjct  75    KEKAAHRALFKYLKNDLAKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGVLVNVPTEWKDG  134

Query  1769  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               + E    LK + S +   +V      +  T   +++   DWNG++NA  FE+ F A  
Sbjct  135   RQIGESGNRLKEQLSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAAGG  194

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             + KK+WT +++   S +YGW A+ +DY + G +  +LR+   LK++ DL +E  R  D++
Sbjct  195   YGKKDWTGKKNQ-GSELYGWLARAEDYNSPGIIADHLRKNGDLKSVNDLAKEGARKTDRL  253

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL N++++KN  L  L ++++E   SL +M+ +++ L +++ +E  KMQ+LAR H Q+
Sbjct  254   VANLANQIEVKNRYLQELESKYSETTASLEKMMGQREQLLQSYNKEISKMQQLARRHSQK  313

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             ++ E + L SELE K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ E
Sbjct  314   IIDENQKLRSELEAKMNDLDVRSKQLDELAAKSDYDRRNLEQEKQKNAIKSSHLKLATLE  373

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KADENVL+L+EE KREK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD+
Sbjct  374   QQKADENVLKLVEEQKREKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGDE  433

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             DSA + KI E+ E L EKI+++  ++ +N  LV+KE +SN ELQEARK L  GL D L+ 
Sbjct  434   DSASKNKINELSEALQEKIDELDGMESLNQTLVIKESKSNIELQEARKELENGLLD-LSG  492

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G++ IGI+RMGE+D KAF   C Q+  TE+A+V +  LCS W+ ++K+P+WHPFRV+ + 
Sbjct  493   GQALIGIKRMGELDLKAFSKAC-QKEHTEDAEVTSAFLCSKWEAEIKNPDWHPFRVVTVD  551

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              +  +II +D +  +  +E  GEEI A V KA+ E+NEY + G Y + ELWNFKE RK T
Sbjct  552   GKEMEIIEDDAKLRALKEEH-GEEIYALVTKALLEINEYKSKGSYPVGELWNFKENRKVT  610

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKE V F+ +Q +T++RKR
Sbjct  611   LKEAVQFVLRQWRTNRRKR  629



>ref|XP_011091511.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Sesamum indicum]
Length=641

 Score =   461 bits (1185),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 266/620 (43%), Positives = 418/620 (67%), Gaps = 12/620 (2%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVK  1932
             +Y+EK YEEL+SGK++VK  +    CP+C  K+K+D++YK+LLQHA+ +G  S++ R+ +
Sbjct  22    DYQEKAYEELKSGKHQVKISDQAYTCPYCPKKRKRDFQYKELLQHASAIGSCSSHKRTAR  81

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRA----VAPEDNN-LYCWPWTGIVVNVSKDNANGT  1767
              KANH+ALAKYLE D    A P    A    +A +D + L+ WPW GIVVN+  D  +G 
Sbjct  82    DKANHLALAKYLENDTAVDAGPSKPSAEVDALADQDRDELFVWPWIGIVVNIPTDFKDGR  141

Query  1766  AVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+ + ++  +    V+   + +  +   +++ + DW+G+ NA+ FE  +EA 
Sbjct  142   YVGESGSKLRDQLTRRGFNPTRVRPLWNYQGHSGTAIVEFQKDWSGFTNAMSFEKFYEAN  201

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H +K W A ++   S +Y W A+ DDY +   VG  LR+   L+TI+D+++EE R  +K
Sbjct  202   HHGQKNWLA-KNGMKSDLYAWVARADDYNSNNIVGENLRKIGDLRTISDIMEEEARKTNK  260

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++ NLTN ++ K  +L  +  +F E   SL ++I EKD LH+A+ EE +K++  AR+H +
Sbjct  261   LVGNLTNVIEAKKMHLLEMENKFKETESSLLQLIMEKDNLHQAYNEEIKKIESSARDHFK  320

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             ++ ++ E L  +LE +K+ L+   +EL KRE   E E+ KL E+ ++N  +N SL+ A++
Sbjct  321   KIFNDHEKLKLQLETQKRDLEFRGQELMKRETHNEIERKKLSEDLEQNAVKNCSLQAAAE  380

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KADE V++L EE K++KE   ++I+ LEK +DAKQ +++EI++L+GKL+VM+HMG +
Sbjct  381   EQRKADEKVMKLAEEQKKQKENLHKRIILLEKQLDAKQAVQLEIEQLRGKLNVMKHMGDE  440

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              D  V  K+  + + L EK  +++DL+ +N  L+++ER+ NDELQ+ARK L+ GL ++  
Sbjct  441   GDLEVLNKVDLLLKALREKEGELEDLEVLNQTLIVQERKRNDELQDARKELVNGLKEMST  500

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             +G  HIG++RMGE+D K FH+  K+++S  EAD +A ELCSLW+E ++DP WHP +V++I
Sbjct  501   NG--HIGVKRMGELDSKPFHDAMKRKYSEAEADERATELCSLWEEYLRDPEWHPIKVVSI  558

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
             + + + +I EDDE+L  LKE +G+E+  AV  A+ E+NEYN SGRY+I ELWN+ EGR+A
Sbjct  559   NGKHQAVIKEDDEKLRDLKENYGDEVYNAVTAALCEINEYNPSGRYIISELWNYNEGRRA  618

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKE V  + KQ +  KRKR
Sbjct  619   TLKEGVEVLLKQWRYQKRKR  638



>gb|KDP44945.1| hypothetical protein JCGZ_01445 [Jatropha curcas]
Length=636

 Score =   460 bits (1184),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 276/623 (44%), Positives = 415/623 (67%), Gaps = 14/623 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             + EY+ + YEEL++G   VK  +    CP+C  K+K+DY YKDLLQHA GVGK  +N RS
Sbjct  16    MEEYEAQSYEELKNGTRSVKISDEIFSCPYCPKKRKRDYLYKDLLQHAVGVGKSPSNKRS  75

Query  1937  VKQKANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSK---D  1782
              K+KANH+AL KYLE DLG    P  P+    P    +      WPWTGIVVN+     D
Sbjct  76    AKEKANHLALVKYLEKDLGATGSPSEPKSDTDPLSECDHYEKLVWPWTGIVVNLPTTRTD  135

Query  1781  NANGTAVEEEDYWLKRFSK-YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  1605
             +          +  +  S+ +    V    + +  +   V++ + DW G  NA+ FE A+
Sbjct  136   DGRFVGASGSKFRDELISRGFNPTRVHPLWNYRGHSGSAVVEFRKDWPGLHNALSFEKAY  195

Query  1604  EAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRD  1425
             EA+ H KKEW        S VY W A+ DDY+A+  +G +LR+   LKT++++++EE R 
Sbjct  196   EADHHGKKEWFT--GGEKSGVYCWVARADDYKADNIIGEHLRKIGDLKTVSEIMEEEARK  253

Query  1424  KDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLARE  1245
             +DK++SNL N +++KN++L  +  + +E  +SL +++ EKD L +A+ EE +K+Q  ARE
Sbjct  254   QDKLISNLNNIIEIKNKHLQEMEEKCSETTVSLQKLMGEKDRLLQAYNEEIKKIQMSARE  313

Query  1244  HVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM  1065
             H Q++ ++ E L  +LE +K++L+    EL +RE   E ++  L EE ++N  RNSSL++
Sbjct  314   HFQKIFNDHEKLKLQLESQKRELEMRGSELEQREARNESDRRLLSEEIEKNAIRNSSLQL  373

Query  1064  ASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHM  885
             AS EQ+KADE+VL+L E+ KR+KE    +I++LEK +DAKQ LE+EI+ L+G L+V++HM
Sbjct  374   ASLEQQKADESVLKLAEDQKRQKEELHNRIIQLEKQLDAKQALELEIERLRGSLNVIKHM  433

Query  884   GGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD  705
             G D D+ V +K+  + + L EK  ++++L+ +N AL+++ER+SNDELQEARK LI GL +
Sbjct  434   GDDGDAEVLKKMDTIIQNLREKEGELEELETLNQALIVRERKSNDELQEARKELITGLKE  493

Query  704   LLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV  525
             +  S R+ IG++RMGE+D K F    K++F  +EA+V+A ELCSLW E +KDP+WHPF+ 
Sbjct  494   I--SNRASIGVKRMGELDSKPFLEAMKKKFVEDEAEVRASELCSLWMEYLKDPDWHPFKF  551

Query  524   INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
             + +  + +++IN++DE+L  L++E   E+  AV  A+ E+NEYN SGRY+I ELWN+KEG
Sbjct  552   VMVDGKHKEVINDEDEKLKGLRKEMSNEVYKAVTDALMEINEYNPSGRYIISELWNYKEG  611

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             +KATLKE VSF+ KQ +  KRKR
Sbjct  612   KKATLKEGVSFLLKQWQVAKRKR  634



>ref|NP_001168342.1| putative XH domain family protein [Zea mays]
 gb|ACN27880.1| unknown [Zea mays]
 gb|AFW57328.1| putative XH domain family protein [Zea mays]
Length=626

 Score =   459 bits (1181),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 270/621 (43%), Positives = 410/621 (66%), Gaps = 18/621 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y +K Y +L+SGK+  +  +   RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  16    IDDYADKSYSDLKSGKFVARLGSDRFRCPFCPGKKKQDYRYSELLQHAVGVG--ASNRAA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQ-RAVA-------PEDNNLYCWPWTGIVVNVSKDN  1779
             K KANH ALAK L+ D  D A  LP  +A+A        +D   + WPWTG++ NV    
Sbjct  74    KVKANHQALAKLLKEDHADAAATLPAWQAIALSNAPKPAQDQEAFVWPWTGVLANVPA--  131

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               G A E     +++ ++++  ++   C        VV+    DW G+KNA+ F+N F++
Sbjct  132   --GQAQEGGATLMEQLAEFKPVQITAVCGADGYAGYVVVLFTKDWIGFKNALAFQNCFKS  189

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
                 K++W  E       V+GW AK +DY ++  VG +L     LKT+++L QE     D
Sbjct  190   RRLGKQDWK-ETKGHVEQVFGWLAKEEDYRSDDPVGRFLSANGDLKTVSELEQEMSSKTD  248

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              ++ +L  ++  K++ L  L  + N+ NLSL + +EE D LH+ + EE R MQ   REH 
Sbjct  249   NLIDSLARQITAKSKYLQELECKCNQMNLSLQKAMEESDLLHKRYNEEMRNMQSAVREHT  308

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             +RV  E E L ++L +K+  +   +RELN+    T+ E+ KL+EE+K+N ++N SL MA 
Sbjct  309   RRVFQETEELRNQLVEKESNIQRRSRELNELVAQTDMERRKLEEERKKNADQNDSLNMAR  368

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ++ADE  L+L+E+HK+EKE AL +IL+LE+ +D KQKLE++I++LKGKL+V++HM G
Sbjct  369   IEQQRADERALQLLEKHKKEKEDALNRILQLERQVDEKQKLELDIEQLKGKLEVVKHMAG  428

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             +    V+++ +E+  +L+E+IE+M+DL+ +N  LV+K R +NDE+Q+A+K LI GL+D+L
Sbjct  429   EG-VDVKKRSEELTAELNERIEEMEDLEALNQTLVVKHRMTNDEIQDAKKELITGLTDML  487

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
                RS+IGI+RMGE+D K F   CKQR+  ++A++KA EL SLWQE +KDPNWHPF+++ 
Sbjct  488   GP-RSNIGIKRMGELDEKPFVLSCKQRYG-QDAEMKAAELVSLWQEHLKDPNWHPFKIVT  545

Query  518   IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  339
                  EQII++ DE+L+ LK++ GE++  AV  A+ E+NEYNASG YV+ ELWN +E RK
Sbjct  546   TGSTKEQIIDDKDEKLAGLKKQLGEKVYEAVATALLEINEYNASGSYVVSELWNNRENRK  605

Query  338   ATLKEVVSFIFKQLKTHKRKR  276
             A++ E +  + KQ K  +R+R
Sbjct  606   ASVTEAIQHVLKQWKAQRRRR  626



>gb|AGT16810.1| transcription factor [Saccharum hybrid cultivar R570]
Length=629

 Score =   459 bits (1181),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 267/619 (43%), Positives = 404/619 (65%), Gaps = 11/619 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+ K Y  L SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  
Sbjct  16    IDDYEGKIYARLMSGDLKVKKNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAPED----NNLYCWPWTGIVVNVSKDNANG  1770
             K+KA H +L KYL+ DL    EP P    V P+     +  + WPW G++VNV  +  +G
Sbjct  75    KEKAAHRSLFKYLKNDLAKSPEPRPHVIPVEPQPLQNRDEKFVWPWMGVLVNVPTEWKDG  134

Query  1769  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               + E    LK + S +   +V      +  T   +++   DWNG++NA  FE+ F A  
Sbjct  135   RQIGESGNRLKEQLSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAAGG  194

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             + KK+WT +++   S +YGW A+ +DY + G +  +LR+   LK++ DL +E  R  D++
Sbjct  195   YGKKDWTGKKNQ-GSELYGWLARAEDYNSPGIIADHLRKNGDLKSVNDLAKEGARKTDRL  253

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL N++++KN  L  L ++++E   SL +M+ +++ L +++ +E  KMQ+LAR H Q+
Sbjct  254   VANLANQIEVKNRYLQELESKYSETTASLEKMMGQREQLLQSYNKEISKMQQLARRHSQK  313

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             ++ E + L SELE K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ E
Sbjct  314   IIDENQKLRSELEAKMNDLDVRSKQLDELAAKSDYDRRNLEQEKQKNAIKSSHLKLATLE  373

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KADENVL+L+EE KREK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD+
Sbjct  374   QQKADENVLKLVEEQKREKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGDE  433

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             DSA + KI E+ E L EKI+++  ++ +N  LV+KE +SN ELQEARK L  GL D L+ 
Sbjct  434   DSASKNKINELSEALQEKIDELDGMESLNQTLVIKESKSNIELQEARKELENGLLD-LSG  492

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G++ IGI+RMGE+D KAF   C Q+  TE+A+V A  LCS W+ ++K+P+WHPFRV+ + 
Sbjct  493   GQALIGIKRMGELDLKAFSKAC-QKEHTEDAEVTAAFLCSKWEAEIKNPDWHPFRVVTVD  551

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              +  +II +D +  +  +E  GEEI A V KA+ E+NEY + G Y + ELWN KE RK T
Sbjct  552   GKEMEIIEDDAKLRALKEEH-GEEIYALVTKALLEINEYKSKGSYPVGELWNLKENRKVT  610

Query  332   LKEVVSFIFKQLKTHKRKR  276
             LKE V F+ +Q +T++RKR
Sbjct  611   LKEAVQFVLRQWRTNRRKR  629



>ref|XP_004240949.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Solanum lycopersicum]
Length=638

 Score =   459 bits (1181),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 262/616 (43%), Positives = 407/616 (66%), Gaps = 16/616 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I EY EK YE+L+SG   +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  16    IEEYGEKSYEDLKSGSRSLKISDVAYTCPYCPKKRKRDFLYKELVQHASGVGSCSSNKRT  75

Query  1937  VKQKANHVALAKYLEIDLG-------DQAEPLPQR-AVAPEDNN-LYCWPWTGIVVNVSK  1785
              ++KANH+ LAKYLE D           AEP  Q   +A  D + ++ WPW G+VVN+  
Sbjct  76    AREKANHLGLAKYLETDAAVAADSSKPDAEPDTQTDPLADHDRDEMFVWPWIGVVVNIPT  135

Query  1784  DNANGTAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
             +  +G  V E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ +E
Sbjct  136   EYKDGRNVGESGSKLRDQLTRRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMAYE  195

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
              A+EA+ H KK+W    S  +S +Y W A+ DDY+A   +G  LR+   L+TI+D+++EE
Sbjct  196   KAYEADHHGKKDWKVNHSK-NSDLYAWIARADDYKAINIIGENLRKVGDLRTISDIMEEE  254

Query  1433  KRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRL  1254
              R  +K++SNLTN +++K  +L  +  +F E + SL +++EEKD LH+A+ EE RK+Q  
Sbjct  255   ARKTNKLVSNLTNVIEVKKLHLKEMADKFKETSQSLKQLVEEKDKLHQAYNEEIRKIQSS  314

Query  1253  AREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSS  1074
             AR+H Q++ ++ E L  +LE +KK+L+   REL KRE   E ++ KL E+ ++N   N+S
Sbjct  315   ARDHFQKIFNDHEKLKLQLESQKKELELRGRELEKREAKNESDRKKLSEDLEQNATLNTS  374

Query  1073  LEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVM  894
             L  A++EQ+K DE VL+L EE KR+KE   ++I++LEK +DAKQ +E+EI++L+G L+VM
Sbjct  375   LSAAAEEQRKVDEKVLKLAEEQKRQKEDLHKRIIQLEKQLDAKQAVELEIEQLRGSLNVM  434

Query  893   EHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQG  714
             +H+  + D  V +K+  + + L EK E+   L+ +N  L++KER SNDELQ+ARK L+ G
Sbjct  435   KHIEDEGDQEVLKKVDTLLKSLREKEEEYDGLEALNQTLIVKERNSNDELQDARKELVNG  494

Query  713   LSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHP  534
             L +L   G   IG++RMGE+D + FH   K+ ++  EAD +A ELCSLW+E ++DP WHP
Sbjct  495   LKELPRVG--PIGVKRMGELDNRPFHEAMKRNYNESEADERATELCSLWEEYLRDPGWHP  552

Query  533   FRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNF  354
              +V+ I+ +PE +I+E+DE+L  LK  +GEE+C AV  A+ EVN+YN SGRY+I ELWN+
Sbjct  553   IKVVMINGKPENVIDEEDEKLKDLKRNYGEEVCKAVTAALMEVNDYNPSGRYIISELWNY  612

Query  353   KEGRKATLKEVVSFIF  306
                +KATL+E V+ + 
Sbjct  613   AVNKKATLEEGVTVLL  628



>ref|XP_003569416.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=630

 Score =   459 bits (1180),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 269/620 (43%), Positives = 408/620 (66%), Gaps = 12/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllQHATGVGKGSANRS  1938
             I+EY+ K Y  L SG  KV   NG    CPFC+GKKK++Y   +LLQHA+GVG  + NR 
Sbjct  16    IDEYEGKIYASLMSGDLKVN--NGESYSCPFCSGKKKKNYTLHNLLQHASGVG-AAPNRP  72

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRA-----VAPEDNNLYCWPWTGIVVNVSKDNAN  1773
              K+KA H ALAK+L+  L    EP  Q         P     + WPW G+V NV  +  +
Sbjct  73    EKEKATHRALAKHLKNGLAKSPEPQSQLVDVEPQPLPGRYEKFVWPWMGVVANVPTEWKD  132

Query  1772  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             G  + E    LK + S++   +V    + K  T   +I+   DWNG++NA+ F N FEAE
Sbjct  133   GCQIGESGNRLKEQLSRFCPLKVIPLWNFKGHTGNAIIEFGKDWNGFRNALAFGNYFEAE  192

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              + K++W  ++ +  S+++GW AK +D+ + G +G +LR+   LKTI DL  E  R  D+
Sbjct  193   GYGKRDWK-QKQNQGSNLFGWVAKAEDHSSPGPIGDHLRKNGDLKTINDLENEGTRKNDE  251

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             +++NL N+++ KN+ L  L  R+NE   SL++M+ +++ L  A+ EE RKMQ+LA  H Q
Sbjct  252   LVANLANQIEAKNKYLEDLEFRYNETTASLAKMMGQRELLLHAYNEEIRKMQQLAHRHSQ  311

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             +++ E + L SELE K  +L++  ++L+     +  ++  L++EK++N  R++ L++A+ 
Sbjct  312   KIIDENQNLRSELESKMSELNARKKQLDDLAAKSYCDRRILEQEKQKNAIRSNHLKLATV  371

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ++A E+VL+L+ E KR KEAAL  IL+LE+ ++AKQ LE+EIQ+LKGKL+VM+HM G 
Sbjct  372   EQQRAGEDVLKLVGEQKRAKEAALDNILKLEQRLEAKQTLELEIQQLKGKLEVMKHMPGH  431

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             +DS  + KI E+  +L +KI+++  ++ +N  LV+KE +SN E+QEARK L  G    L+
Sbjct  432   EDSESKNKIDELSAELQDKIDELDAMESLNQTLVIKESKSNIEMQEARKELENGFL-YLS  490

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
              G++HIGI+RMGE+D KAF + C+Q+ S EEA+V A  LCS W+ ++++P WHPFR + +
Sbjct  491   GGQAHIGIKRMGELDLKAFSSACRQKSSKEEAEVTAAILCSKWEAEIRNPEWHPFRAVMV  550

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               +  +II+ DD +L +LK E GEE+ A V KA+ E+NEYNA+ RY I ELWNF+E RKA
Sbjct  551   DGKETEIIDADDAKLQELKGEHGEEVYALVTKALHEINEYNATARYPIGELWNFREERKA  610

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             +LKE V F+ +Q + +K+KR
Sbjct  611   SLKEAVQFVMRQWRMNKKKR  630



>emb|CDP00105.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   460 bits (1183),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 267/617 (43%), Positives = 413/617 (67%), Gaps = 13/617 (2%)
 Frame = -1

Query  2099  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQKA  1923
             +K Y+ L+SGK +VK  +G   CP+C  K+K D+ YKD+LQHA+GVG  ++  RS + KA
Sbjct  42    DKSYQALKSGKKEVKVSDGAFTCPYCPKKRKADFLYKDILQHASGVGSSTSKKRSARDKA  101

Query  1922  NHVALAKYLEIDLGDQAEP----LPQRAVAPEDNN-LYCWPWTGIVVNVSKDNANGTAVE  1758
             NH+ALAKYLE D+   A P    +    +A  D + ++ WPW GIVVN++ D  +G  V 
Sbjct  102   NHLALAKYLEKDMSVTAGPSQATVEVDPLADHDRDEMFVWPWIGIVVNLATDFKDGRYVG  161

Query  1757  EEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
             +    L+       +    V+   + +  +   +++   DW G+KNA+ FE A+EA+ H 
Sbjct  162   KSGSNLRDELTSRGFNPTRVRPLWNYQGHSGTALVEFTKDWFGFKNAMSFEKAYEADRHG  221

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             K++W A  ++  S +Y W A+VDDY+++G +G  LR+   ++TI+D+++EE R   K+++
Sbjct  222   KRDWMA-NNTLKSDLYAWVARVDDYKSDGIIGENLRKIGDIRTISDIIEEEVRKTSKLVN  280

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             NLTN +++KN  +  + ++F E   SL  +IEEK+ LH+A+ EE +K+Q  AREH Q++L
Sbjct  281   NLTNVIEVKNMQVKEMESKFQETESSLGILIEEKNKLHQAYNEELKKLQSTAREHFQKIL  340

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              + E + S+LE +KK+L+   ++L +RE   E ++ KL EE + N  +NS ++ AS+EQ+
Sbjct  341   SDHEKMKSQLENQKKELELRGKQLEQREAKNESDRKKLLEELEENAAQNSLIDAASEEQR  400

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             K D  VL+L EE +++KE  L +I++LEKD+D KQ L++EI+ LKG ++VM+HMG + D 
Sbjct  401   KVDAKVLKLAEEQRKQKEELLNRIIQLEKDLDTKQALQLEIERLKGTINVMKHMGDEGDL  460

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
              V +K   + + L EK  +++D D +N  L++KER+SN+ELQ+ARK LI GL +  NS  
Sbjct  461   EVLQKADSLNKLLREKEGELEDFDRLNQTLIVKERKSNEELQDARKELINGLKEYPNS--  518

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFSTE-EADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             ++IGI+RMGE+D K F+   K ++  E +A+ +A ELCSLW E +KDP WHP +VI ++ 
Sbjct  519   AYIGIKRMGELDNKPFYEAMKLKYKHEADAEERASELCSLWDEYLKDPEWHPTKVILVNG  578

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
             + E++I+EDDE+L+ LKE++G E+  AV  A  E+NEYNASGRY+  ELWN+ EGRKATL
Sbjct  579   KHEEVIDEDDEKLNDLKEKYGHEVYKAVTTAFIEINEYNASGRYITSELWNYAEGRKATL  638

Query  329   KEVVSFIFKQLKTHKRK  279
             KE  +F+ K+ K H  K
Sbjct  639   KEGAAFLLKKWKLHMEK  655



>ref|XP_006362466.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Solanum tuberosum]
Length=653

 Score =   459 bits (1180),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 260/616 (42%), Positives = 408/616 (66%), Gaps = 16/616 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I EY EK YE+L+SG + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  31    IEEYGEKSYEDLKSGSHSLKISDVAYTCPYCPKKRKRDFLYKELIQHASGVGSCSSNKRT  90

Query  1937  VKQKANHVALAKYLEIDLG-------DQAEPLPQR-AVAPEDNN-LYCWPWTGIVVNVSK  1785
              ++KANH+ LAKYLE D           AEP  Q   +A  D + ++ WPW GIVVN+  
Sbjct  91    AREKANHLGLAKYLETDAAVAADSSKPDAEPDSQTDPLADHDRDEMFVWPWIGIVVNIPT  150

Query  1784  DNANGTAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
             +  +G  V E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ +E
Sbjct  151   EFKDGRNVGESGSKLRDQLTRRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMAYE  210

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
              A+EA+ H KK+W       +S +Y W A+ DDY+A   +G  LR+   L+TI+D+++EE
Sbjct  211   KAYEADHHGKKDWKVNHCK-NSDLYAWIARADDYKAINIIGENLRKVGDLRTISDIMEEE  269

Query  1433  KRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRL  1254
              R  +K++SNLTN +++K  +L  +  +F E + SL +++EEKD LH+A+ EE RK+Q  
Sbjct  270   ARKTNKLVSNLTNVIEVKKLHLKEMADKFKETSQSLKQLVEEKDKLHQAYNEEIRKIQSS  329

Query  1253  AREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSS  1074
             AR+H Q++ ++ E L  +LE +KK+L+   REL KRE   E ++ KL E+ ++N   N+S
Sbjct  330   ARDHFQKIFNDHEKLKLQLESQKKELELRGRELEKREAKNESDRKKLSEDLEQNATLNTS  389

Query  1073  LEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVM  894
             L  A++EQ+K DE VL+L EE KR+KE   ++I++LEK +DAKQ +E+EI++L+G L+VM
Sbjct  390   LSAAAEEQRKVDEKVLKLAEEQKRQKEDLHKRIIQLEKQLDAKQAVELEIEQLRGSLNVM  449

Query  893   EHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQG  714
             +H+  + D  V +K+  + + L EK E+   L+ +N  L++KER SNDELQ+ARK L+ G
Sbjct  450   KHIEDEGDQEVLKKVDTLLKSLREKEEEYDGLEALNQTLIVKERNSNDELQDARKELVNG  509

Query  713   LSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHP  534
             L +L   G   IG++RMGE+D + FH   K+ ++  EAD +A ELCSLW+E ++DP WHP
Sbjct  510   LKELPRVG--PIGVKRMGELDNRPFHEAMKRSYNESEADERATELCSLWEEYLRDPGWHP  567

Query  533   FRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNF  354
              +V+ ++ +PE +I+++DE+L  LK+ +GEE+C AV  A+ EVN+YN SGRY+I ELWN+
Sbjct  568   IKVVMVNGKPENVIDDEDEKLKDLKKNYGEEVCKAVTAALMEVNDYNPSGRYIISELWNY  627

Query  353   KEGRKATLKEVVSFIF  306
                +KATL+E V+ + 
Sbjct  628   AVNKKATLEEGVTVLL  643



>ref|XP_006362467.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Solanum tuberosum]
Length=638

 Score =   457 bits (1177),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 260/616 (42%), Positives = 408/616 (66%), Gaps = 16/616 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I EY EK YE+L+SG + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  S+N R+
Sbjct  16    IEEYGEKSYEDLKSGSHSLKISDVAYTCPYCPKKRKRDFLYKELIQHASGVGSCSSNKRT  75

Query  1937  VKQKANHVALAKYLEIDLG-------DQAEPLPQR-AVAPEDNN-LYCWPWTGIVVNVSK  1785
              ++KANH+ LAKYLE D           AEP  Q   +A  D + ++ WPW GIVVN+  
Sbjct  76    AREKANHLGLAKYLETDAAVAADSSKPDAEPDSQTDPLADHDRDEMFVWPWIGIVVNIPT  135

Query  1784  DNANGTAVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
             +  +G  V E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ +E
Sbjct  136   EFKDGRNVGESGSKLRDQLTRRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMAYE  195

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
              A+EA+ H KK+W       +S +Y W A+ DDY+A   +G  LR+   L+TI+D+++EE
Sbjct  196   KAYEADHHGKKDWKVNHCK-NSDLYAWIARADDYKAINIIGENLRKVGDLRTISDIMEEE  254

Query  1433  KRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRL  1254
              R  +K++SNLTN +++K  +L  +  +F E + SL +++EEKD LH+A+ EE RK+Q  
Sbjct  255   ARKTNKLVSNLTNVIEVKKLHLKEMADKFKETSQSLKQLVEEKDKLHQAYNEEIRKIQSS  314

Query  1253  AREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSS  1074
             AR+H Q++ ++ E L  +LE +KK+L+   REL KRE   E ++ KL E+ ++N   N+S
Sbjct  315   ARDHFQKIFNDHEKLKLQLESQKKELELRGRELEKREAKNESDRKKLSEDLEQNATLNTS  374

Query  1073  LEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVM  894
             L  A++EQ+K DE VL+L EE KR+KE   ++I++LEK +DAKQ +E+EI++L+G L+VM
Sbjct  375   LSAAAEEQRKVDEKVLKLAEEQKRQKEDLHKRIIQLEKQLDAKQAVELEIEQLRGSLNVM  434

Query  893   EHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQG  714
             +H+  + D  V +K+  + + L EK E+   L+ +N  L++KER SNDELQ+ARK L+ G
Sbjct  435   KHIEDEGDQEVLKKVDTLLKSLREKEEEYDGLEALNQTLIVKERNSNDELQDARKELVNG  494

Query  713   LSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHP  534
             L +L   G   IG++RMGE+D + FH   K+ ++  EAD +A ELCSLW+E ++DP WHP
Sbjct  495   LKELPRVG--PIGVKRMGELDNRPFHEAMKRSYNESEADERATELCSLWEEYLRDPGWHP  552

Query  533   FRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNF  354
              +V+ ++ +PE +I+++DE+L  LK+ +GEE+C AV  A+ EVN+YN SGRY+I ELWN+
Sbjct  553   IKVVMVNGKPENVIDDEDEKLKDLKKNYGEEVCKAVTAALMEVNDYNPSGRYIISELWNY  612

Query  353   KEGRKATLKEVVSFIF  306
                +KATL+E V+ + 
Sbjct  613   AVNKKATLEEGVTVLL  628



>dbj|BAD21477.1| putative X1 [Oryza sativa Japonica Group]
 dbj|BAH01332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   456 bits (1174),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 277/625 (44%), Positives = 411/625 (66%), Gaps = 23/625 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y +K Y +L+SGK  V   N   RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  15    IDDYADKCYMDLKSGKPVVSLGNEKFRCPFCLGKKKQDYRYNELLQHAIGVG--ASNRAP  72

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAP-------EDNNLYCWPWTGIVVNVS--K  1785
             K KANH+ALA  L+ D  D A  LP R A+ P       +D   Y WPW GI+ NV   K
Sbjct  73    KVKANHMALANLLKNDYADAAGSLPSRQAIGPSNPPRPLQDQEAYVWPWMGILANVPAEK  132

Query  1784  DNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  1605
                +G ++ ++   L  F+    Q   + C +   T   V+    DW G+ NA+ F N F
Sbjct  133   TKEDGASLMQQ---LANFNPL--QFTAVLCSEGRYTGYAVVGFSKDWIGFTNALAFHNYF  187

Query  1604  EAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRD  1425
             +++   KK+W A       ++ GW AK +DY++   VG +L     LKT++ L  +  R 
Sbjct  188   KSQRLGKKDWAA--LGQEKYICGWMAKEEDYKSSDPVGRFLSANGDLKTVSGLENDLSRK  245

Query  1424  KDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLARE  1245
              + +++NL++++  K++ L  L  R N+ NLS+ R +EE D LH+++ EE R MQ  ARE
Sbjct  246   TETLIANLSHQITAKSKYLVELECRCNQMNLSVKRAMEETDLLHKSYNEEMRNMQSAARE  305

Query  1244  HVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM  1065
             H Q++  E + L  +L+ K+  ++  +++L+K    T+ E+ KL+ E K+N E+N S+ M
Sbjct  306   HSQKIFEETDQLRKQLDDKENAIERRSKQLSKFVAQTDIERRKLESEMKKNSEQNDSIHM  365

Query  1064  ASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHM  885
             A  EQ+K+D+NVL+L+E+HK+EKE AL KIL+LEK +D KQKLE+EIQ+L+G+L V++HM
Sbjct  366   ARIEQQKSDKNVLKLVEKHKKEKEIALNKILQLEKQLDEKQKLELEIQQLRGRLLVVQHM  425

Query  884   GGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD  705
              G+    V+++  E+ E+L+EKIE+M+ ++ +N  L++KER++NDELQ+A+K LI GLS+
Sbjct  426   EGEG-VDVKKRTDELTEELNEKIEEMEYMEGLNQTLIIKERKTNDELQDAKKALISGLSE  484

Query  704   LLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE--EADVKALELCSLWQEKVKDPNWHPF  531
             LL   RS IG++RMGE+D K F   CK+R+ T   EA++KA E CS WQE +KD NWHPF
Sbjct  485   LLGP-RSTIGLKRMGELDEKPFLAACKKRYGTADGEAEIKAAEFCSEWQENLKDANWHPF  543

Query  530   RVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFK  351
             +++    + EQIINEDDE+L  LKE+ G+E+  AV  A+ E+NEYNASG YV+ ELWN K
Sbjct  544   KIVTRGGKTEQIINEDDEKLVGLKEQLGDEVYKAVTTALLEINEYNASGSYVVSELWNNK  603

Query  350   EGRKATLKEVVSFIFKQLKTHKRKR  276
             E RKA+++E +  + +Q K  +R+R
Sbjct  604   EDRKASMQEALQHVLEQWKLRRRRR  628



>ref|XP_007009299.1| XH/XS domain-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY18109.1| XH/XS domain-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=638

 Score =   455 bits (1170),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 279/629 (44%), Positives = 414/629 (66%), Gaps = 25/629 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16    MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  1782
              K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76    AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  1781  NANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  134   SEDGRSVGESGSKLRDELIRR--GFNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  191

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A++A+ H KKEW A        +Y W A+ DDY++ G +G  LR+T  LKTI+ +++E
Sbjct  192   EKAYQADHHGKKEWCANNDVKFG-LYAWVARADDYKSSGIIGENLRKTSDLKTISGIMEE  250

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +DK++SNLTN ++ KN+++  +  R +E + SL  +++EKD L +A+ EE +K+Q 
Sbjct  251   EARKQDKLVSNLTNIIETKNKHIKEMEARCSETSKSLEVLMDEKDNLLQAYNEEIKKIQL  310

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AREH  R+ ++ E L S+LE  K+ L+    EL KRE L E E+ KL EE ++N  +NS
Sbjct  311   SAREHFLRIFNDHEKLKSQLESHKRDLELRGVELEKREALNESERKKLAEELEQNAVQNS  370

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             +L++AS EQKKADENV++L E+ K  KE    +I++LEK +D KQ LE+EI++L+G L+V
Sbjct  371   ALQLASLEQKKADENVMKLAEDQK--KEELHNRIIQLEKQLDQKQALELEIEQLRGSLNV  428

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             + HMG +DD  V  K++   ++L EK  +++D++ +N  L+++ER+SNDELQEARK LI 
Sbjct  429   IRHMGDEDDIEVLRKMEATLKELREKEGELEDVEALNQTLIVRERKSNDELQEARKELIN  488

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             GL ++  S R+HIG++RMGE+D K F  V K+R++ E+A+ +A ELCSLW E +KDP+WH
Sbjct  489   GLKEI--SSRAHIGVKRMGELDSKPFFEVMKRRYNEEQAEERASELCSLWDEYLKDPDWH  546

Query  536   PFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  363
             PF+ I +    E  ++IN++DE+L  L+ + G E+   V  A++E+NEYN SGRY+I EL
Sbjct  547   PFKRIKLEGEEEYQEVINDEDEKLRDLRNQMGNEVYKVVTSAIKEINEYNPSGRYIISEL  606

Query  362   WNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             WN+ EGRKATL+E V ++ K   T KRKR
Sbjct  607   WNYGEGRKATLQEGVIYLLKLWNTAKRKR  635



>ref|XP_006645454.1| PREDICTED: centrosomal protein of 128 kDa-like [Oryza brachyantha]
Length=570

 Score =   452 bits (1163),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 242/518 (47%), Positives = 363/518 (70%), Gaps = 3/518 (1%)
 Frame = -1

Query  1826  YCWPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKS  1650
             + +PW GI+VNV  +  NG  V E    LK RFS++   +V    +    T   +++   
Sbjct  53    FVFPWMGILVNVPTERKNGRHVGESGNRLKERFSQFSPHKVVPLWNRWGHTGNAIVEFAK  112

Query  1649  DWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETR  1470
             DW G+ NA  FEN FE E + +K W  ++    S ++GW A+ DDY + G +G YLR+  
Sbjct  113   DWTGFANASAFENHFEQEGYGRKAWMGKKHR-GSEMFGWVARADDYHSLGPIGDYLRKNG  171

Query  1469  QLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHR  1290
              LKT+ DL  E  R  DK+++NL +++++KN ++  L ++F+E   SL R++E+++   +
Sbjct  172   DLKTVADLENEGTRKTDKLVANLASQVEVKNRDVEELESKFSETTASLERVMEQREMQLQ  231

Query  1289  AFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkld  1110
             A+ EE RK+Q ++R H Q ++ E +   S+ E K ++LDS ++EL+     +  ++  L+
Sbjct  232   AYNEEIRKIQDISRRHSQMIMEENQKRRSDFESKMQELDSRSKELDALAAQSNSDRRNLE  291

Query  1109  eekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEM  930
              EK++N+ +   L+MA+ EQ++ADE++L+L+EEHKREK+AAL KIL+LE+ ++AKQKLE+
Sbjct  292   LEKEKNNTKAKHLKMATLEQERADESLLKLVEEHKREKQAALDKILKLEQQLNAKQKLEL  351

Query  929   EIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSND  750
             EIQ+L+GKL+VM+HM G++DS  + KI E+ E+L  K +DM +++ +N  LV KERQSND
Sbjct  352   EIQQLQGKLEVMKHMPGEEDSEARRKIDELNEELKSKYDDMNEMESLNQILVTKERQSND  411

Query  749   ELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSL  570
             ELQ ARK LI G  ++   GR++IGI+RMGE+D KAF N CKQRFS  + D  A+ LCS 
Sbjct  412   ELQLARKELIDGFKEI-TVGRTNIGIKRMGELDLKAFANACKQRFSKGDVDETAVMLCSQ  470

Query  569   WQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNA  390
             W++++K+P+WHPFRV+ I  +  +I++EDDE+L +LKEE GE I A V +A++E+NEYN 
Sbjct  471   WEDEIKNPDWHPFRVVMIKGKETEIVSEDDEKLRELKEEHGETIYALVTQALKELNEYNP  530

Query  389   SGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             SGRY +PELWNFKEGR+ATLKEVV ++ KQ +THKRKR
Sbjct  531   SGRYPVPELWNFKEGRRATLKEVVQYVLKQWRTHKRKR  568



>gb|EEE56772.1| hypothetical protein OsJ_06333 [Oryza sativa Japonica Group]
Length=720

 Score =   457 bits (1176),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 277/625 (44%), Positives = 411/625 (66%), Gaps = 23/625 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y +K Y +L+SGK  V   N   RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  107   IDDYADKCYMDLKSGKPVVSLGNEKFRCPFCLGKKKQDYRYNELLQHAIGVG--ASNRAP  164

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-AVAP-------EDNNLYCWPWTGIVVNVS--K  1785
             K KANH+ALA  L+ D  D A  LP R A+ P       +D   Y WPW GI+ NV   K
Sbjct  165   KVKANHMALANLLKNDYADAAGSLPSRQAIGPSNPPRPLQDQEAYVWPWMGILANVPAEK  224

Query  1784  DNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  1605
                +G ++ ++   L  F+    Q   + C +   T   V+    DW G+ NA+ F N F
Sbjct  225   TKEDGASLMQQ---LANFNPL--QFTAVLCSEGRYTGYAVVGFSKDWIGFTNALAFHNYF  279

Query  1604  EAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRD  1425
             +++   KK+W A       ++ GW AK +DY++   VG +L     LKT++ L  +  R 
Sbjct  280   KSQRLGKKDWAA--LGQEKYICGWMAKEEDYKSSDPVGRFLSANGDLKTVSGLENDLSRK  337

Query  1424  KDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLARE  1245
              + +++NL++++  K++ L  L  R N+ NLS+ R +EE D LH+++ EE R MQ  ARE
Sbjct  338   TETLIANLSHQITAKSKYLVELECRCNQMNLSVKRAMEETDLLHKSYNEEMRNMQSAARE  397

Query  1244  HVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM  1065
             H Q++  E + L  +L+ K+  ++  +++L+K    T+ E+ KL+ E K+N E+N S+ M
Sbjct  398   HSQKIFEETDQLRKQLDDKENAIERRSKQLSKFVAQTDIERRKLESEMKKNSEQNDSIHM  457

Query  1064  ASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHM  885
             A  EQ+K+D+NVL+L+E+HK+EKE AL KIL+LEK +D KQKLE+EIQ+L+G+L V++HM
Sbjct  458   ARIEQQKSDKNVLKLVEKHKKEKEIALNKILQLEKQLDEKQKLELEIQQLRGRLLVVQHM  517

Query  884   GGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD  705
              G+    V+++  E+ E+L+EKIE+M+ ++ +N  L++KER++NDELQ+A+K LI GLS+
Sbjct  518   EGEGVD-VKKRTDELTEELNEKIEEMEYMEGLNQTLIIKERKTNDELQDAKKALISGLSE  576

Query  704   LLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE--EADVKALELCSLWQEKVKDPNWHPF  531
             LL   RS IG++RMGE+D K F   CK+R+ T   EA++KA E CS WQE +KD NWHPF
Sbjct  577   LLGP-RSTIGLKRMGELDEKPFLAACKKRYGTADGEAEIKAAEFCSEWQENLKDANWHPF  635

Query  530   RVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFK  351
             +++    + EQIINEDDE+L  LKE+ G+E+  AV  A+ E+NEYNASG YV+ ELWN K
Sbjct  636   KIVTRGGKTEQIINEDDEKLVGLKEQLGDEVYKAVTTALLEINEYNASGSYVVSELWNNK  695

Query  350   EGRKATLKEVVSFIFKQLKTHKRKR  276
             E RKA+++E +  + +Q K  +R+R
Sbjct  696   EDRKASMQEALQHVLEQWKLRRRRR  720



>dbj|BAB21190.1| putative transcription factor [Oryza sativa Japonica Group]
 gb|EEC69862.1| hypothetical protein OsI_00219 [Oryza sativa Indica Group]
 gb|EEE53794.1| hypothetical protein OsJ_00215 [Oryza sativa Japonica Group]
Length=560

 Score =   452 bits (1162),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 253/558 (45%), Positives = 381/558 (68%), Gaps = 4/558 (1%)
 Frame = -1

Query  1943  RSVKQKANHVALAKYLEIDLGDQAE-PLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGT  1767
             RS  + A+      +    + D++E  LP+       +  + +PW GI+VNV  +  NG 
Sbjct  5     RSAAENASRHHHHHHRAHAIADRSERGLPEEHSRGSVDERFVFPWMGILVNVPTEWKNGR  64

Query  1766  AVEEEDYWLKR-FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              V E    LK  F+++   +V    + +  T   +++   DW G++NA+ FE  FE + +
Sbjct  65    QVGESGNRLKEGFARFCPHKVIPLWNHRGHTGNAIVEFAKDWTGFENALAFEVHFEQQGY  124

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
              ++ W   +    S ++GW A+ DD+ + G +G YLR+   LKT+ DL  E  R  DK++
Sbjct  125   GRRAWMGNKYR-GSQMFGWVARADDHNSPGPIGVYLRKNGDLKTVADLENEGTRKTDKLV  183

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             +NL +++++K  ++  L +++NE   SL R++E+++   +A+ EE RKMQ LA  H QR+
Sbjct  184   ANLASQVEVKKRHVEELESQYNETTASLERVMEQREQQLQAYNEEIRKMQDLALRHSQRI  243

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             + E + L S+LE K + LDS ++EL+K  V +  +++ L++EK++ND +   L+MA+ EQ
Sbjct  244   MDENKKLRSDLESKMQLLDSRSKELDKLAVQSNSDRMNLEKEKEKNDIKTKHLKMATLEQ  303

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             +KADE+VL+L+EEHKREK+AAL KIL+LE+ ++AKQKLE+EIQ+L+GKL+VM+HM G +D
Sbjct  304   QKADESVLKLVEEHKREKQAALDKILKLEQQLNAKQKLELEIQQLQGKLEVMKHMPGKED  363

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             S  + KI E+ E+L +K  +M+ ++ +N ALV+KERQSNDELQ ARK+LI+G  D++  G
Sbjct  364   SEAKSKIHELSEELKDKYAEMESIESLNQALVIKERQSNDELQHARKVLIEGFQDII-VG  422

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             R++IGI+RMG ID KAF N  KQR   E+ADV A ELCSLW+ ++K+ +WHPFRV+ +  
Sbjct  423   RTNIGIKRMGVIDFKAFTNAYKQRSLEEDADVSAAELCSLWENEIKNSDWHPFRVVMVDG  482

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATL  330
             +  +I++EDD +L +LKEE GEEICA V KA+ E+NEYN SGRY +PELWNFKE RKATL
Sbjct  483   KEMEILSEDDGKLCELKEEHGEEICAMVTKALLELNEYNPSGRYPVPELWNFKENRKATL  542

Query  329   KEVVSFIFKQLKTHKRKR  276
             KEVV ++  Q K +KRKR
Sbjct  543   KEVVQYVLNQWKKNKRKR  560



>ref|XP_002316281.2| XH/XS domain-containing family protein [Populus trichocarpa]
 gb|EEF02452.2| XH/XS domain-containing family protein [Populus trichocarpa]
Length=749

 Score =   457 bits (1177),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 270/619 (44%), Positives = 406/619 (66%), Gaps = 14/619 (2%)
 Frame = -1

Query  2099  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKG-SANRSVKQK  1926
             +K YEEL++G ++VK  +    CP+C  KK++       L QHATGVGK  S  R+ K+K
Sbjct  132   DKSYEELKNGNHQVKISDETFTCPYCPTKKRKRDYAYQDLLQHATGVGKSLSEKRTAKEK  191

Query  1925  ANHVALAKYLEIDL---GDQAEPL--PQRAVAPEDNNLYCWPWTGIVVNVSKDNA-NGTA  1764
             A+H+AL KYLE DL   G  ++P    +   +   N+ + WPWTGI VN+    A +G  
Sbjct  192   ADHLALVKYLEKDLAAAGSSSKPAGKTENLSSCSQNDKFVWPWTGIAVNLPTRRAEDGRF  251

Query  1763  VEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             V E     +   +   +    V    + +  +   V++   DW G  NAI FE A+EA+ 
Sbjct  252   VGESGSKFRDELKSRGFNPTRVHPLWNFRGHSGTAVVEFNKDWPGLHNAISFEKAYEADQ  311

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
               KKEW A  S   S +Y W A+ DDY +   +G +LR+   ++TI+DL++EE R +DK+
Sbjct  312   QGKKEWFAS-SGEKSGIYCWVARADDYNSNNIIGEHLRKIGDVRTISDLIEEEARKQDKL  370

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             + NLTN ++ KN  L  +  R +E + SL+++++EK+ L  A+ EE RK+Q  AR+H Q+
Sbjct  371   VFNLTNVIETKNRYLKEMELRCSETSASLNKLVQEKEKLLHAYNEEIRKIQTGARDHFQK  430

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L++ E +  +LE  KK+L+    EL KRE   E ++  L EE ++N  RNSSLE+A+ E
Sbjct  431   ILNDHEKIKLQLESHKKELEMRGSELEKREAKNESDRRSLSEEIEKNAVRNSSLELAALE  490

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KADE+VL+L E+ KR+KE    +I+ LEK +DAKQ LE+EI+ L+G L+VM+HM  D 
Sbjct  491   QQKADEDVLKLAEDQKRQKEELHNRIIRLEKQLDAKQALELEIERLRGALNVMKHMEDDG  550

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D  V  K+  + + L EK  ++ DL+ +N  L+++ER+SNDELQ+ARK LI GL ++  S
Sbjct  551   DVEVLRKMDAIIKNLREKEGELNDLEALNQTLIVRERKSNDELQDARKELINGLKEI--S  608

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
              R+HIG++RMGE+D K F    K++++ EEA+ +A E+CSLW+E +KDP+WHPF+V+ + 
Sbjct  609   NRAHIGVKRMGELDSKPFLEAMKRKYNNEEAEDRASEICSLWEEYLKDPDWHPFKVVMVD  668

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + ++II+E+DE+LS+L++E G+E C +V  ++ +VNEYN SGRY+I ELWN+KEG+KAT
Sbjct  669   GKHQEIIDEEDEKLSRLRDEMGDEACMSVTTSLIQVNEYNPSGRYIISELWNYKEGKKAT  728

Query  332   LKEVVSFIFKQLKTHKRKR  276
             L E VSF+  + K  KRKR
Sbjct  729   LGEGVSFLLSRWKALKRKR  747


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 4/88 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             ++EY+ + YEEL+ GK +VK  +    CPFC  KK+Q Y YKDLLQHA+GVGK  S  RS
Sbjct  18    MDEYENEAYEELKDGKLRVKISDETFACPFCPQKKRQAYLYKDLLQHASGVGKSRSQKRS  77

Query  1937  VKQKANHVALAKYLEIDL---GDQAEPL  1863
              K+KANH+AL KYLE DL   G  ++P+
Sbjct  78    TKEKANHLALVKYLEKDLTAAGRTSKPV  105



>ref|XP_010108755.1| hypothetical protein L484_011413 [Morus notabilis]
 gb|EXC20169.1| hypothetical protein L484_011413 [Morus notabilis]
Length=681

 Score =   455 bits (1171),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 274/642 (43%), Positives = 418/642 (65%), Gaps = 37/642 (6%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++E  E+ Y+EL+SGK+ VK  +G   CP+C  KKKQ+Y Y+DLLQHA+GVG   ++ RS
Sbjct  41    MDESVEEAYKELKSGKHHVKLWDGTFTCPYCQKKKKQNYLYRDLLQHASGVGNSPSDKRS  100

Query  1937  VKQKANHVALAKYLEIDLGDQAEP------------------------LPQRAVAPEDNN  1830
              KQK  H+ALAK+LE DL     P                             V+ ++++
Sbjct  101   AKQKITHLALAKFLEKDLAGGVGPSEPAGEEKAPAPAPASAPAAAPAPAAAPVVSCDNDD  160

Query  1829  LYCWPWTGIVVNV----SKDN--ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQV  1668
              + WPW GI VN+    ++D   A G+  +  D  + R   +    V+   + +  +   
Sbjct  161   KFVWPWIGIAVNLPITQTEDGRFAGGSGSKFRDELISR--GFNPTRVRPLWNYRGHSGTA  218

Query  1667  VIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGY  1488
             V++    W G  NA+ FE A+EA+ H KK+W A +S   S +Y W A+ DDY +   VG 
Sbjct  219   VVEFNKGWPGLHNALSFERAYEADRHGKKDWYA-KSDEKSGIYAWVARADDYNSATIVGE  277

Query  1487  YLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEE  1308
             +LR+   LK+I+++++EE R +D+++SNLT+ +++KN++L  +  +F E + S+  ++ E
Sbjct  278   HLRKIGDLKSISEIMEEEARKQDRLVSNLTSIIEVKNKHLEEMEVKFKETSNSIDALMAE  337

Query  1307  KDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTer  1128
             KD LH+ + EE RK+Q  +R+H+QR+L++ E L S+LE +KK+L+    EL KRE + + 
Sbjct  338   KDRLHQTYNEEIRKIQSSSRDHLQRILNDHEKLKSQLESQKKELELRGSELEKREAVNDS  397

Query  1127  eklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDA  948
             E+ KL EE ++N  RNSSLEMA+  Q+KADE V++L E+ KR+KE    +I++LEK +DA
Sbjct  398   ERKKLAEELEKNAIRNSSLEMAALAQEKADEKVMKLAEDQKRQKEELHNRIIQLEKKLDA  457

Query  947   KQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLK  768
             KQ LE+EI+ L+G L+VM+HMG DDD  V +K++ ++++L EK  +  DL+ +N  L++K
Sbjct  458   KQALELEIERLRGSLNVMKHMG-DDDLEVIQKVEAIQKELREKEGEYDDLEALNQTLIIK  516

Query  767   ERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKA  588
             ER+ NDELQEARK LI GL +   S R+  G++RMGE+D + F    K+++S EEA+ +A
Sbjct  517   ERKCNDELQEARKELISGLKE--TSSRATTGVKRMGELDTQPFLESMKRKYSEEEAEDRA  574

Query  587   LELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEE  408
             +ELCSLW E +KDP+WHPF+V  +  + ++II++ DE+L  LK+E G ++  AV +A+ E
Sbjct  575   MELCSLWDEYLKDPDWHPFKVTMVDGKHKEIIDDKDEKLKALKKEMGADVYNAVTRALIE  634

Query  407   VNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKR  282
             +NEYN SGRY+ PELWN +EGR+ATLKE V  I  Q +T KR
Sbjct  635   INEYNPSGRYITPELWNCQEGRRATLKEGVEVILNQWRTKKR  676



>gb|KHG06632.1| KilA-N domain-containing protein [Gossypium arboreum]
Length=640

 Score =   451 bits (1161),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 279/629 (44%), Positives = 414/629 (66%), Gaps = 23/629 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVG-KGSANRS  1938
             + EY++K YE+L++GKY V   +    CP+C    KQ Y+YKDLLQHA+GVG   SA R 
Sbjct  16    MEEYEDKSYEKLKNGKYTVMVSDETYTCPYCPKSNKQKYRYKDLLQHASGVGNSSSAKRK  75

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SKD  1782
              + KANH+ALA+YLE D+         + V  ED    C       WP TGIVVN+ +K 
Sbjct  76    PRVKANHLALARYLETDVVPVVSS--SKPVVEEDPPSGCDHDEKIVWPCTGIVVNIPTKR  133

Query  1781  NANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             +A+G +V E      D  ++R   +    V    + +  +   V++ +  W G  NA+ F
Sbjct  134   SADGRSVGESGSKLRDELIRR--GFNPVRVHPLWNFRGHSGTAVVEFRKGWPGLHNALSF  191

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A+EA+ H KK+W A        +Y W A+ DDY A G +G +LR+   LKTI++L++E
Sbjct  192   EKAYEADHHGKKDWGA-NDDVKHGLYAWVARADDYTASGIIGDHLRKIGDLKTISELMEE  250

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +D+++SNLTN ++ K +++  L    +E + SL  ++EEK+ L +A+ EE +K+Q 
Sbjct  251   EARKQDRLVSNLTNIIETKTKHIKELEAICSETSKSLEVLMEEKENLLQAYNEEIKKIQL  310

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AREH Q++  + E L S+LE  KK+L+    EL KRE L E E+ KL EE ++N  +NS
Sbjct  311   SAREHFQKISSDHEKLKSQLETHKKELELRGVELEKREALNETERKKLAEELEQNAVQNS  370

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL+MA+ EQK+ADENV++L E+ KR+KE    +I++LEK +D KQ LE+EI++L+G L+V
Sbjct  371   SLQMAALEQKRADENVMKLAEDQKRQKEELHNRIIQLEKQLDQKQALELEIEQLRGSLNV  430

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             + HMG +DD  V +KI+   + L EK  +++DL+ +N  L++ ER+SNDELQ+ARK LI 
Sbjct  431   IRHMGEEDDKEVLQKIEASLKDLREKEGELEDLEALNQTLIVSERKSNDELQDARKELIN  490

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             GL ++  S R++IG++RMGE+DGK F    K+R++ E A+ +A E+CSLW+E +KDP+WH
Sbjct  491   GLKEI--SRRANIGVKRMGELDGKPFLEAMKRRYNEELAEERASEMCSLWEEYLKDPDWH  548

Query  536   PFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  363
             PF+ I +  R E  ++I+++DE+L  LK E G E   +V  A++E+NEYN SGRYVI EL
Sbjct  549   PFKRIKLEGREEYQEVIDDEDEKLRDLKAEMGNEAYKSVTSAIKEINEYNPSGRYVISEL  608

Query  362   WNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             WN++EGRKA+LKE V F+ +  +T KR+R
Sbjct  609   WNYREGRKASLKEGVEFLLELWETVKRRR  637



>gb|KHG15173.1| Forkhead-associated domain-containing 1 [Gossypium arboreum]
Length=645

 Score =   451 bits (1161),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 274/636 (43%), Positives = 413/636 (65%), Gaps = 32/636 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             + EY++K YE+L++G YK+K  N    CPFC  KKKQD+ YKDLLQHA+GVGK +++ RS
Sbjct  16    MEEYEDKYYEKLKNGNYKIKVSNEKYTCPFCPKKKKQDFLYKDLLQHASGVGKSNSDKRS  75

Query  1937  VKQKANHVALAKYLEIDLGDQA--------------EPLPQRAVAPEDNNLYCWPWTGIV  1800
              ++KANH+AL KYLE DL                  +PL       + +    WPWTG+V
Sbjct  76    AREKANHLALFKYLENDLRGTVGSSSSSAAAAAEVEDPLS----GCDHDEKIVWPWTGVV  131

Query  1799  VNVSKD------NANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNG  1638
             VN+         +  G+  +  D  ++R   +    V    + +  +   V++ + DW G
Sbjct  132   VNIPTQKLEDGRSVGGSGSKLRDELIRR--GFNPLRVHPLWNYRGHSGTAVVEFRKDWPG  189

Query  1637  YKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKT  1458
               NA+ FE A+EA+ H KK+W A        +Y W A+ DDY++   +G +LR+   LKT
Sbjct  190   LHNALSFEKAYEADHHGKKDWFANNGVKEG-LYAWVARADDYKSSTIIGEHLRKIGDLKT  248

Query  1457  ITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYE  1278
             +++L++EE R +D++++NLTN ++ KN+++  +  R +E + SL  ++EEKD L +A+ E
Sbjct  249   VSELMEEEARKQDRLVTNLTNIIETKNKHIQEMEQRCSETSKSLEALMEEKDNLSQAYNE  308

Query  1277  ESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekk  1098
             E +K+Q  AR+H QR+  + E L S+LE  KK L+    EL KRE L E E+ KL EE +
Sbjct  309   EIKKIQVSARDHFQRIFSDHEKLKSQLESHKKDLELRGVELEKREALNESERKKLAEELE  368

Query  1097  rndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQE  918
              N  +NS+L +A+ EQK+ADENV++L E+ KR+KE    +I++LEK +D KQ LE+EI++
Sbjct  369   ENAVQNSALHLAALEQKRADENVMKLAEDQKRQKEELHNRIIQLEKKLDQKQALELEIEQ  428

Query  917   LKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQE  738
             L+G L+V+ HMG +DD  V EK+    ++L EK  +++DL+ +N  L+++ER+SNDELQ+
Sbjct  429   LRGSLNVIRHMGDEDDMEVLEKVDASLKELREKEAELEDLEALNQTLIVRERKSNDELQD  488

Query  737   ARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEK  558
             ARK LI GL ++  S RS IG++RMGE+D K F    K+R++ E A+ +A E+CSLW+E 
Sbjct  489   ARKELINGLKEI--STRSQIGVKRMGELDSKPFLEAMKRRYNEELAEERASEVCSLWEEY  546

Query  557   VKDPNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  384
             +KDP+WHPF+ I +    E  ++I+++DE+L  LK++ G E   +V  A++E+NEYN SG
Sbjct  547   LKDPDWHPFKRIKLEGGEEYQEVIDDEDEKLRDLKDQMGIEAYKSVTSAIKEINEYNPSG  606

Query  383   RYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             RY+I ELWN+ EGRKATLKE V+F+ K     KRKR
Sbjct  607   RYIISELWNYGEGRKATLKEGVTFLLKLWDNAKRKR  642



>ref|XP_011027214.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Populus euphratica]
Length=749

 Score =   454 bits (1169),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 268/624 (43%), Positives = 410/624 (66%), Gaps = 14/624 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKG-SANR  1941
             ++ Y+++ YEEL++G ++VK  +    CP+C  KK++       L QHATGVGK  S  R
Sbjct  127   MDNYEDRSYEELKNGNHQVKISDETFACPYCPTKKRKRDYVYQDLLQHATGVGKSLSEKR  186

Query  1940  SVKQKANHVALAKYLEIDL---GDQAEPL--PQRAVAPEDNNLYCWPWTGIVVNVSKDNA  1776
             + K+KA+H+AL KYLE DL   G  ++P    +   +   N+ + WPWTGI VN+    A
Sbjct  187   TAKEKADHLALVKYLEKDLAAAGSSSKPAGKTENPSSCSQNDKFVWPWTGIAVNLPTRRA  246

Query  1775  -NGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENA  1608
              +G  V E     +   +   ++   V    + +  +   +++   DW G  NAI FE A
Sbjct  247   EDGRFVGESGSKFRDELKSRGFKPTRVHPLWNFRGHSGTAIVEFNKDWPGLHNAISFEKA  306

Query  1607  FEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKR  1428
             +EA+   KKEW A  S   S +Y W A+ DDY +   +G +LR+   ++TI+DL++EE R
Sbjct  307   YEADQQGKKEWFAS-SGEKSGIYCWVARADDYNSNNIIGEHLRKIGDVRTISDLIEEEAR  365

Query  1427  DKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAR  1248
              +DK++ NLTN ++ KN  L  +  R +E + SL+++++EK+ L  A+ EE RK+Q  AR
Sbjct  366   KQDKLVFNLTNVIETKNRYLKEMELRCSETSASLNKLVQEKEKLLHAYNEEIRKIQTGAR  425

Query  1247  EHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLE  1068
             +H Q++L++ E +  +LE  KK+L+    EL KRE   E ++  L EE ++N  RNSSLE
Sbjct  426   DHFQKILNDHEKIKLQLESHKKELEMRGSELEKREAKNESDRRILSEEIEKNAVRNSSLE  485

Query  1067  MASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEH  888
             +A+ EQ+KADE+VL+L E+ KR+KE    +I+ LEK +DAKQ LE+EI+ L+G L+VM+H
Sbjct  486   LAAVEQQKADEDVLKLAEDQKRQKEELHNRIIRLEKQLDAKQALELEIERLRGALNVMKH  545

Query  887   MGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLS  708
             M  D D  V  K+  + + L EK  ++ DL+ +N  L+++ER+SNDELQ+ARK LI GL 
Sbjct  546   MEDDGDVEVLRKMDAIIKNLREKEGELNDLEALNQTLIVRERKSNDELQDARKELINGLK  605

Query  707   DLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFR  528
             ++ N  R+HIG++RMGE+D K F    K++++ EEA+ +A E+CSLW+E +KDP+WHPF+
Sbjct  606   EISN--RAHIGVKRMGELDSKPFLEAMKRKYNNEEAEDRASEICSLWEEYLKDPDWHPFK  663

Query  527   VINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKE  348
             V+ +  + ++II+E+DE+LS+L++E G+E   +V  ++ +VNEYN SGRY+I ELWN+KE
Sbjct  664   VVMVDGKHQEIIDEEDEKLSRLRDEMGDEAYMSVRTSLIQVNEYNPSGRYIISELWNYKE  723

Query  347   GRKATLKEVVSFIFKQLKTHKRKR  276
             G+KATL E VSF+  + K  KRKR
Sbjct  724   GKKATLGEGVSFLLSRWKALKRKR  747


 Score = 70.5 bits (171),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             ++EY+ + YEEL+ GK +VK  +    CPFC  KK+Q   YKDLLQHA+GVGK  S  RS
Sbjct  18    MDEYENEAYEELKDGKLRVKISDETFACPFCPQKKRQACLYKDLLQHASGVGKSRSEKRS  77

Query  1937  VKQKANHVALAKYLEIDL---GDQAEPL  1863
              K+KANH+AL KYLE DL   G  ++P+
Sbjct  78    TKEKANHLALVKYLEKDLTAAGRTSKPV  105



>gb|EMS54623.1| hypothetical protein TRIUR3_33647 [Triticum urartu]
Length=693

 Score =   451 bits (1161),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 275/622 (44%), Positives = 410/622 (66%), Gaps = 21/622 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y EK Y +L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  84    IDDYAEKAYTDLKSGKLVARFGADRFRCPFCPGKKKQDYRYNELLQHAIGVG--ASNRAA  141

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVSKDN  1779
             K KANH ALA +L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV  + 
Sbjct  142   KVKANHQALASHLKTDHADAAGSLPPRQAEALINPPKPVQDQELFVWPWMGILANVPVEQ  201

Query  1778  AN-GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
                G A+  +     +  ++ A    + C D   T   +++   DW G+K+A+ F N ++
Sbjct  202   TQRGGAIVMQQLAGYKPIRFNA----VHCPDGGYTGFAIVRFNKDWIGFKDALGFHNTYK  257

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             +    K +W A +S    +++ W AK +DY+A+  VG +L E   LKT+ +L QE  R  
Sbjct  258   SHHLGKTDWEANKSD--KYMFAWLAKEEDYKADDPVGKFLSENGDLKTVAELQQEMSRKT  315

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             D ++++LT+++  K++ L  L  + N+ +L+L R +E+ D+L + + EE RKMQ  AREH
Sbjct  316   DTLITSLTSQISAKSKYLMELECKCNQMDLALQRAMEDNDSLDQRYNEEMRKMQSTAREH  375

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
               ++ HE + L  +L++K+  +   +++L++    T+ E+ KL+ E+K+ND +N SL MA
Sbjct  376   SLKIFHETDQLRKQLDEKENDIRRRSKQLSEIVAQTDMERRKLENERKKNDGQNDSLNMA  435

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
               EQ+KA+E V  L+E+HK+EKEAAL KIL LEK +D K +LE++IQ+L+GKL+V++HM 
Sbjct  436   RIEQEKANEGVRLLVEKHKKEKEAALNKILLLEKQLDEKHQLELDIQQLRGKLEVVKHME  495

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
             G+    V+++ +E+ + L ++I+ M+DL+E+N AL++KER +NDELQ+A+K LI GL DL
Sbjct  496   GEG-VDVKKRTEELNKDLQDRIDAMEDLEELNQALIIKERMTNDELQDAKKELISGLVDL  554

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
             L   RS+IGIRRMG++D K F   CK ++  E AD KALE CS+WQ+ ++D NWHPF+++
Sbjct  555   LGP-RSNIGIRRMGQVDEKPFIEACKPKYGAE-ADTKALEFCSMWQDNLRDANWHPFKIV  612

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
                ++ EQII+E DE+L  LKEE GEE+  AV  A+ E+NEYNASG YV+ ELWN K+ R
Sbjct  613   TTGEKSEQIIDEGDEKLVGLKEELGEEVYKAVTTALVEMNEYNASGSYVVSELWNNKDNR  672

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             KA++ EVV  I KQ K  KRKR
Sbjct  673   KASMGEVVEHILKQWKA-KRKR  693



>ref|NP_001146275.1| putative transcription factor [Zea mays]
 gb|AAM22636.1|AF434193_1 X1 [Zea mays]
 gb|ACL53618.1| unknown [Zea mays]
 gb|ACN27531.1| unknown [Zea mays]
 tpg|DAA58437.1| TPA: putative XH domain family protein isoform 1 [Zea mays]
 tpg|DAA58438.1| TPA: putative XH domain family protein isoform 2 [Zea mays]
 tpg|DAA58439.1| TPA: putative XH domain family protein isoform 3 [Zea mays]
Length=628

 Score =   449 bits (1156),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 273/620 (44%), Positives = 401/620 (65%), Gaps = 14/620 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+ K Y  L SG  K+        CPFC+  KK++Y    L+QHA+GV   + NR  
Sbjct  16    IDDYEGKIYARLMSGDLKLNKNGENYICPFCS-SKKKNYSKSSLVQHASGVS-AAPNREA  73

Query  1934  KQKANHVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNAN  1773
             K+KA H AL KYL+  L      G  A P+  + +   D   + WPW G++VNV  +  +
Sbjct  74    KEKAVHRALFKYLKNGLAKSPEPGSHATPVEPQPLQNRDEK-FVWPWMGVLVNVPTEWKD  132

Query  1772  GTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
             G  + E    LK + S +    V      +  T   +++   DWNG++NA  FE+ F A 
Sbjct  133   GRQIGESGNRLKEQLSHFCPLRVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAAG  192

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
                KK+W  +++   S +YGW A+ +DY + G +  +LR+   LK++ DL +E  R  D+
Sbjct  193   GFGKKDWIGKKNQ-GSELYGWLARAEDYNSPGIIADHLRKNGDLKSVNDLAKEGARKNDR  251

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             +++NL N++++KN  L  L  +++E   SL +M+ +++ L +++ EE  KMQ+LAR H Q
Sbjct  252   LVANLANQIEVKNRYLQELECKYSETTASLEKMMGQREQLLQSYNEEISKMQQLARRHSQ  311

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             +++ E + L S+LE K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ 
Sbjct  312   KIIDENQKLRSDLEAKMNDLDVRSKQLDEIAAKSDYDRRSLEQEKQKNAIKSSHLKLATL  371

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KADENVL+L+EE KREK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD
Sbjct  372   EQQKADENVLKLVEEQKREKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGD  431

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
             +DSA + KI E+ E L EKI+++  ++ +N  LV+KE +SN ELQEARK L  GL D L+
Sbjct  432   EDSASKNKINELSEALQEKIDELDGMESLNQTLVIKESKSNIELQEARKELENGLLD-LS  490

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
              G++HIGI+RMGE+D KAF   C Q+  TE A+V A  LCS W+ ++K+P+WHPFRV+ I
Sbjct  491   GGQTHIGIKRMGELDLKAFSKAC-QKERTENAEVTAAFLCSKWEAEIKNPDWHPFRVVTI  549

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
              D  E  I EDD +L  LKEE GEEI A V KA+ E NEY + G Y + ELWNFKE RK 
Sbjct  550   -DGKEMAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPVGELWNFKENRKV  608

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TLKE V F+ +Q +T++RKR
Sbjct  609   TLKEAVQFVLRQWRTNRRKR  628



>ref|XP_010690719.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690724.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   448 bits (1153),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 260/623 (42%), Positives = 411/623 (66%), Gaps = 16/623 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             I+EY +K +EEL+ G  ++K       CP+C GK+K+DY+YK+LLQHA+G+G   S  R 
Sbjct  16    IDEYGDKTFEELKKGSSELKVAEEKYTCPYCPGKRKRDYQYKELLQHASGIGNANSKKRR  75

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQ--RAVAP----EDNNLYCWPWTGIVVNVSKDNA  1776
              ++KANH+ LAK+LE ++ +QA    Q     AP    + ++ + WPWTGIVVN+   + 
Sbjct  76    AREKANHLGLAKFLEEEVQNQASSSKQVNNGDAPIAGGDHDDKFVWPWTGIVVNIPTLHK  135

Query  1775  NGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF  1605
             +G  V E    L+   R   +  + V    + +  +   V++   DW G+ NA+ FE  +
Sbjct  136   DGRYVGESGSKLRDELRARGFNPKRVHPLWNFRGHSGTAVVEFNKDWMGWNNALAFEKEY  195

Query  1604  EAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRD  1425
             E   H K+ W A + +  S +Y W A+ DDY + G +G +LR+   +KT++++  EE R 
Sbjct  196   ELNQHGKQHWQA-KDTEKSGLYAWVARADDYNSPGIIGEHLRKIGDVKTVSEMQAEEARK  254

Query  1424  KDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLARE  1245
             +DK++SNLTN L+ K ++L  + +RFNE ++S +++ EEKD LH+A+ EE +K+Q  AR+
Sbjct  255   RDKLVSNLTNVLEYKKKSLLEIESRFNETSISFNKLAEEKDKLHQAYNEEIKKIQLSARD  314

Query  1244  HVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM  1065
             H Q++ ++   L  +LE +K +L+    EL KRE   E E+ KL E+ ++N  +N+SL+ 
Sbjct  315   HFQKIFNDHAKLKQQLESEKTELEVRVHELEKREARNENERKKLQEDVEKNAVKNNSLQH  374

Query  1064  ASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHM  885
             A+  Q+KADENV++L EE K++KE   ++IL+L+  ++AKQ LE+EI++LKGKL VMEH+
Sbjct  375   AAIVQQKADENVMKLAEEQKKQKEDLHKRILQLQNQLEAKQALELEIEQLKGKLKVMEHV  434

Query  884   GGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD  705
                D   +Q+ ++ +++ L EK E ++ ++ +N  L++ ER SN+ELQEARK LI GL D
Sbjct  435   A--DKEEIQQ-VEAIQKDLREKEESLEGVESLNQTLIVTERMSNEELQEARKELINGLKD  491

Query  704   LLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV  525
             +  S R ++G++RMGE+D   F   CK+++  + A+ KA E+CSLW E ++DP WHPF+V
Sbjct  492   M--SNRGYLGVKRMGELDSSVFQEACKRKYPEDIAEDKAAEICSLWDEYLRDPTWHPFKV  549

Query  524   INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
             + +H   +++I+  DE+L  LK+EWG+++  AV  A++E+NEYN SGRY+I ELWN +E 
Sbjct  550   VPVHGEHKEVIDVADEKLRDLKKEWGDDVYDAVTTALKEINEYNPSGRYIITELWNNRES  609

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             RKATL+E VS+I  + K +K KR
Sbjct  610   RKATLQEGVSYILNKWKDYKGKR  632



>ref|XP_010265647.1| PREDICTED: factor of DNA methylation 1-like isoform X3 [Nelumbo 
nucifera]
Length=556

 Score =   445 bits (1145),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 246/473 (52%), Positives = 344/473 (73%), Gaps = 10/473 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16    INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  1779
             KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76    KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               G A    ++  K  SKY    V+     +  T   ++    +W G+++A+ FE  FE 
Sbjct  134   EEGRASGSANWLAKELSKYRPLSVQTSWSQQDHTMFAIVDFGKEWTGFRDAMEFEKDFET  193

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             + H KKEW+ +R    S++YGWFA+VDDY +EG +G YLR   +LKTI+ ++QE+ + ++
Sbjct  194   DHHGKKEWSEQRMHHGSNIYGWFARVDDYNSEGPIGDYLRNQGELKTISSIVQEKTQQEN  253

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              ++++LTN LD+ NEN+  L ++ NEK++SLSR++EEK+ LH+ + EE RK+ R+AR H 
Sbjct  254   SMVASLTNVLDVTNENIDELQSKCNEKSMSLSRLVEEKERLHQEYNEERRKLYRIARNHT  313

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             +R++ E + L   L+ ++K L+   +EL K E L ERE+  LDEE ++N  +N+ L+MAS
Sbjct  314   RRIIEESDKLRDSLDYRRKNLEQRQKELAKLEALNERERKGLDEEMQKNAVKNNLLQMAS  373

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQKKADENVLRL+EE KREKEAA+ K+L+LEK +DAKQKLE+EI ELKGKL VM+HM G
Sbjct  374   MEQKKADENVLRLMEEQKREKEAAMNKLLQLEKQLDAKQKLELEIAELKGKLQVMKHMEG  433

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             +DD  +Q+K+KEM ++L+EK+E+M +++++N  L+ KER SNDELQEAR+ LI
Sbjct  434   EDDIGIQKKLKEMADELEEKMEEMVNMEDLNQTLIAKERASNDELQEARQELI  486



>ref|XP_003566895.1| PREDICTED: factor of DNA methylation 1 [Brachypodium distachyon]
Length=599

 Score =   446 bits (1147),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 251/575 (44%), Positives = 396/575 (69%), Gaps = 13/575 (2%)
 Frame = -1

Query  1976  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQRA---VAPED----NNLYCW  1818
             HA+GVG  + N   + KA   +LAK+ + +L + +EP  QR    + P+     ++ + W
Sbjct  30    HASGVG-SADNCQGRDKA--PSLAKHAKNELYESSEPQSQRMSMDMEPQPVHNRDDHFVW  86

Query  1817  PWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWN  1641
             PW G++VNV  +  NG  V E    LK + S++  Q+V    + +  T   +++   DW 
Sbjct  87    PWMGVLVNVPTEWKNGRHVGESRNRLKEQLSRFCPQKVIPLWNYRGHTGNAIVEFGKDWT  146

Query  1640  GYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLK  1461
             G+ NA+ FEN FEAE + K     ++    S ++GW A+ DD ++ G +G YL++   LK
Sbjct  147   GFNNALAFENHFEAEGYGKLVRKTQKHR-GSEMFGWVARADDQKSPGTIGDYLQKNGDLK  205

Query  1460  TITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFY  1281
             TI D+  E  R  D++++NL +E+++K +++  L  ++NEK  SL  ++E+K+ L +A+ 
Sbjct  206   TIADVENEGTRKTDRLVANLASEIEVKRKHVEELECKYNEKTTSLDMIMEQKEQLLQAYN  265

Query  1280  EESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeek  1101
             EE  KMQ+LAR H QR++ E + L SELE K + L   +++L++    +  ++  L++EK
Sbjct  266   EEIHKMQQLARTHSQRIIDENQKLRSELESKMQDLSLRSKQLDELAARSNSDRQNLEQEK  325

Query  1100  krndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQ  921
             ++N  +   L+MA+ EQ++ADENVL+L+ +HKREK+ AL KI++LE+ ++AKQKLE+EI+
Sbjct  326   EKNGIKTKHLKMATMEQQRADENVLKLVGKHKREKQYALDKIIKLEQQLNAKQKLELEIK  385

Query  920   ELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQ  741
             +L+GKL+VM+HM G++DS  ++KI E+ E+L +K ++M  ++ ++  L++KER+SNDELQ
Sbjct  386   QLQGKLEVMKHMPGEEDSESKKKINELSEELQDKYDEMDAMESLHQTLLIKERKSNDELQ  445

Query  740   EARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  561
             +ARK LI GL D++ +GR++IGI+RMGE+D K+F   CK + S ++A+V A  LCS W+ 
Sbjct  446   DARKKLIDGLLDII-TGRANIGIKRMGELDLKSFTVACKHKLSKQDAEVTAAILCSKWEA  504

Query  560   KVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGR  381
             ++K+P WHPFRV+ +  + ++I+ EDDE+L +LKEE+GEE+ A V  A+ EVNEYN SGR
Sbjct  505   EIKNPEWHPFRVVMVDGKEKEILREDDEKLRELKEEYGEEVHALVTNALREVNEYNPSGR  564

Query  380   YVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             Y +PELWN+KEGRKATLKEV+ +I KQ +THKRKR
Sbjct  565   YAVPELWNYKEGRKATLKEVIQYILKQWRTHKRKR  599



>ref|XP_010265646.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Nelumbo 
nucifera]
Length=578

 Score =   445 bits (1145),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 246/473 (52%), Positives = 344/473 (73%), Gaps = 10/473 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             IN+YK+KPYE+L++G +KVK  +   RCPFC G+KKQDY+YKDLLQHA+GVGKGS+NRS 
Sbjct  16    INDYKDKPYEQLKAGMHKVKYSDVAFRCPFCKGRKKQDYRYKDLLQHASGVGKGSSNRSA  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-SKDN  1779
             KQKANH+ALAKYLEIDL D   P P + V        PE  +LY WPWTGIVVN+ +K N
Sbjct  76    KQKANHLALAKYLEIDLADA--PGPSQPVTELKPSEHPEHGDLYIWPWTGIVVNILAKQN  133

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               G A    ++  K  SKY    V+     +  T   ++    +W G+++A+ FE  FE 
Sbjct  134   EEGRASGSANWLAKELSKYRPLSVQTSWSQQDHTMFAIVDFGKEWTGFRDAMEFEKDFET  193

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             + H KKEW+ +R    S++YGWFA+VDDY +EG +G YLR   +LKTI+ ++QE+ + ++
Sbjct  194   DHHGKKEWSEQRMHHGSNIYGWFARVDDYNSEGPIGDYLRNQGELKTISSIVQEKTQQEN  253

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              ++++LTN LD+ NEN+  L ++ NEK++SLSR++EEK+ LH+ + EE RK+ R+AR H 
Sbjct  254   SMVASLTNVLDVTNENIDELQSKCNEKSMSLSRLVEEKERLHQEYNEERRKLYRIARNHT  313

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             +R++ E + L   L+ ++K L+   +EL K E L ERE+  LDEE ++N  +N+ L+MAS
Sbjct  314   RRIIEESDKLRDSLDYRRKNLEQRQKELAKLEALNERERKGLDEEMQKNAVKNNLLQMAS  373

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQKKADENVLRL+EE KREKEAA+ K+L+LEK +DAKQKLE+EI ELKGKL VM+HM G
Sbjct  374   MEQKKADENVLRLMEEQKREKEAAMNKLLQLEKQLDAKQKLELEIAELKGKLQVMKHMEG  433

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             +DD  +Q+K+KEM ++L+EK+E+M +++++N  L+ KER SNDELQEAR+ LI
Sbjct  434   EDDIGIQKKLKEMADELEEKMEEMVNMEDLNQTLIAKERASNDELQEARQELI  486



>ref|XP_008461675.1| PREDICTED: flagellar attachment zone protein 1 [Cucumis melo]
 ref|XP_008461676.1| PREDICTED: flagellar attachment zone protein 1 [Cucumis melo]
Length=643

 Score =   447 bits (1150),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 269/628 (43%), Positives = 405/628 (64%), Gaps = 29/628 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVG   +N RS
Sbjct  19    MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGNSPSNKRS  78

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  1779
              K+KANH+AL KYLE DL D   P      + +D  + C       WPW GIVVN+    
Sbjct  79    TKEKANHLALLKYLEKDLADTVGPSKPATASNKDPVMDCNHDEKFVWPWRGIVVNIPTRR  138

Query  1778  AN------GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
              +      G+  +  D   +R   +    V    + +  +   +++   DW G  NAI F
Sbjct  139   TDDGRFVGGSGSKFRDELKER--GFNPTRVTPLWNYRGHSGCAIVEFNKDWPGLHNAISF  196

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A+EA+ H KK+W A  ++    +Y W A+ DDY     VG +LR+   LKTI++++QE
Sbjct  197   ERAYEADRHGKKDWLANGTTEKLGIYAWVARADDYNTNNIVGEHLRKIGDLKTISEIIQE  256

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +D+++SNLT+ ++LKN++L  +  R  E   +L+ ++ E++ L  A+ EE +K+Q 
Sbjct  257   EARKQDRLVSNLTSIIELKNKHLIEMEKRCTETATTLNNLMGEREKLLHAYNEEIKKIQL  316

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AR+H++++  + E L  +LE +KK+ +   REL KRE   E E   L EE ++ + RNS
Sbjct  317   GARDHLKKIFSDHEKLKLQLESQKKEFELRGRELEKREAQNENESKYLAEEIEKYEVRNS  376

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL++A  EQ+KADE+ ++L ++ K++KE    +I+ LEK +DAKQ LE+EI+ L+G L+V
Sbjct  377   SLQLAELEQQKADEDFMKLADDQKKQKEDLHNRIIRLEKQLDAKQALELEIERLRGTLNV  436

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HM   +D    E I  +KE L EK  D+++LD++N AL++K+R+SNDELQEARK +I 
Sbjct  437   MKHMEDVEDVQKAESI--LKE-LSEKERDLEELDDLNQALIVKQRKSNDELQEARKEIIN  493

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
                DL   GRSH+ ++RMGE+D K FH   K+ ++ +EAD +A ELCSLW E +KDP+WH
Sbjct  494   AFKDL--PGRSHLRVKRMGELDTKPFHEAMKKIYNEDEADERASELCSLWAEYLKDPDWH  551

Query  536   PFRVINIH--DRPE------QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGR  381
             PFRVI +   D P+      +I++++DE+L  LK+++GEE+C AVI A+ E+NEYN SGR
Sbjct  552   PFRVIKVEAKDAPDGKEKEIEILDDEDEKLKGLKKDYGEEVCKAVISALMEINEYNPSGR  611

Query  380   YVIPELWNFKEGRKATLKEVVSFIFKQL  297
             Y+  ELWN++EGRKATL+E V F+  +L
Sbjct  612   YITSELWNYQEGRKATLREGVRFLLDKL  639



>ref|XP_004147687.1| PREDICTED: uncharacterized protein LOC101219429 [Cucumis sativus]
Length=643

 Score =   447 bits (1149),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 265/628 (42%), Positives = 409/628 (65%), Gaps = 29/628 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  19    MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  78

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  1779
              K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+    
Sbjct  79    TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNIPTRR  138

Query  1778  AN------GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
              +      G+  +  D   +R   +    V    + +  +   +++   DW G  NAI F
Sbjct  139   TDDGRFVGGSGSKFRDELKER--GFNPSRVTPLWNYRGHSGCAIVEFNKDWPGLHNAISF  196

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A+EA+ H KK+W A  ++    VY W A+ DDY +   +G +LR+   LKTI++++QE
Sbjct  197   ERAYEADRHGKKDWLANGTTEKLGVYAWVARADDYNSNNIIGEHLRKIGDLKTISEIIQE  256

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +D+++SNLT+ ++LKN++L+ +  R NE + ++  ++ E + L +A+ EE +K+Q 
Sbjct  257   EARKQDRLVSNLTSIIELKNKHLTEMEKRCNETSATVDSLMREIEKLLQAYNEEIKKIQL  316

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AR+H++++  + E L  +LE +KK+ +   REL KRE   E E   L EE ++ + RNS
Sbjct  317   GARDHLKKIFSDHEKLKLKLESQKKEFELRGRELEKREAQNENESKYLAEEIEKYEVRNS  376

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL++A  EQ+KADE+ ++L ++ K++KE    +I+ LEK +DAKQ LE+EI+ L+G L+V
Sbjct  377   SLQLAELEQQKADEDFMKLADDQKKQKEDLHDRIIRLEKQLDAKQALELEIERLRGTLNV  436

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HM   +D+   +K + + + L EK  D+++LD++N AL++K+R+SNDELQEARK +I 
Sbjct  437   MKHM---EDAEDVQKAESILKDLSEKERDLEELDDLNQALIVKQRKSNDELQEARKEIIN  493

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
                DL   GRSH+ I+RMGE+D K FH   K+ ++ +EAD +A ELCSLW E +KDP+WH
Sbjct  494   AFKDL--PGRSHLRIKRMGELDTKPFHEAMKKIYNEDEADERASELCSLWAEYLKDPDWH  551

Query  536   PFRVINIH--DRPE------QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGR  381
             PF+VI +   D P+      +I++++DE+L  LK+++GEE+C AVI A+ E+NEYN SGR
Sbjct  552   PFKVIKVEGKDAPDGKEKEIEILDDEDEKLKGLKKDYGEEVCKAVISALVEINEYNPSGR  611

Query  380   YVIPELWNFKEGRKATLKEVVSFIFKQL  297
             Y+  ELWN++EG++ATL+E V F+  +L
Sbjct  612   YITSELWNYQEGKRATLREGVRFLLDKL  639



>ref|XP_006435548.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
 ref|XP_006486474.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X1 [Citrus sinensis]
 gb|ESR48788.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
Length=639

 Score =   447 bits (1149),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 278/616 (45%), Positives = 413/616 (67%), Gaps = 17/616 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19    YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  1928  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  1767
             KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79    KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  1766  AVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
             +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139   SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             A+ H KK+W A     S  +Y W A+ DDY  +  +G +LR+   LKTI+++++EE R +
Sbjct  197   ADHHGKKDWYASNQEKSG-LYAWVARSDDYNLKNIIGDHLRKIGDLKTISEMMEEEARKQ  255

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             + ++SNLTN +++K+++L  +  RF E + S+ +++EEKD L +++ EE +K+Q  AR+H
Sbjct  256   NLLVSNLTNMIEVKDKHLEEMKERFTETSNSVEKLMEEKDRLLQSYNEEIKKIQLSARDH  315

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
              QR+  + E L  +LE +KK+L+    EL KRE   E ++  L EE ++N  RN+SL++A
Sbjct  316   FQRIFTDHEKLKLQLESQKKELELRGEELEKRETQNENDRKILAEEIEKNAMRNNSLQLA  375

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             S  Q+KADENV +L E+ K++KE    +I++LEK +DAKQ L +EI+ LKG L+VM+HMG
Sbjct  376   SLVQQKADENVRKLAEDQKKQKEDLHNRIIQLEKQLDAKQALALEIERLKGSLNVMKHMG  435

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
              D D  V +K++ + + L EK  ++ DL+ +N  L+++ER+SNDELQ+ARK LI  L +L
Sbjct  436   DDGDIEVLQKMETVLKDLREKEGELDDLEALNQTLIIRERKSNDELQDARKELINALKEL  495

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
               +GR+HIG++RMGE+D K F  V  ++++ EEA+ +A ELCSLW+E +KDP+WHPF+VI
Sbjct  496   --AGRAHIGLKRMGELDNKPFLEVMNRKYNEEEAEERASELCSLWEEYLKDPDWHPFKVI  553

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
                 + ++IINE+DE+L  LK+E GEE+  AV  A+ E+NEYN SGRY+  ELWN+KEGR
Sbjct  554   TAEGKHKEIINEEDEKLKGLKKEMGEEVYIAVTTALVEINEYNPSGRYITSELWNYKEGR  613

Query  341   KATLKEVVSFIFKQLK  294
             KATL+E V+F+ KQ K
Sbjct  614   KATLQEGVAFLMKQWK  629



>ref|XP_007220898.1| hypothetical protein PRUPE_ppa002712mg [Prunus persica]
 gb|EMJ22097.1| hypothetical protein PRUPE_ppa002712mg [Prunus persica]
Length=641

 Score =   446 bits (1146),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 273/616 (44%), Positives = 400/616 (65%), Gaps = 17/616 (3%)
 Frame = -1

Query  2081  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRSVKQKANHVALA  1905
             L++GK+ V+  +G   CPFC  KKK+D+  KDLLQHA+GVGK  S  RS ++KA H ALA
Sbjct  31    LKNGKHSVRSSDGTYICPFCPKKKKRDFVLKDLLQHASGVGKSNSEKRSTEEKAKHSALA  90

Query  1904  KYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN-GTAVEEED  1749
             KYLE DL    E  P + V  ED  + C       WPWTG+VVN+    A+ G  V E  
Sbjct  91    KYLEKDLA--TEGGPSKPVGEEDPPIDCDHDEKLVWPWTGVVVNIPTRRADDGRYVGESG  148

Query  1748  YWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKE  1578
               L+   +   +    V    + +  +   V++ + DW GY NA+ FE A+EA+ H KK+
Sbjct  149   SKLRDDLKRRGFNPTRVHPLWNFRGHSGSAVVEFRKDWPGYVNAMSFERAYEADRHGKKD  208

Query  1577  WTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLT  1398
             W A      S +Y W A+ DDY+A   VG +LR+   LKTI+++++EE R +DK++ NL 
Sbjct  209   WGA-NGDQKSGLYAWVARADDYKATNIVGEHLRKIGDLKTISEIMEEEARKQDKLVFNLN  267

Query  1397  NELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQ  1218
             N +  KN+++  +  + +E   S+  +I EK+ L + + E+ +K+Q  AR+H QR+  + 
Sbjct  268   NIIQGKNKDMEEMELKCSETTNSIKSVITEKEKLVQGYNEDIKKIQMSARDHFQRIFSDH  327

Query  1217  ETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKAD  1038
             E L  +LE +K  L++   E+ KR V  E E  KL +E ++N  +NSSL++AS EQ KA+
Sbjct  328   EKLKLQLETQKIGLETRIEEMEKRAVANESESRKLADEIEKNSAKNSSLQLASMEQLKAN  387

Query  1037  ENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQ  858
             EN+L+L E+ KR+KE    KI++LEK +D KQ LE+EI++L+G L+V+  MG D D  V 
Sbjct  388   ENLLKLAEDQKRQKEELHSKIIKLEKQLDTKQTLELEIEQLRGNLNVVRRMGDDGDVEVL  447

Query  857   EKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHI  678
             EK+  M ++L EK E  +DL+ +N  L++KER+SNDELQEARK L+ GL ++  S R+HI
Sbjct  448   EKVDTMLKELREKEETFEDLEALNQTLIVKERKSNDELQEARKELVNGLKEI--SNRAHI  505

Query  677   GIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQ  498
             G++RMGE+D K F    K++++ EEA+ KA ELCSLW+E +KDP+WHPFRV  +  + ++
Sbjct  506   GVKRMGELDSKPFQEAMKRKYNEEEAEEKATELCSLWEEYLKDPDWHPFRVTTVDGQHKE  565

Query  497   IINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVV  318
              INE DE+L  LK++ G+E+  AV  A++E+NEYN SGRY+  ELWN+ EGR+A+L+E V
Sbjct  566   FINEQDEKLKDLKKQLGDEVYNAVTSALKEINEYNPSGRYITSELWNYAEGRRASLQEGV  625

Query  317   SFIFKQLKTHKRKRHD  270
              FI KQ K  K++  D
Sbjct  626   DFILKQWKQKKQRMED  641



>gb|KDO69291.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
 gb|KDO69292.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
Length=639

 Score =   445 bits (1145),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 278/616 (45%), Positives = 413/616 (67%), Gaps = 17/616 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19    YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  1928  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  1767
             KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79    KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  1766  AVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
             +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139   SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             A+ + KK+W A     S  +Y W A+ DDY  +  +G +LR+   LKTI+++++EE R +
Sbjct  197   ADHYGKKDWYASNQEKSG-LYAWVARSDDYNLKNIIGDHLRKIGDLKTISEMMEEEARKQ  255

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             + ++SNLTN +++K+++L  +  RF E + S+ +++EEKD L +++ EE +K+Q  AR+H
Sbjct  256   NLLVSNLTNMIEVKDKHLEEMKERFTETSNSVEKLMEEKDRLLQSYNEEIKKIQLSARDH  315

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
              QR+  + E L  +LE +KK+L+    EL KRE   E ++  L EE ++N  RN+SL++A
Sbjct  316   FQRIFTDHEKLKLQLESQKKELELRGEELEKRETQNENDRKILAEEIEKNAMRNNSLQLA  375

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             S  Q+KADENV +L E+ K++KE    +I++LEK +DAKQ L +EI+ LKG L+VM+HMG
Sbjct  376   SLVQQKADENVRKLAEDQKKQKEDLHNRIIQLEKQLDAKQALALEIERLKGSLNVMKHMG  435

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
              D D  V +K++ + + L EK  ++ DL+ +N  L+++ER+SNDELQ+ARK LI  L +L
Sbjct  436   DDGDIEVLQKMETVLKDLREKEGELDDLEALNQTLIIRERKSNDELQDARKELINALKEL  495

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
               SGR+HIG++RMGE+D K F  V  ++++ EEA+ +A ELCSLW+E +KDP+WHPF+VI
Sbjct  496   --SGRAHIGLKRMGELDNKPFLEVMNRKYNEEEAEERASELCSLWEEYLKDPDWHPFKVI  553

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
                 + ++IINE+DE+L  LK+E GEE+  AV  A+ E+NEYN SGRY+  ELWN+KEGR
Sbjct  554   TAEGKHKEIINEEDEKLKGLKKEMGEEVYIAVTTALVEINEYNPSGRYITSELWNYKEGR  613

Query  341   KATLKEVVSFIFKQLK  294
             KATL+E V+F+ KQ K
Sbjct  614   KATLQEGVAFLMKQWK  629



>gb|KEH34701.1| XH/XS domain protein [Medicago truncatula]
Length=640

 Score =   444 bits (1142),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 270/628 (43%), Positives = 403/628 (64%), Gaps = 23/628 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I EY+EK YEEL+SG   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  R 
Sbjct  16    IGEYEEKCYEELKSGSQNVKTSDEKFTCPYCPKKRKRDYLYNELLQHASGVGQSSSQKRK  75

Query  1937  VKQKANHVALAKYLEIDLGDQAEPL-PQRAVAP--------EDNNLYCWPWTGIVVNVSK  1785
              ++KA H+AL KYLE DL +   P  P    A         + +  + WPW GI+VN+  
Sbjct  76    PREKATHLALVKYLEKDLMNIDTPSKPTENCADNGDTDTSIDSDEQFVWPWIGIIVNIPT  135

Query  1784  DNA-NGTAVE------EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNA  1626
               A +G AV        ++Y  + F+ Y    +  F   +  +   +++   +W G  NA
Sbjct  136   SRAQDGRAVGASGSKLRDEYRRRGFNPYRVNPLWNF---RGHSGTALVEFYKNWPGLDNA  192

Query  1625  ILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDL  1446
             + FE A+ ++ H KK+W    + P S +Y W A+ DDY+    +G YLR+   +KTI +L
Sbjct  193   LAFEKAYASDHHGKKDWFV-NTEPKSGLYAWVARADDYKKNNIIGEYLRKMGDIKTIPEL  251

Query  1445  LQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRK  1266
              +EE R +DK++SNLTN + +KN++L  +  R  E    ++  + EKD L +A+ EE +K
Sbjct  252   QEEEARRQDKLVSNLTNIIQVKNKHLHEIEARCTETTAKMNSAMTEKDQLIQAYNEEIKK  311

Query  1265  MQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrnde  1086
             +Q  A++H QR+ ++ E L S+LE +K +L+S    L KRE   E E+ KL EE + N  
Sbjct  312   IQSSAKDHFQRIFNDHEKLKSQLETQKSELESRRITLEKREAHNESERRKLLEEMEENAT  371

Query  1085  RNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGK  906
             RNSSL+MAS EQ+KAD NV++L E+ K++KE    KI++LE+ +D KQKLE+EIQ+LKG 
Sbjct  372   RNSSLQMASLEQQKADINVMKLAEDQKKQKEQLHAKIIQLERQLDMKQKLELEIQQLKGS  431

Query  905   LDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKL  726
             L V++H+  D+D  V +K+ ++   L EK + ++DLD +N  L++KER+SNDELQ+ARK 
Sbjct  432   LSVLKHIEDDEDVEVLKKVDDLHMGLREKEQSLQDLDALNQTLIIKERKSNDELQDARKE  491

Query  725   LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  546
             LI G+ D+    R HIG++RMGE+D   F    K+R++ EEA+ KA ELCSLW+E +KDP
Sbjct  492   LISGIKDI--GTRVHIGVKRMGELDTGPFLEAMKKRYNEEEAEDKASELCSLWEEYLKDP  549

Query  545   NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  366
             +WHPF+V+    + ++II +DDE+L+ L++E GE+  +AV+ ++ E+NEYN SGRYV  E
Sbjct  550   DWHPFKVVMNEGKEKEIIKDDDEKLNGLRKEVGEKAYSAVVASLTEINEYNPSGRYVTSE  609

Query  365   LWNFKEGRKATLKEVVSFIFKQLKTHKR  282
             LWN+K GR+ATL+E V F+    K  K+
Sbjct  610   LWNYKAGRRATLQEGVKFLLDYWKRKKK  637



>ref|NP_001169159.1| putative XH domain family protein [Zea mays]
 ref|XP_008673152.1| PREDICTED: putative XH domain family protein isoform X1 [Zea 
mays]
 ref|XP_008673153.1| PREDICTED: putative XH domain family protein isoform X1 [Zea 
mays]
 gb|ACN31803.1| unknown [Zea mays]
 tpg|DAA53677.1| TPA: putative XH domain family protein [Zea mays]
Length=530

 Score =   439 bits (1130),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 237/518 (46%), Positives = 359/518 (69%), Gaps = 3/518 (1%)
 Frame = -1

Query  1826  YCWPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKS  1650
             + WPW G++VNV  +  NG  V E    LK + S++  Q+V      +  T   +++   
Sbjct  15    FVWPWMGVLVNVPTEWKNGRQVGESGNRLKEQLSRFCPQKVIPLWSYRGHTGNAIVEFAK  74

Query  1649  DWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETR  1470
             DW G+KNA+ FEN FEAE + K++W  + S   S ++GW A+ DD+  +G +G YLR+  
Sbjct  75    DWTGFKNALAFENHFEAEGYGKRDWKLKYSG--SEMFGWVARADDHRCQGPIGDYLRKNG  132

Query  1469  QLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHR  1290
              LKT+ DL  E  R  DK+++NL +++++KN+++  L ++ NE   SL RM+E+++ + +
Sbjct  133   DLKTVGDLETEGTRKTDKLVANLASQIEVKNKHVQELESKCNETTASLDRMMEQREQILQ  192

Query  1289  AFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkld  1110
              + EE RKMQ++AR H Q ++ + + L+ ELE K ++LD  ++EL+   +  + ++  L 
Sbjct  193   KYNEEIRKMQQIARRHSQMIIDDNKKLHKELESKMQELDLRSKELDDIALQRDCDRRNLQ  252

Query  1109  eekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEM  930
             +EK++N  +   L MA+ EQ+KADENVL+L+EEHKREK+AAL KIL L++ +DAKQKLE+
Sbjct  253   QEKEKNKIKTKHLMMATMEQQKADENVLKLVEEHKREKQAALGKILRLQQQLDAKQKLEL  312

Query  929   EIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSND  750
             E+Q L+ K+ VM HM GD DS  ++K+ E+ E+L EK+++++ ++ +N  L++KER+SND
Sbjct  313   EVQTLESKMKVMMHMPGDQDSESKKKMDELAEELKEKVDELEAMESLNQTLIIKERKSND  372

Query  749   ELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSL  570
             ELQ ARK LI G  +L   GR++IGI+RMGE+D KAF   CK+R   E+A+V +  LCS 
Sbjct  373   ELQHARKELIDGFMELAVVGRANIGIKRMGELDLKAFGIACKKRLPKEDAEVISATLCSK  432

Query  569   WQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNA  390
             WQE++++P+W+PF+V  +  +  +I+ EDDE L +LKEE GEEI   V KA+ E+NEYN 
Sbjct  433   WQEEIRNPSWYPFKVKVVDGKEMEILKEDDEMLQELKEEHGEEIYGLVTKALLEINEYNP  492

Query  389   SGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             SGRY +PELWN+KEGRKATLKE V  + +Q K+HKRKR
Sbjct  493   SGRYPVPELWNYKEGRKATLKEAVQHVMRQWKSHKRKR  530



>ref|XP_004503147.1| PREDICTED: myosin-11-like isoform X1 [Cicer arietinum]
 ref|XP_004503148.1| PREDICTED: myosin-11-like isoform X2 [Cicer arietinum]
 ref|XP_004503149.1| PREDICTED: myosin-11-like isoform X3 [Cicer arietinum]
Length=635

 Score =   443 bits (1139),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 261/626 (42%), Positives = 406/626 (65%), Gaps = 21/626 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I++Y++K YEEL++G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  R 
Sbjct  16    ISDYEDKCYEELKNGSQNVKTSDEKFTCPYCPKKRKRDYLYNELLQHASGVGQSSSQKRK  75

Query  1937  VKQKANHVALAKYLE-----IDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKD---  1782
              ++KA H+AL KYL+     +D   + EP  +   A + +  + WPW GI+VN+      
Sbjct  76    AREKATHLALVKYLQKDLMSVDAPSEPEPADKTDNAIDSDEQFVWPWIGIIVNIPTSRAA  135

Query  1781  -----NANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
                   A+G+ + +E Y  + F+ +    +  F   +  +   +++   +W G  NA+ F
Sbjct  136   DGRSVGASGSKLRDE-YRRRGFNPFRVNPLWNF---RGHSGTALVEFNKNWPGLDNALAF  191

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A+  E H KK+W    S P S +Y W A+ DDY+    +G  LR+   +KTI +L++E
Sbjct  192   EKAYVLEHHGKKDWFV-GSEPKSGLYAWVARADDYKRNNIIGENLRKMGDIKTIPELMEE  250

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +DK++SNLTN + +KN++L  +  R  E    ++  +EEKD L +A+ EE +K+Q 
Sbjct  251   EARRQDKLVSNLTNIIQVKNKHLHEIEARCTETTAKMNVAMEEKDQLIQAYNEEIKKIQT  310

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              A++H QR+ ++ E L S+LE +K++L+S   EL KR+   E E+ KL EE + N  +NS
Sbjct  311   SAKDHFQRIFNDHEKLKSQLESQKRELESRKIELEKRDAHNETERKKLAEEMEENAMKNS  370

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL+MAS EQ+KAD+NV++L ++ KREKE    KI++LE+ +D KQKLE+EIQ+LKG L V
Sbjct  371   SLQMASLEQQKADQNVMKLADDQKREKEKLHSKIIQLERQLDMKQKLELEIQQLKGSLSV  430

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             ++H+  D+D  V +K+  +   L EKI+ ++D++ +   L++K+R+SNDELQ+ARK LI 
Sbjct  431   LKHIEDDEDVEVLKKVDALHMDLREKIQSLEDVEALYQTLIIKQRKSNDELQDARKELIN  490

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
              + ++  + R+ IG++RMGE+D   F    K+R++ EEA+ KA ELCSLW+E +KDP+WH
Sbjct  491   AIKEI--ATRAQIGVKRMGELDTGPFLEAMKKRYNEEEAEDKASELCSLWEEYLKDPDWH  548

Query  536   PFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWN  357
             PF+V+ I  + ++ I +DDE+L+ L++E GE    AV+ A+ E+NEYN SGRYV  ELWN
Sbjct  549   PFKVVTIDGKSKEFIKDDDEKLNGLRKEVGERAYNAVVAALNEINEYNPSGRYVTSELWN  608

Query  356   FKEGRKATLKEVVSFIFKQLKTHKRK  279
             +KEGR+ATL+E V F+    +  K K
Sbjct  609   YKEGRRATLQEGVKFLLNHWRRKKGK  634



>ref|XP_010067411.1| PREDICTED: coiled-coil domain-containing protein 39 [Eucalyptus 
grandis]
 gb|KCW65540.1| hypothetical protein EUGRSUZ_G02937 [Eucalyptus grandis]
Length=645

 Score =   443 bits (1139),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 271/622 (44%), Positives = 407/622 (65%), Gaps = 12/622 (2%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVK  1932
             +YKEK YEEL+SG ++VK  +    CP+C  K+K+DY+Y +LLQHA+GVGK S+  RS K
Sbjct  22    DYKEKSYEELKSGNHQVKVSDEAFACPYCPKKRKRDYQYNELLQHASGVGKSSSEKRSAK  81

Query  1931  QKANHVALAKYLEIDLGDQAEP--LPQRAVAP---EDNNLYCWPWTGIVVNVSKDNA-NG  1770
             +KANH+ALAKYLE DL D A P  L     AP     ++ + WPW G+V+N+    A +G
Sbjct  82    EKANHLALAKYLEKDLSDVAGPSKLVDEGKAPIGCSHDDKFVWPWKGVVMNIPTKRAEDG  141

Query  1769  TAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               V E    L+       +    V    + +  +   V++    W G  NA+ FE A+EA
Sbjct  142   RYVGESGSKLRDELTRRGFNPMRVHPLWNYRGHSGSAVVEFNKGWPGLHNAMSFEKAYEA  201

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             + H +K+W AE +     +Y W A+ DDY +   VG +LR+   LKTI ++++EE R +D
Sbjct  202   DRHGRKDWYAEGTQKIG-LYAWVARADDYNSNSIVGEHLRKIGDLKTIPEIMEEEARKQD  260

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
             +++S+LTN +++KN+ +  +  R NE   SL+ ++ EKD LH+++ EE RK+Q  A +H 
Sbjct  261   RLVSDLTNIIEVKNKYMQEIEERCNETLKSLNVIMTEKDKLHQSYDEELRKIQTSAHDHY  320

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             +R+  + E L  +LE  KK L+   +EL KRE   E E+ KL EE   N ++NSSLE+A+
Sbjct  321   RRIFSDHEKLKFQLESLKKDLEVRGQELEKREAHNESERKKLLEEIAENAQKNSSLELAA  380

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ+K DE V +L E+ KR+KE    +I++LEK +DAKQ LE+EI++L+G ++VM+HM  
Sbjct  381   LEQQKVDEKVWKLAEDQKRQKEELHNRIIQLEKQLDAKQALELEIEQLRGSVNVMKHMED  440

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             +DD+ + + +  +   L EK  +++DL+ +N AL++KE  SN+ELQEARK LI  L D+ 
Sbjct  441   EDDAEILKNVDVLLSDLREKEGNLEDLEALNQALIVKEHNSNNELQEARKELINVLRDIC  500

Query  698   -NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
               S +++IG++RMGE+D + F  V K +++ EEA+ K  ELCSLW+E +KDP+WHPFRVI
Sbjct  501   TGSSKANIGVKRMGELDHEPFLEVMKLKYNEEEAEEKTSELCSLWEEYLKDPDWHPFRVI  560

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
              ++ + ++II+E DE+L+ LK E G+++C AV  A++EVNEYN SGRY+  E+WN+KE R
Sbjct  561   EVNGKHQEIIDEQDEKLNTLKREMGDKVCQAVTAALKEVNEYNPSGRYITSEVWNYKERR  620

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             KA+LKE   F+       + KR
Sbjct  621   KASLKEGAEFLLTLWNASRSKR  642



>gb|KHN17925.1| hypothetical protein glysoja_017976 [Glycine soja]
Length=640

 Score =   442 bits (1138),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 267/626 (43%), Positives = 407/626 (65%), Gaps = 18/626 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I+EY++K YEEL+SG   VK  +    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17    ISEYEDKSYEELKSGSQDVKTSDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  1785
              + KANH+AL KYLE DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77    ARDKANHLALLKYLEKDLMNV--DVPSNDSKPEDESDPSVNSNDQFAWPWIGVVVNIPTR  134

Query  1784  DNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
                +G  V E    L+   R   +    V    + +  +   +++   +W G  NA+ FE
Sbjct  135   RTEDGRCVGESGSRLRDEYRSRGFNPFRVNPLWNFRGHSGTALVEFNKNWPGLHNALAFE  194

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
              A+E + H KK+W    S   S +Y W A+ DDY+     G +LR    +KTI++L++EE
Sbjct  195   RAYELDHHGKKDWFT-NSGLKSGLYAWVARADDYKINSIYGEHLRRMGDVKTISELMEEE  253

Query  1433  KRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRL  1254
              R +DK++SNLTN + +KN++L  +  R +E    ++ ++++KD L +A+ EE +K+Q  
Sbjct  254   ARRQDKLVSNLTNIIQVKNKHLKEIEVRCHETTDKMNLVMKDKDQLIQAYNEEIQKIQLS  313

Query  1253  AREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSS  1074
             AR+H QR+  + E L  +LE  K +L+    EL KRE   E E+ KL EE + N  +NSS
Sbjct  314   ARDHFQRIFTDHEKLKLQLESHKNELELRKVELEKREAHNESERKKLAEEIEENASKNSS  373

Query  1073  LEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVM  894
             L+MA+ EQ KADENV++L E+ KR+KE    KI++L+K +D KQ+LE+EIQ+LKG L V+
Sbjct  374   LQMAALEQMKADENVMKLAEDQKRQKEQLHAKIIQLQKQLDVKQELELEIQQLKGSLSVL  433

Query  893   EHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQG  714
             +HM  D+D+ +  K+  +++ L +K + ++DLD +N  L++KER+SNDELQEAR+ L+  
Sbjct  434   KHMEDDEDAEILNKVDTLQKDLRDKEQSLQDLDALNQTLIIKERESNDELQEARQALVDA  493

Query  713   LSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHP  534
             + +L + G  +I ++RMGE+D + F    KQR++ E+A+ +A ELCSLW+E +KDP+WHP
Sbjct  494   IKELQSHG--NIRLKRMGELDTRPFLEAMKQRYNEEDAEERASELCSLWEEYLKDPDWHP  551

Query  533   FRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNF  354
             F+VI +  + ++II +DDE+L+ LK + GE    AV++A+ E+NE+N SGRY+   LWN+
Sbjct  552   FKVIMVEGKEKEIIRDDDEKLNGLKNDLGEGAYKAVVEALLEINEHNPSGRYLTSVLWNY  611

Query  353   KEGRKATLKEVVSFIFKQLKTHKRKR  276
             K+GR+ATLKE V FI  Q K  KRK+
Sbjct  612   KQGRRATLKEGVQFISNQWKVLKRKK  637



>ref|XP_003538408.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X1 [Glycine max]
 ref|XP_006591339.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X2 [Glycine max]
 ref|XP_006591340.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
isoform X3 [Glycine max]
Length=640

 Score =   442 bits (1138),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 267/626 (43%), Positives = 407/626 (65%), Gaps = 18/626 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I+EY++K YEEL+SG   VK  +    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17    ISEYEDKSYEELKSGSQDVKTSDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  1785
              + KANH+AL KYLE DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77    ARDKANHLALLKYLEKDLMNV--DVPSNDSKPEDESDPSVNSNDQFVWPWIGVVVNIPTR  134

Query  1784  DNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
                +G  V E    L+   R   +    V    + +  +   +++   +W G  NA+ FE
Sbjct  135   RTEDGRCVGESGSRLRDEYRSRGFNPFRVNPLWNFRGHSGTALVEFNKNWPGLHNALAFE  194

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
              A+E + H KK+W    S   S +Y W A+ DDY+     G +LR    +KTI++L++EE
Sbjct  195   RAYELDHHGKKDWFT-NSGLKSGLYAWVARADDYKINSIYGEHLRRMGDVKTISELMEEE  253

Query  1433  KRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRL  1254
              R +DK++SNLTN + +KN++L  +  R +E    ++ ++++KD L +A+ EE +K+Q  
Sbjct  254   ARRQDKLVSNLTNIIQVKNKHLKEIEVRCHETTDKMNLVMKDKDQLIQAYNEEIQKIQLS  313

Query  1253  AREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSS  1074
             AR+H QR+  + E L  +LE  K +L+    EL KRE   E E+ KL EE + N  +NSS
Sbjct  314   ARDHFQRIFTDHEKLKLQLESHKNELELRKVELEKREAHNESERKKLAEEIEENASKNSS  373

Query  1073  LEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVM  894
             L+MA+ EQ KADENV++L E+ KR+KE    KI++L+K +D KQ+LE+EIQ+LKG L V+
Sbjct  374   LQMAALEQMKADENVMKLAEDQKRQKEQLHAKIIQLQKQLDVKQELELEIQQLKGSLSVL  433

Query  893   EHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQG  714
             +HM  D+D+ +  K+  +++ L +K + ++DLD +N  L++KER+SNDELQEAR+ L+  
Sbjct  434   KHMEDDEDAEILNKVDTLQKDLRDKEQSLQDLDALNQTLIIKERESNDELQEARQALVDA  493

Query  713   LSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHP  534
             + +L + G  +I ++RMGE+D + F    KQR++ E+A+ +A ELCSLW+E +KDP+WHP
Sbjct  494   IKELQSHG--NIRLKRMGELDTRPFLEAMKQRYNEEDAEERASELCSLWEEYLKDPDWHP  551

Query  533   FRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNF  354
             F+VI +  + ++II +DDE+L+ LK + GE    AV++A+ E+NE+N SGRY+   LWN+
Sbjct  552   FKVIMVEGKEKEIIRDDDEKLNGLKNDLGEGAYKAVVEALLEINEHNPSGRYLTSVLWNY  611

Query  353   KEGRKATLKEVVSFIFKQLKTHKRKR  276
             K+GR+ATLKE V FI  Q K  KRK+
Sbjct  612   KQGRRATLKEGVQFISNQWKVLKRKK  637



>gb|KGN50554.1| hypothetical protein Csa_5G182100 [Cucumis sativus]
Length=781

 Score =   447 bits (1149),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 265/628 (42%), Positives = 409/628 (65%), Gaps = 29/628 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  157   MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  216

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  1779
              K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+    
Sbjct  217   TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNIPTRR  276

Query  1778  AN------GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
              +      G+  +  D   +R   +    V    + +  +   +++   DW G  NAI F
Sbjct  277   TDDGRFVGGSGSKFRDELKER--GFNPSRVTPLWNYRGHSGCAIVEFNKDWPGLHNAISF  334

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A+EA+ H KK+W A  ++    VY W A+ DDY +   +G +LR+   LKTI++++QE
Sbjct  335   ERAYEADRHGKKDWLANGTTEKLGVYAWVARADDYNSNNIIGEHLRKIGDLKTISEIIQE  394

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +D+++SNLT+ ++LKN++L+ +  R NE + ++  ++ E + L +A+ EE +K+Q 
Sbjct  395   EARKQDRLVSNLTSIIELKNKHLTEMEKRCNETSATVDSLMREIEKLLQAYNEEIKKIQL  454

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AR+H++++  + E L  +LE +KK+ +   REL KRE   E E   L EE ++ + RNS
Sbjct  455   GARDHLKKIFSDHEKLKLKLESQKKEFELRGRELEKREAQNENESKYLAEEIEKYEVRNS  514

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL++A  EQ+KADE+ ++L ++ K++KE    +I+ LEK +DAKQ LE+EI+ L+G L+V
Sbjct  515   SLQLAELEQQKADEDFMKLADDQKKQKEDLHDRIIRLEKQLDAKQALELEIERLRGTLNV  574

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HM   +D+   +K + + + L EK  D+++LD++N AL++K+R+SNDELQEARK +I 
Sbjct  575   MKHM---EDAEDVQKAESILKDLSEKERDLEELDDLNQALIVKQRKSNDELQEARKEIIN  631

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
                DL   GRSH+ I+RMGE+D K FH   K+ ++ +EAD +A ELCSLW E +KDP+WH
Sbjct  632   AFKDL--PGRSHLRIKRMGELDTKPFHEAMKKIYNEDEADERASELCSLWAEYLKDPDWH  689

Query  536   PFRVINIH--DRPE------QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGR  381
             PF+VI +   D P+      +I++++DE+L  LK+++GEE+C AVI A+ E+NEYN SGR
Sbjct  690   PFKVIKVEGKDAPDGKEKEIEILDDEDEKLKGLKKDYGEEVCKAVISALVEINEYNPSGR  749

Query  380   YVIPELWNFKEGRKATLKEVVSFIFKQL  297
             Y+  ELWN++EG++ATL+E V F+  +L
Sbjct  750   YITSELWNYQEGKRATLREGVRFLLDKL  777



>gb|KCW65539.1| hypothetical protein EUGRSUZ_G02937 [Eucalyptus grandis]
Length=646

 Score =   440 bits (1132),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 272/623 (44%), Positives = 408/623 (65%), Gaps = 13/623 (2%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVK  1932
             +YKEK YEEL+SG ++VK  +    CP+C  K+K+DY+Y +LLQHA+GVGK S+  RS K
Sbjct  22    DYKEKSYEELKSGNHQVKVSDEAFACPYCPKKRKRDYQYNELLQHASGVGKSSSEKRSAK  81

Query  1931  QKANHVALAKYLEIDLGDQAEP--LPQRAVAP---EDNNLYCWPWTGIVVNVSKDNA-NG  1770
             +KANH+ALAKYLE DL D A P  L     AP     ++ + WPW G+V+N+    A +G
Sbjct  82    EKANHLALAKYLEKDLSDVAGPSKLVDEGKAPIGCSHDDKFVWPWKGVVMNIPTKRAEDG  141

Query  1769  TAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               V E    L+       +    V    + +  +   V++    W G  NA+ FE A+EA
Sbjct  142   RYVGESGSKLRDELTRRGFNPMRVHPLWNYRGHSGSAVVEFNKGWPGLHNAMSFEKAYEA  201

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             + H +K+W AE +     +Y W A+ DDY +   VG +LR+   LKTI ++++EE R +D
Sbjct  202   DRHGRKDWYAEGTQKIG-LYAWVARADDYNSNSIVGEHLRKIGDLKTIPEIMEEEARKQD  260

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
             +++S+LTN +++KN+ +  +  R NE   SL+ ++ EKD LH+++ EE RK+Q  A +H 
Sbjct  261   RLVSDLTNIIEVKNKYMQEIEERCNETLKSLNVIMTEKDKLHQSYDEELRKIQTSAHDHY  320

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
             +R+  + E L  +LE  KK L+   +EL KRE   E E+ KL EE   N ++NSSLE+A+
Sbjct  321   RRIFSDHEKLKFQLESLKKDLEVRGQELEKREAHNESERKKLLEEIAENAQKNSSLELAA  380

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ+K DE V +L E+ KR+KE    +I++LEK +DAKQ LE+EI++L+G ++VM+HM  
Sbjct  381   LEQQKVDEKVWKLAEDQKRQKEELHNRIIQLEKQLDAKQALELEIEQLRGSVNVMKHMED  440

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI-QGLSDL  702
             +DD+ + + +  +   L EK  +++DL+ +N AL++KE  SN+ELQEARK LI Q L D+
Sbjct  441   EDDAEILKNVDVLLSDLREKEGNLEDLEALNQALIVKEHNSNNELQEARKELINQVLRDI  500

Query  701   L-NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV  525
                S +++IG++RMGE+D + F  V K +++ EEA+ K  ELCSLW+E +KDP+WHPFRV
Sbjct  501   CTGSSKANIGVKRMGELDHEPFLEVMKLKYNEEEAEEKTSELCSLWEEYLKDPDWHPFRV  560

Query  524   INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
             I ++ + ++II+E DE+L+ LK E G+++C AV  A++EVNEYN SGRY+  E+WN+KE 
Sbjct  561   IEVNGKHQEIIDEQDEKLNTLKREMGDKVCQAVTAALKEVNEYNPSGRYITSEVWNYKER  620

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             RKA+LKE   F+       + KR
Sbjct  621   RKASLKEGAEFLLTLWNASRSKR  643



>ref|XP_009343557.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Pyrus 
x bretschneideri]
Length=646

 Score =   440 bits (1131),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 268/616 (44%), Positives = 401/616 (65%), Gaps = 20/616 (3%)
 Frame = -1

Query  2081  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGK-GSANRSVKQKANHVALA  1905
             L++GK+ V+  +G   CPFC  KKK+ +  KDLLQHA+GVGK  S  RS ++KA H+A+ 
Sbjct  31    LKNGKHSVRNSDGTYTCPFCPNKKKRGFVRKDLLQHASGVGKRTSEKRSTEEKAKHLAVV  90

Query  1904  KYLEIDLG-DQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN-GTAVEEE  1752
             KYLE DL  + AE  P + V  E   + C       WPWTG+VVN+    AN G  V E 
Sbjct  91    KYLENDLAAEAAEGGPSKPVGEEKPPIDCDQDEKLVWPWTGVVVNIPTRRANDGRYVGES  150

Query  1751  -----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
                  D  ++R   +    V    + +  +   +++ + DW GY NA+ FE A++ + H 
Sbjct  151   GSKLRDELIRR--GFNPLRVHPLWNFRGHSGSAIVEFRKDWPGYVNAMSFEKAYDVDHHG  208

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             KK+W    S   S +Y W A+ DDY+A   VG +LR+   LK+I+++ +EE R +D++++
Sbjct  209   KKDWET-NSDQKSGLYAWVARSDDYKASNIVGEHLRKIGDLKSISEITEEEARKQDRLVT  267

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             NL N +++K ++L  +  + +E   S+  +I EK+ + + + EE +K+Q  AR+H QR+ 
Sbjct  268   NLNNIIEVKYKDLEEMELKCSETTNSIKSVITEKEKIIQTYNEEIKKIQTSARDHFQRIF  327

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              + E L  +LE +KK+L+S   E+ KR V  E E  KL EE ++N  +NSSL +AS EQ 
Sbjct  328   GDHEKLKLQLETQKKELESRIEEMEKRAVANEDESRKLAEEIEKNSIKNSSLHLASMEQL  387

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             KA+ N+L+L E+ KR+KE    KI++L++ +D KQ LE+EI++L+G L+V+  MG D D 
Sbjct  388   KANANLLKLAEDQKRQKEQLHNKIIKLQQQLDTKQTLELEIEQLRGNLNVVRRMGDDGDV  447

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
              V +K+  M + L EK E ++DL+ +N  L++KER+SNDELQEAR+ LI GL ++  S  
Sbjct  448   EVLKKVDNMIKGLREKEESLEDLEALNQTLIVKERKSNDELQEARRELINGLKEI--SSS  505

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDR  507
             + IG+RRMGE+D K F    K++++ EEA+ KA+ELCSLW E +KDP WHPF+V  +  +
Sbjct  506   AQIGVRRMGELDSKPFQEALKRKYNEEEAEEKAMELCSLWVEYLKDPEWHPFKVTTVDGK  565

Query  506   PEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLK  327
              +++I+ +DE+L  LK+E GEE+C AVI A+ E+NEYN SGRY+  ELWN+KEGR+A+LK
Sbjct  566   HKEVISVEDEKLKDLKKELGEEVCNAVISALTEINEYNPSGRYITSELWNYKEGRRASLK  625

Query  326   EVVSFIFKQLKTHKRK  279
             E V+FI  Q KT KR+
Sbjct  626   EGVAFILNQWKTKKRR  641



>gb|EYU17877.1| hypothetical protein MIMGU_mgv1a002871mg [Erythranthe guttata]
Length=629

 Score =   439 bits (1128),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 263/620 (42%), Positives = 403/620 (65%), Gaps = 24/620 (4%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             EY EK YEEL+              CP+C   KK+ ++YKDL QHA  +   S  R+ ++
Sbjct  22    EYTEKSYEELKK----------AYTCPYCP-TKKKAFQYKDLFQHANAIAT-SPKRNARE  69

Query  1928  KANHVALAKYLE----IDLGDQAEPLPQ-RAVAPEDNN-LYCWPWTGIVVNVSKDNANGT  1767
             +ANH+AL KYLE    +D G  ++P  +   +A  D + ++ WPW GIVVN+  D  +G 
Sbjct  70    RANHLALTKYLETDSSVDSGGPSKPAGKLDTLADHDGDEMFVWPWIGIVVNIPTDLKDGR  129

Query  1766  AVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+ + ++  +    V+   + +  +   +++   +W+G+ NA+ FE  +EA 
Sbjct  130   YVGESGSKLRDQLARRGFNPTRVRPLWNYQGHSGTAIVEFHKNWSGFTNAMSFEKDYEAN  189

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H +K W A ++   S +Y W A+ DDY     VG  LR+   L+TI+D+++EE R  +K
Sbjct  190   HHGRKNWLA-KNEKKSDLYAWVARTDDYNLNNIVGENLRKIGDLRTISDIMEEEARKTNK  248

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++ NLTN ++ K  +L  + ++F E + SL +MI EKD LH+A+ EE +K++  AR+H +
Sbjct  249   LVGNLTNVIEAKKMHLIEMESKFKETDSSLRQMIMEKDNLHQAYNEEIKKIESSARDHFK  308

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             ++ ++ E L  +LE +K+ L+   +EL KRE   E EK KL E+ ++N  +N SL+ A++
Sbjct  309   KIFNDHEKLKFQLETQKRDLELRGQELMKRETHNEIEKKKLAEDLEQNAVKNCSLQAAAE  368

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KADE V++L EEHK EKE   ++I++LEK +DAKQ +++EI++L+GKL+V++HMG +
Sbjct  369   EQRKADEKVMKLAEEHKNEKEKLHKRIIQLEKQLDAKQAVQLEIEQLRGKLNVVKHMGDE  428

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              D  V  K+  + + L EK  ++ DL+ +N  LV++ER+SNDELQ+ARK L+ GL D+  
Sbjct  429   GDLEVLNKVDLVLKALREKEGELDDLEALNQTLVVQERKSNDELQDARKELVNGLKDM--  486

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S  SHIG++RMGE+D K FH+  K++++  EAD +A ELCSLW+E +KDP W P +V+ I
Sbjct  487   SLNSHIGVKRMGELDSKPFHDAMKRKYNEAEADERATELCSLWEEYLKDPEWDPIKVVTI  546

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
                P+ +INEDDE+L  L+E +GEE+  AV   + E+NEYN SGRYVI ELWN+KEGR+A
Sbjct  547   DGTPKNVINEDDEKLIDLRENYGEEVYNAVKATLFEINEYNPSGRYVISELWNYKEGRRA  606

Query  335   TLKEVVSFIFKQLKTHKRKR  276
              LKE V+ + KQ K  KRK+
Sbjct  607   YLKEGVAVLLKQWKFFKRKK  626



>emb|CBI40114.3| unnamed protein product [Vitis vinifera]
Length=352

 Score =   428 bits (1101),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 232/353 (66%), Positives = 298/353 (84%), Gaps = 1/353 (0%)
 Frame = -1

Query  1334  LSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNREL  1155
             +SLSRM+EEKD LH AFYEE+RKMQRLAR+HVQR+L EQE LN EL+ K+K+LD+W++EL
Sbjct  1     MSLSRMLEEKDKLHHAFYEETRKMQRLARDHVQRILGEQEKLNYELDSKRKELDNWSKEL  60

Query  1154  NKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKI  975
             NKRE LTEREK KLD+EKK+N++RN+SL+MAS EQ+KADENVL+L+EE KREKE AL KI
Sbjct  61    NKREALTEREKQKLDDEKKKNNDRNNSLQMASIEQRKADENVLKLVEEQKREKEEALSKI  120

Query  974   LELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLD  795
             L+LEK +DAKQKLEMEI+E+KGKL VM+H+G +DD+AVQ K+KEM E+L+EK+ +M++L+
Sbjct  121   LQLEKQLDAKQKLEMEIEEIKGKLQVMKHLGDEDDTAVQNKMKEMNEELEEKVGEMENLE  180

Query  794   EMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRF  615
              +N  L++KERQSNDELQ AR  LI GL D+L SGR++IG++RMGE+D K F N CKQRF
Sbjct  181   SLNQTLIVKERQSNDELQAARTELITGLKDML-SGRTNIGLKRMGELDEKPFLNTCKQRF  239

Query  614   STEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEIC  435
             S EEA+V+A  L SLWQ+ +K P WHPF+++ +     +IINE+DE+L KLK+EWG+EI 
Sbjct  240   SLEEANVQAYTLVSLWQDNLKKPEWHPFKIVEVEGETLEIINEEDEKLQKLKQEWGDEIY  299

Query  434   AAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
              AV K+++E+NEYN SGRY + ELWNFKEGRKATLKEV+ +I K +KT KRKR
Sbjct  300   MAVTKSLKEINEYNPSGRYTVFELWNFKEGRKATLKEVIQYILKNMKTLKRKR  352



>ref|XP_008343538.1| PREDICTED: myosin-2 heavy chain-like [Malus domestica]
Length=643

 Score =   438 bits (1126),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 265/614 (43%), Positives = 400/614 (65%), Gaps = 21/614 (3%)
 Frame = -1

Query  2078  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQKANHVALAK  1902
             ++GK+ V+  +G   CPFC  KKK+    KDLLQHA+GVGK ++  RS ++KA H+A+ K
Sbjct  32    KNGKHSVRNSDGTYTCPFCPNKKKRGSVRKDLLQHASGVGKSTSEKRSTEEKAKHLAVVK  91

Query  1901  YLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN-GTAVEEE--  1752
             YLE DL   AE  P + V  E+  + C       WPWTG+VVN+    AN G  V E   
Sbjct  92    YLENDLA--AEGGPSKRVGEEEPPIDCDHDEKLVWPWTGVVVNIPTRRANDGRYVGESGS  149

Query  1751  ---DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKK  1581
                D  ++R   +    V    + +  +   +++ + DW GY NA+ FE A++ + H KK
Sbjct  150   KLRDELIRR--GFNPLRVHPLWNFRGHSGSAIVEFRKDWPGYVNAMSFEKAYDVDHHGKK  207

Query  1580  EWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNL  1401
             +W    S   S +Y W A+ DDY+A   VG +LR+   LK+I+++ +EE R +D++++NL
Sbjct  208   DWEI-NSDQKSGLYAWVARSDDYKASNIVGEHLRKIGDLKSISEITEEEARKQDRLVTNL  266

Query  1400  TNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHE  1221
              N +++K ++L  +  + +E   S+  +I EK+ + + + EE +K+Q  AR+H QR+  +
Sbjct  267   NNIIEVKYKDLEEMELKCSETTNSIKSVITEKEKIIQTYXEEIKKIQTSARDHFQRIFGD  326

Query  1220  QETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKA  1041
              E L  +LE +KK+L+S   E+ KR V  E E  KL EE ++N  +NSSL +AS EQ KA
Sbjct  327   HEKLKLQLETQKKELESRIEEMEKRAVANEDESRKLAEEIEKNSIKNSSLHLASMEQLKA  386

Query  1040  DENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAV  861
             + N+L+L E+ KR+KE    KI++L++ +D KQ LE+EI++L+G L+V+  MG D D  V
Sbjct  387   NANLLKLAEDQKRQKEQLHNKIIKLQQQLDTKQTLELEIEQLRGNLNVVRRMGDDGDVEV  446

Query  860   QEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSH  681
              +K+  M + L EK E ++DL+ +N  L++KER+SNDELQEAR+ LI GL ++  S  + 
Sbjct  447   LKKVDNMIKGLREKEESLEDLEALNQTLIVKERKSNDELQEARRELINGLKEI--SSSAQ  504

Query  680   IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE  501
             IG+RRMGE+D K F    K++++ EEA+ KA+ELCSLW E +KDP WHPF+V  +  + +
Sbjct  505   IGVRRMGELDSKPFQEALKRKYNEEEAEEKAMELCSLWVEYLKDPEWHPFKVTTVDGKHK  564

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
             ++I+ +DE+L  LK+E GEE+C AVI A+ E+NEYN SGRY+  ELWN+KEGR+A+LK+ 
Sbjct  565   EVISVEDEKLKDLKKELGEEVCNAVISALTEINEYNPSGRYITSELWNYKEGRRASLKDG  624

Query  320   VSFIFKQLKTHKRK  279
             V+FI  Q KT KR+
Sbjct  625   VAFILNQWKTKKRR  638



>ref|XP_010234409.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234410.1| PREDICTED: factor of DNA methylation 1-like isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   437 bits (1123),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 271/621 (44%), Positives = 401/621 (65%), Gaps = 18/621 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y E+ Y  L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  21    IDDYAEQTYLNLKSGKLVARYGADRFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAA  78

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVSKDN  1779
             K KANH+ALA  L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV  + 
Sbjct  79    KVKANHLALANLLKNDYSDAAGSLPSRQADALINPPKPVQDQELFVWPWMGILANVPAEQ  138

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
                         ++  + +              T   V++  SDW G+K+A+ F N +++
Sbjct  139   TQRDGA----ILMQHLAHFNPSHFDAVHSPDGYTGFAVVRFTSDWIGFKDALAFHNNYKS  194

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
               H  K    E S    ++ GW AK +DY+A+  VG +L    +LKT+++L  E  R  +
Sbjct  195   R-HLGKMDLNEASRRGKYICGWLAKEEDYKADDPVGMFLSANGELKTVSELQLELSRKTE  253

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              I+++LT ++  K++ +  L  + N+ NL+L R +E+ D+LH+ + E  RKMQ  AREH 
Sbjct  254   TIIASLTTQISAKSKYMMELEIKCNKMNLALRRAMEDSDSLHQRYNEAMRKMQSAAREHS  313

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
              ++  E + L  +L++K+  +   +++L++    T+ E+ KL  E+K+N  +N SL MA 
Sbjct  314   LKIFQETDQLRKQLDEKESDIQRRSKQLSEIVAQTDMERRKLKNERKKNAGQNDSLHMAR  373

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ+KA+E V  L+E+HK+EKE AL KIL+LEK +D KQKLE+EIQ+L+G+L+V++HM G
Sbjct  374   VEQQKANEAVRVLVEKHKKEKEVALNKILQLEKQLDEKQKLELEIQQLRGQLEVVKHMEG  433

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             +    V+++ +E+ E+L+ KI+DM+DL+ +N  L++KER +NDELQ+A+K LI GLSDLL
Sbjct  434   EG-VDVKKRTEELTEELENKIDDMEDLEALNQTLIIKERMTNDELQDAKKELISGLSDLL  492

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
                RS+IGI+RMGE+D K F   CKQ++  E A+ K LELCS+WQ+K+KD NWHPF+V+ 
Sbjct  493   GP-RSNIGIKRMGELDEKPFIQACKQKYGVE-AETKGLELCSMWQDKLKDANWHPFKVVV  550

Query  518   IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  339
               ++  QIINE DEEL+ LK+E G+E+  AV  A+ E+NEYNASG YV+ ELWN KE +K
Sbjct  551   TGEKTGQIINEHDEELAGLKQELGQEVYQAVTTALLEINEYNASGSYVVSELWNNKENKK  610

Query  338   ATLKEVVSFIFKQLKTHKRKR  276
             A++ +VV  I KQ K  KR+R
Sbjct  611   ASMGDVVQHILKQWKLQKRRR  631



>ref|XP_010234408.1| PREDICTED: factor of DNA methylation 1-like isoform X1 [Brachypodium 
distachyon]
Length=632

 Score =   437 bits (1123),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 271/621 (44%), Positives = 401/621 (65%), Gaps = 18/621 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y E+ Y  L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  22    IDDYAEQTYLNLKSGKLVARYGADRFRCPFCLGKKKQDYRYNELLQHAVGVG--ASNRAA  79

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRA----VAP----EDNNLYCWPWTGIVVNVSKDN  1779
             K KANH+ALA  L+ D  D A  LP R     + P    +D  L+ WPW GI+ NV  + 
Sbjct  80    KVKANHLALANLLKNDYSDAAGSLPSRQADALINPPKPVQDQELFVWPWMGILANVPAEQ  139

Query  1778  ANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
                         ++  + +              T   V++  SDW G+K+A+ F N +++
Sbjct  140   TQRDGA----ILMQHLAHFNPSHFDAVHSPDGYTGFAVVRFTSDWIGFKDALAFHNNYKS  195

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
               H  K    E S    ++ GW AK +DY+A+  VG +L    +LKT+++L  E  R  +
Sbjct  196   R-HLGKMDLNEASRRGKYICGWLAKEEDYKADDPVGMFLSANGELKTVSELQLELSRKTE  254

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              I+++LT ++  K++ +  L  + N+ NL+L R +E+ D+LH+ + E  RKMQ  AREH 
Sbjct  255   TIIASLTTQISAKSKYMMELEIKCNKMNLALRRAMEDSDSLHQRYNEAMRKMQSAAREHS  314

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
              ++  E + L  +L++K+  +   +++L++    T+ E+ KL  E+K+N  +N SL MA 
Sbjct  315   LKIFQETDQLRKQLDEKESDIQRRSKQLSEIVAQTDMERRKLKNERKKNAGQNDSLHMAR  374

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ+KA+E V  L+E+HK+EKE AL KIL+LEK +D KQKLE+EIQ+L+G+L+V++HM G
Sbjct  375   VEQQKANEAVRVLVEKHKKEKEVALNKILQLEKQLDEKQKLELEIQQLRGQLEVVKHMEG  434

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             +    V+++ +E+ E+L+ KI+DM+DL+ +N  L++KER +NDELQ+A+K LI GLSDLL
Sbjct  435   EG-VDVKKRTEELTEELENKIDDMEDLEALNQTLIIKERMTNDELQDAKKELISGLSDLL  493

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
                RS+IGI+RMGE+D K F   CKQ++  E A+ K LELCS+WQ+K+KD NWHPF+V+ 
Sbjct  494   GP-RSNIGIKRMGELDEKPFIQACKQKYGVE-AETKGLELCSMWQDKLKDANWHPFKVVV  551

Query  518   IHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRK  339
               ++  QIINE DEEL+ LK+E G+E+  AV  A+ E+NEYNASG YV+ ELWN KE +K
Sbjct  552   TGEKTGQIINEHDEELAGLKQELGQEVYQAVTTALLEINEYNASGSYVVSELWNNKENKK  611

Query  338   ATLKEVVSFIFKQLKTHKRKR  276
             A++ +VV  I KQ K  KR+R
Sbjct  612   ASMGDVVQHILKQWKLQKRRR  632



>ref|XP_008354129.1| PREDICTED: myosin-2 heavy chain-like [Malus domestica]
Length=643

 Score =   437 bits (1124),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 265/614 (43%), Positives = 400/614 (65%), Gaps = 21/614 (3%)
 Frame = -1

Query  2078  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQKANHVALAK  1902
             ++GK+ V+  +G   CPFC  KKK+    KDLLQHA+GVGK ++  RS ++KA H+A+ K
Sbjct  32    KNGKHSVRNSDGTYTCPFCPNKKKRGSVRKDLLQHASGVGKSTSEKRSTEEKAKHLAVVK  91

Query  1901  YLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN-GTAVEEE--  1752
             YLE DL   AE  P + V  E+  + C       WPWTG+VVN+    AN G  V E   
Sbjct  92    YLENDLA--AEGGPSKRVGEEEPPIDCDHDEKLVWPWTGVVVNIPTRRANDGRYVGESGS  149

Query  1751  ---DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKK  1581
                D  ++R   +    V    + +  +   +++ + DW GY NA+ FE A++ + H KK
Sbjct  150   KLRDELIRR--GFNPLRVHPLWNFRGHSGSAIVEFRKDWPGYVNAMSFEKAYDVDHHGKK  207

Query  1580  EWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNL  1401
             +W    S   S +Y W A+ DDY+A   VG +LR+   LK+I+++ +EE R +D++++NL
Sbjct  208   DWEI-NSDQKSGLYAWVARSDDYKASNIVGEHLRKIGDLKSISEITEEEARKQDRLVTNL  266

Query  1400  TNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHE  1221
              N +++K ++L  +  + +E   S+  +I EK+ + + + EE +K+Q  AR+H QR+  +
Sbjct  267   NNIIEVKYKDLEEMELKCSETTNSIKSVITEKEKIIQTYNEEIKKIQTSARDHFQRIFGD  326

Query  1220  QETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKA  1041
              E L  +LE +KK+L+S   E+ KR V  E E  KL EE ++N  +NSSL +AS EQ KA
Sbjct  327   HEKLKLQLETQKKELESRIEEMEKRAVANEDESRKLAEEIEKNSIKNSSLHLASMEQLKA  386

Query  1040  DENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAV  861
             + N+L+L E+ KR+KE    KI++L++ +D KQ LE+EI++L+G L+V+  MG D D  V
Sbjct  387   NANLLKLAEDQKRQKEQLHNKIIKLQQQLDTKQTLELEIEQLRGNLNVVRRMGDDGDVEV  446

Query  860   QEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSH  681
              +K+  M + L EK E ++DL+ +N  L++KER+SNDELQEAR+ LI GL ++  S  + 
Sbjct  447   LKKVDNMIKGLREKEESLEDLEALNQXLIVKERKSNDELQEARRELINGLKEI--SSSAQ  504

Query  680   IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE  501
             IG+RRMGE+D K F    K++++ EEA+ KA+ELCSLW E +KDP WHPF+V  +  + +
Sbjct  505   IGVRRMGELDSKPFQEALKRKYNEEEAEEKAMELCSLWVEYLKDPEWHPFKVTTVDGKHK  564

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
             ++I+ +DE+L  LK+E GEE+C AVI A+ E+NEYN SGRY+  ELWN+KEGR+A+LK+ 
Sbjct  565   EVISVEDEKLKDLKKELGEEVCNAVISALTEINEYNPSGRYITSELWNYKEGRRASLKDG  624

Query  320   VSFIFKQLKTHKRK  279
             V+FI  Q KT KR+
Sbjct  625   VAFILXQWKTXKRR  638



>ref|XP_007163408.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163409.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163410.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 ref|XP_007163411.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35402.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35403.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35404.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
 gb|ESW35405.1| hypothetical protein PHAVU_001G232400g [Phaseolus vulgaris]
Length=641

 Score =   436 bits (1122),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 257/625 (41%), Positives = 408/625 (65%), Gaps = 15/625 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I+EY++K YEEL+SG   +K P+    CP+C  K+K+DY YK+LLQHA+GVG+ S+  R 
Sbjct  17    ISEYEDKSYEELKSGSQNLKTPDETFTCPYCPKKRKRDYLYKELLQHASGVGQSSSQKRK  76

Query  1937  VKQKANHVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV-SKDN  1779
              + KANH+AL KYLE DL       + ++P+ +   +   N+ + WPW GIVVN+ ++  
Sbjct  77    ARDKANHLALVKYLENDLMNVDVPSNNSKPVDESDSSVNSNDQFVWPWVGIVVNIPTRRT  136

Query  1778  ANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENA  1608
              +G  V E    L+   R   +    V    + +  +   +++   +W G  NA+ FE A
Sbjct  137   EDGRCVGESGSRLRDEYRIRGFNPVRVNPLWNFRGHSGTALVEFNKNWPGLDNAMAFERA  196

Query  1607  FEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKR  1428
             +E + H KK+W +      S +YGW A+ DDY      G YLR+   +KTI++L++EE R
Sbjct  197   YELDHHGKKDWFS-NCGQKSGLYGWVARADDYNMNNIYGEYLRKMGDVKTISELMEEEAR  255

Query  1427  DKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAR  1248
              +DK++SNL N + +KN ++  +  R++E    ++  + EKD L +A+ EE +KM   AR
Sbjct  256   RQDKLVSNLNNIIQVKNNHIKEIKVRYDETTDKMNLAMMEKDKLSQAYNEEIQKMWSSAR  315

Query  1247  EHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLE  1068
             +H  ++  + E L  +LE +K +L+    +L KRE   E E+ KL EE + N  +NSSL+
Sbjct  316   DHCHKIFTDHEKLKMQLESQKNELELRKIQLEKREAHNESERKKLAEEIEENATKNSSLQ  375

Query  1067  MASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEH  888
             MA+ EQKK+DENV++L E+ KR+KE    KI++L+K +D KQ+LE+EIQ+LKG L V++H
Sbjct  376   MATLEQKKSDENVMKLAEDQKRQKEQLHAKIIQLQKQLDMKQELELEIQQLKGSLSVLKH  435

Query  887   MGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLS  708
             M  D+D  + +K+  +++ L +K + ++D++ +N  L++KER+SNDELQ+AR+ L+ G+ 
Sbjct  436   MEDDEDVEILKKVDNLQKDLRDKEQSLEDIESLNQTLIIKERKSNDELQDARQALVDGVK  495

Query  707   DLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFR  528
             +L + G  ++ ++RMGE+D + F    K++++ E+A+ +A ELCSLW+E +KDP+WHPF+
Sbjct  496   ELPSHG--NVRLKRMGELDSRPFLEAMKKKYNEEDAEERASELCSLWEEYLKDPDWHPFK  553

Query  527   VI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFK  351
             VI + + + ++II  DDE+L+ LKEE GE    AV++A+ E+NE+N SGRY+   LWN+K
Sbjct  554   VIMDANGKEKEIIKNDDEKLNGLKEELGEGAYKAVVEALSEINEHNPSGRYLTSVLWNYK  613

Query  350   EGRKATLKEVVSFIFKQLKTHKRKR  276
             +GR+ATLKE + F+    K  KRKR
Sbjct  614   QGRRATLKEGIQFLLNHWKVLKRKR  638



>ref|XP_008233634.1| PREDICTED: LOW QUALITY PROTEIN: CAP-Gly domain-containing linker 
protein 1 [Prunus mume]
Length=633

 Score =   435 bits (1119),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 266/618 (43%), Positives = 391/618 (63%), Gaps = 29/618 (5%)
 Frame = -1

Query  2081  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRSVKQKANHVALA  1905
             L++GK+ V+  +G   CPFC          K  LQHA+GV K  S  RS ++KA H ALA
Sbjct  31    LKNGKHNVRSSDGTYICPFCP--------KKSXLQHASGVEKSNSEKRSAEEKAKHSALA  82

Query  1904  KYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDNAN-GTAVEEE-  1752
             KYLE DL    E  P + V  ED  + C       WPWTG+VVN+    A+ G  V E  
Sbjct  83    KYLEKDLA--TEGGPSKPVGEEDPPVDCDHDEKLVWPWTGVVVNIPTRRADDGRYVGESG  140

Query  1751  ----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSK  1584
                 D  ++R   +    V    + +  +   V++ + DW GY NA+ FE A+EA+ H K
Sbjct  141   SKLRDDLIRR--GFNPTRVHPLWNFRGHSGSAVVEFRKDWPGYVNAMSFERAYEADRHGK  198

Query  1583  KEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSN  1404
             K+W A      S +Y W A+ +DY+A   VG +LR+   LKTI+++++EE R +DK++ N
Sbjct  199   KDWGA-NGDQKSGLYAWVARAEDYKATNIVGEHLRKIGDLKTISEIMEEEARKQDKLVFN  257

Query  1403  LTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLH  1224
             L N +  KN+++  +  + +E   S+  +I EK+ L + + E+ +K+Q  AR+H QR+  
Sbjct  258   LNNIIQGKNKDMEEMELKCSETTNSIESVITEKEKLVQGYNEDIKKIQMSARDHFQRIFS  317

Query  1223  EQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKK  1044
             + E L  +LE +K  L++   E+ KR V  E E  KL +E ++N  +NSSL++AS EQ K
Sbjct  318   DHEKLKLQLETQKIGLETRIEEMEKRAVANESESRKLADEIEKNSAKNSSLQLASMEQLK  377

Query  1043  ADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSA  864
             A+EN+L+L E+ KR+KE    KI++LEK +D KQ LE+EI++L+G L+V+  MG D D  
Sbjct  378   ANENLLKLAEDQKRQKEELHSKIIKLEKQLDTKQTLELEIEQLRGNLNVVRRMGDDGDVE  437

Query  863   VQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS  684
             V EK+  M + L EK E  +DL+ +N  L++KER+SNDELQEARK L+ GL ++  S R+
Sbjct  438   VLEKVDTMLKDLREKEETFEDLEALNQTLIVKERKSNDELQEARKELVNGLKEI--SNRA  495

Query  683   HIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRP  504
             HIG++RMGE+D K F    K++++ EEA+ KA ELCSLW+E +KDP+WHPFRV  +  + 
Sbjct  496   HIGVKRMGELDSKPFQEAMKRKYNEEEAEEKATELCSLWEEYLKDPDWHPFRVTTVDGQH  555

Query  503   EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKE  324
             ++ INE DE+L  LK++ G+E+  AV  A++E+NEYN SGRY+  ELWN+ EGR+A+L+E
Sbjct  556   KEFINEQDEKLKDLKKQLGDEVYNAVTSALKEINEYNPSGRYITSELWNYAEGRRASLQE  615

Query  323   VVSFIFKQLKTHKRKRHD  270
              V FI KQ K  K++  D
Sbjct  616   GVDFILKQWKIKKQRMED  633



>dbj|BAK05532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=601

 Score =   433 bits (1114),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 244/568 (43%), Positives = 376/568 (66%), Gaps = 16/568 (3%)
 Frame = -1

Query  1976  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVV  1797
             HATGVG  +  R   + A  + L            EP P   V   D++ + WPW G++V
Sbjct  49    HATGVGLATYRRGRDKAARQLQLIAM---------EPQP---VQNRDDH-FVWPWMGVLV  95

Query  1796  NVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAIL  1620
             NV  +  NG  V E    LK + S +  Q+V    + +  T   +++   DW  + NA+ 
Sbjct  96    NVPTELKNGRHVGESGNRLKEKLSCFCPQKVIPLWNYRGHTGNAIVEFGKDWTAFNNALA  155

Query  1619  FENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQ  1440
             FEN FE+E + K +W A R      ++GW A+ DD +  G +G YL +   LKTI D+  
Sbjct  156   FENHFESEGYGKLDWKAHRHRRPG-MFGWVARADDQKYPGPIGDYLHKNGDLKTIADVEN  214

Query  1439  EEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQ  1260
             EE R  +K+++NL +++++K  ++  L  ++NE   SL  ++E+KD L RA+ EE  KMQ
Sbjct  215   EEARKTNKLVANLASQIEVKRRHVEELEFKYNETTSSLDMIMEQKDQLLRAYNEEIHKMQ  274

Query  1259  RLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRN  1080
             +LAR H Q+++ E + L SELE K + LD  +++L++    +E E+  L+ EK++N  + 
Sbjct  275   QLARRHSQKIIDENQKLRSELESKMQDLDLRSKQLDELAARSESERRNLEHEKEKNGVKT  334

Query  1079  SSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLD  900
               L+MA+  Q+KADENVL+L+E+HK EK+ AL KI++LE+ +DAKQKLE+EI++L+GKL+
Sbjct  335   KHLKMATLVQQKADENVLKLVEKHKLEKQVALDKIIKLEQQLDAKQKLELEIKQLQGKLE  394

Query  899   VMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             +M+HM G++DS  +++I E+ E+L +K ++M  ++ + +AL++KER+SNDELQ+AR+ LI
Sbjct  395   IMKHMPGEEDSESKKRIDELSEELQDKYDEMDAMESLYHALLIKERKSNDELQDARRKLI  454

Query  719   QGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNW  540
              GL   + +GR++IGI+RMGE+D K+F   C ++ S E+A+V A  LCS W+ ++K+P W
Sbjct  455   DGLQ-TITTGRANIGIKRMGELDLKSFAIACGRKLSKEDAEVTAAILCSKWEAEIKNPEW  513

Query  539   HPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELW  360
             HPFRV+ ++ +  +++ ED+E+L  LKEE GEE+   V KA+ EVNEYN  GRY +PELW
Sbjct  514   HPFRVVMVNGKKRELVCEDNEKLQTLKEEHGEEVYGLVTKALVEVNEYNPRGRYAVPELW  573

Query  359   NFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             N+KEGRKATLKE + ++ KQ +THKRKR
Sbjct  574   NYKEGRKATLKEALQYVLKQWRTHKRKR  601



>ref|XP_009357740.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Pyrus 
x bretschneideri]
Length=642

 Score =   434 bits (1117),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 264/610 (43%), Positives = 397/610 (65%), Gaps = 14/610 (2%)
 Frame = -1

Query  2078  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQKANHVALAK  1902
             ++GKY V+  +G   CPFC  KKK+D+  K+LLQHA+GVGK +++ RS ++KA H+A+ K
Sbjct  32    KNGKYSVRSSDGRYTCPFCPSKKKRDFVLKELLQHASGVGKRTSDKRSTEEKAKHLAVVK  91

Query  1901  YLEIDLGDQAEPLPQRAVAP-----EDNNLYCWPWTGIVVNVSKDNAN-GTAVEEEDYWL  1740
             YLE DL  +  P    A  P     +D  L  WPWTG+VVN+    AN G  V E    L
Sbjct  92    YLEKDLAAEGGPSKHVAEEPPIDCDQDEKL-VWPWTGVVVNIPTRRANDGRYVGESGSKL  150

Query  1739  K---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTA  1569
             +   +   +    V    + +  +   V++ + DW GY NA+ FE A++ + H KK+W A
Sbjct  151   RDELKRRGFNPLRVHPLWNYRGHSGSAVVEFRKDWPGYVNAMSFEKAYDVDHHGKKDWEA  210

Query  1568  ERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNEL  1389
               S   S +Y W A+ DDY+A   VG +LR+   LK+I+++ +EE R +D++++NL N +
Sbjct  211   -NSDQKSGLYAWVARSDDYKASNIVGEHLRKIGDLKSISEITEEEARKQDRLVTNLNNII  269

Query  1388  DLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETL  1209
             ++K ++L  +  + +E   S+  +I EK+ + + + EE +K+Q  AR+H QR+  + E L
Sbjct  270   EVKYKDLEEMELKCSETTNSIKSVITEKEKIVQTYNEEIKKIQTSARDHFQRIFGDHEKL  329

Query  1208  NSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENV  1029
               +LE +KK+L+S   E+ KR V  E E  KL EE ++N  +NSSL +AS EQ KA+ N+
Sbjct  330   KLQLETQKKELESRIEEMEKRAVANEDESRKLAEEIEKNSIKNSSLHLASMEQLKANANL  389

Query  1028  LRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKI  849
             L+L E+ KR+KE    KI++L++ +D KQ LE+EI++L+  L+V+  MG D D  V +K+
Sbjct  390   LKLAEDQKRQKEQLHNKIIKLQQQLDTKQTLELEIEQLRVNLNVVRRMGDDGDVEVLKKV  449

Query  848   KEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIR  669
               M + L EK E + DL+ +N  L++KER+SNDELQEAR+ LI GL ++  S  +HIG+R
Sbjct  450   DNMIKGLREKEESLDDLEALNQTLIVKERKSNDELQEARRELINGLKEI--SSSAHIGVR  507

Query  668   RMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIIN  489
             RMGE+D K F    K++++ EEA+ KA ELCSLW+E +KDP WHPF+V  +  + +++I+
Sbjct  508   RMGELDSKPFQEAMKRKYNEEEAEEKATELCSLWEEYLKDPEWHPFKVTTVDGKHKEVIS  567

Query  488   eddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFI  309
              +DE+L  L +E GEE+  AV  A+ E+NEYN SGRY+  ELWN+KEGR+A+LKE V+FI
Sbjct  568   VEDEKLKDLMKELGEEVYNAVTSALTEINEYNPSGRYITSELWNYKEGRRASLKEGVTFI  627

Query  308   FKQLKTHKRK  279
               Q KT KR+
Sbjct  628   LNQWKTKKRR  637



>ref|XP_008371804.1| PREDICTED: WEB family protein At4g27595, chloroplastic [Malus 
domestica]
Length=642

 Score =   432 bits (1111),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 264/611 (43%), Positives = 397/611 (65%), Gaps = 16/611 (3%)
 Frame = -1

Query  2078  RSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQKANHVALAK  1902
             ++GK+ V+  +G   CPFC  KKK+D+  K+LLQHA+GVGK +++ RS ++KA H+A+ K
Sbjct  32    KNGKHSVRSSDGRYTCPFCPSKKKRDFVLKELLQHASGVGKSTSDKRSTEEKAKHLAVVK  91

Query  1901  YLEIDLGDQAEPLPQRAVAPE------DNNLYCWPWTGIVVNVSKDNAN-GTAVEEEDYW  1743
             YLE DL   AE  P + VA E       +    WPWTG+VVN+    AN G  V E    
Sbjct  92    YLEKDLA--AEGGPSKTVAEEPPIDCDQDEKLVWPWTGVVVNIPTRRANDGRFVGESGSK  149

Query  1742  LK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWT  1572
             L+   +   +    V    + +  +   +++ + DW GY NA+ FE A++ + H KK+W 
Sbjct  150   LRDELKRRGFNPLRVHPLWNYRGHSGSAIVEFRKDWPGYVNAMSFEKAYDVDHHGKKDWE  209

Query  1571  AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNE  1392
             A  S   S +Y W A+ DDY+A   VG +LR+   LK+I+++ +EE R +D++++NL N 
Sbjct  210   A-NSDQKSGLYAWVARSDDYKASNIVGEHLRKIGDLKSISEITEEEARKQDRLVTNLNNI  268

Query  1391  LDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQET  1212
             +++K ++L  +  + +E   S+  +I EK+ + + + EE +K+Q  AR+H QR+  + E 
Sbjct  269   IEVKYKDLEEMELKCSETTNSIKSVITEKEKIVQTYNEEIKKIQTSARDHFQRIFGDHEK  328

Query  1211  LNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADEN  1032
             L  +LE +KK L+S   E+ KR V  E E  KL EE ++N  +NSSL +AS EQ KA+ N
Sbjct  329   LKLQLETQKKDLESRIEEMEKRAVANEDESRKLAEEIEKNSIKNSSLHLASMEQLKANAN  388

Query  1031  VLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEK  852
             +L+L E+ KR+KE    KI++L++ +D KQ LE+EI++L+  L+V+  MG D D  V +K
Sbjct  389   LLKLAEDQKRQKEQLHNKIIKLQQQLDTKQTLELEIEQLRVNLNVVRRMGDDGDVEVLKK  448

Query  851   IKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGI  672
             +  M + L EK E + DL+ +N  L++KER+SNDELQEAR+ LI GL ++  S  +HIG+
Sbjct  449   VDNMIKGLREKEESLDDLEALNQTLIVKERKSNDELQEARRELINGLKEI--SSSAHIGV  506

Query  671   RRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQII  492
             RRMGE+D K F    K++++ EEA+ KA ELCSLW+E +KDP WHPF+V  +  + +++I
Sbjct  507   RRMGELDSKPFQEAMKRKYNEEEAEEKATELCSLWEEYLKDPEWHPFKVTTVDGKHKEVI  566

Query  491   NeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSF  312
             + +DE+L  LK+E GEE+  AV  A+ E+NEYN SGRY+  ELWN+KEGR+A+LKE V F
Sbjct  567   SVEDEKLKDLKKELGEEVSNAVTSALTEINEYNPSGRYITSELWNYKEGRRASLKEGVVF  626

Query  311   IFKQLKTHKRK  279
             I  Q KT KR+
Sbjct  627   ILNQWKTKKRR  637



>dbj|BAH20228.1| AT1G80790 [Arabidopsis thaliana]
Length=552

 Score =   428 bits (1101),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 255/553 (46%), Positives = 383/553 (69%), Gaps = 10/553 (2%)
 Frame = -1

Query  1910  LAKYLEIDL-GDQAEPLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGTAVEEE  1752
             LAKY+E +L GD   P PQ   +  +      +++Y WPW GIV+N  +   N   + + 
Sbjct  1     LAKYMENELAGDADVPRPQIPSSSTEQSQAVVDDIYVWPWMGIVINPVRRTDNKNVLLDS  60

Query  1751  DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWT  1572
              YWLK+ +++   EVK    D+     V+ +  S W+G+K+    E  +E     +K+W 
Sbjct  61    AYWLKKLARFNPLEVKTLWLDQESVVAVIPQFNSGWSGFKSVTELEKEYEIRGCGRKDWI  120

Query  1571  AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNE  1392
              +R    S  YGW A+ DDY ++G++  YL +  +L++ +D+ +EE ++K  ++ +L N+
Sbjct  121   DKRGDWRSKAYGWCARADDYNSQGSIAEYLSKVGKLRSFSDITKEEIQNKSIVVDDLANK  180

Query  1391  LDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQET  1212
             +   NE+L+ L    NEK LSL R++ EKD L R + +E++KMQ L+RE + R+  E+E 
Sbjct  181   IATTNEDLNKLQYMNNEKTLSLRRVLIEKDELDRVYKQETKKMQELSREKINRIFREKER  240

Query  1211  LNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADEN  1032
             L +ELE K   L  W+++L+K++ LTE E+ KLDE+KK++D  NSSL++AS EQKK D+ 
Sbjct  241   LTNELEAKMNNLKIWSKQLDKKQALTELERQKLDEDKKKSDVMNSSLQLASLEQKKTDDR  300

Query  1031  VLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEK  852
             VLRL++EHKR+KE  L KIL+LEK++D+KQKL+MEIQELKGKL VM+H   +DD  +++K
Sbjct  301   VLRLVDEHKRKKEETLNKILQLEKELDSKQKLQMEIQELKGKLKVMKH-EDEDDEGIKKK  359

Query  851   IKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGI  672
             +K+MKE+L+EK  +++DL++ N+AL++KER+SNDE+ EARK LI  L +L+ S R+ I +
Sbjct  360   MKKMKEELEEKCSELQDLEDTNSALMVKERKSNDEIVEARKFLITELRELV-SDRNIIRV  418

Query  671   RRMGEIDGKAFHNVCKQRFST-EEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQI  495
             +RMGE++ K F   C+QR +  EEA V+   LCS WQEKVKD  W PF+ +   DR +++
Sbjct  419   KRMGELEEKPFMTACRQRCTVEEEAQVQYAMLCSKWQEKVKDSAWQPFKHVGTGDRKKEV  478

Query  494   INeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVS  315
             ++E+DEE+ KL+EEWGEE+  AV  A+EE+NE+N SGRY +PELWN K+GRKATLKEV+ 
Sbjct  479   VDEEDEEIKKLREEWGEEVKNAVKTALEELNEFNPSGRYSVPELWNSKQGRKATLKEVID  538

Query  314   FIFKQLKTHKRKR  276
             +I +Q+KT KR+R
Sbjct  539   YITQQVKTLKRRR  551



>gb|EMS50669.1| hypothetical protein TRIUR3_29122 [Triticum urartu]
Length=528

 Score =   426 bits (1096),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 357/521 (69%), Gaps = 3/521 (1%)
 Frame = -1

Query  1835  NNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIK  1659
             ++L+ WPW G++VNV  +  NG  V E    LK + S +  Q+V    + +  T   +++
Sbjct  10    DDLFVWPWMGVLVNVPTERKNGRHVGESGNRLKEKLSCFCPQKVIPLWNYRGHTGNAIVE  69

Query  1658  LKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLR  1479
                DW  + NA+ FEN FE+E + K +W A +      ++GW A+ DD +  G +G YL 
Sbjct  70    FGKDWTAFNNALAFENHFESEGYGKLDWKAYKHRRPG-MFGWVARADDQKYPGPIGDYLH  128

Query  1478  ETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDT  1299
             +   LKTI D+  EE R  +K+++NL +++++K  ++  L  ++NE   SL  ++E+KD 
Sbjct  129   KNGDLKTIADVENEEARKTNKLVANLASQIEVKRRHVEELECKYNETTTSLDMIMEQKDQ  188

Query  1298  LHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTerekl  1119
             L RA+ EE  KMQ+LAR H QR++ E + L SELE K + LD  +++L++    +E ++ 
Sbjct  189   LLRAYNEEIHKMQQLARRHSQRIIDENQKLRSELESKMQNLDLRSKQLDELVARSESDRR  248

Query  1118  kldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQK  939
              L+ EK++N  +   L+MA+  Q+KADENVL+L+E+HK EK+ AL KI++LE  +DAKQK
Sbjct  249   NLEHEKEKNGVKTKHLKMATLVQQKADENVLKLVEKHKLEKQVALDKIIKLEHQLDAKQK  308

Query  938   LEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQ  759
             LE+EI++L+GKL+VM+HM G++DS  +++I E+ E+L +K ++M  ++ + + L++KER+
Sbjct  309   LELEIKQLQGKLEVMKHMPGEEDSESKKRIDELSEELQDKYDEMDAMESLYHTLLIKERK  368

Query  758   SNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALEL  579
             SNDELQ+ARK LI GL   + +GR++IGI+RMGE+D K+    C ++ S E+A+V A  L
Sbjct  369   SNDELQDARKKLIDGLQ-TITTGRANIGIKRMGELDLKSLAIACGRKLSKEDAEVTAAIL  427

Query  578   CSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNE  399
             CS W+  +K P WHPFRV+ ++ +  ++I+EDD +L  L+EE+GEE+ + V KA+ EVNE
Sbjct  428   CSKWEADIKKPEWHPFRVVMVNGKKRELISEDDAKLQTLREEYGEEVYSLVTKALLEVNE  487

Query  398   YNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             YN  GRY +PELWN+KEGRKATLKE + ++ KQ +THKRKR
Sbjct  488   YNPRGRYPVPELWNYKEGRKATLKEALQYVLKQWRTHKRKR  528



>ref|XP_006300858.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 ref|XP_006300859.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33756.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
 gb|EOA33757.1| hypothetical protein CARUB_v10019950mg [Capsella rubella]
Length=568

 Score =   427 bits (1097),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 246/540 (46%), Positives = 366/540 (68%), Gaps = 10/540 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y +KPYE +++G YKVK  +   RCPFC+GKKKQ YKYK+LL HA+GV KGSA+RS KQK
Sbjct  19    YSDKPYELIKNGHYKVKVKD-TFRCPFCSGKKKQHYKYKELLAHASGVAKGSASRSAKQK  77

Query  1925  ANHVALAKYLEIDLGDQAE-PLPQRAVAPED------NNLYCWPWTGIVVNVSKDNANGT  1767
             ANH ALAKY++ +L   A+ P PQ   +         +++Y WPW GIV+N  +   N  
Sbjct  78    ANHFALAKYMQNELAADADVPRPQIPSSSSKQGQAVVDDIYVWPWMGIVINPVRRTDNNK  137

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
              + +  YWLK+ +++   EVK    ++     V        +G+K+A   E  +E     
Sbjct  138   LLLDSAYWLKKLARFNPLEVKTLWLEQESVVAVFPLFSRGMSGFKSATELEKEYEIRGCG  197

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             KK W  ++   +S  YGW A+ DDY ++G++  YL +  +LK+ +D+ +EE  +K+ ++ 
Sbjct  198   KKNWRDKKGDWTSKAYGWCARADDYNSQGSIAEYLSKVGKLKSFSDICKEEIHNKNSLVD  257

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
             +L N++D+ NE L+ +  + NEK +SL R+++EKD L R + EE+++MQ  +R+++ R+ 
Sbjct  258   DLANKIDMTNEYLNKVQYKCNEKAISLRRVLKEKDELDRVYKEETKRMQEFSRDNINRIF  317

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              E+E L++ELE K   L  W+++L+K++ LTE E+ KLDE+KK++D  NSSL++AS+EQK
Sbjct  318   REKERLSNELEAKMNALKIWSKQLDKKQALTELERQKLDEDKKKSDVMNSSLQLASQEQK  377

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             K D+ VL L+EEHKR+KE  L KIL+LEK++D KQKL+MEIQELKGKL VM+H   +DD 
Sbjct  378   KTDDRVLTLVEEHKRKKEETLNKILQLEKELDGKQKLQMEIQELKGKLQVMKH-EDEDDE  436

Query  866   AVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGR  687
              V++K+KEMKEQL++K  +++DL+E N+AL++KERQSNDE+QEAR  L+      L S R
Sbjct  437   DVKQKMKEMKEQLEDKCSELEDLEETNSALMIKERQSNDEIQEAR-ALLTTELRELLSER  495

Query  686   SHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDR  507
             + I ++R+GE++ K F   CKQRF+ EEA V+   LCS WQE +KD  W PF+ +   D+
Sbjct  496   TTIRVKRVGELNEKPFMKACKQRFTGEEAAVQYAILCSKWQENLKDSAWQPFKHVGTGDK  555



>ref|XP_004307495.1| PREDICTED: uncharacterized protein LOC101306757 [Fragaria vesca 
subsp. vesca]
Length=647

 Score =   429 bits (1104),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 263/626 (42%), Positives = 410/626 (65%), Gaps = 21/626 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++E  E+   EL++GK++VKG +G   CPFC  K+K+D+  KDLLQHA+GVGK +++ RS
Sbjct  21    LDEEVEQYLGELKNGKHRVKGADGVFMCPFCQRKRKRDFNLKDLLQHASGVGKSNSDKRS  80

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  1779
               +KA H+AL+KYLE DL   AE  P +  A ++  + C       WPW G+V N+    
Sbjct  81    TDEKAKHLALSKYLENDL--IAEGGPSKPAAEDEPPVDCDHDEKLVWPWIGVVANIPTTR  138

Query  1778  A-NGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             A +G  V E      D +++R   Y    V    + +  +   V++ K DW GY NA+ F
Sbjct  139   AKDGRFVGESGSKLRDEYIRR--GYNPTRVIPLWNFRGHSGNAVVEFKKDWPGYANAMAF  196

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A EA+ H KK+W A+     S +Y W A+ DDY+A   VG +LR+   LK+I+++++E
Sbjct  197   ERAHEADRHGKKDWFAD-GDHKSGLYAWVARSDDYKANNIVGEHLRKIGDLKSISEIMEE  255

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             + R +D ++SNLT+ +++KN++L  +  + NE   ++  +I EKD L + + E+ +K+Q 
Sbjct  256   DARKQDSLVSNLTSIIEVKNKDLEEMELKCNETTNAIKNVITEKDKLIQTYNEDIKKIQV  315

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              A++H +R+ ++ + L  +LE +KK+L+S   ++ KR V  E E  KL EE ++N  +NS
Sbjct  316   SAQDHFKRIFNDHQKLKLQLESQKKELESRIEQMEKRAVDNESESRKLAEELEKNSVKNS  375

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL++A+ EQ KA++ +L+L E+ KREKE   +KI++LEKD+D KQ LE++I++L+G ++V
Sbjct  376   SLQLAAAEQVKANDKLLKLAEDQKREKEELHKKIIKLEKDLDTKQALELQIEQLRGNVNV  435

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             +  MG D D+ V EK+ +M + L EK  +++DL+ +N  L++KER+SNDELQEARK LI 
Sbjct  436   VRSMGDDGDAEVLEKVDKMLKGLSEKENELEDLEALNQTLIVKERKSNDELQEARKELIN  495

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQ--RFSTEEADVKALELCSLWQEKVKDPN  543
             GL ++  S ++ +GI+RMGE+D K F    ++  +++ EEA+ KA ELC LW+E +K P 
Sbjct  496   GLKEIDMSSKAQLGIKRMGELDSKPFQEAMRRKYKYNVEEAEDKATELCCLWEEYLKQPE  555

Query  542   WHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  363
             WHPF+V+    + ++II+EDDE L +LK E G++   AV  A+ E+N+YN SG Y+  EL
Sbjct  556   WHPFKVVEGIGKAKEIIDEDDERLKRLKNELGDDAYNAVTSALMEINQYNPSGSYITSEL  615

Query  362   WNFKEGRKATLKEVVSFIFKQLKTHK  285
             W++  GRKATLKE  +FI K LK  K
Sbjct  616   WHYGLGRKATLKEGAAFILKILKQKK  641



>ref|XP_009799105.1| PREDICTED: golgin candidate 4 [Nicotiana sylvestris]
 ref|XP_009799106.1| PREDICTED: golgin candidate 4 [Nicotiana sylvestris]
Length=639

 Score =   428 bits (1101),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 254/610 (42%), Positives = 401/610 (66%), Gaps = 20/610 (3%)
 Frame = -1

Query  2084  ELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQKANHVAL  1908
             +L+ G + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG G++N R+ + KANH+AL
Sbjct  26    DLKRGNHSLKISDVAYTCPYCPKKRKRDFGYKELVQHASGVGSGNSNKRTARDKANHLAL  85

Query  1907  AKYLEIDL---GDQ--------AEPLPQR-AVAPEDNN-LYCWPWTGIVVNVSKDNANGT  1767
             AKYLE D+   GD         A+P PQ   +A  D + ++ WPW GIVVN+  +  +G 
Sbjct  86    AKYLENDVVVAGDSSNDSSKPDAKPDPQADPLADHDRDEMFVWPWIGIVVNILTEYKDGR  145

Query  1766  AVEEEDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ FE A+EA+
Sbjct  146   YVGESGSKLRDQLARRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMSFEKAYEAD  205

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H K+EW A      S +Y W A+ DDY+A   VG  LR+   L+TI+D+++EE R  +K
Sbjct  206   HHGKREWKA-NIGKKSDLYAWIARADDYKALNIVGENLRKVGDLRTISDIMEEEARKTNK  264

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++SNLTN +++K  +L  +  +F E   SL +++EEKD LH+A+ EE RK+Q  AR+H Q
Sbjct  265   LVSNLTNVIEVKKLHLKEMENKFKETAQSLQQLVEEKDKLHQAYNEEIRKIQSSARDHFQ  324

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
             ++ ++ E L  +LE +KK+L+   REL +RE   E ++ KL EE ++N   N+SL  A++
Sbjct  325   KIFNDHEKLKLQLESQKKELELRGRELEQREAKNESDRKKLSEELEQNAVLNTSLSAAAE  384

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+K DE VL+L EE KR+KE   ++I+ LEK +DAKQ +E+EI++L+G L VM+H+  +
Sbjct  385   EQRKVDEKVLKLAEEQKRQKEDLHKRIIHLEKQLDAKQAVELEIEQLRGSLKVMKHIEDE  444

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              D  V +K+  + + L EK E+ + L+ +N  L++KER SNDELQ+ARK L+ GL +L  
Sbjct  445   GDQEVLKKVDTLLKSLREKEEEYEGLEALNQTLIVKERNSNDELQDARKELVNGLKELPR  504

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
              G   IG++RMGE+D + FH   K++++  EAD +A ELCSLW+E ++DP WHP +V+ +
Sbjct  505   VG--PIGVKRMGELDNRPFHEAMKRKYNESEADERATELCSLWEEYLRDPGWHPIKVVTV  562

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
             + + E +I+++DE+L  LK  +GE++  AV  A+ E+N+YN SGRY+I ELWN+   +KA
Sbjct  563   NGKLENVIDDEDEKLKDLKRNYGEDVYKAVTAALIEINDYNPSGRYIISELWNYAVNQKA  622

Query  335   TLKEVVSFIF  306
             TL+E V+ + 
Sbjct  623   TLEEGVTVLL  632



>emb|CDM83432.1| unnamed protein product [Triticum aestivum]
Length=528

 Score =   424 bits (1089),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 230/521 (44%), Positives = 359/521 (69%), Gaps = 3/521 (1%)
 Frame = -1

Query  1835  NNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIK  1659
             ++L+ WPW G++VNV  +  NG  V E    LK + S +  Q+V    + +  T   +++
Sbjct  10    DDLFVWPWMGVLVNVPTEWKNGCHVGESGNRLKEKLSCFCPQKVIPLWNYRGHTGNAIVE  69

Query  1658  LKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLR  1479
                DW  + NA+ FEN FE+E + K +W A +      ++GW A+ DD +  G +G YL 
Sbjct  70    FGKDWTAFNNALAFENHFESEGYGKLDWKAYKHRRPG-MFGWVARADDQKYPGPIGDYLH  128

Query  1478  ETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDT  1299
             +   LKTI D+  EE R  +K+++NL +++++K  ++  L  ++NE   SL  ++E+KD 
Sbjct  129   KNGDLKTIADVENEEARKTNKLVANLASQIEVKRRHVEELECKYNETTTSLDMIMEQKDQ  188

Query  1298  LHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTerekl  1119
             L  A+ EE  KMQ+LAR H QR++ E + L SELE K + LD  +++L++    +E E+ 
Sbjct  189   LLWAYNEEIHKMQQLARRHSQRIIDENQKLRSELESKMQNLDLRSKQLDELVARSESERR  248

Query  1118  kldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQK  939
              L+ EK++N  +   L+MA+  Q++ADENVL+L+E+HK EK+ AL KI++LE+ +DAKQK
Sbjct  249   NLEHEKEKNGVKTKHLKMATLVQQRADENVLKLVEKHKLEKQVALDKIIKLEQQLDAKQK  308

Query  938   LEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQ  759
             LE+EI++L+GKL+VM+HM G++DS  +++I E+ E+L +K ++M  ++ + + L+ KER+
Sbjct  309   LELEIKQLQGKLEVMKHMPGEEDSESKKRIDELSEELQDKYDEMDAMESLYHTLLTKERK  368

Query  758   SNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALEL  579
             SNDELQ+ARK LI GL  +  +GR++IGI+RMGE+D K+   VC ++FS E+A+V A  L
Sbjct  369   SNDELQDARKKLIDGLQTI-TTGRANIGIKRMGELDLKSLAIVCGRKFSKEDAEVTAAIL  427

Query  578   CSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNE  399
             CS W+  ++ P WHPFRV+ ++ + +++I+EDD +L  L+EE+GEE+ + V KA+ EVNE
Sbjct  428   CSKWEADIRKPEWHPFRVVMVNGKKKELISEDDAKLQALREEYGEEVYSLVTKALLEVNE  487

Query  398   YNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             YN  GRY +PELWN+KEGRKATLKE + ++ KQ +THKRKR
Sbjct  488   YNPRGRYAVPELWNYKEGRKATLKEALQYVLKQWRTHKRKR  528



>ref|XP_009589398.1| PREDICTED: golgin candidate 4 [Nicotiana tomentosiformis]
 ref|XP_009589399.1| PREDICTED: golgin candidate 4 [Nicotiana tomentosiformis]
Length=638

 Score =   427 bits (1098),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 254/606 (42%), Positives = 401/606 (66%), Gaps = 16/606 (3%)
 Frame = -1

Query  2084  ELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQKANHVAL  1908
             +L+ G + +K  +    CP+C  K+K+D+ YK+L+QHA+GVG  ++N R+ + KANH+AL
Sbjct  26    DLKRGNHSLKISDVAYTCPYCPKKRKRDFGYKELVQHASGVGSCNSNKRTARDKANHLAL  85

Query  1907  AKYLEIDL---GDQ----AEPLPQR-AVAPEDNN-LYCWPWTGIVVNVSKDNANGTAVEE  1755
             AKYLE D+   GD     A+P PQ   +A  D + ++ WPW GIVVN+  +  +G  V E
Sbjct  86    AKYLENDVAVAGDSSKPDAKPDPQADPLADHDRDEMFVWPWIGIVVNILTEYKDGRYVGE  145

Query  1754  EDYWLK-RFSK--YEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSK  1584
                 L+ + ++  +    V+   + +  +   +++   DW+G+ NA+ FE A+EA+ H K
Sbjct  146   SGSKLRDQLARRGFNPTRVRPLWNYQGHSGTALVEFNKDWSGFGNAMSFEKAYEADHHGK  205

Query  1583  KEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSN  1404
             +EW A      S +Y W A+ DDY+A   VG  LR+   L+TI+D++ EE R  +K++SN
Sbjct  206   REWKA-NIGKKSDLYAWIARADDYKALNIVGENLRKVGDLRTISDIMDEEARKTNKLVSN  264

Query  1403  LTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLH  1224
             LTN +++K  +L  +  +F E   SL +++EEKD LH+A+ EE RK+Q  AR+H Q++ +
Sbjct  265   LTNVIEVKKLHLKEMENKFKETAQSLQQLVEEKDKLHQAYNEEIRKIQSSARDHFQKIFN  324

Query  1223  EQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKK  1044
             + E L  +LE +KK+L+   REL +RE   E ++ KL EE ++N   N+SL  A++EQ+K
Sbjct  325   DHEKLKLQLESQKKELELRGRELEQREAKNESDRKKLSEELEQNAVLNTSLSAAAEEQRK  384

Query  1043  ADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSA  864
              DE VL+L EE KR+KE   ++I+ LEK +DAKQ +E+EI++L+G L+VM+H+  + D  
Sbjct  385   VDEKVLKLAEEQKRQKEDLHKRIIHLEKQLDAKQAVELEIEQLRGSLNVMKHIEDEGDQE  444

Query  863   VQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS  684
             V +K+  + + L EK E+ + L+ +N  L++KER SNDELQ+ARK L+ GL +L   G  
Sbjct  445   VLKKVDTLLKSLREKEEEYEGLEALNQTLIVKERNSNDELQDARKELVNGLKELPRVG--  502

Query  683   HIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRP  504
              IG++RMGE+D + FH   K++++  EAD +A ELCSLW+E ++DP WHP +V+ ++ + 
Sbjct  503   PIGVKRMGELDNRPFHEAMKRKYNESEADERATELCSLWEEYLRDPGWHPIKVVTVNGKL  562

Query  503   EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKE  324
             E +I+++DE+L  LK+ +GEE+  AV  A+ E+N+YN SGRY+I ELWN+   +KATL+E
Sbjct  563   ENVIDDEDEKLKDLKKNYGEEVYKAVTAALMEINDYNPSGRYIISELWNYAVNQKATLEE  622

Query  323   VVSFIF  306
              V+ + 
Sbjct  623   GVTVLL  628



>gb|EMT32524.1| hypothetical protein F775_28173 [Aegilops tauschii]
Length=528

 Score =   423 bits (1087),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 229/521 (44%), Positives = 357/521 (69%), Gaps = 3/521 (1%)
 Frame = -1

Query  1835  NNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIK  1659
             ++L+ WPW G++VNV  +  NG  V E    LK + S +  Q+V    + +  T   +++
Sbjct  10    DDLFVWPWMGVLVNVPTEWKNGRHVGESGNRLKEKLSCFCPQKVIPLWNYRGHTGNAIVE  69

Query  1658  LKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLR  1479
                DW  + NA+ FEN FE+E + K +W A +      ++GW A+ DD +  G +G YL 
Sbjct  70    FGKDWTAFNNALAFENHFESEGYGKLDWKAYKHRRPG-MFGWVARSDDQKYPGPIGDYLH  128

Query  1478  ETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDT  1299
             +   LKTI D+  EE R  +K+++NL +++++K  ++  L  ++NE   SL  ++E+KD 
Sbjct  129   KNGDLKTIADVENEEARKTNKLVANLASQIEVKRRHVEELECKYNETTTSLDMIMEQKDQ  188

Query  1298  LHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTerekl  1119
             L RA+ EE  KMQ+LAR H QR++ E + L SELE K + LD  +++L++    +E ++ 
Sbjct  189   LLRAYNEEIHKMQQLARRHSQRIIDENQKLRSELESKMQNLDLRSKQLDELVARSESDRR  248

Query  1118  kldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQK  939
              L+ EK++N  +   L+MA+  Q++ADENVL+L+E+HK EK+ AL KI++LE+ +DAKQK
Sbjct  249   NLEHEKEKNGVKTKHLKMATLVQQRADENVLKLVEKHKLEKQVALDKIIKLEQQLDAKQK  308

Query  938   LEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQ  759
             LE+EI++L+GKL+VM+HM G++DS  +++I E+ E+L +K ++M  ++ + + L++KER+
Sbjct  309   LELEIKQLQGKLEVMKHMPGEEDSESKKRIDELSEELQDKYDEMDAMESLYHTLLIKERK  368

Query  758   SNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALEL  579
             SNDELQ+ARK LI GL   + +GR++IGI+RMGE+D K+    C ++ S E+A+V A  L
Sbjct  369   SNDELQDARKKLIDGLQ-TITTGRANIGIKRMGELDLKSLAIACGRKLSKEDAEVTAAIL  427

Query  578   CSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNE  399
             CS W+  +K P WHPFRV+ ++ +  ++I+EDD +L  L+EE+GEE+ + V KA+ EVNE
Sbjct  428   CSKWEADIKKPEWHPFRVVMVNGKKRELISEDDAKLQTLREEYGEEVYSLVTKALLEVNE  487

Query  398   YNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             YN  GRY +PELWN+KEGRKATLKE +  + KQ +THKRKR
Sbjct  488   YNPHGRYAVPELWNYKEGRKATLKEALQHVLKQWRTHKRKR  528



>ref|XP_010940184.1| PREDICTED: factor of DNA methylation 1-like [Elaeis guineensis]
Length=984

 Score =   437 bits (1123),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 280/645 (43%), Positives = 405/645 (63%), Gaps = 50/645 (8%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y+EK +  L++ K KVK      RCPFC GKKKQDY+Y++LLQHATGVG  ++NR  
Sbjct  359   IDDYREKSFWRLKTQKLKVKYSENNYRCPFCVGKKKQDYQYEELLQHATGVG--ASNRGG  416

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQ----------RAVAPEDNNLYCWPWTGIVVNVSK  1785
             K+KANH ALAK+L   +      +P+          +   P+   L+ WPW G++VN+  
Sbjct  417   KEKANHQALAKFLHELVNGAGSSVPKLNTRQQQQLQQPPQPDQPELFVWPWMGVLVNIQT  476

Query  1784  DNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENA  1608
             +  NG    E    LK RFS +   +V +    K  +   ++    DWNG+K+A+  E  
Sbjct  477   EWRNGMHAGESGARLKERFSGFNVVKVHVLWGQKGHSGCAILGFNKDWNGFKDAMSLEAH  536

Query  1607  FEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKR  1428
             F+A    K EW   R   S  +YGW A+ DDY   G +G YLR+   LKT  D++ EE R
Sbjct  537   FKAWRLGKNEWNETRYLRSC-MYGWIARADDYRCGGKIGEYLRKHGDLKTCADIMNEESR  595

Query  1427  DKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEE---------  1275
               + ++ NL NE+  KN  L    T++NE N +L++++E++D L    Y+          
Sbjct  596   KTNALVENLANEIYEKNYCLMEWQTKYNETNFALNKVMEDRDRLQNEHYKVGQILVSILM  655

Query  1274  --------SRKMQRLA---REHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTer  1128
                     S ++QRL    R+H+ RV  E         K++ QLDS  R+L K  V TE 
Sbjct  656   SYSKMMVFSSELQRLETDRRDHLHRVFEE-------YAKRRSQLDSERRKLEKLVVATEM  708

Query  1127  eklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDA  948
             E+  L+ EK++N        +A++ Q K DEN L+L+E+ KREKE AL KIL+LEK +DA
Sbjct  709   ERENLEREKEKN-------RLATEMQMKVDENCLKLVEQQKREKETALIKILDLEKQLDA  761

Query  947   KQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLK  768
             KQ+LE+E+++LKGKL+VM  MG ++D  +++K+++M E+LDEK ++++ L +++ AL +K
Sbjct  762   KQQLELEVEQLKGKLEVMSQMG-EEDLQLKKKLEKMTEELDEKRDELEGLTDVSTALAVK  820

Query  767   ERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKA  588
             ERQ+NDELQ ARK LI GL ++  SG + IGI+RMGE+D K F N  K +F + EAD+KA
Sbjct  821   ERQTNDELQRARKALITGLKEM-QSGSTLIGIKRMGELDYKPFRNAFKGKFLSIEADIKA  879

Query  587   LELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEE  408
              ELC+ WQ+++++ +WHPF+VI I +  +Q+INEDDE+L  LK + G+E+  AV  A+ E
Sbjct  880   AELCTFWQQELQNSDWHPFKVIQIGEDYKQVINEDDEKLRDLKGQLGDEVYKAVTAALNE  939

Query  407   VNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKRH  273
             + EYNASG Y I ELWNFKEGRKA+L EV+ +IFKQ  T+KRKR 
Sbjct  940   LLEYNASGNYCISELWNFKEGRKASLGEVIQYIFKQWNTNKRKRQ  984



>gb|AAV69067.1| X1, partial [Zea mays subsp. mexicana]
Length=550

 Score =   423 bits (1088),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 247/555 (45%), Positives = 364/555 (66%), Gaps = 12/555 (2%)
 Frame = -1

Query  1919  HVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVE  1758
             H AL KYL+  L      G  A P+  + +   D   + WPW G++VNV  +  +G  + 
Sbjct  1     HRALFKYLKNGLAKSPEPGSHATPVEPQPLQNRDEK-FVWPWMGVLVNVPTEWKDGRQIG  59

Query  1757  EEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKK  1581
             E    LK + S +    V      +  T   +++   DWNG++NA  FE+ F A    KK
Sbjct  60    ESGNRLKEQLSHFCPLRVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAAGGFGKK  119

Query  1580  EWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNL  1401
             +W  +++   S +YGW A+ +DY + G +  +LR+   LK++ DL +E  R  D++++NL
Sbjct  120   DWIGKKNQ-GSELYGWLARAEDYNSPGIIADHLRKNGDLKSVNDLAKEGARKNDRLVANL  178

Query  1400  TNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHE  1221
              N++++KN  L  L  +++E   SL +M+ +++ L +++ EE  KMQ+LAR H Q+++ E
Sbjct  179   ANQIEVKNRYLQELECKYSETTASLEKMMGQREQLLQSYNEEISKMQQLARRHSQKIIDE  238

Query  1220  QETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKA  1041
              + L S+LE K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ EQ+KA
Sbjct  239   NQKLRSDLEAKMNDLDVRSKQLDEIAAKSDYDRRSLEQEKQKNAIKSSHLKLATLEQQKA  298

Query  1040  DENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAV  861
             DENVL+L+EE KREK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD+DSA 
Sbjct  299   DENVLKLVEEQKREKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGDEDSAS  358

Query  860   QEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSH  681
             + KI E+ E L EKI+++  ++ +N  LV+KE +SN ELQEARK L  GL D L+ G++H
Sbjct  359   KNKINELSEALQEKIDELDGMESLNQTLVIKESKSNIELQEARKELENGLLD-LSGGQTH  417

Query  680   IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE  501
             IGI+RMGE+D KAF   C Q+  TE A+V A  LCS W+ ++K+P+WHPFRV+ I D  E
Sbjct  418   IGIKRMGELDLKAFSKAC-QKERTENAEVTAAFLCSKWEAEIKNPDWHPFRVVTI-DGKE  475

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
               I EDD +L  LKEE GEEI A V KA+ E NEY + G Y + ELWNFKE RK TLKE 
Sbjct  476   MAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPVGELWNFKENRKVTLKEA  535

Query  320   VSFIFKQLKTHKRKR  276
             V F+ +Q +T++RKR
Sbjct  536   VQFVLRQWRTNRRKR  550



>gb|EMT07790.1| hypothetical protein F775_28070 [Aegilops tauschii]
Length=636

 Score =   426 bits (1095),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 260/626 (42%), Positives = 406/626 (65%), Gaps = 24/626 (4%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             Y+ K +  L SG  K +  NG    CPFC G+K +DY  + LLQH++GVG  + NR  K 
Sbjct  19    YEGKIHARLVSGDLKFR--NGDSYSCPFCTGRKNKDYNMQSLLQHSSGVG-AAPNRPAKD  75

Query  1928  KANHVALAKYLEIDLGDQAEPL--------PQR-AVAPED----NNLYCWPWTGIVVNVS  1788
             KA+H ALAK+L+  +   +EP         PQ+ AV P+     +  + WPW G++VNV 
Sbjct  76    KASHRALAKHLKNGVAKPSEPQQIAIEPQQPQQIAVEPQPLPNRHEKFVWPWMGVLVNVP  135

Query  1787  KDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  1611
              +  +G  V E    LK   S++   +V    + +  T   +++   +WNG++NA+ FE 
Sbjct  136   TEWKDGRQVGESGNRLKGELSQFCPLKVIPLWNFRGHTGNAIVEFAKNWNGFRNALAFEK  195

Query  1610  AFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEK  1431
              FEA    +++W  +  +  S + GW A+ +DY   G +G +LR+   LKTI DL  E  
Sbjct  196   YFEAGGCGRRDWK-QNQNQGSKLCGWVARAEDYNFPGLIGDHLRKNADLKTIDDLENEGT  254

Query  1430  RDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLA  1251
             R  +K+++NL N++++KN+ L  L  R+NE  LSL +M+ +++   +A+ EE RKMQ+LA
Sbjct  255   RKNNKLVANLANQIEVKNKYLQELELRYNETTLSLEKMMGQREQRLQAYNEEIRKMQQLA  314

Query  1250  REHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSL  1071
             R H ++++ E + L SELE K  +L++ ++EL+     +  +K  L++EK++N  +++ L
Sbjct  315   RRHSEKIIDENQNLRSELESKMSELNARSKELDDLAAKSSHDKSNLEQEKQKNAIKSNHL  374

Query  1070  EMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVME  891
             ++A+ EQ++ADE+V++L+ + KREK AAL KILELE+ ++AKQ LE+EIQ+LKGKL+VM+
Sbjct  375   KLATAEQQRADEDVVKLVRDQKREKVAALNKILELEQQLEAKQTLELEIQQLKGKLEVMK  434

Query  890   HMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGL  711
             HM G +DS  ++KI E+ E+L +K++++  ++ +N  LV+KE +SN E+QEARK L  GL
Sbjct  435   HMPGHEDSVSKDKINELSEELQDKMDELDAMESLNQTLVIKESKSNTEMQEARKELENGL  494

Query  710   SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPF  531
              + L+ GR+HIGI+RMGE+D KA  N   Q+ S E+A+V A  LCS W+ ++++P WHPF
Sbjct  495   LN-LSGGRAHIGIKRMGELDLKAVSNALGQKLSKEDAEVTAAILCSKWEAEIRNPEWHPF  553

Query  530   RVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNA-SGRYVIPELWNF  354
             R + +  +  + IN DD +L +LK+E GEEI + V KA+    EYNA S RY + ELWNF
Sbjct  554   RAVMVDGKEMERINADDAKLRELKDEHGEEIYSLVTKALR---EYNANSTRYPVGELWNF  610

Query  353   KEGRKATLKEVVSFIFKQLKTHKRKR  276
             +E RKA+LKE V  + +Q + ++RKR
Sbjct  611   REERKASLKEAVQVVLRQWRANRRKR  636



>gb|EMT17491.1| hypothetical protein F775_14734 [Aegilops tauschii]
Length=1285

 Score =   443 bits (1140),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 272/617 (44%), Positives = 406/617 (66%), Gaps = 20/617 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I++Y EK Y +L+SGK   +      RCPFC GKKKQDY+Y +LLQHA GVG  ++NR+ 
Sbjct  16    IDDYAEKAYTDLKSGKLVARFGADRFRCPFCPGKKKQDYRYNELLQHAIGVG--ASNRAA  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR-AVA-------PEDNNLYCWPWTGIVVNVSKDN  1779
             K KANH ALA +L+ D  D A  LP R AVA        +D  L+ WPW GI+ NV  + 
Sbjct  74    KVKANHQALASHLKTDHADAAGSLPPRQAVALINPPKPVQDQELFVWPWMGILANVPVEQ  133

Query  1778  AN-GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
                G A+  +     +  ++ A    +   D   T   +++   DW G+K+A+ F N ++
Sbjct  134   TQRGGAIVMQQLAGYKPIRFNA----VHSPDGEYTGFAIVRFNKDWIGFKDALGFHNTYK  189

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             +    K +W A +S    +++ W AK +DY+A+  VG +L E   LKT+ +L QE  R  
Sbjct  190   SHHLGKTDWEASKSD--KYMFAWLAKEEDYKADDPVGKFLSENGDLKTVAELQQEMSRKT  247

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             D ++++LT+++  K++ L  L  + N+ +L+L R +E+ D+L + + EE RKMQ  AREH
Sbjct  248   DTLITSLTSQISAKSKYLMELECKCNQMDLALQRAMEDNDSLDQRYNEEMRKMQSTAREH  307

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
               ++ HE + L  +L++K+  +   +++L++    T+ E+ KL+ E+K+ND +N SL MA
Sbjct  308   SLKIFHETDQLRKQLDEKENDIKRRSKQLSEIVAQTDMERRKLENERKKNDGQNDSLNMA  367

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
               EQ+KA+E V  L+E+HK+EKEAAL KIL LEK +D K +LE++IQ+L+GKL+V++HM 
Sbjct  368   RIEQEKANEGVRSLVEKHKKEKEAALNKILLLEKQLDEKHQLELDIQQLRGKLEVVKHME  427

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
             G+    V+++ +E+ + L ++I+ M+DL+E+N AL++KER +NDELQ+A+K LI GL DL
Sbjct  428   GEGVD-VKKRTEELNKDLQDRIDAMEDLEELNQALIIKERMTNDELQDAKKELISGLVDL  486

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
             L   RS+IGIRRMG++D K F   CK ++  E AD KALE CS+WQ+ ++D NWHPF+++
Sbjct  487   LGP-RSNIGIRRMGQVDEKPFIEACKPKYGAE-ADTKALEFCSMWQDNLRDANWHPFKIV  544

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
                ++ EQII++ DE+L  LKEE GEE+  AV  A+ E+NEYNASG YV+ ELWN KE R
Sbjct  545   TRGEKSEQIIDKGDEKLVGLKEELGEEVYKAVTTALVEMNEYNASGSYVVSELWNNKESR  604

Query  341   KATLKEVVSFIFKQLKT  291
             KA++ EVV  I KQ K 
Sbjct  605   KASMGEVVEHILKQWKA  621



>gb|AAV69069.1| X1, partial [Zea luxurians]
Length=550

 Score =   423 bits (1087),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 246/555 (44%), Positives = 364/555 (66%), Gaps = 12/555 (2%)
 Frame = -1

Query  1919  HVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVE  1758
             H AL KYL+  L      G  A P+  + +   D   + WPW G++VNV  +  +G  + 
Sbjct  1     HRALFKYLKNGLAKSPEPGSHATPVEPQPLQNRDEK-FVWPWMGVLVNVPTEWKDGRQIG  59

Query  1757  EEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKK  1581
             E    LK + S +    V      +  T   +++   DWNG++NA  FE  F A    KK
Sbjct  60    ESGNRLKEQLSHFCPLRVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFEGHFAAGGFGKK  119

Query  1580  EWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNL  1401
             +W  +++   S +YGW A+ +DY + G +  +LR+   LK++ DL +E +R  D++++NL
Sbjct  120   DWIGKKNQ-GSELYGWLARAEDYNSPGIIADHLRKNGDLKSVNDLTKEGERKTDRLVANL  178

Query  1400  TNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHE  1221
              N++++KN  L  L  +++E   SL +M+ +++ L +++ EE  KMQ+LAR H Q+++ E
Sbjct  179   ANQIEVKNRYLQELECKYSETTASLEKMMGQREQLLQSYNEEISKMQQLARRHSQKIIDE  238

Query  1220  QETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKA  1041
              + L S+LE K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ EQ+KA
Sbjct  239   NQKLRSDLEAKMNDLDVRSKQLDEIAAKSDYDRRSLEQEKQKNAIKSSHLKLATLEQQKA  298

Query  1040  DENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAV  861
             DENVL+L+EE KREK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD+DSA 
Sbjct  299   DENVLKLVEEQKREKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGDEDSAS  358

Query  860   QEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSH  681
             + KI E+ E L EKI+++  ++ +N  LV+KE +SN ELQEARK L  GL D L+ G++H
Sbjct  359   KNKINELSEALQEKIDELDGMESLNQTLVIKESKSNIELQEARKELENGLLD-LSGGQTH  417

Query  680   IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE  501
             IGI+RMGE+D KAF   C Q+  TE A+V A  LCS W+ ++K+P+WHPFRV+ + D  E
Sbjct  418   IGIKRMGELDLKAFSKAC-QKERTENAEVTAAFLCSKWEAEIKNPDWHPFRVVTV-DGKE  475

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
               I EDD +L  LKEE GEEI A V KA+ E NEY + G Y + ELWNFKE RK TLKE 
Sbjct  476   MAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPVGELWNFKENRKVTLKEA  535

Query  320   VSFIFKQLKTHKRKR  276
             V F+ +Q +T++RKR
Sbjct  536   VQFVLRQWRTNRRKR  550



>gb|EMT09583.1| hypothetical protein F775_10228 [Aegilops tauschii]
Length=598

 Score =   424 bits (1089),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 242/567 (43%), Positives = 383/567 (68%), Gaps = 11/567 (2%)
 Frame = -1

Query  1949  ANRSVKQKANHVALAKYLEIDLGDQAEPLPQ----RAVAP----EDNNLYCWPWTGIVVN  1794
             A+R  + +  H   AK ++ +L + +EP P+    +AV P    + +  + WPW G++VN
Sbjct  34    AHRHGRDRPTHRVPAKRVKDELPESSEP-PRSSRLKAVVPRPLQDRDEQFVWPWMGVLVN  92

Query  1793  VSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             V  +   G  V E    LK + S++  Q+V    + +  T   +++   D+  + NA  F
Sbjct  93    VPTEWKGGRQVGESGNRLKEQLSRFCPQKVIPLWNHRGHTGYAIVEFGKDYACFCNAFKF  152

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             EN FEAE + K++W A     S  ++GW A+ DD    G +G +L++   LKT+ +L  E
Sbjct  153   ENHFEAEGYGKRDWEARMHRGSDQMFGWVARADDQRTPGPIGEHLQKNGDLKTVAELENE  212

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
               R  DK+++NL +++++K +++  L  ++NE   SL ++IEEK+ + + + +E  KMQ+
Sbjct  213   GTRKTDKLVANLASQIEVKAKHVQELECKYNETTNSLDKVIEEKEQVLQRYNDEIHKMQQ  272

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
             LAR+H Q +++E + L SELE K + L+  +R+L++  V ++ ++  L++EK++N+ +  
Sbjct  273   LARKHSQMIVNENQRLRSELESKMQDLEIKSRQLDELAVRSDSDRRNLEKEKEKNELKAK  332

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
              L+MA+ EQ++ADENVL+L+E+HKREK+AAL +I++LE+ +DAKQKLE+EI++++GKL+V
Sbjct  333   YLKMATLEQQRADENVLKLVEKHKREKQAALNEIIKLEQKLDAKQKLELEIKQMQGKLEV  392

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HM G +DS  + KI E+  +L +K ++M  ++ +++ L++KER SNDELQ+ARK LI 
Sbjct  393   MKHMPGVEDSESKRKIDELSAELQDKYDEMDAMESLHHTLLMKERISNDELQDARKKLID  452

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             GL DL  +GR  IGI+RMG++D K+F   CK + S E+A V A  LCS W+E++KDP WH
Sbjct  453   GLRDL-TTGRGIIGIKRMGDLDLKSFAIACKNKMSKEDAAVTASLLCSKWEEEIKDPEWH  511

Query  536   PFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWN  357
             PF+VI    + ++I+ EDDE+L +LKEE+GEE+   V KA+ EVNEYN SGRY +PELWN
Sbjct  512   PFKVIMDEGKEKEILREDDEKLRELKEEYGEEVYGLVTKALLEVNEYNPSGRYPVPELWN  571

Query  356   FKEGRKATLKEVVSFIFKQLKTHKRKR  276
             FKE RKATLKE V ++ +Q +T KRKR
Sbjct  572   FKEKRKATLKEAVQYVLRQWRTQKRKR  598



>ref|XP_006431940.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
 gb|ESR45180.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
Length=633

 Score =   425 bits (1092),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 260/605 (43%), Positives = 397/605 (66%), Gaps = 12/605 (2%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             +Y++K YE+L+SG Y VK  +    CP+C  K+K DY+YKDLLQHA+G+G  S+ RS K+
Sbjct  18    DYEDKSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYRYKDLLQHASGIG-NSSKRSAKE  76

Query  1928  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  1764
             KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77    KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  1763  VEEEDYWLKR---FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             V E    LK            V+   + +  +   +++   +W G  NA+ FE ++EA+ 
Sbjct  137   VGESGSKLKDELIRRGLHPTRVQSLWNFRGHSGCALVQFNKNWPGLDNAMAFEKSYEADH  196

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK+W  E +   S +YGW A+ DDY     +G +LR+ R LKTI+ L++EE R K+ +
Sbjct  197   HGKKDWN-EGNQEKSGLYGWVARSDDYSLNNIIGEHLRKNRDLKTISGLVEEEARKKNLL  255

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +SNLTN +++KN++L  +  R  E +  +  ++EEKD L + + EE +K+Q  A++H QR
Sbjct  256   VSNLTNTIEVKNKHLEEMKERCIETSNFIENLMEEKDRLVQGYNEEIKKIQLSAQDHFQR  315

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +  E E    +LE +KK+L+    +L KRE   E ++  L EE ++N  RNSSL++A+ E
Sbjct  316   IFTEHENFKLQLEAQKKELEFLGVDLQKREAKNENDRKALAEEIEKNAMRNSSLQLATLE  375

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KAD+NV +L E+ K EKE    KI++LEK +DAKQ LE+EI+ L+G   VM+H+    
Sbjct  376   QQKADDNVRKLAEDQKIEKEELHNKIIQLEKQLDAKQALELEIERLRGTSKVMKHVSDGG  435

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D+ VQ+K++ + + L EK  +++DL+ +N  L++KER+SND+LQ+ARK LI  + +   S
Sbjct  436   DAEVQQKMETVLKDLREKEGELEDLEALNQTLIIKERKSNDDLQDARKELINAMKE--TS  493

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G +HIG++RMGE+DGK F    K+ ++ EEA+ K  ELCSLW E ++D +WHPF+V+   
Sbjct  494   GHAHIGLKRMGELDGKPFFEAMKKWYNEEEAEEKGSELCSLWDEYLRDSDWHPFKVVTAE  553

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + ++I+ E+DE+L  LK++ GEE+  AV  A+ E+NEYN SGRY+  ELWNF+EGR+A 
Sbjct  554   GKHKEILKEEDEKLKGLKKQMGEEVYKAVTTALLEINEYNPSGRYITSELWNFREGRRAR  613

Query  332   LKEVV  318
             L+E V
Sbjct  614   LQEGV  618



>gb|AAV69068.1| X1, partial [Zea mays subsp. parviglumis]
Length=550

 Score =   421 bits (1082),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 245/555 (44%), Positives = 363/555 (65%), Gaps = 12/555 (2%)
 Frame = -1

Query  1919  HVALAKYLEIDL------GDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVE  1758
             H AL KYL+  L      G  A P+  + +   D   + WPW G++VNV  +  +G  + 
Sbjct  1     HRALFKYLKNGLAKSPEPGSHATPVEPQPLQNRDEK-FVWPWMGVLVNVPTEWKDGRQIG  59

Query  1757  EEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKK  1581
             E    LK + S +    V      +  T   +++   DWNG++NA  FE+ F A    KK
Sbjct  60    ESGNRLKEQLSHFCPLRVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAAGGFGKK  119

Query  1580  EWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNL  1401
             +W  +++   S +YGW A+ +DY + G +  +LR+   LK++ DL +E  R  D++++NL
Sbjct  120   DWIGKKNQ-GSELYGWLARAEDYNSPGIIADHLRKNGDLKSVNDLAKEGARKNDRLVANL  178

Query  1400  TNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHE  1221
              N++++KN  L  L  +++E   SL +M+ +++ L +++ EE  KMQ+LAR H Q+++ E
Sbjct  179   ANQIEVKNRYLQELECKYSETTASLEKMMGQREQLLQSYNEEISKMQQLARRHSQKIIDE  238

Query  1220  QETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKA  1041
              + L S+LE K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ EQ+KA
Sbjct  239   NQKLRSDLEAKMNDLDVRSKQLDEIAAKSDYDRRSLEQEKQKNAIKSSHLKLATLEQQKA  298

Query  1040  DENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAV  861
             DENVL+L+EE KREK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD+DSA 
Sbjct  299   DENVLKLVEEQKREKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGDEDSAS  358

Query  860   QEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSH  681
             + KI E+ E L EKI+++  ++ +N  LV+KE +SN ELQEARK L  GL D L+ G++H
Sbjct  359   KNKINELSEALQEKIDELDGMESLNQTLVIKESKSNIELQEARKELENGLLD-LSGGQTH  417

Query  680   IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE  501
             IGI+RMGE+D KAF   C Q+   E A+V A  LCS W+ ++K+P+WHPFRV+ + D  E
Sbjct  418   IGIKRMGELDLKAFSKAC-QKERAENAEVTAAFLCSKWEAEIKNPDWHPFRVVTV-DGKE  475

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
               I EDD +L  LKEE GEEI A V KA+ E NEY + G Y + ELWNFKE RK TLKE 
Sbjct  476   MAIIEDDAKLRALKEEHGEEIYAMVTKALLETNEYKSKGSYPVGELWNFKENRKVTLKEA  535

Query  320   VSFIFKQLKTHKRKR  276
             V F+ +Q +T++RKR
Sbjct  536   VQFVLRQWRTNRRKR  550



>dbj|BAJ90280.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   423 bits (1088),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 257/627 (41%), Positives = 399/627 (64%), Gaps = 31/627 (5%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             Y+ K    L SG  K +  NG    CPFC GKK + Y  + LLQH++GVG  + NR  K 
Sbjct  19    YEGKINARLISGDLKFR--NGDSYGCPFCTGKKNKGYNMQSLLQHSSGVG-AAPNRPAKD  75

Query  1928  KANHVALAKYLEIDLGDQAE--------------PLPQRAVAPEDNNLYCWPWTGIVVNV  1791
             KA+H ALAK+L+ D+   +E              PLP R      +  + WPW G++VNV
Sbjct  76    KASHRALAKHLKNDVAKPSEPQQQQPQQIVVEPQPLPNR------HEKFVWPWMGVLVNV  129

Query  1790  SKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
               +  +G  V E    LK   S++   +V    + +  T   +++   DWNG++NA+ FE
Sbjct  130   PTEWKDGRQVGESGTRLKGELSQFCPLKVIPLWNFRGHTGNAIVEFAKDWNGFRNALAFE  189

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
               FEA    +++W  +  +  S ++GW A+ +DY   G +G +LR+   LKTI DL  E 
Sbjct  190   QYFEAGGCGRRDWK-QNQNQGSKLFGWVARAEDYNLSGLIGDHLRKNADLKTIDDLENEG  248

Query  1433  KRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRL  1254
              R  +K+++NL N++++KN+ L  L  R+NE   SL +M+ +++   +A+ EE RKMQ+L
Sbjct  249   TRKNNKLVANLANQIEVKNKYLEELELRYNETTASLEKMMGQREQRLQAYNEEIRKMQQL  308

Query  1253  AREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSS  1074
             AR H +R++ E + L SELE K  +L+  ++EL+     +  ++  L++EK++N  +++ 
Sbjct  309   ARRHSERIIDENQNLRSELESKMSELNERSKELDDLSAKSSHDRSNLEQEKQKNAIKSNH  368

Query  1073  LEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVM  894
             L++A+ EQ++A+E+V++L+ + KREK AAL KILELE+ ++AKQ LE+EIQ+LKGKL+VM
Sbjct  369   LKLATVEQQRANEDVVKLVRDQKREKVAALNKILELEQQLEAKQTLELEIQQLKGKLEVM  428

Query  893   EHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQG  714
             +HM G +DS  ++KI ++ E+L +K++++  ++ +N  LV+KE +SN E+QEARK L  G
Sbjct  429   KHMPGHEDSEAKDKINQLSEELQDKMDELDAMESLNQTLVIKESKSNTEMQEARKELENG  488

Query  713   LSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHP  534
             L +L   G +HIGI+RMGE+D KAF N   Q+ S EEA+V A  LCS W+ ++++P WHP
Sbjct  489   LLNLPGGG-AHIGIKRMGELDLKAFSNALGQKLSKEEAEVTAAILCSKWEAEIRNPEWHP  547

Query  533   FRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNA-SGRYVIPELWN  357
             FR + +  +  + I+ DD +L +LK+E G+EI + V KA+    EYNA S RY + ELWN
Sbjct  548   FRTVMVDGKEVEKIDADDTKLQELKDEHGQEIYSLVTKALR---EYNANSTRYPVGELWN  604

Query  356   FKEGRKATLKEVVSFIFKQLKTHKRKR  276
             F+E RKA+LKE V  + +Q +T +RKR
Sbjct  605   FREERKASLKEAVQVVLRQWRTTRRKR  631



>gb|EMS57892.1| hypothetical protein TRIUR3_23802 [Triticum urartu]
Length=674

 Score =   424 bits (1091),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 250/575 (43%), Positives = 389/575 (68%), Gaps = 11/575 (2%)
 Frame = -1

Query  1976  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQ---RAVAP----EDNNLYCW  1818
             HATG G   A+R  + +  H   AK ++ DL + +EP P    +AV P    + +  + W
Sbjct  103   HATGAG-SDAHRHGRDRPTHRVPAKRVKDDLPESSEPPPSSRLKAVVPRPLQDRDEQFVW  161

Query  1817  PWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWN  1641
             PW G++VNV  +   G  V E    LK + S++  Q+V    + +  T   +++   D+ 
Sbjct  162   PWMGVLVNVPTEWKGGRQVGESGNRLKEQLSRFCPQKVIPLWNHRGHTGYAIVEFGKDYA  221

Query  1640  GYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLK  1461
              + NA  FEN FEAE +SK++W A R    S ++GW A+ DD    G +G +L++   LK
Sbjct  222   CFCNAFKFENHFEAEGYSKRDWEARRYR-GSKMFGWVARADDQRTLGPIGEHLQKNGDLK  280

Query  1460  TITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFY  1281
             T+ +L  E  R  DK+++NL +++++K +++  L  ++NE   SL +++EEK+ + + + 
Sbjct  281   TVAELENEGTRKTDKLVANLASQIEVKAKHVQELECKYNETTNSLDKVMEEKEQVLQRYN  340

Query  1280  EESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeek  1101
             +E  KMQ+LAR+H Q +++E + L SELE K + L+  +R+L++  V ++ ++  L++EK
Sbjct  341   DEIHKMQQLARKHSQMIINENQRLRSELESKMQDLEIKSRQLDELAVRSDSDRRNLEKEK  400

Query  1100  krndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQ  921
             ++N+ +   L+MA+ EQ++ADENVL+L+E+HKREK+AAL +I++LE+ +DAKQKLE+EI+
Sbjct  401   EKNEMKAKYLKMATSEQQRADENVLKLVEKHKREKQAALNEIIKLEQKLDAKQKLELEIK  460

Query  920   ELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQ  741
             +++GKL+VM+HM G +DS  + KI E+  +L EK ++M  ++ +++ L++KER SNDELQ
Sbjct  461   QMQGKLEVMKHMPGVEDSESKRKIDELSAELQEKYDEMDAMESLHHTLLMKERISNDELQ  520

Query  740   EARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQE  561
             +ARK LI GL DL  +GR  IGI+RMG++D K+F   CK + S E+A V A  LCS W+E
Sbjct  521   DARKKLIDGLRDL-TTGRGIIGIKRMGDLDLKSFAIACKNKMSKEDAGVTASILCSKWEE  579

Query  560   KVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGR  381
             ++KDP WHPF+VI    + ++I+ EDDE+L +LKEE+GEE+   V KA+ EVNEYN SGR
Sbjct  580   EIKDPEWHPFKVIVDEGKEKEILREDDEKLRELKEEYGEEVYGLVTKALLEVNEYNPSGR  639

Query  380   YVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             Y +PELWNFKE RKATLKE V ++ +Q +T KRKR
Sbjct  640   YPVPELWNFKEKRKATLKEAVQYVLRQWRTQKRKR  674



>ref|XP_006491884.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472-like 
isoform X1 [Citrus sinensis]
Length=633

 Score =   422 bits (1086),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 258/605 (43%), Positives = 396/605 (65%), Gaps = 12/605 (2%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             +Y+++ YE+L+SG Y VK  +    CP+C  K+K DY YKDLLQHA+G+G  S+ RS K+
Sbjct  18    DYEDRSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYLYKDLLQHASGIG-NSSKRSAKE  76

Query  1928  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  1764
             KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77    KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  1763  VEEEDYWLKR---FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             V E    LK            V+   + +  +   +++   +W G  NA+ FE +FEA+ 
Sbjct  137   VGESGSKLKDELIRRGLHPTRVQSLWNFRGHSGCALVQFNKNWPGLDNAMAFEKSFEADH  196

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK+W  + +   S +YGW A+ DD+     +G +LR+ R LKTI+ L++EE R K+ +
Sbjct  197   HGKKDWN-DGNQVKSGLYGWVARSDDHSLNNIIGEHLRKNRDLKTISGLVEEEARKKNLL  255

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +SNLTN +++KN++L  +  R  E +  +  ++EEKD L + + EE +K+Q  A++H QR
Sbjct  256   VSNLTNTIEVKNKHLEEMKERCIETSNFIENLMEEKDRLVQGYNEEIKKIQLSAQDHFQR  315

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +  E E    +LE +KK+L+    +L KRE   E ++  L EE ++N  RNSSL++A+ E
Sbjct  316   IFTEHENFKLQLEAQKKELEFLGVDLQKREAKNENDRKALAEEIEKNAMRNSSLQLATLE  375

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KAD+NV +L E+ K EKE    KI++LEK +DAKQ LE+EI+ L+G   VM+HM    
Sbjct  376   QQKADDNVRKLAEDQKIEKEELHNKIIQLEKQLDAKQALELEIERLRGTSSVMKHMSDGG  435

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D+ V++K++ + + L EK  +++DL+ +N  L++KER+SND+LQ+ARK LI  + +   S
Sbjct  436   DAEVRQKMETVLKDLREKEGELEDLEALNQTLIIKERKSNDDLQDARKELINAMKE--TS  493

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH  513
             G +HIG++RMGE+DGK F    K+ ++ EEA+ K  ELCSLW E ++D +WHPF+V+   
Sbjct  494   GHAHIGLKRMGELDGKPFFEAMKKWYNEEEAEEKGSELCSLWDEYLRDSDWHPFKVVTAE  553

Query  512   DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKAT  333
              + ++I+ E+DE+L  LK++ GEE+  AV  A+ E+NEYN SGRY+  ELWNF+EGR+A 
Sbjct  554   GKHKEILKEEDEKLKGLKKQMGEEVYKAVTTALLEINEYNPSGRYITSELWNFREGRRAG  613

Query  332   LKEVV  318
             L+E V
Sbjct  614   LQEGV  618



>gb|AAL35831.2|AF434705_1 putative transcription factor X1 [Triticum monococcum]
Length=639

 Score =   422 bits (1086),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 256/629 (41%), Positives = 401/629 (64%), Gaps = 27/629 (4%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             Y  K    L SG  K +  NG    CPFC G+K +DY  + LLQH++GVG  + NR  K 
Sbjct  19    YGAKIQARLLSGDLKFR--NGDSYSCPFCTGRKNKDYNMQSLLQHSSGVG-AAPNRPAKD  75

Query  1928  KANHVALAKYLEIDLGDQAEPLPQRAVA----------------PEDNNLYCWPWTGIVV  1797
             KA+H ALAK+L+  +   ++P   + +A                P  +  + WPW G++V
Sbjct  76    KASHRALAKHLKNGVAKPSDPQQAQQIAVEPQQPQQISVEPQPLPNRHEKFVWPWMGVLV  135

Query  1796  NVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAIL  1620
             NV  +  +G  V E    LK   S++   +V    + +  T   +++   +WNG++NA+ 
Sbjct  136   NVPTEWKDGRQVGESGNRLKGELSQFCPLKVIPLWNFRGHTGNAIVEFAKNWNGFRNALA  195

Query  1619  FENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQ  1440
             FE  FEA    +++W  +  +  S + GW A+ +DY   G +G +LR+   LKTI DL  
Sbjct  196   FEKYFEAGGCGRRDWK-QNMNQGSKLCGWVARAEDYNFPGLIGDHLRKNADLKTIDDLEN  254

Query  1439  EEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQ  1260
             E  R  +K+++NL N++++KN+ L  L  R+NE  +SL +M+ +++   +A+ EE RKMQ
Sbjct  255   EGTRKNNKLVANLANQIEVKNKYLQELELRYNETTVSLEKMMGQREQRLQAYNEEIRKMQ  314

Query  1259  RLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRN  1080
             +LAR H ++++ E + L SELE K  +L++ ++EL+     +  +K  L++EK++N  ++
Sbjct  315   QLARRHSEKIIDENQNLRSELESKMSELNARSKELDDLAAKSSHDKSNLEQEKQKNAIKS  374

Query  1079  SSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLD  900
             + L++A+ EQ++ADE+V++L+ + KREK AAL KILELE+ ++AKQ LE+EIQ+LKGKL+
Sbjct  375   NHLKLATAEQQRADEDVVKLVRDQKREKVAALNKILELEQQLEAKQTLELEIQQLKGKLE  434

Query  899   VMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             VM+HM G +DS +++KI E+ E+L +K++++  ++ +N  LV+KE +SN E+QEARK L 
Sbjct  435   VMKHMPGHEDSVLKDKINELSEELQDKMDELDAMESLNQTLVIKESKSNTEMQEARKELE  494

Query  719   QGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNW  540
              GL + L  GR+HIGI+RMGE+D KA  NV  Q+ S E+A+V A  LCS W+ ++K+P W
Sbjct  495   NGLLN-LPGGRAHIGIKRMGELDLKAVSNVLGQKLSKEDAEVTAAILCSKWEAEIKNPEW  553

Query  539   HPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNA-SGRYVIPEL  363
             HPFR + +  +  + IN DD +L +LK+E GEEI + V KA+    EYN  S RY + EL
Sbjct  554   HPFRAVMVDGKEMERINADDAKLRELKDEHGEEIYSLVTKALR---EYNVNSTRYPVGEL  610

Query  362   WNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             WNF+E RKA+LKE V  + +Q + ++RKR
Sbjct  611   WNFREERKASLKEAVQVVLRQWRANRRKR  639



>ref|XP_007156380.1| hypothetical protein PHAVU_003G281400g [Phaseolus vulgaris]
 gb|ESW28374.1| hypothetical protein PHAVU_003G281400g [Phaseolus vulgaris]
Length=636

 Score =   422 bits (1085),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 260/621 (42%), Positives = 397/621 (64%), Gaps = 17/621 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPN--GCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-  1944
             I+EY++K YEELR+G   VK  N  G   CP+C  K+KQDY Y +LLQHA+GVG+ S+  
Sbjct  17    ISEYEDKTYEELRNGVQNVKTSNENGTFICPYCPRKRKQDYLYNELLQHASGVGQSSSKK  76

Query  1943  RSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPE-DNNLYC-----WPWTGIVVNV-SK  1785
             R  + KANH+AL KYLE DL D   P        E D+++ C     WPW GIVVN+ + 
Sbjct  77    RKARDKANHLALVKYLEKDLVDVDAPAKDSKPTDESDSSVNCDEQFVWPWIGIVVNIPTS  136

Query  1784  DNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
                +G  V E    L+   R   +    V    + +  +   +++   DW G  NA+ FE
Sbjct  137   QTVDGRCVGESGSRLRDDYRSRGFNPVRVNALWNYRGHSGTALVEFSKDWPGLHNALAFE  196

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
              A+E + H KK+W A  S     +Y W A+ DD++     G +L+    +KTI++L++EE
Sbjct  197   RAYELDHHGKKDWFA-NSEQKFGLYAWVARADDFKRNSIYGEHLQTIADVKTISELIEEE  255

Query  1433  KRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRL  1254
              R +DK++SNLTN + +KN++L  +  R +E    ++ ++ EKD L +A+  E +K+Q  
Sbjct  256   SRRQDKLVSNLTNIIQVKNQHLKEIEVRCHEATHKINSVMMEKDKLFQAYNAEIKKIQSS  315

Query  1253  AREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSS  1074
             A  +++++  + E L  +LE +KK+L+  N EL KRE   E E+ +L++E + N  +NSS
Sbjct  316   AMNNLKKISIDHEKLKLQLESQKKELELRNIELEKREAQNESERKRLEKEIRENAMKNSS  375

Query  1073  LEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVM  894
             + MA+ E KKA+ENV++L E+ +R+KE    KI  L+K +D KQ+LE+EIQ LKG L+V+
Sbjct  376   VHMATLEHKKANENVMKLAEDQRRQKEQLHAKIFRLQKQLDMKQELELEIQRLKGSLNVL  435

Query  893   EHMGGDDDSA-VQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             +HM  DDD     +K+  +++ L +K E ++DLDE+N  L+++ER SNDELQEAR+ L+ 
Sbjct  436   KHMKDDDDGVEFLKKVDSLQKDLIDKEESLEDLDELNRTLIIRERVSNDELQEARQALVN  495

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             G+ +L  + R +I ++RMGE+D + F    ++R+  EE + +A ELCSLW+E +K+PNWH
Sbjct  496   GIKEL--ASRGNIRLKRMGELDTRPFLKAIQKRYKKEEVEERASELCSLWEEHLKNPNWH  553

Query  536   PFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWN  357
             PF+VI    + ++II +DDE+L +LK+E GE    AV++A+ E+NEYN SGRY+   LWN
Sbjct  554   PFKVIMAEGKEKEIIKDDDEKLKELKKELGEGAYKAVVQALSEINEYNPSGRYLTSVLWN  613

Query  356   FKEGRKATLKEVVSFIFKQLK  294
             +KEGR+ATLKE +  +  +LK
Sbjct  614   YKEGRRATLKEGLQLLLNKLK  634



>ref|XP_006585879.1| PREDICTED: myosin heavy chain, clone 203-like isoform X1 [Glycine 
max]
 ref|XP_006585880.1| PREDICTED: myosin heavy chain, clone 203-like isoform X2 [Glycine 
max]
 ref|XP_006585881.1| PREDICTED: myosin heavy chain, clone 203-like isoform X3 [Glycine 
max]
 gb|KHN37146.1| hypothetical protein glysoja_038766 [Glycine soja]
Length=641

 Score =   421 bits (1081),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 252/627 (40%), Positives = 405/627 (65%), Gaps = 19/627 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdyky-kdllQHATGVGKGSAN-R  1941
             I+EYK+K Y+EL+SG  KVK  +    CP+C  ++K+D    K+LLQHA+GVG+ S+  R
Sbjct  17    ISEYKDKTYQELKSGSQKVKNLDETFTCPYCPKRRKRDDYSYKELLQHASGVGRSSSKKR  76

Query  1940  SVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-S  1788
               + KANH+AL KYLE DL   +  +P     PED        +  + WPW GIVVN+ +
Sbjct  77    KARDKANHLALVKYLEKDL--VSVDIPAEVSKPEDESGTSVNSDEQFVWPWIGIVVNIPT  134

Query  1787  KDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             +   +G +V E    L+   +   +    V    + +  +   +++   DW+G  NA+ F
Sbjct  135   RLTGDGHSVGESGTGLRDEYKSRGFNPVRVTPLWNFRGHSGIALVEFNKDWSGLDNALAF  194

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E  +E + H KK+W A  S   S +Y W A+ DD+  +   G +L++   +KTI+ L++E
Sbjct  195   EREYELDHHGKKDWFA-NSEQKSGLYAWVARADDHGMKNIYGEHLQKMCDVKTISQLMEE  253

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +DK++S LTN + +KN+++  +  + +E    +   + EKD L +A+  E +K+Q 
Sbjct  254   EARRQDKLVSTLTNVIQVKNQHIKEIEVKCHETTHKMDLAMMEKDKLIQAYNAEIKKIQS  313

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              A +H++++  + E L  +L+ +K +L+    EL KRE   E E+ KL +E   N  +NS
Sbjct  314   SATDHLKKIFTDHEKLKLQLKSQKNELELRKVELEKREAHNESERKKLTKEIMENAMKNS  373

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL+MA+ EQKKADENV++L E+ KR+KE    KI++L+K +D KQ+LE+EIQ+LKG L+V
Sbjct  374   SLQMATLEQKKADENVMKLAEDQKRQKEQLHAKIIQLQKQLDKKQELELEIQQLKGSLNV  433

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             ++HM   +D+ V +K+  +++ L +K + ++DLDE+N AL++KER+SNDELQEAR+ L+ 
Sbjct  434   LKHMDDYEDAEVLKKVDTLQKDLRDKEQSLQDLDELNQALIIKERESNDELQEARQALVD  493

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             G+ +L + G  +I ++RMGE+D + F    K+R++ EEA+ +  ++CSLW+E +++P+WH
Sbjct  494   GIKELSSHG--NICLKRMGELDTRPFLEAMKKRYNEEEAEERTADMCSLWEELLRNPDWH  551

Query  536   PFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWN  357
             PF+VI +  + ++II +DDE+L++LK + GE    AV++A+ E+NE+N SGRY+   +WN
Sbjct  552   PFKVIMVEGKEKEIIRDDDEKLNELKNDLGEGAYKAVVQALLEINEHNPSGRYLTSVVWN  611

Query  356   FKEGRKATLKEVVSFIFKQLKTHKRKR  276
             +KE R+ATLKE V F+  Q    KRKR
Sbjct  612   YKEKRRATLKEGVHFLLNQWIVRKRKR  638



>gb|KHN27026.1| hypothetical protein glysoja_039182 [Glycine soja]
Length=637

 Score =   417 bits (1071),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 259/619 (42%), Positives = 396/619 (64%), Gaps = 17/619 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRS-  1938
             I+EY++K YEEL +G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  + 
Sbjct  17    ISEYEDKSYEELNNGSQNVKTSDETFTCPYCPKKRKRDYLYNELLQHASGVGQNSSQMTK  76

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYCWPWTGIVVNVSKD  1782
              + KANH+AL KYLE DL      +P +   P D N         + WPW GIVVN+   
Sbjct  77    ARDKANHLALVKYLEKDL--MTVDVPSKDSKPVDENEPSVNSDEQFVWPWIGIVVNIPTR  134

Query  1781  NANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  1611
               +G  V E    L+   R   +    V    + +  +   +++ K DW G  NA+ FE 
Sbjct  135   WIDGHYVGESGTKLRDEYRSRGFNPVRVTPLWNFRGHSGIALVEFKKDWPGLDNALAFER  194

Query  1610  AFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEK  1431
              +E + H KK+W A  S   S +Y W A+ DDY+     G  L++   LKTI + ++EE 
Sbjct  195   TYELDHHGKKDWFA-NSEQKSGLYAWVARADDYKVNNIYGEQLQKMGDLKTIPERMEEEA  253

Query  1430  RDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLA  1251
             R +D ++SNLTN + +KN++L  +  R +E    ++  + EKD L R +  E +KMQ  A
Sbjct  254   RKQDILVSNLTNIIQVKNQHLKEIEVRCHETTNKMNLAMNEKDKLIRTYNAEIKKMQSSA  313

Query  1250  REHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSL  1071
              +H++R+  + E L  +LE +K +L+    +L KRE   E E+ KL EE + N  +NSSL
Sbjct  314   SDHLKRIFTDHEKLKFQLESQKNELELRKIDLEKREAHNESERKKLAEEIEENATKNSSL  373

Query  1070  EMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVME  891
             +MA+ EQKKADENV++L E+ +R+KE    KI++L+K +D KQ+LE+EIQ+LKG L V++
Sbjct  374   QMAALEQKKADENVMKLAEDQQRQKELLHAKIIQLQKQLDMKQELELEIQQLKGSLSVLK  433

Query  890   HMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGL  711
             HM  D+D+ V +K+  +++ L +K + +++LD +N AL++KER+SNDELQEARK L+ G+
Sbjct  434   HMEDDEDAGVLKKVDTLQKDLRDKEQSLEELDALNQALIVKERESNDELQEARKALVDGM  493

Query  710   SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPF  531
              +L  S  S+I ++RMGEID   F +  K+R++ EEA+ +A ELCSLW+E +K+P+WHPF
Sbjct  494   KEL--SSHSNIRLKRMGEIDTIPFLDAMKKRYNEEEAEERASELCSLWEEYLKNPDWHPF  551

Query  530   RVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFK  351
             +VI +  + ++I+ +DDE+L++LK + GE    AV++A+ E+NE+N SGRY+   +WN+K
Sbjct  552   KVIMVEGKEKEIVRDDDEKLNELKNDLGEGAYKAVVQALSEINEHNPSGRYLTSVVWNYK  611

Query  350   EGRKATLKEVVSFIFKQLK  294
             EGR+A+LKE V F+    K
Sbjct  612   EGRRASLKEGVQFLLNHWK  630



>gb|AAB94013.1| gene X-like protein [Sorghum bicolor]
Length=895

 Score =   420 bits (1079),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 261/595 (44%), Positives = 377/595 (63%), Gaps = 31/595 (5%)
 Frame = -1

Query  2075  SGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKANHVALAKYL  1896
             SG  KVK       C FC+ KKK +Y    L+QHA+GV   + NR  K+KA H AL KYL
Sbjct  2     SGGLKVKNNGENYSCLFCSSKKKNNYSKSSLVQHASGVS-AAPNRKAKEKAAHRALFKYL  60

Query  1895  EIDLGDQAEPLPQR-AVAPED----NNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK-R  1734
             + DL   +EP P    V P+     +  + WPW GI+VNV  +  +G  + E    LK +
Sbjct  61    KNDLAKSSEPQPLVIPVEPQPLQNRDEKFVWPWMGILVNVPTEWKDGRQIGESGNRLKEQ  120

Query  1733  FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSP  1554
              S +   +V      +  T   +++   DWNG++NA  FE+ F A    KK+WT +++  
Sbjct  121   LSHFCPLKVIPLWTFRGHTGNAIVEFGKDWNGFRNARTFESHFAAGGFGKKDWTGKKNQ-  179

Query  1553  SSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNE  1374
              S +YGW A+ +DY + G +  YLR+   LK++ DL +E  R  D++++NL N++++KN 
Sbjct  180   GSELYGWLARAEDYNSPGIIADYLRKNGDLKSVNDLAKEGARKTDRLVANLANQIEVKNR  239

Query  1373  NLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELE  1194
              L  L ++++E   SL +M+ +++ L +++ EE  KMQ+LAR H Q+V+ E + L SELE
Sbjct  240   YLQELESKYSETTASLEKMMGQREQLLQSYNEEISKMQQLARRHSQKVIDENQKLRSELE  299

Query  1193  KKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIE  1014
              K   LD  +++L++    ++ ++  L++EK++N  ++S L++A+ EQ+KADENVL+L  
Sbjct  300   AKMNDLDVRSKQLDELAAKSDYDRRNLEQEKQKNAIKSSHLKLATLEQQKADENVLKL--  357

Query  1013  EHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKE  834
                REK AAL+KIL LE+ +DAKQKLE+EIQ+LKGKL VMEHM GD+DSA + KI E+ E
Sbjct  358   ---REKHAALKKILMLEQQLDAKQKLELEIQQLKGKLKVMEHMPGDEDSASKNKINELSE  414

Query  833   QLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN-SGRSHIGIRRMGE  657
              L EKI+++  ++ +N  LV+KE +SN ELQEARK       +L N  G++HIGI+RMGE
Sbjct  415   ALQEKIDELDGMESLNQTLVIKESKSNIELQEARK-------ELENVCGQAHIGIKRMGE  467

Query  656   IDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINedde  477
             +D KAF   C Q+  TE+A+V A  LCS W+ ++K+P+WHPFRV  I D  +        
Sbjct  468   LDLKAFSKAC-QKERTEDAEVTAAFLCSKWEAEIKNPDWHPFRVEIIEDDAK--------  518

Query  476   elsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSF  312
              L  LKEE GEEI A V KA+ E+NEY + G Y + ELWNFKE RK TLKE V F
Sbjct  519   -LRALKEEHGEEIYALVTKALLEINEYKSKGSYPVGELWNFKENRKVTLKEAVQF  572



>dbj|BAJ94618.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   411 bits (1056),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 241/576 (42%), Positives = 379/576 (66%), Gaps = 13/576 (2%)
 Frame = -1

Query  1976  HATGVGKGSANRSVKQKANHVALAKYLE--------IDLGDQAEPLPQRAVAPEDNNLYC  1821
             H+TG G   A+R  + +  H   AK ++             + + +  R V  +D   + 
Sbjct  37    HSTGAG-SDAHRHGRDRMTHRVPAKRVKDELPESSEPPPPSRLKTVVPRPVQDKDEQ-FV  94

Query  1820  WPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDW  1644
             WPW G++VNV  +   G  V E    LK + S +  Q+V    + +  T   +++   D+
Sbjct  95    WPWMGVLVNVPTEWKGGRQVGESGNRLKEQLSGFCPQKVIPLWNHRGHTGNAIVEFGKDY  154

Query  1643  NGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQL  1464
               + NA  FEN FEAE + K++W   R    S +YGW A+ DD    G +G +L++   L
Sbjct  155   ACFCNAFKFENHFEAEGYGKRDWET-RKYRGSEMYGWVARADDQRTPGPIGEHLQKNGDL  213

Query  1463  KTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAF  1284
             KT+ +L  E  R  DK+++NL  ++++K +++  L  ++NE   SL +++EEK+ + + +
Sbjct  214   KTVAELENEGTRKTDKLVANLAIQIEVKAKHVQELECKYNETTTSLDKVMEEKEQVLQRY  273

Query  1283  YEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldee  1104
              +E  KMQ+LAR+H Q +++E + L SELE K + L+  +R+L++  V ++ ++  L++E
Sbjct  274   NDEIHKMQQLARKHSQMIINENQRLRSELESKMQDLELKSRQLDELAVRSDSDRRNLEKE  333

Query  1103  kkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEI  924
             K++N+ +   L+MA+ EQ++ADENVL+L+E+HKREK+AAL +I++LE+ +DAKQKLE+EI
Sbjct  334   KEKNEMKAKYLKMATSEQQRADENVLKLVEKHKREKQAALNEIIKLEQKLDAKQKLELEI  393

Query  923   QELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDEL  744
             ++++GKL+VM+HM G +DS  + KI E+  +L +K ++M  ++ +++ L++KER SNDEL
Sbjct  394   KQMQGKLEVMKHMPGVEDSESKRKIDELSAELQDKYDEMDAMESLHHTLLMKERISNDEL  453

Query  743   QEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQ  564
             Q+ARK LI GL +L N GR  IGI+RMG++D K+F   CK + S E+A V A  LCS W+
Sbjct  454   QDARKKLIDGLRELTN-GRGIIGIKRMGDLDLKSFAIACKNKMSKEDAGVTASILCSKWE  512

Query  563   EKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASG  384
             E++KDP WHPF+VI    + ++I+ EDDE+L +LKEE+GEE+   V KA+ EVNEYN SG
Sbjct  513   EEIKDPEWHPFKVIVDEGKEKEILCEDDEKLRELKEEYGEEVYGLVKKALLEVNEYNPSG  572

Query  383   RYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             RY +PELWNFKE R+ATLKE V ++ +Q +T KRKR
Sbjct  573   RYPVPELWNFKEKRRATLKEAVQYVLRQWRTQKRKR  608



>ref|XP_006575506.1| PREDICTED: uncharacterized protein LOC100806426 isoform X4 [Glycine 
max]
Length=1037

 Score =   421 bits (1081),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 254/620 (41%), Positives = 388/620 (63%), Gaps = 14/620 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKGSA-NRSVK  1932
             Y  K YE L+ G + VK       CP+C  KK++       + +HA+GVG+ S+  RS  
Sbjct  419   YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  478

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRA--VAPEDN--NLYCWPWTGIVVNV-SKDNANGT  1767
             +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+ ++   +G 
Sbjct  479   EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNIPTRLTEDGR  537

Query  1766  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+   R   +  + V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  538   CVGESGSKLRDEYRSRGFNPRRVRILSNFCVHSGTAVVEFNKNWTGLDNALAFERAYELD  597

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W A  +   S +Y W A+ DDY+    +G  LR+   +KTI++L++EE R +DK
Sbjct  598   HHGKKDWFAN-TQHKSGIYAWIAQADDYKMNNIIGEQLRKMVDIKTISELMEEEARTQDK  656

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++SNL N L +K + L  +  ++ E +  +  ++ E D L +   +E +K+Q  A +H Q
Sbjct  657   LVSNLNNTLQVKKKRLKEMEVKYYETSRRMDIVMGEIDKLTQGHNQEMKKIQSSATQHFQ  716

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
              + +  E L  +LE +K++L+    EL KRE   E E+ KL+EE   N  +NSSL+MA  
Sbjct  717   NIFNGHERLKLQLESQKRELELRRIELEKREARNESERKKLEEEIMENALKNSSLDMAVL  776

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KA ENVL+L  + KR+KE    KI+ LE+ ++ KQKLE+EIQ+LKGKL+VM H+  D
Sbjct  777   EQQKAGENVLKLAADQKRQKEQFHAKIILLERQLEVKQKLELEIQQLKGKLNVMAHIEDD  836

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              DS V  K+  + + L EK + ++DLD +N  L++KERQSNDELQEARK LI G+ ++  
Sbjct  837   GDSEVLNKVDALHKDLREKEQSLRDLDSLNQTLIIKERQSNDELQEARKELINGIKEI--  894

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R+++G++RMGE+D + F    K +++ E+A+ +A ELCSLW+E ++DP+WHPF++  I
Sbjct  895   SCRANVGVKRMGELDIRPFLEAMKIKYNNEDAEDRASELCSLWEEYIRDPDWHPFKITII  954

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               + ++II+++DE+L  LK E GE +  AV+ A+ E+N YN SGRY+  ELWN++EG++A
Sbjct  955   EGKHQEIIDDEDEKLKGLKNEMGEGVYKAVVTALTEINTYNPSGRYITSELWNYEEGKRA  1014

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TL+E V  +  Q K  K+KR
Sbjct  1015  TLQEGVKLLLMQWKLTKQKR  1034


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKG-SANRSVK  1932
             Y E  YEEL+ G + VK  +   RCP+C  KK         + +HA+GVG+  S  RS  
Sbjct  299   YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  358

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRAV  1848
             +KANH+AL KYL+ DL +   P P + +
Sbjct  359   EKANHLALVKYLKRDLMNVGAPCPSKPM  386


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  135   YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  194

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             K  H+AL KYL+ DL    +P
Sbjct  195   KTTHLALMKYLKNDLKYMNDP  215



>ref|XP_006599359.1| PREDICTED: uncharacterized protein PFB0765w-like [Glycine max]
Length=659

 Score =   409 bits (1050),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 258/619 (42%), Positives = 394/619 (64%), Gaps = 16/619 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRS-  1938
             I+EY++K YEEL +G   VK  +    CP+C  K+K+DY Y +LLQHA+GVG+ S+  + 
Sbjct  38    ISEYEDKSYEELNNGSQNVKTSDETFTCPYCPKKRKRDYLYNELLQHASGVGQNSSQMTK  97

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNN--------LYCWPWTGIVVNVSKD  1782
              + KANH+AL KYLE DL      +P +   P D N         + WPW GIVVN+   
Sbjct  98    ARDKANHLALVKYLEKDL--MTVDVPSKDSKPVDENEPSVNSDEQFVWPWIGIVVNIPTR  155

Query  1781  NANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFEN  1611
               +G  V E    L+   R   +    V    + +  +   +++ K DW G  NA+ FE 
Sbjct  156   WIDGHYVGESGTKLRDEYRSRGFNPVRVTPLWNFRGHSGIALVEFKKDWPGLDNALAFER  215

Query  1610  AFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEK  1431
              +E + H KK+W A  S   S +Y W A+ DDY+     G  L++   LKTI + ++EE 
Sbjct  216   TYELDHHGKKDWFA-NSEQKSGLYAWVARADDYKVNNIYGEQLQKMGDLKTIPERMEEEA  274

Query  1430  RDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLA  1251
             R +D ++SNLTN + +KN++L  +  R +E    ++  + EKD L R +  E +KMQ  A
Sbjct  275   RKQDILVSNLTNIIQVKNQHLKEIEVRCHETTNKMNLAMNEKDKLIRTYNAEIKKMQSSA  334

Query  1250  REHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSL  1071
              +H++R+  + E L  +LE +K +L+    +L KRE   E E+ KL EE + N  +NSSL
Sbjct  335   SDHLKRIFTDHEKLKFQLESQKNELELRKIDLEKREAHNESERKKLAEEIEENATKNSSL  394

Query  1070  EMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVME  891
             +MA+ EQKKADENV++L E+ +R+KE    KI++L+K +D KQ+LE+EIQ+LKG L V++
Sbjct  395   QMAALEQKKADENVMKLAEDQQRQKELLHAKIIQLQKQLDMKQELELEIQQLKGSLSVLK  454

Query  890   HMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGL  711
             HM  D+D+ V +K+  +++ L +K + +++LD +N AL++KER+SNDELQEARK L+   
Sbjct  455   HMEDDEDAEVLKKVDTLQKDLRDKEQSLEELDALNQALIVKERESNDELQEARKALVDVR  514

Query  710   SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPF  531
                L+S  S+I ++RMGEID   F +  K+R++ EEA+ +A ELCSLW+E +K+P+WHPF
Sbjct  515   MKELSS-HSNIRLKRMGEIDTIPFLDAMKKRYNEEEAEERASELCSLWEEYLKNPDWHPF  573

Query  530   RVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFK  351
             +VI +  + ++I+ +DDE+L++LK + GE    AV++A+ E+NE+N SGRY+   +WN+K
Sbjct  574   KVIMVEGKEKEIVRDDDEKLNELKNDLGEGAYKAVVQALSEINEHNPSGRYLTSVVWNYK  633

Query  350   EGRKATLKEVVSFIFKQLK  294
             EGR+A+LKE V F+    K
Sbjct  634   EGRRASLKEGVQFLLNHWK  652



>ref|NP_001042014.1| Os01g0147700 [Oryza sativa Japonica Group]
 dbj|BAD61126.1| putative transcription factor X1 [Oryza sativa Japonica Group]
 dbj|BAD61269.1| putative transcription factor X1 [Oryza sativa Japonica Group]
 dbj|BAF03928.1| Os01g0147700 [Oryza sativa Japonica Group]
Length=700

 Score =   409 bits (1052),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 255/670 (38%), Positives = 399/670 (60%), Gaps = 78/670 (12%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y+E+ Y  LRSG ++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S  R   
Sbjct  49    SDYEERSYGLLRSGNHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGASSKRRRHG  108

Query  1934  KQKANHVALAKYLEID------------LGDQAEPLP--------QRAVAPEDNNL----  1827
             +++A H A A+++  D            +   A+ +         ++A A  D +     
Sbjct  109   RERAFHRAFARFVRTDPSFAQDLAAINGIATTADAISNSSAAGAKEKADANGDTDGSASV  168

Query  1826  -------------YCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDD-  1689
                          + WPW+G++       A G     ED+         A  V +F  D 
Sbjct  169   AAVAAGNRREEERFAWPWSGVL-------AAGAGFNAEDF---------ADRVAMFGLDD  212

Query  1688  ---------KSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS----  1548
                      +   S  +++  + W G+ +A+  EN F      K EW A  S+  +    
Sbjct  213   VVPLVVDDAEGADSFAIVRFANGWGGFGDALTLENHFNKNKLGKNEWDARGSAGDAVKGD  272

Query  1547  ------HVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELD  1386
                    VYGW A+  DY A   VG YLR+   L TI ++ + E     K+++ L  +++
Sbjct  273   DGDTDVKVYGWVAREGDYNAGNVVGRYLRKHTNLTTIDEVSKSESEKSGKMVAILATQIE  332

Query  1385  LKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLN  1206
              KN  L  L T+ N   LS++R+ E+   LH A+ EE R + R AR++  RV  + E L 
Sbjct  333   AKNRFLQDLETKKNATELSIARLEEDNRKLHDAYNEEMRNLHRRARDYALRVFQDNENLK  392

Query  1205  SELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVL  1026
              EL+ ++++L+S  ++L K       ++ KLD++K++  + NS LE+AS EQ++ADE+V+
Sbjct  393   LELDSRRRELNSRAKQLEKITAENASDRKKLDDQKQKAKDDNSELELASIEQQRADEDVM  452

Query  1025  RLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIK  846
             +L+E+ KREKE  L ++L+LEK++  KQ+LE+E+  L G L VM+H+ GDDD  + +K++
Sbjct  453   KLVEDQKREKEDVLARMLQLEKELHEKQQLELEVTRLNGTLQVMKHLEGDDDGDIHDKME  512

Query  845   EMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRR  666
             ++ E+L+    + K L+E++  LV KER+SNDELQEARK LI GL D+L +GR+ IGI+R
Sbjct  513   KLSERLEH---EKKRLEELSGELVKKERESNDELQEARKELIMGLEDML-TGRTAIGIKR  568

Query  665   MGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINe  486
             MGE+D K F N CK+++  ++ + KA EL S WQE++K P+WHP+++I +    ++++++
Sbjct  569   MGELDEKPFQNACKRKYGNDDYETKAAELVSSWQEEIKKPSWHPYKIITVDGEDKEVVDD  628

Query  485   ddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIF  306
             DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+PELWNF++GRKAT+KEV+ +IF
Sbjct  629   DDTKLRHLWIEYGDDVCNAVKTALSEVNEYNASGRYVVPELWNFRKGRKATMKEVLKYIF  688

Query  305   KQLKTHKRKR  276
              Q++T  ++R
Sbjct  689   GQIETTSKRR  698



>ref|XP_006595902.1| PREDICTED: uncharacterized protein LOC100790814 isoform X3 [Glycine 
max]
Length=1073

 Score =   419 bits (1077),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 255/620 (41%), Positives = 388/620 (63%), Gaps = 14/620 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKGSA-NRSVK  1932
             Y  K YE L+ G + VK       CP+C  KK++       + +HA+GVG+ S+  RS  
Sbjct  455   YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYVYREILEHASGVGQSSSEKRSAI  514

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRA--VAPEDN--NLYCWPWTGIVVNV-SKDNANGT  1767
             +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTGIVVN+ ++    G 
Sbjct  515   EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGIVVNIPTRLTEEGC  573

Query  1766  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+   R   +  Q V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  574   CVGESGSKLRDEYRSRGFNPQRVRILSNFCGHSGTAVVEFNKNWTGLDNALAFERAYELD  633

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W A  +   S +Y W A+ DDY+    +G  L++   +KTI++L++EE R +DK
Sbjct  634   HHGKKDWFA-NTEHKSGIYAWIARADDYKVNNIIGEQLQKMGDIKTISELMEEEARMQDK  692

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             +LS+L N L +K + L  +  ++ E +  +  ++ E D L +   +E +K+Q  A +H Q
Sbjct  693   LLSSLNNTLQVKKKRLKEMEVKYYETSHRMDIVMGEIDKLTQGHNQEMKKIQSSATQHFQ  752

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
              + +  E L  +LE +K++L+    EL KRE   E E+ KL+EE   N  +NSSL+MA  
Sbjct  753   NIFNGHERLKLQLESQKRELELRRIELEKREARNESERKKLEEEIMENALKNSSLDMAVL  812

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KA ENVL+L  + KR+KE    KI+ LE+ ++ KQKLE+EIQ+LKGKL+VM ++  D
Sbjct  813   EQQKAGENVLKLAADQKRQKEQFHAKIILLERQLEVKQKLELEIQQLKGKLNVMAYIEDD  872

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              D+ V  K+  + + L EK + ++DLD +N  L++KERQSNDELQEARK LI G+ ++  
Sbjct  873   GDTEVLNKVDALHKDLREKEQSLRDLDSLNQTLIIKERQSNDELQEARKELINGIKEI--  930

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R+++G++RMGE+D + F    K++++ E+A+ +A ELCSLW+E +KDP+WHPF++  I
Sbjct  931   SCRANVGVKRMGELDIRPFLEAMKKKYNDEDAEDRASELCSLWEEYIKDPDWHPFKITMI  990

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               + ++II++DDE+L  LK E GE +  AV+ A+ E+N YN SGRY+  ELWN++EG++A
Sbjct  991   EGKHQEIIDDDDEKLKGLKNEMGEGVYKAVVTALTEINTYNPSGRYITSELWNYEEGKRA  1050

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TL+E V  +  Q K  K+KR
Sbjct  1051  TLQEGVKLLLMQWKLTKQKR  1070


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKG-SANR  1941
             I  Y EK YEEL+ G + VK  +   RCP+C+ KK         + +HA+GVG+  S  R
Sbjct  332   IGRYAEKFYEELKRGIHNVKTSDETFRCPYCSNKKINRDYVYREILEHASGVGQSKSQKR  391

Query  1940  SVKQKANHVALAKYLEIDLGDQAEPLPQRAV  1848
             S  +KANH+AL KYL+ DL +   P P + +
Sbjct  392   SFIEKANHLALVKYLKKDLMNVGAPCPSKPM  422


 Score = 57.0 bits (136),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y EK Y+EL+ G + V+  +  L CP+C  K+KQDY Y++LL+HA+GVG+ S+  R V++
Sbjct  171   YVEKFYKELKKGNHMVQTSDLTLCCPYCPKKRKQDYVYRELLEHASGVGQSSSEKRHVRE  230

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             KA H+AL KYL+ DL    +P
Sbjct  231   KATHLALMKYLKNDLKYLNDP  251



>gb|EAZ10533.1| hypothetical protein OsJ_00365 [Oryza sativa Japonica Group]
Length=701

 Score =   409 bits (1051),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 255/671 (38%), Positives = 399/671 (59%), Gaps = 79/671 (12%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y+E+ Y  LRSG ++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S  R   
Sbjct  49    SDYEERSYGLLRSGNHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGASSKRRRHG  108

Query  1934  KQKANHVALAKYLEID------------LGDQAEPLP--------QRAVAPEDNNL----  1827
             +++A H A A+++  D            +   A+ +         ++A A  D +     
Sbjct  109   RERAFHRAFARFVRTDPSFAQDLAAINGIATTADAISNSSAAGAKEKADANGDTDGSASV  168

Query  1826  --------------YCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDD  1689
                           + WPW+G++       A G     ED+         A  V +F  D
Sbjct  169   AAVAAAGNRREEERFAWPWSGVL-------AAGAGFNAEDF---------ADRVAMFGLD  212

Query  1688  ----------KSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS---  1548
                       +   S  +++  + W G+ +A+  EN F      K EW A  S+  +   
Sbjct  213   DVVPLVVDDAEGADSFAIVRFANGWGGFGDALTLENHFNKNKLGKNEWDARGSAGDAVKG  272

Query  1547  -------HVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNEL  1389
                     VYGW A+  DY A   VG YLR+   L TI ++ + E     K+++ L  ++
Sbjct  273   DDGDTDVKVYGWVAREGDYNAGNVVGRYLRKHTNLTTIDEVSKSESEKSGKMVAILATQI  332

Query  1388  DLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETL  1209
             + KN  L  L T+ N   LS++R+ E+   LH A+ EE R + R AR++  RV  + E L
Sbjct  333   EAKNRFLQDLETKKNATELSIARLEEDNRKLHDAYNEEMRNLHRRARDYALRVFQDNENL  392

Query  1208  NSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENV  1029
               EL+ ++++L+S  ++L K       ++ KLD++K++  + NS LE+AS EQ++ADE+V
Sbjct  393   KLELDSRRRELNSRAKQLEKITAENASDRKKLDDQKQKAKDDNSELELASIEQQRADEDV  452

Query  1028  LRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKI  849
             ++L+E+ KREKE  L ++L+LEK++  KQ+LE+E+  L G L VM+H+ GDDD  + +K+
Sbjct  453   MKLVEDQKREKEDVLARMLQLEKELHEKQQLELEVTRLNGTLQVMKHLEGDDDGDIHDKM  512

Query  848   KEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIR  669
             +++ E+L+    + K L+E++  LV KER+SNDELQEARK LI GL D+L +GR+ IGI+
Sbjct  513   EKLSERLEH---EKKRLEELSGELVKKERESNDELQEARKELIMGLEDML-TGRTAIGIK  568

Query  668   RMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIIN  489
             RMGE+D K F N CK+++  ++ + KA EL S WQE++K P+WHP+++I +    +++++
Sbjct  569   RMGELDEKPFQNACKRKYGNDDYETKAAELVSSWQEEIKKPSWHPYKIITVDGEDKEVVD  628

Query  488   eddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFI  309
             +DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+PELWNF++GRKAT+KEV+ +I
Sbjct  629   DDDTKLRHLWIEYGDDVCNAVKTALSEVNEYNASGRYVVPELWNFRKGRKATMKEVLKYI  688

Query  308   FKQLKTHKRKR  276
             F Q++T  ++R
Sbjct  689   FGQIETTSKRR  699



>gb|EMS57088.1| hypothetical protein TRIUR3_02882 [Triticum urartu]
Length=771

 Score =   411 bits (1056),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 252/615 (41%), Positives = 391/615 (64%), Gaps = 27/615 (4%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNG-CLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             Y  K    L SG  K +  NG    CPFC G+K +DY  + LLQH++GVG  + NR  K 
Sbjct  19    YGAKIQARLLSGDLKFR--NGDSYSCPFCTGRKNKDYNMQSLLQHSSGVG-AAPNRPAKD  75

Query  1928  KANHVALAKYLEIDLGDQAEPLPQRAVA----------------PEDNNLYCWPWTGIVV  1797
             KA+H ALAK+L+  +   ++P   + +A                P  +  + WPW G++V
Sbjct  76    KASHRALAKHLKNGVAKPSDPQQAQQIAVEPQQPQQIAVEPQPLPNRHEKFVWPWMGVLV  135

Query  1796  NVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAIL  1620
             NV  +  +G  V E    LK   S++   +V    + +  T   +++   +WNG++NA+ 
Sbjct  136   NVPTEWKDGRQVGESGNRLKGELSQFCPLKVIPLWNFRGHTGNAIVEFAKNWNGFRNALA  195

Query  1619  FENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQ  1440
             FE  FEA    +++W  +  +  S + GW A+ +DY   G +G +LR+   LKTI DL  
Sbjct  196   FEKYFEAGGCGRRDWK-QNMNQGSKLCGWVARAEDYNFPGLIGDHLRKNADLKTIDDLEN  254

Query  1439  EEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQ  1260
             E  R  +K+++NL N++++KN+ L  L  R+NE  +SL +M+ +++   +A+ EE RKMQ
Sbjct  255   EGTRKNNKLVANLANQIEVKNKYLQELELRYNETTVSLEKMMGQREQRLQAYNEEIRKMQ  314

Query  1259  RLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRN  1080
             +LAR H ++++ E + L SELE K  +L++ ++EL+     +  +K  L++EK++N  ++
Sbjct  315   QLARRHSEKIIDENQNLRSELESKMSELNARSKELDDLAAKSSHDKSNLEQEKQKNAIKS  374

Query  1079  SSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLD  900
             + L++A+ EQ++ADE+V++L+ + KREK AAL KILELE+ ++AKQ LE+EIQ+LKGKL+
Sbjct  375   NHLKLATAEQQRADEDVVKLVRDQKREKVAALNKILELEQQLEAKQTLELEIQQLKGKLE  434

Query  899   VMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             VM+HM G +DS  ++KI E+ E+L +K++++  ++ +N  LV+KE +SN E+QEARK L 
Sbjct  435   VMKHMPGHEDSVSKDKINELSEELQDKMDELDAMESLNQTLVIKESKSNTEMQEARKELE  494

Query  719   QGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNW  540
              GL + L  GR+HIGI+RMGE+D KA  NV  Q+ S E+A+V A  LCS W+ ++K+P W
Sbjct  495   NGLLN-LPGGRAHIGIKRMGELDLKAVSNVLGQKLSKEDAEVTAAILCSKWEAEIKNPEW  553

Query  539   HPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNA-SGRYVIPEL  363
             HPFR + +  +  + IN DD +L +LK+E GEEI + V KA+    EYN  S RY + EL
Sbjct  554   HPFRAVMVDGKEMERINADDAKLRELKDEHGEEIYSLVTKALR---EYNVNSTRYPVGEL  610

Query  362   WNFKEGRKATLKEVV  318
             WNF+E RKA+LKE V
Sbjct  611   WNFREERKASLKEAV  625



>gb|EAY72526.1| hypothetical protein OsI_00387 [Oryza sativa Indica Group]
Length=700

 Score =   408 bits (1048),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 252/670 (38%), Positives = 394/670 (59%), Gaps = 78/670 (12%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y+E+ Y  LRSG ++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S  R   
Sbjct  49    SDYEERSYGLLRSGNHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGASSKRRRHG  108

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAP-----------------------------  1842
             +++A H A A+++  D     +      +A                              
Sbjct  109   RERAFHRAFARFVRTDPSFAQDLAAINGIATTADASSNSSATGAKEKADANGGTDGSASV  168

Query  1841  --------EDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDD-  1689
                     ++   + WPW+G++       A G     ED+         A  V +F  D 
Sbjct  169   AAAAVGNRQEEERFAWPWSGVL-------AAGAGFNAEDF---------ADRVAMFGLDD  212

Query  1688  ---------KSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS----  1548
                      +   S  +++  + W G+ +A+  EN F      K EW A  S+  +    
Sbjct  213   VVPLVVDDAEGADSFAIVRFANGWGGFGDALTLENHFNKNKLGKNEWDARGSAGDAVKGE  272

Query  1547  ------HVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELD  1386
                    VYGW A+  DY A   VG YLR+   L TI ++ + E     K+++ L  +++
Sbjct  273   DGETDVKVYGWVAREGDYNAGNVVGRYLRKHTNLTTIDEVSKSESEKSGKMVAILATQIE  332

Query  1385  LKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLN  1206
              KN  L  L T+ N   LS++R+ E+   LH A+ EE R + R AR++  RV  + E L 
Sbjct  333   AKNRFLQDLETKKNATELSIARLEEDNRKLHDAYNEEMRNLHRRARDYALRVFQDNENLK  392

Query  1205  SELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVL  1026
              EL+ ++++L+S  ++L K       ++ KLD++K++  + NS LE+AS EQ++ADE+V+
Sbjct  393   LELDSRRRELNSRAKQLEKITAENANDRKKLDDQKQKAKDDNSELELASIEQQRADEDVM  452

Query  1025  RLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIK  846
             +L+E+ KREKE  L ++L+LEK++  KQ+LE+E+  L G L VM+H+ GDDD  + +K++
Sbjct  453   KLVEDQKREKEDVLARMLQLEKELHEKQQLELEVTRLNGTLQVMKHLEGDDDGDIHDKME  512

Query  845   EMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRR  666
             ++ E+L+    + K L+E++  LV KER+SNDELQEARK LI GL D+L +GR+ IGI+R
Sbjct  513   KLSERLEH---EKKRLEELSGELVKKERESNDELQEARKELIMGLEDML-TGRTAIGIKR  568

Query  665   MGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINe  486
             MGE+D K F N CK+++  ++ + KA EL S WQE++K P+WHP+++I +    ++++++
Sbjct  569   MGELDEKPFQNACKRKYGNDDYETKAAELVSSWQEEIKKPSWHPYKIITVDGEDKEVVDD  628

Query  485   ddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIF  306
             DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+PELWNF++GRKAT+KEV+ +IF
Sbjct  629   DDTKLRHLWIEYGDDVCNAVKTALSEVNEYNASGRYVVPELWNFRKGRKATMKEVLKYIF  688

Query  305   KQLKTHKRKR  276
              Q++T  ++R
Sbjct  689   GQIETTSKRR  698



>ref|XP_006575503.1| PREDICTED: uncharacterized protein LOC100806426 isoform X1 [Glycine 
max]
 ref|XP_006575504.1| PREDICTED: uncharacterized protein LOC100806426 isoform X2 [Glycine 
max]
Length=1153

 Score =   420 bits (1079),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 254/620 (41%), Positives = 388/620 (63%), Gaps = 14/620 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKGSA-NRSVK  1932
             Y  K YE L+ G + VK       CP+C  KK++       + +HA+GVG+ S+  RS  
Sbjct  535   YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  594

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRA--VAPEDN--NLYCWPWTGIVVNV-SKDNANGT  1767
             +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+ ++   +G 
Sbjct  595   EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNIPTRLTEDGR  653

Query  1766  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+   R   +  + V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  654   CVGESGSKLRDEYRSRGFNPRRVRILSNFCVHSGTAVVEFNKNWTGLDNALAFERAYELD  713

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W A  +   S +Y W A+ DDY+    +G  LR+   +KTI++L++EE R +DK
Sbjct  714   HHGKKDWFAN-TQHKSGIYAWIAQADDYKMNNIIGEQLRKMVDIKTISELMEEEARTQDK  772

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++SNL N L +K + L  +  ++ E +  +  ++ E D L +   +E +K+Q  A +H Q
Sbjct  773   LVSNLNNTLQVKKKRLKEMEVKYYETSRRMDIVMGEIDKLTQGHNQEMKKIQSSATQHFQ  832

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
              + +  E L  +LE +K++L+    EL KRE   E E+ KL+EE   N  +NSSL+MA  
Sbjct  833   NIFNGHERLKLQLESQKRELELRRIELEKREARNESERKKLEEEIMENALKNSSLDMAVL  892

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KA ENVL+L  + KR+KE    KI+ LE+ ++ KQKLE+EIQ+LKGKL+VM H+  D
Sbjct  893   EQQKAGENVLKLAADQKRQKEQFHAKIILLERQLEVKQKLELEIQQLKGKLNVMAHIEDD  952

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              DS V  K+  + + L EK + ++DLD +N  L++KERQSNDELQEARK LI G+ ++  
Sbjct  953   GDSEVLNKVDALHKDLREKEQSLRDLDSLNQTLIIKERQSNDELQEARKELINGIKEI--  1010

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R+++G++RMGE+D + F    K +++ E+A+ +A ELCSLW+E ++DP+WHPF++  I
Sbjct  1011  SCRANVGVKRMGELDIRPFLEAMKIKYNNEDAEDRASELCSLWEEYIRDPDWHPFKITII  1070

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               + ++II+++DE+L  LK E GE +  AV+ A+ E+N YN SGRY+  ELWN++EG++A
Sbjct  1071  EGKHQEIIDDEDEKLKGLKNEMGEGVYKAVVTALTEINTYNPSGRYITSELWNYEEGKRA  1130

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TL+E V  +  Q K  K+KR
Sbjct  1131  TLQEGVKLLLMQWKLTKQKR  1150


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKG-SANRSVK  1932
             Y E  YEEL+ G + VK  +   RCP+C  KK         + +HA+GVG+  S  RS  
Sbjct  415   YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  474

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRAV  1848
             +KANH+AL KYL+ DL +   P P + +
Sbjct  475   EKANHLALVKYLKRDLMNVGAPCPSKPM  502


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20    YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  1928  KANHVALAKYLEIDL  1884
             KANH+AL KYLE DL
Sbjct  79    KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251   YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             K  H+AL KYL+ DL    +P
Sbjct  311   KTTHLALMKYLKNDLKYMNDP  331



>ref|XP_003545257.1| PREDICTED: uncharacterized protein LOC100790814 isoform X1 [Glycine 
max]
 ref|XP_006595901.1| PREDICTED: uncharacterized protein LOC100790814 isoform X2 [Glycine 
max]
Length=1154

 Score =   419 bits (1076),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 255/620 (41%), Positives = 388/620 (63%), Gaps = 14/620 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKGSA-NRSVK  1932
             Y  K YE L+ G + VK       CP+C  KK++       + +HA+GVG+ S+  RS  
Sbjct  536   YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYVYREILEHASGVGQSSSEKRSAI  595

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRA--VAPEDN--NLYCWPWTGIVVNV-SKDNANGT  1767
             +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTGIVVN+ ++    G 
Sbjct  596   EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGIVVNIPTRLTEEGC  654

Query  1766  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+   R   +  Q V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  655   CVGESGSKLRDEYRSRGFNPQRVRILSNFCGHSGTAVVEFNKNWTGLDNALAFERAYELD  714

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W A  +   S +Y W A+ DDY+    +G  L++   +KTI++L++EE R +DK
Sbjct  715   HHGKKDWFA-NTEHKSGIYAWIARADDYKVNNIIGEQLQKMGDIKTISELMEEEARMQDK  773

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             +LS+L N L +K + L  +  ++ E +  +  ++ E D L +   +E +K+Q  A +H Q
Sbjct  774   LLSSLNNTLQVKKKRLKEMEVKYYETSHRMDIVMGEIDKLTQGHNQEMKKIQSSATQHFQ  833

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
              + +  E L  +LE +K++L+    EL KRE   E E+ KL+EE   N  +NSSL+MA  
Sbjct  834   NIFNGHERLKLQLESQKRELELRRIELEKREARNESERKKLEEEIMENALKNSSLDMAVL  893

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KA ENVL+L  + KR+KE    KI+ LE+ ++ KQKLE+EIQ+LKGKL+VM ++  D
Sbjct  894   EQQKAGENVLKLAADQKRQKEQFHAKIILLERQLEVKQKLELEIQQLKGKLNVMAYIEDD  953

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              D+ V  K+  + + L EK + ++DLD +N  L++KERQSNDELQEARK LI G+ ++  
Sbjct  954   GDTEVLNKVDALHKDLREKEQSLRDLDSLNQTLIIKERQSNDELQEARKELINGIKEI--  1011

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R+++G++RMGE+D + F    K++++ E+A+ +A ELCSLW+E +KDP+WHPF++  I
Sbjct  1012  SCRANVGVKRMGELDIRPFLEAMKKKYNDEDAEDRASELCSLWEEYIKDPDWHPFKITMI  1071

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               + ++II++DDE+L  LK E GE +  AV+ A+ E+N YN SGRY+  ELWN++EG++A
Sbjct  1072  EGKHQEIIDDDDEKLKGLKNEMGEGVYKAVVTALTEINTYNPSGRYITSELWNYEEGKRA  1131

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TL+E V  +  Q K  K+KR
Sbjct  1132  TLQEGVKLLLMQWKLTKQKR  1151


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 60/91 (66%), Gaps = 2/91 (2%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkk-kqdykykdllQHATGVGKG-SANR  1941
             I  Y EK YEEL+ G + VK  +   RCP+C+ KK  +DY Y+++L+HA+GVG+  S  R
Sbjct  413   IGRYAEKFYEELKRGIHNVKTSDETFRCPYCSNKKINRDYVYREILEHASGVGQSKSQKR  472

Query  1940  SVKQKANHVALAKYLEIDLGDQAEPLPQRAV  1848
             S  +KANH+AL KYL+ DL +   P P + +
Sbjct  473   SFIEKANHLALVKYLKKDLMNVGAPCPSKPM  503


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  RS K+
Sbjct  20    YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRSAKE  78

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             KANH+AL KYLE DL     P
Sbjct  79    KANHLALVKYLEKDLAYMDGP  99


 Score = 56.6 bits (135),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y EK Y+EL+ G + V+  +  L CP+C  K+KQDY Y++LL+HA+GVG+ S+  R V++
Sbjct  252   YVEKFYKELKKGNHMVQTSDLTLCCPYCPKKRKQDYVYRELLEHASGVGQSSSEKRHVRE  311

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             KA H+AL KYL+ DL    +P
Sbjct  312   KATHLALMKYLKNDLKYLNDP  332



>ref|XP_010651011.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 ref|XP_010651012.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 ref|XP_010651013.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Vitis vinifera]
 emb|CBI16121.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   404 bits (1039),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 250/622 (40%), Positives = 393/622 (63%), Gaps = 21/622 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             +++Y+ + Y EL++G  +VK  +   RCP+C  K  +DY+ ++LLQHA+ VG+ S +  V
Sbjct  16    LDDYRYRYYRELQNGSVRVKISDTTFRCPYCPSKDDRDYRCRELLQHASRVGRDSGSGDV  75

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQR----AVAPEDNNLYCWPWTGIVVNVSKDNANGT  1767
             K+KA H+AL KYL+  L  +  P   +    + A + +  + WPW GI+ N+     +G 
Sbjct  76    KEKARHLALMKYLDKYLDTKQSPASTKDTESSTANDADGHFVWPWVGIIANIPVQRIDGR  135

Query  1766  AVEEEDYWLKRF---SKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    +K +     +    V    + +  +   +++   DW G+ NAI F+ AFEA+
Sbjct  136   YVGESGTKIKEYLAAQGFNPSRVNPLWNHRGHSGFAIVEFDKDWPGFTNAIAFDKAFEAD  195

Query  1595  CHSKKEW-TAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
                K++W TA+R      +YGW A+ DDY ++   G +L ++  LKT+ ++  E+KR   
Sbjct  196   HRGKRDWKTAKR--LGDKLYGWVAREDDYRSKSIFGEHLSKSWDLKTVEEIQAEDKRKTT  253

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
             K++SNLTN +++K   L  + +++ E ++SLS ++ +KD +H+AF EE  K+Q+ AR+H 
Sbjct  254   KLVSNLTNVIEVKTMRLKEIESKYAETSISLSNVMLQKDAMHQAFNEEITKIQQQARDHF  313

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM-A  1062
             +++  E      +LE +KK+         ++      ++   +E ++R       + M A
Sbjct  314   EKISLEHAKSTMQLEAQKKE--------LEKREKELEKRKAQNESERRKIYNEKKMNMKA  365

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             + EQKKADENVLRL E+ +REKE   ++I+ELE+ +DAKQ LE+EI+ ++G L VM+HMG
Sbjct  366   TIEQKKADENVLRLAEDQRREKENLHKRIIELERKLDAKQALELEIERMRGALQVMKHMG  425

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
              + D  ++ K+ E++E+L EK E++ DL+ +N ALV+KER+SNDELQEARK LI      
Sbjct  426   ENGDMDMKIKMDEIQEELKEKEEELDDLEALNQALVVKERKSNDELQEARKELISYFKG-  484

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
               SGR+ I +++MG++D K F    K+++S EEA+ KALE CSLW++ + D +WHPF+VI
Sbjct  485   -RSGRAFIAVKQMGDLDTKPFQKAMKRKYSEEEANEKALEWCSLWEQNLTDSSWHPFKVI  543

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
                   ++II+E+DE L  L+ E+G+E+  AV  A++E+NEYN SGRYV+ ELWNFKEGR
Sbjct  544   TDKGNCKEIIDEEDERLKDLQNEYGDEVYMAVTDALKEMNEYNPSGRYVVSELWNFKEGR  603

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             KATL+E V  I KQ + HKRKR
Sbjct  604   KATLREGVEDILKQWRLHKRKR  625



>ref|XP_006655910.1| PREDICTED: myosin-9-like [Oryza brachyantha]
Length=697

 Score =   405 bits (1042),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 257/670 (38%), Positives = 395/670 (59%), Gaps = 80/670 (12%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SVKQ  1929
             Y+EK Y  L+SG ++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S +R   ++
Sbjct  46    YEEKSYGLLKSGNHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGVSSKHRRHGRE  105

Query  1928  KANHVALAKYLEID--------------------LGDQAEPLPQRAVAPEDNNL------  1827
             +A H A A+++  D                    + D +      A    D N       
Sbjct  106   RAFHRAFARFVRTDPSFAQELAIINAKPGATVTAIADASANSNASAKEEADANGDTDGST  165

Query  1826  -------------YCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDK  1686
                          + WPW+G++       A G     E++         A  V +F  D 
Sbjct  166   SVTAAMGVKQEEKFAWPWSGVL-------AAGAGFNSENF---------ADRVAMFNLDD  209

Query  1685  SRT----------SQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS----  1548
                          S  +++  + W G+ +A+  EN F      KKEW A  S+  S    
Sbjct  210   VVPLVVDDVEGIESFAIVRFGNGWGGFGDALTLENHFNKNKLGKKEWEAWISAGDSMMGE  269

Query  1547  ------HVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELD  1386
                    VYGW A+  DY A   VG YLR+   L TI ++ + E     K+++ L  +++
Sbjct  270   NGETDVKVYGWVAREADYNAGNVVGRYLRKHTNLTTIDEVSKSESEKSGKMVAILATQIE  329

Query  1385  LKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLN  1206
              KN  L  L T+ N   LS+SR+ E+   LH A+ EE R + R AR++  RV  + E L 
Sbjct  330   AKNRYLQDLETKKNATELSISRLEEDNRKLHEAYNEEMRNLHRKARDYALRVFQDNENLK  389

Query  1205  SELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVL  1026
              EL+ ++++L+S  ++L K       ++ KLD++K++  + NS LE+AS EQ++ADE+VL
Sbjct  390   LELDSRRRELNSRAKQLEKITAENASDRKKLDDQKQKAKDDNSELELASIEQQRADEDVL  449

Query  1025  RLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIK  846
             +L+E+ KREKE  L ++L+LEK++  KQ+LE+E+  L G L VM+H+ GDDD  + EK++
Sbjct  450   KLVEDQKREKEDVLARMLQLEKELHEKQQLELEVTRLNGTLQVMKHLEGDDDGDISEKME  509

Query  845   EMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRR  666
             ++ E+L+    + K L+E++  LV KER+SNDELQEARK LI GL D+L +GR+ IGI+R
Sbjct  510   KLSERLEH---EKKRLEELSGELVKKERESNDELQEARKELITGLEDML-TGRTAIGIKR  565

Query  665   MGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINe  486
             MGE+D K F N C++++  ++ + KA EL S WQE++K P+WHP++++ I+   ++++++
Sbjct  566   MGELDEKPFQNACRRKYGNDDYETKAAELVSSWQEEIKKPSWHPYKIVTINGEDKEVVDD  625

Query  485   ddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIF  306
             DD +L  L  E+G+++C AV  A+ EVNEYNASGRYV+PELW+F++GRKAT+KEV+ +IF
Sbjct  626   DDTKLRHLWIEYGDDVCNAVKTALSEVNEYNASGRYVVPELWDFRKGRKATMKEVLKYIF  685

Query  305   KQLKTHKRKR  276
              Q++T  ++R
Sbjct  686   GQMETTGKRR  695



>gb|KHN41100.1| hypothetical protein glysoja_013442 [Glycine soja]
Length=1115

 Score =   416 bits (1068),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 251/620 (40%), Positives = 384/620 (62%), Gaps = 15/620 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKGSA-NRSVK  1932
             Y  K YE L+ G + VK       CP+C  KK++       + +HA+GVG+ S+  RS  
Sbjct  498   YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  557

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRA--VAPEDN--NLYCWPWTGIVVNV-SKDNANGT  1767
             +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+ ++   +G 
Sbjct  558   EKANHLALMKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNIPTRLTEDGR  616

Query  1766  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+   R   +  + V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  617   CVGESGSKLRDEYRSRGFNPRRVRILSNFCVHSGTAVVEFNKNWTGLDNALAFERAYELD  676

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W A  +   S +Y W A+ DDY+    +G  LR+   +KTI++L++EE R +DK
Sbjct  677   HHGKKDWFAN-TQHKSGIYAWIAQADDYKMNNIIGEQLRKMVDIKTISELMEEEARTQDK  735

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++SNL N L +K + L  +  ++ E +  +  ++ E D L +   +E +K+Q  A +H Q
Sbjct  736   LVSNLNNTLQVKKKRLKEMEVKYYETSRRMDIVMGEIDKLTQGHNQEMKKIQSSATQHFQ  795

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
              + +  E L  +LE +K++L+    EL KRE      + K  EE   N  +NSSL+MA  
Sbjct  796   NIFNGHERLKLQLESQKRELELRRIELEKREA-RNESERKKVEEIMENALKNSSLDMAVL  854

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KA ENVL+L  + KR+KE    KI+ LE+ ++ KQKLE+EIQ+LKGKL+VM H+  D
Sbjct  855   EQQKAGENVLKLAADQKRQKEQFHAKIILLERQLEVKQKLELEIQQLKGKLNVMAHIEDD  914

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              DS V  K+  + + L EK + ++DLD +N  L++KERQSNDELQEARK LI G+ ++  
Sbjct  915   GDSEVLNKVDALHKDLREKEQSLRDLDSLNQTLIIKERQSNDELQEARKELINGIKEI--  972

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R+++G++RMGE+D + F    K +++ E+A+ +A ELCSLW+E ++DP+WHPF++  I
Sbjct  973   SCRANVGVKRMGELDIRPFLEAMKIKYNNEDAEDRASELCSLWEEYIRDPDWHPFKITII  1032

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               + ++II+++DE+L  LK E GE +  AV+ A+ E+N YN SGRY+  ELWN++EG++A
Sbjct  1033  EGKHQEIIDDEDEKLKGLKNEMGEGVYKAVVTALTEINTYNPSGRYITSELWNYEEGKRA  1092

Query  335   TLKEVVSFIFKQLKTHKRKR  276
             TL+E V  +  Q K  K+KR
Sbjct  1093  TLQEGVKLLLMQWKLTKQKR  1112


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKG-SANRSVK  1932
             Y E  YEEL+ G + VK  +   RCP+C  KK         + +HA+GVG+  S  RS  
Sbjct  378   YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  437

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRAV  1848
             +KANH+AL KYL+ DL +   P P + +
Sbjct  438   EKANHLALVKYLKRDLMNVGAPCPSKPM  465


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20    YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  1928  KANHVALAKYLEIDL  1884
             KANH+AL KYLE DL
Sbjct  79    KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251   YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             K  H+AL KYL+ DL    +P
Sbjct  311   KTTHLALMKYLKNDLKYMNDP  331



>emb|CDM82421.1| unnamed protein product [Triticum aestivum]
 emb|CDM82462.1| unnamed protein product [Triticum aestivum]
Length=704

 Score =   404 bits (1038),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 250/667 (37%), Positives = 395/667 (59%), Gaps = 67/667 (10%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y+EK Y  L+SGK++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S +R   
Sbjct  48    SDYEEKSYGLLKSGKHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGISSKHRRHG  107

Query  1934  KQKANHVALAKYLEIDLG------------------------------------DQAEPL  1863
             +++A H A A+++  D                                        + P+
Sbjct  108   RERAFHRAFARFVRADPSFAQELSTIVGIPGATPSATANADASDKGKAIANGHTSGSSPV  167

Query  1862  PQRAVAPEDNN-LYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVK--IFCD  1692
                   P+D    + WPW GI+   +  NA   A         R + +  +++   +F D
Sbjct  168   AVDKGPPQDGEEKFAWPWCGILAAGAGFNAESFA--------DRVAMFSPEDIVPLVFDD  219

Query  1691  DKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTA-----------ERSSPSSH  1545
              ++     +++    W G+ +A+  EN F      KKEW A           E  +    
Sbjct  220   TENSECFAIVRFSPGWGGFSDALALENQFSVNKLGKKEWEAWSSCGGAVDGEENENGEVK  279

Query  1544  VYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLS  1365
             VYGW A+  DY AEG VG YLR+   +KTI ++ + ++    KI++ L  +L+ KN++L 
Sbjct  280   VYGWVAREVDYTAEGLVGRYLRKHIDIKTIDEITKSQREPLGKIVAALATQLEAKNQDLQ  339

Query  1364  ALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKK  1185
              L TR N    S++R+ E+   LH A+ EE RK+ R AR++  R+  + E L  E+E  K
Sbjct  340   DLETRKNATEFSIARLEEDNRRLHEAYNEEMRKLHRKARDNALRIFQDNENLKLEIENNK  399

Query  1184  KQLDSWNRELNKREVLTerek---lkldeekkrndeRNSSLEMASKEQKKADENVLRLIE  1014
             +++    ++L K  V    ++    +L +EK++  +  S LE+AS EQ++ D+++L+L+E
Sbjct  400   REMILRAKQLEKLSVENANDRKKLAELSDEKQKAKDDKSELELASIEQQRNDQDILKLVE  459

Query  1013  EHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKE  834
             + KREKE AL ++LELEK++  K++LE+E+  L G L VM+H+ GDDD  + +K++++ E
Sbjct  460   DQKREKEDALARMLELEKELHEKRELELEVTRLNGTLQVMKHLEGDDDGDIHDKMEKLSE  519

Query  833   QLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEI  654
             +L+    + K L+E++  LV KER+SNDELQEARK LI GL D+L SGR+ IGI+RMGE+
Sbjct  520   KLE---HERKRLEELSGELVRKERESNDELQEARKELIMGLEDIL-SGRTAIGIKRMGEL  575

Query  653   DGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE-QIINedde  477
             D + F N CK+++  ++ + +A EL S WQE++K P WHP++ +   D  + +++N++D 
Sbjct  576   DERPFQNACKRKYGNDDYETRAAELVSSWQEEIKKPAWHPYKFVKAEDGSDKEVVNDEDP  635

Query  476   elsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQL  297
              L +L  E+G+++C AV  A+ EVNEYN SGRYV+ ELWNF++ RKAT+KEV+ FIF+Q+
Sbjct  636   RLKQLWIEYGDDVCNAVKTALSEVNEYNPSGRYVVSELWNFRKNRKATMKEVLRFIFQQM  695

Query  296   KTHKRKR  276
             +   ++R
Sbjct  696   EVPGKRR  702



>ref|XP_008655632.1| PREDICTED: centrosomal protein of 128 kDa-like [Zea mays]
 gb|AFW80053.1| putative XH domain family protein [Zea mays]
Length=691

 Score =   404 bits (1037),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 256/663 (39%), Positives = 399/663 (60%), Gaps = 66/663 (10%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SVKQ  1929
             Y+E+ +  L+SGK++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S +R   ++
Sbjct  40    YEEESFGLLKSGKHRVRNPDGTFRCPFCPGKKKQGYKIKDLLQHADGIGVSSKHRRHGRE  99

Query  1928  KANHVALAKYLEID----------LGDQA--EPLP---------------------QRAV  1848
             +ANH A A+++  +           G Q   +P P                       +V
Sbjct  100   RANHRAFARFVRTEPSFAEDLVGITGIQGAIKPTPANRDGSTNGDGKAKANVDTAGSSSV  159

Query  1847  A-----PEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYW--LKRFSKYEAQEVKIFCDD  1689
             A     P +   + WPW  ++       A G     ED+   +  FS  E   V +F D+
Sbjct  160   AAKVGLPREVERFSWPWACVL-------AAGAGFNTEDFAGRVAMFSSVEV--VPLFVDE  210

Query  1688  -KSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS----------HV  1542
              +   +  V++  +DW+G+ +A+  EN F      KKE+    +   S           V
Sbjct  211   VEVAETFAVVRFTNDWSGFSDALTLENHFSINKLGKKEFEMRDNGIGSVEGDGGEGEVKV  270

Query  1541  YGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSA  1362
             YGW A+ +DY++   VG +LR+   LKTI ++ + E     ++++ L ++++ KN +L  
Sbjct  271   YGWVARAEDYDSPSVVGRFLRKHTVLKTIDEVSKTELEKSGEMVAILASKIEEKNRHLQD  330

Query  1361  LTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKK  1182
             L T+ N   LS+SR+ E+   LH A+ EE R + R ARE+  R+  E E L  +LE KK+
Sbjct  331   LETKKNATELSISRLEEDNRKLHEAYNEEMRNLHRRARENALRIFQENENLRIDLESKKR  390

Query  1181  QLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKR  1002
             +L+   +EL+K       ++  LD EK++    NS LE+AS EQ++AD +VL+L+ + +R
Sbjct  391   ELNLRAKELDKISTENANDRKTLDNEKQKAKYDNSELELASIEQQRADADVLKLLADQER  450

Query  1001  EKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDE  822
             EKE  L ++L+LEK++  KQ+LE+E++ L G L VM+H+ GDDD      I E  E+L E
Sbjct  451   EKEDVLARMLQLEKELHEKQQLELEVERLNGTLQVMKHLEGDDDGG---DIHEKMEKLSE  507

Query  821   KIE-DMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGK  645
             + E + K L+E++  LV KER+SNDELQEARK LI+GL + LN GR+ IG++RMGE+D K
Sbjct  508   RFEREKKRLEELSGDLVRKERESNDELQEARKELIKGLEEELN-GRTAIGVKRMGELDEK  566

Query  644   AFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsk  465
              F N CK ++  +E ++KA EL + WQ+++K P+WHPF+++ ++   ++I+++DD +L  
Sbjct  567   PFQNACKTKYGKDEYEIKAAELVTSWQDELKKPSWHPFKMVEVNGENKEILDDDDTKLKF  626

Query  464   lkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHK  285
             L  E+G+++C AV  A+ E+NEYN SGRYV+PELWNF++GRKAT+KEV+ ++F Q+ T  
Sbjct  627   LWIEYGDDVCNAVKTALMEINEYNPSGRYVVPELWNFRKGRKATVKEVLKYLFSQMDTTT  686

Query  284   RKR  276
             ++R
Sbjct  687   KRR  689



>ref|XP_006391023.1| hypothetical protein EUTSA_v10019728mg [Eutrema salsugineum]
 gb|ESQ28309.1| hypothetical protein EUTSA_v10019728mg [Eutrema salsugineum]
Length=621

 Score =   401 bits (1030),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 248/609 (41%), Positives = 382/609 (63%), Gaps = 36/609 (6%)
 Frame = -1

Query  2099  EKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKAN  1920
             E PY+ L+ G YKVK      RCPFC+GKKKQ YKYKDLL HATG+  GSA+RS KQKAN
Sbjct  22    EYPYKLLKKGDYKVKLKEDTFRCPFCSGKKKQHYKYKDLLAHATGLAIGSASRSAKQKAN  81

Query  1919  HVALAKYLEIDL-GDQAEPLPQRAVAPEDN-----NLYCWPWTGIVVNVSKDNANGTAVE  1758
             H+AL KY+E +L G  A  +P+  +    +     ++Y WPW GIV+N  + N +   + 
Sbjct  82    HLALRKYMENELAGGDAHQVPRLQIITSSSSKQSSDIYVWPWMGIVINPLRRNDDKNLLL  141

Query  1757  EEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKE  1578
             +  YWLK+ +++   EVK    ++     V+ K  S  +G+K+A   E  +E     KK+
Sbjct  142   DSAYWLKKLARFNPLEVKTLWVEQDSVVAVISKFNSGMSGFKSATELEREYEINRCGKKD  201

Query  1577  WTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLT  1398
             W+ +        YGW A+ DDY ++G++  YL    +L++ +D+ +EE  + + ++ +L 
Sbjct  202   WSVKTGDWRFKEYGWCARADDYNSQGSIAEYLSTVGKLRSFSDISKEEMLNTNIVVDDLA  261

Query  1397  NELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQ  1218
             +++ + NE+L+ +  + NEK +SL +++ EK+ L +A+ EE+++MQ  +R +V R+L ++
Sbjct  262   DKIAMTNEDLNKVQYKCNEKAVSLRKVLREKEELDQAYKEETKRMQEFSRLNVVRILEDK  321

Query  1217  ETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKAD  1038
             E L ++L    K L  W++EL+K+E LT          +      +   + +   QK+ D
Sbjct  322   EKLRNKL----KNLSDWSKELDKKEALT----------ELERQRLDEDKKKSDALQKETD  367

Query  1037  ENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQ  858
             + ++RL+EEHKR+KE  L++IL+LEK++ +KQKL+MEIQELKGKL VM H+  +DD  V+
Sbjct  368   DRLVRLVEEHKRQKEETLKEILQLEKELASKQKLQMEIQELKGKLQVMRHVEDEDDEDVK  427

Query  857   EKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHI  678
             EK+K+M E+L+EK   ++ L + N AL +K+RQ  DE+QEAR  LI GL ++L S R++I
Sbjct  428   EKMKKMNEELEEKSSTLEYLQDTNTALTIKDRQGIDEIQEARDELITGLREML-SDRTNI  486

Query  677   GIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD-PNWHPFRVINIHDRPE  501
              I+RMGEIDGK     CK+RF+ EEA V+   LCS WQE +K+ P+WHPF+ +   D+ +
Sbjct  487   RIKRMGEIDGKPLMKACKERFTGEEAGVQHAMLCSKWQENLKNVPSWHPFKFVGTGDKMQ  546

Query  500   --------------QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPEL  363
                            ++ E DE+L  L+EEWGE++  AV  A+EE NE N+SG   +  L
Sbjct  547   ILSHFMILHSGKLVVMVQEVDEQLRSLREEWGEDVKNAVKTALEERNECNSSGGASVQAL  606

Query  362   WNFKEGRKA  336
             WNFKE +K+
Sbjct  607   WNFKEKKKS  615



>ref|XP_008673715.1| PREDICTED: intraflagellar transport protein 74 homolog [Zea mays]
 tpg|DAA53475.1| TPA: putative XH domain family protein [Zea mays]
Length=685

 Score =   403 bits (1035),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 252/661 (38%), Positives = 397/661 (60%), Gaps = 63/661 (10%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SVKQ  1929
             Y+EK +  L+SGK++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S +R   ++
Sbjct  35    YEEKSFGLLKSGKHRVRNPDGTFRCPFCLGKKKQGYKIKDLLQHADGIGVSSKHRRHGRE  94

Query  1928  KANHVALAKYLEID----------LGDQ----------------------------AEPL  1863
             +ANH A A+++  D           G Q                            +  +
Sbjct  95    RANHRAFARFVRTDPSFAEDLVGITGIQGAITTTPANENYSANGNGKAKANVDTAGSSSV  154

Query  1862  PQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEV-KIFCDDK  1686
               +   P++   + WPW  ++       A G     ED+ + R + + + EV  +F D+ 
Sbjct  155   AAKVGPPQEVERFAWPWACVL-------AAGAGFNAEDF-VGRVALFSSVEVVPLFVDEM  206

Query  1685  SRT-SQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS---------HVYG  1536
               T +  +++  +DW+G+ +A+  EN F      KKE+    S   S          VYG
Sbjct  207   EVTETFAIVRFTNDWSGFNDALTIENYFSVNKLGKKEFQMRDSGLGSVEGDGEGDVKVYG  266

Query  1535  WFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALT  1356
             W A+ +DY+A   VG +LR+   L+TI ++ + E     ++++ L ++++ KN  L  L 
Sbjct  267   WVARAEDYDATTVVGRFLRKHTVLQTIDEVSKTELEKSGEMVAILASQIEEKNRYLQDLE  326

Query  1355  TRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQL  1176
             T+ N   LS+SR+ E+   LH A+ EE R + R ARE+  R+  E E L  +LE K+++L
Sbjct  327   TKKNATELSISRLEEDNRKLHEAYNEEMRNLHRRARENALRIFQENENLRIDLENKRREL  386

Query  1175  DSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREK  996
             +   +EL K       ++  LD++K++    NS LE+AS EQ++AD +VL+L+ + +REK
Sbjct  387   NLRAKELEKMSAENANDRKTLDDQKQKTKYDNSELELASIEQQRADADVLKLLADQEREK  446

Query  995   EAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKI  816
             E  L ++L+LEK++  KQ+LE+E++ L G L VM+H+ GDDD      I E  E+L E+ 
Sbjct  447   EDVLARMLQLEKELHEKQQLELEVERLNGTLQVMKHLEGDDDGG---DIHEKMEKLSERF  503

Query  815   E-DMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAF  639
             E + K L++++  LV KER+SNDELQ+ARK LI+GL + LN GR+ +GI+RMGE+D K F
Sbjct  504   EREKKRLEDLSGDLVTKERESNDELQQARKELIKGLEEELN-GRTAVGIKRMGELDEKPF  562

Query  638   HNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklk  459
              N CK+++   E  VKA EL + WQE++K+P+W+PF++I++    ++I+ +DD +L  L 
Sbjct  563   LNACKRKYGNNEYQVKAAELVTNWQEELKNPSWYPFKMIHVDGEDKEILVDDDTKLKFLW  622

Query  458   eEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRK  279
              E+G+++C AV  A+ E+NEYN SGRYV+PELWNF++GRKAT+KEV+ ++F Q+ T  ++
Sbjct  623   IEFGDDVCNAVKTALMEINEYNPSGRYVVPELWNFRKGRKATMKEVLKYLFSQMDTTTKR  682

Query  278   R  276
             R
Sbjct  683   R  683



>ref|XP_004968205.1| PREDICTED: uncharacterized protein LOC101778142 [Setaria italica]
Length=699

 Score =   403 bits (1036),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 255/662 (39%), Positives = 395/662 (60%), Gaps = 64/662 (10%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y+E+ +  L SGK++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S + R  ++
Sbjct  48    YEEQSFRLLTSGKHRVRNPDGTFRCPFCPGKKKQGYKIKDLLQHADGIGVSSKHCRHGRE  107

Query  1928  KANHVALAKYLEID-------------LGDQAEPLPQRA--------------------V  1848
             +A+H A A+++  D             LG   +P P  A                     
Sbjct  108   RASHRAFARFVRTDPSFAEDLVGITGILG-AIKPAPANANGSGSATAEAKANVGPTGSSS  166

Query  1847  APEDN-------NLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDD  1689
             AP +N         Y WPW  ++   +  NA     EE    +  FS  E   V +F D+
Sbjct  167   APAENVGPPREVERYAWPWACVLAAGAGFNA-----EEFAGRVAMFSFVEV--VPLFIDE  219

Query  1688  -KSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSS----------PSSHV  1542
              +   +  +++  +DW+G+ +A+  EN F      KKE+    S               V
Sbjct  220   IEGMETFAIVRFTNDWSGFNDALTLENHFSVNKLGKKEFETRNSGLGAAEGEGGEGEVKV  279

Query  1541  YGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSA  1362
             YGW A+  DY     VG +LR+   LKTI ++ + E     ++++ L ++++ KN  L  
Sbjct  280   YGWVAREGDYNGGTVVGRFLRKRTILKTIDEVSKTELEKSGEMVARLASQIEEKNRYLQD  339

Query  1361  LTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKK  1182
             L T+ N   LS+SR+ E+   LH A+ EE R + R ARE+  R+  E + L  ELE K++
Sbjct  340   LETKKNATELSISRLEEDNRKLHEAYNEEMRNLHRRARENALRIFQENDNLRQELENKRR  399

Query  1181  QLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKR  1002
             +L+S  ++L K       +   LD+EK++  + NS LE+AS EQ++AD +VL+L+++ KR
Sbjct  400   ELNSRAKQLEKLSAENANDWKTLDDEKQKAKDDNSELELASIEQQRADFDVLKLLDDQKR  459

Query  1001  EKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDE  822
             EKE    ++L+LEK++  KQ+LE+E+  L G L VM+H+ GDDD  + EK++++ E+L+ 
Sbjct  460   EKEDVFARMLQLEKELHEKQQLELEVARLNGTLQVMKHLEGDDDGDIHEKMEKLSERLER  519

Query  821   KIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKA  642
                + K L++++  LV KER+SNDELQ+ARK LI GL D LN GR+ IGI+RMGE+D K 
Sbjct  520   ---EKKRLEDLSGDLVRKERESNDELQQARKELIMGLEDELN-GRAAIGIKRMGELDEKP  575

Query  641   FHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelskl  462
             F N C+++F  ++  VKA EL + WQE++K P+WHPF+V+ ++   ++++++DD +L  L
Sbjct  576   FQNACRRKFGNDDYQVKAAELITNWQEELKKPSWHPFKVVQVNGEDKEVLDDDDAKLKFL  635

Query  461   keEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKR  282
               E+G+++C AV  A+ E+NEYN SGRYV+PELWNF++GRKAT KEV+ ++F Q++T  +
Sbjct  636   WIEYGDDVCNAVKTALMEINEYNPSGRYVVPELWNFRKGRKATTKEVLKYLFGQMETTTK  695

Query  281   KR  276
             +R
Sbjct  696   RR  697



>ref|XP_007009300.1| XH/XS domain-containing protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY18110.1| XH/XS domain-containing protein, putative isoform 3 [Theobroma 
cacao]
Length=566

 Score =   398 bits (1022),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 240/547 (44%), Positives = 360/547 (66%), Gaps = 21/547 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  16    MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  75

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  1782
              K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  76    AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  133

Query  1781  NANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  134   SEDGRSVGESGSKLRDELIRR--GFNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  191

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A++A+ H KKEW A        +Y W A+ DDY++ G +G  LR+T  LKTI+ +++E
Sbjct  192   EKAYQADHHGKKEWCANNDVKFG-LYAWVARADDYKSSGIIGENLRKTSDLKTISGIMEE  250

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +DK++SNLTN ++ KN+++  +  R +E + SL  +++EKD L +A+ EE +K+Q 
Sbjct  251   EARKQDKLVSNLTNIIETKNKHIKEMEARCSETSKSLEVLMDEKDNLLQAYNEEIKKIQL  310

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AREH  R+ ++ E L S+LE  K+ L+    EL KRE L E E+ KL EE ++N  +NS
Sbjct  311   SAREHFLRIFNDHEKLKSQLESHKRDLELRGVELEKREALNESERKKLAEELEQNAVQNS  370

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             +L++AS EQKKADENV++L E+ KR+KE    +I++LEK +D KQ LE+EI++L+G L+V
Sbjct  371   ALQLASLEQKKADENVMKLAEDQKRQKEELHNRIIQLEKQLDQKQALELEIEQLRGSLNV  430

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             + HMG +DD  V  K++   ++L EK  +++D++ +N  L+++ER+SNDELQEARK LI 
Sbjct  431   IRHMGDEDDIEVLRKMEATLKELREKEGELEDVEALNQTLIVRERKSNDELQEARKELIN  490

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             GL ++  S R+HIG++RMGE+D K F  V K+R++ E+A+ +A ELCSLW E +KDP+WH
Sbjct  491   GLKEI--SSRAHIGVKRMGELDSKPFFEVMKRRYNEEQAEERASELCSLWDEYLKDPDWH  548

Query  536   PFRVINI  516
             PF+ I +
Sbjct  549   PFKRIKL  555



>ref|XP_007009301.1| XH/XS domain-containing protein, putative isoform 4, partial 
[Theobroma cacao]
 gb|EOY18111.1| XH/XS domain-containing protein, putative isoform 4, partial 
[Theobroma cacao]
Length=567

 Score =   398 bits (1022),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 240/547 (44%), Positives = 360/547 (66%), Gaps = 21/547 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  12    MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  71

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  1782
              K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  72    AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  129

Query  1781  NANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  130   SEDGRSVGESGSKLRDELIRR--GFNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  187

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A++A+ H KKEW A        +Y W A+ DDY++ G +G  LR+T  LKTI+ +++E
Sbjct  188   EKAYQADHHGKKEWCANNDVKFG-LYAWVARADDYKSSGIIGENLRKTSDLKTISGIMEE  246

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +DK++SNLTN ++ KN+++  +  R +E + SL  +++EKD L +A+ EE +K+Q 
Sbjct  247   EARKQDKLVSNLTNIIETKNKHIKEMEARCSETSKSLEVLMDEKDNLLQAYNEEIKKIQL  306

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AREH  R+ ++ E L S+LE  K+ L+    EL KRE L E E+ KL EE ++N  +NS
Sbjct  307   SAREHFLRIFNDHEKLKSQLESHKRDLELRGVELEKREALNESERKKLAEELEQNAVQNS  366

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             +L++AS EQKKADENV++L E+ KR+KE    +I++LEK +D KQ LE+EI++L+G L+V
Sbjct  367   ALQLASLEQKKADENVMKLAEDQKRQKEELHNRIIQLEKQLDQKQALELEIEQLRGSLNV  426

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             + HMG +DD  V  K++   ++L EK  +++D++ +N  L+++ER+SNDELQEARK LI 
Sbjct  427   IRHMGDEDDIEVLRKMEATLKELREKEGELEDVEALNQTLIVRERKSNDELQEARKELIN  486

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             GL ++  S R+HIG++RMGE+D K F  V K+R++ E+A+ +A ELCSLW E +KDP+WH
Sbjct  487   GLKEI--SSRAHIGVKRMGELDSKPFFEVMKRRYNEEQAEERASELCSLWDEYLKDPDWH  544

Query  536   PFRVINI  516
             PF+ I +
Sbjct  545   PFKRIKL  551



>ref|XP_007009302.1| XH/XS domain-containing protein isoform 5 [Theobroma cacao]
 gb|EOY18112.1| XH/XS domain-containing protein isoform 5 [Theobroma cacao]
Length=561

 Score =   397 bits (1021),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 240/547 (44%), Positives = 360/547 (66%), Gaps = 21/547 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             + EY++K YE+L++GK+ +K       CP+C  KKK+DY YK+LLQHA+GVG   S  RS
Sbjct  1     MEEYEDKSYEKLKNGKHNIKVSEETYTCPYCPKKKKRDYLYKELLQHASGVGNSNSEKRS  60

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED-------NNLYCWPWTGIVVNV-SKD  1782
              K+KANH+AL KYLE DL   A     +  A ED       +    WPWTGIVVN+ ++ 
Sbjct  61    AKEKANHLALVKYLEKDL--VAVGSSSKTAAEEDPLSGYDHDEKIVWPWTGIVVNIPTRR  118

Query  1781  NANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             + +G +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ F
Sbjct  119   SEDGRSVGESGSKLRDELIRR--GFNPIRVLPLWNYRGHSGTAVVEFHKDWPGLHNALSF  176

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A++A+ H KKEW A        +Y W A+ DDY++ G +G  LR+T  LKTI+ +++E
Sbjct  177   EKAYQADHHGKKEWCANNDVKFG-LYAWVARADDYKSSGIIGENLRKTSDLKTISGIMEE  235

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +DK++SNLTN ++ KN+++  +  R +E + SL  +++EKD L +A+ EE +K+Q 
Sbjct  236   EARKQDKLVSNLTNIIETKNKHIKEMEARCSETSKSLEVLMDEKDNLLQAYNEEIKKIQL  295

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AREH  R+ ++ E L S+LE  K+ L+    EL KRE L E E+ KL EE ++N  +NS
Sbjct  296   SAREHFLRIFNDHEKLKSQLESHKRDLELRGVELEKREALNESERKKLAEELEQNAVQNS  355

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             +L++AS EQKKADENV++L E+ KR+KE    +I++LEK +D KQ LE+EI++L+G L+V
Sbjct  356   ALQLASLEQKKADENVMKLAEDQKRQKEELHNRIIQLEKQLDQKQALELEIEQLRGSLNV  415

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             + HMG +DD  V  K++   ++L EK  +++D++ +N  L+++ER+SNDELQEARK LI 
Sbjct  416   IRHMGDEDDIEVLRKMEATLKELREKEGELEDVEALNQTLIVRERKSNDELQEARKELIN  475

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
             GL ++  S R+HIG++RMGE+D K F  V K+R++ E+A+ +A ELCSLW E +KDP+WH
Sbjct  476   GLKEI--SSRAHIGVKRMGELDSKPFFEVMKRRYNEEQAEERASELCSLWDEYLKDPDWH  533

Query  536   PFRVINI  516
             PF+ I +
Sbjct  534   PFKRIKL  540



>ref|XP_006846222.1| hypothetical protein AMTR_s00012p00230440 [Amborella trichopoda]
 gb|ERN07897.1| hypothetical protein AMTR_s00012p00230440 [Amborella trichopoda]
Length=641

 Score =   399 bits (1026),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 265/631 (42%), Positives = 399/631 (63%), Gaps = 24/631 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+E  E  Y EL+SGK+ +K  +G  RCPFC GKKKQDY++KDLLQHATGVG  S+NR  
Sbjct  16    IDECVENIYSELKSGKHLIKNYDGTFRCPFCKGKKKQDYRHKDLLQHATGVG-ASSNRGT  74

Query  1934  KQKANHVALAKYLEIDLGDQA------EPLPQRAVAPEDNNLYCWPWTGIVVNVSKD--N  1779
             ++KA H AL K+L+ ++ D+       + LP+     + ++L  +PW GI+VN+  D   
Sbjct  75    EEKAKHQALGKFLKEEVPDEPGHSNEQKELPKPLTMSKSDDLLVFPWMGIIVNIETDYIR  134

Query  1778  ANGTAVEEEDYWLK-RFSKYEAQEVKIFC--DDKSRTSQVVIKLKSDWNGYKNAILFENA  1608
              +G  V      LK    K + + VK+    + +  T + V+    DW G+ +A+ FE  
Sbjct  135   KDGKYVGLGSTQLKDELEKEKLRPVKVHAKWNHQGHTGKAVVDFHKDWTGHHDAMSFEKH  194

Query  1607  FEAECH-SKKEWTAERSSPSSH---VYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQ  1440
             + AE H  KK+W  E+ S  SH    YGW A++DDYEAE  +G +LR+   LKT+ DL Q
Sbjct  195   Y-AELHRGKKQWFHEKRSGRSHKKGFYGWVARLDDYEAEDIIGKHLRQNGDLKTVADLAQ  253

Query  1439  EEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLS---LSRMIEEKDTLHRAFYEESR  1269
             E++R K  ++ +L NE+D KN  + +   +  E       L + +  +D  HR   ++ R
Sbjct  254   EQERRKQMLVQDLANEIDNKNRRIESHEEKLKEMEYQKNELDKKLALQDEAHRKELKKER  313

Query  1268  KMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrnd  1089
               QR A    Q ++ E+    + L+ ++ +L+  +REL + E   + EK KL+EEK++N 
Sbjct  314   --QRQADNWTQ-LMEERNRHKATLDLERDRLERRHRELERLEAHNDAEKKKLEEEKRKNA  370

Query  1088  eRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKG  909
              +NSSLE AS EQK  D  V +L+E HK E+E     I + +K+++ KQ LE+EIQ+LKG
Sbjct  371   LKNSSLEKASLEQKIVDGEVKKLMEHHKIEQERLANVIRKQQKELNEKQTLEVEIQKLKG  430

Query  908   KLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARK  729
             +L +M+HMGG+++S V EK+K + E+L EK  +M+ L+E+N+ LV KER++NDELQ ARK
Sbjct  431   ELVMMKHMGGENNSEVCEKMKLVTEELQEKENEMESLEELNSVLVSKERETNDELQAARK  490

Query  728   LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  549
               IQ   D  + GR+HIG++RMG +D + F+   K +   E+  +KA ELCSLW    +D
Sbjct  491   EAIQYFKDQTH-GRAHIGVKRMGVLDEQPFYRAVKAKLPNEDWQLKASELCSLWDAHTRD  549

Query  548   PNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  369
             P WHPF+ ++I  +  ++I+E+DE+  +L++E+G+E+C AV  A+ E+N+YN SGRY +P
Sbjct  550   PAWHPFKTVSIDGKDREVIDENDEKFKELRDEYGDEVCKAVETAMLELNDYNPSGRYPVP  609

Query  368   ELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
              LW+FKEGR+A+L+EV+    KQ KT KRKR
Sbjct  610   ALWHFKEGRQASLQEVIHHFVKQNKTKKRKR  640



>gb|EYU24614.1| hypothetical protein MIMGU_mgv1a004328mg [Erythranthe guttata]
Length=532

 Score =   395 bits (1014),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 238/533 (45%), Positives = 350/533 (66%), Gaps = 29/533 (5%)
 Frame = -1

Query  1847  APEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQV  1668
             +PE    YCWPW GI+ N   DN          YWL  FSKY    V+I  D     +QV
Sbjct  4     SPE---FYCWPWVGIIANAQNDNRG--------YWLNEFSKYNPSGVEILQD----GAQV  48

Query  1667  VIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGY  1488
             V++   D +G+KNAI FE +F+ +  SKKEW   R+SP + VYGW A+ DDY+++  VG 
Sbjct  49    VVRFGDDLSGFKNAIEFEKSFQDQGCSKKEWIDRRASPGASVYGWLAREDDYKSDDPVGN  108

Query  1487  YLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEE  1308
             YL  T  L+TI+D++ E   ++ KI SNL +E+D +NEN+ ++  +++E+ +SL +M+EE
Sbjct  109   YLCTTGGLRTISDVIDEVIENRKKIASNLVDEIDTRNENMDSMQIKYSERIMSLGKMLEE  168

Query  1307  KDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTer  1128
             KD LHR   EE+RK+  +    ++R L+EQE LN ELE K++QLDSW+ EL+KRE L E 
Sbjct  169   KDELHRTLCEETRKVHSI----IKRALNEQEMLNYELESKRRQLDSWSVELHKRESLIEN  224

Query  1127  eklkldeekkrndeRNSSLEMASKEQKKAD-ENVLRLIEEHKREKEAALQKILELEKDID  951
             E+ K++EEKK+ND R+++L+MA+K+ ++   EN LR++ E +RE E  L  + ELE+D  
Sbjct  225   ERRKIEEEKKQNDLRSNALQMAAKKPRRTTYENGLRMLGEEQREMENFLATVRELERDCV  284

Query  950   A--KQKLEMEIQELKGKLDVMEHMG---GDDDSAVQEKIKEMKEQLD---EKIEDMKDLD  795
             A  K K E+EI +++ K +  +H+G   GD D  VQ+K+ +M+E LD   E  + +  L+
Sbjct  285   AMNKMKTEIEILKMECKFEETKHLGLGDGDCDDKVQQKMDQMQELLDLLQETTDGIDTLE  344

Query  794   EMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRF  615
               N AL++K R ++DELQEARK L+ G +D+ +   ++IGI+++GEI+ KAF +   +R 
Sbjct  345   YYNRALIMKARHTDDELQEARKELVTGFNDIRSVHSANIGIKKIGEINEKAFMDTLIKRL  404

Query  614   STEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQ-IINeddeelsklkeEWGEEI  438
              +EEA+V+A +LC LWQEK+K   W+PF++        + +INEDDE L  LK+EWG+EI
Sbjct  405   PSEEAEVEARKLCCLWQEKIKHTEWYPFQIKGDKGNAMKWVINEDDELLRGLKKEWGDEI  464

Query  437   CAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRK  279
              +AV+ A+ EV EYN  GR  + E+WNFKE RKATL+E +     QLK   RK
Sbjct  465   YSAVLTALLEVEEYNPGGRDAVSEVWNFKENRKATLREAIKHTLTQLKPLLRK  517



>ref|XP_003568833.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=700

 Score =   399 bits (1025),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 250/665 (38%), Positives = 392/665 (59%), Gaps = 68/665 (10%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y++K Y  L+SG ++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S +R   
Sbjct  49    SDYEDKSYGLLKSGNHRVRNPDGTFRCPFCPGKKKQAYKLKDLLQHADGIGVSSKHRRHG  108

Query  1934  KQKANHVALAKYLEIDL------------------------------GDQAEPLPQRAVA  1845
             K++A H A A+++  D                               G   EP    A  
Sbjct  109   KERAFHRAFARFVRADPSFAQELASITGIPGATANADTIDNGKSDANGHATEPSLAAAEG  168

Query  1844  PEDNN--LYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQ  1671
             P  +    +CWPW GI+       A GT    ED+   + + +   ++     D++  ++
Sbjct  169   PPQDGEEKFCWPWCGIL-------AAGTGFNPEDF-ADKVAMFSVDDIVPLVYDEAEGTE  220

Query  1670  --VVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS-----------HVYGWF  1530
                +++  + W+G+ +A+  EN F      K EW    S   +            VYGW 
Sbjct  221   SFAIVQFTNGWSGFSDALALENHFSVNKLGKIEWETRSSHGGAVKGEEDRIGENKVYGWV  280

Query  1529  AKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTR  1350
             A+  DY A G VG YLR+   L TI ++ + ++    KI++ L  +L+ KN++L  L T+
Sbjct  281   AREMDYTAGGLVGRYLRKHTSLMTIDEITKRQREPMGKIVATLATQLEAKNQDLQDLETK  340

Query  1349  FNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDS  1170
              N   LS++R+ E+   LH A+ EE R + R AR++  RV  + E L  E+E  K++L S
Sbjct  341   KNATELSIARLEEDNRRLHEAYNEEMRNLHRKARDNAVRVFQDNENLKLEIEDSKRKLSS  400

Query  1169  WNRELNKREVLTerek------lkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEH  1008
               ++L K   LT           +L +EK++  +  S LE+AS EQ+K DE++L+L+E+ 
Sbjct  401   HAKQLEK---LTAENANDRKKLAELADEKQKAKDDKSELELASIEQQKNDEDILKLVEDQ  457

Query  1007  KREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQL  828
             KREKE AL ++LELEK++  KQ+LE+E+  L G L VM+H+  DDD  +  K++++ E+L
Sbjct  458   KREKEDALARMLELEKELHEKQELELEVTRLSGTLQVMKHLEEDDDGDIHNKMEKLNERL  517

Query  827   DEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDG  648
             +   ++ K L+E++  LV KER+SNDELQEARK LI GL D+L SG + IG++RMGE+D 
Sbjct  518   E---QEKKRLEELSGELVRKERESNDELQEARKELIAGLEDML-SGHTAIGVKRMGELDE  573

Query  647   KAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-NIHDRPEQIINeddeel  471
             + F N C+++F  ++ +++A +L S WQE++K P WHP++++ + +   +++++EDD  L
Sbjct  574   RPFQNACRKKFGNDDYEMRAAQLVSSWQEEIKKPAWHPYKIVKDENGEHKEVLDEDDPRL  633

Query  470   sklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKT  291
              +L  E+G+++C AV  A+ EVNEYN SGRY +PELWNFK+ RKAT+KEV+ +I  Q+ T
Sbjct  634   HELWIEYGDDVCNAVKTALSEVNEYNPSGRYAVPELWNFKKARKATMKEVLRYISLQMGT  693

Query  290   HKRKR  276
               ++R
Sbjct  694   TSKRR  698



>gb|EMT16997.1| hypothetical protein F775_14651 [Aegilops tauschii]
Length=812

 Score =   400 bits (1028),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 250/667 (37%), Positives = 399/667 (60%), Gaps = 67/667 (10%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y+E+ Y  L+SGK++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S +R   
Sbjct  156   SDYEEESYGLLKSGKHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGVSSKHRRHG  215

Query  1934  KQKANHVALAKYLEI-------------------------DLGDQAEPLP------QRAV  1848
             +++A H A A+++                           D  D+ + +         AV
Sbjct  216   RERAFHRAFARFVRAEPSFAQELSTIVGIPGATVTATANADATDKGKAVANGHTSGSSAV  275

Query  1847  A-----PEDNN-LYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVK--IFCD  1692
             A     P+D    + WPW GI+       A G     E++   R + +  +++   +F D
Sbjct  276   AVTEGPPQDGEEKFAWPWCGIL-------AAGAGFNAENF-ADRVAMFSPEDIVPLVFDD  327

Query  1691  DKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS-----------H  1545
              ++     +++    W G+ +A+  EN F      KKEW A  S   +            
Sbjct  328   TENSECFAIVRFSPGWGGFSDALALENQFSVNKLGKKEWEARSSCGGAVDGEENENGEVK  387

Query  1544  VYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLS  1365
             VYGW A+  DY A G VG YLR+   +KTI ++ + ++    KI++ L  +L+ KN++L 
Sbjct  388   VYGWVAREVDYTAGGLVGRYLRKHTDIKTIDEITKSQREPLGKIVAALATQLEAKNQDLQ  447

Query  1364  ALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKK  1185
              L T+ N    S++R+ E+   LH A+ EE RK+ R AR++  R+  + E L  E+E  K
Sbjct  448   DLETKKNATEFSIARLEEDNRRLHEAYNEEMRKLHRKARDNALRIFQDNENLKLEIENNK  507

Query  1184  KQLDSWNRELNKREVLTerek---lkldeekkrndeRNSSLEMASKEQKKADENVLRLIE  1014
             +++    ++L K  V    ++    +L +EK++  +  S LE+AS EQ++ D+++L+L+E
Sbjct  508   REMILRAKQLEKLSVENANDRKKLAELSDEKQKAKDDKSELELASIEQQRNDQDILKLVE  567

Query  1013  EHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKE  834
             + KREKE AL ++LELEK++  K++LE+E+  L G L VM+H+ GDDD  + +K++++ E
Sbjct  568   DQKREKEDALARMLELEKELHEKRELELEVTRLNGTLQVMKHLEGDDDGDIHDKMEKLSE  627

Query  833   QLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEI  654
             +L+    + K L+E++  LV KER+SNDELQEARK LI GL D+L SGR+ IGI+RMGE+
Sbjct  628   KLE---HERKRLEELSGELVRKERESNDELQEARKELIMGLEDIL-SGRTAIGIKRMGEL  683

Query  653   DGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE-QIINedde  477
             D + F N CK+++  ++ + +A EL S WQE++K P WHP++ +   D  + +++N++D 
Sbjct  684   DERPFQNACKRKYGNDDYETRAAELVSSWQEEIKKPAWHPYKFVKAEDGSDKEVVNDEDP  743

Query  476   elsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQL  297
              L +L  E+G+++C AV  A+ EVNEYN SGRYV+ ELWNF++ RKAT+KEV+ FIF+Q+
Sbjct  744   RLKQLWIEYGDDVCNAVKTALSEVNEYNPSGRYVVSELWNFRKNRKATMKEVLRFIFQQM  803

Query  296   KTHKRKR  276
             +   ++R
Sbjct  804   EVPGKRR  810


 Score = 60.1 bits (144),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 77/134 (57%), Gaps = 14/134 (10%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSV  1935
             ++Y+E+ Y  L+SGK++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S + R  
Sbjct  48    SDYEEESYGLLKSGKHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGVSSKHRRHG  107

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVS---KDNANGTA  1764
             +++A H A A+++      +AEP    + A E + +   P        S    D+   + 
Sbjct  108   RERAFHRAFARFV------RAEP----SFAQELSTIVGIPGAASADEESDGEDDSEAESD  157

Query  1763  VEEEDYWLKRFSKY  1722
              EEE Y L +  K+
Sbjct  158   YEEESYGLLKSGKH  171



>ref|XP_002455202.1| hypothetical protein SORBIDRAFT_03g006150 [Sorghum bicolor]
 gb|EES00322.1| hypothetical protein SORBIDRAFT_03g006150 [Sorghum bicolor]
Length=693

 Score =   394 bits (1011),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 251/664 (38%), Positives = 391/664 (59%), Gaps = 67/664 (10%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SVKQ  1929
             Y+EK +  L+SGK++V+ P+G  RCPFC GKKKQ YK KDLLQHA G+G  S +R   ++
Sbjct  41    YEEKSFGLLKSGKHRVRNPDGTFRCPFCPGKKKQGYKIKDLLQHADGIGVSSKHRRHGRE  100

Query  1928  KANHVALAKYLEIDL-------------------------------------GDQA--EP  1866
             +ANH A A+++  D                                      GD A    
Sbjct  101   RANHRAFARFVRTDPDFAEDLVGITGIQGAITTTPADKNGGSANGDGKAKANGDTAGSSS  160

Query  1865  LPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYW--LKRFSKYEAQEVKIFCD  1692
             +  +   P++   + WPW  ++       A G     E++   +  FS  E   V +F D
Sbjct  161   VAAKVGPPQEVERFAWPWACVL-------AAGAGFNPEEFADRVAVFSLVEV--VPLFVD  211

Query  1691  DKSRTSQ-VVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS----------H  1545
             +   T    +++  +DW+G+ +A+  EN F      KKE+    S   S           
Sbjct  212   EMEVTETFAIVRFTNDWSGFNDALTLENHFGVNKLGKKEFETRDSGLGSVEGDGGKGEVK  271

Query  1544  VYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLS  1365
             VYGW A+ +DY+A   VG +LR+   LKTI ++ + E     ++++ L ++++ KN  L 
Sbjct  272   VYGWVARAEDYDATSVVGRFLRKHTVLKTIDEVSKTELEKSGEMVAILASQIEEKNRYLQ  331

Query  1364  ALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKK  1185
              L T+ N   LS+SR+ ++   LH A+ EE R + R ARE+  R+  E E L  +LE K+
Sbjct  332   DLETKKNATELSISRLEDDNRKLHEAYNEEMRNLHRRARENAMRIFQENENLRIDLENKR  391

Query  1184  KQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHK  1005
             ++L+   +EL K       ++  LD+EK++    NS LE+AS EQ++AD +VL+L+ + +
Sbjct  392   RELNLRAKELEKMSAENANDRKTLDDEKQKAKYDNSELELASIEQQRADADVLKLLADQE  451

Query  1004  REKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLD  825
             REKE  L ++L+LEK++  KQ+LE+E++ L G L VM+H+ GDDD      I E  E+L 
Sbjct  452   REKEEVLARMLQLEKELHEKQQLELEVERLNGTLQVMKHLEGDDDGG---DIHEKMEKLS  508

Query  824   EKIE-DMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDG  648
              + E + K L++++  LV KER+SNDELQ ARK LI+GL + L+ G++ IGI+RMGE+D 
Sbjct  509   VRFEHEKKRLEDLSGDLVRKERESNDELQVARKELIKGLEEELD-GQTAIGIKRMGELDE  567

Query  647   KAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeels  468
             K F N CK+++   E  +KA EL + WQE++K P+WHPF+++ ++   ++I+ +DD +L 
Sbjct  568   KPFLNACKRKYGKGEYQIKAAELVTNWQEELKKPSWHPFKMVEVNGENKEILVDDDAKLK  627

Query  467   klkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTH  288
              L  E+G+++C AV  A+ E+NEYN SGRYV+PELWNF++GRKAT+KEV+ ++F Q+ T 
Sbjct  628   HLWIEYGDDVCNAVKTALMEINEYNPSGRYVVPELWNFRKGRKATMKEVLKYLFSQMDTT  687

Query  287   KRKR  276
              ++R
Sbjct  688   TKRR  691



>emb|CDP09063.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   390 bits (1002),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 243/633 (38%), Positives = 381/633 (60%), Gaps = 37/633 (6%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             + +Y  + Y +L+ G  K++       CPFC GK  +         HA+GV KGS  R +
Sbjct  15    VEDYSIQWYAKLKDGHEKLQVSGEEYSCPFCPGKVHKYSLKDLYQ-HASGVSKGSTKRKM  73

Query  1934  KQKANHVALAKYLEIDLGDQAEPL----------PQRAVAPEDNNLYCWPWTGIVVNVSK  1785
             K +  H+ L +Y++ D+ D  +PL          P  +  P +   + +PW GIV N+  
Sbjct  74    KDRGKHLGLVRYMDSDV-DIKKPLAESIKKKADDPIASAGPSEK--FVYPWMGIVANIPS  130

Query  1784  DNANGTAVEE------EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAI  1623
             +  +G  V +      +D+ LK F+  + Q +  +      +   +I+   DW G+ NA+
Sbjct  131   EKRDGRYVGDSGSKLRDDFTLKGFNPLKVQPLWNWT---GFSGYAIIEFNKDWPGFCNAM  187

Query  1622  LFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLL  1443
              FE +FEAE H K+++  E     + +YGW A+ DDY++   +G +LR+   LKTI D+ 
Sbjct  188   AFEKSFEAEHHGKRDYH-EACDRGATLYGWIARADDYDSSTIIGEHLRKKADLKTIADVQ  246

Query  1442  QEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKM  1263
             +EEK     ++SNL NE+ +KN+++  + +++NE   S+S ++ +KD +HR + EE +K 
Sbjct  247   EEEKHRTSMLVSNLANEIAVKNKHIKDIESKYNETIQSISNLMTQKDEMHRLYNEEMQKT  306

Query  1262  QRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeR  1083
             Q  AR  ++++  E ET+   LE +K++L    +EL   E   ER+KL+L+++       
Sbjct  307   QEAARVQLEKIFSEHETIALRLEVQKQKLIEREKELENLEAYNERQKLELEKQMNAK---  363

Query  1082  NSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKL  903
                   A+ EQKKADEN+L+L EE KREKE    +I+ELEK +DAKQ LE+EI+ L+G +
Sbjct  364   ------ATLEQKKADENLLKLAEEQKREKEKLHVQIIELEKKLDAKQALELEIERLRGAV  417

Query  902   DVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLL  723
              VM+H+G   D  V  K+  ++ +L EK E ++DL+  N AL++KER+SNDELQEARK L
Sbjct  418   QVMKHIGSGGDEEVDYKLVAIQVELKEKEEALEDLEVRNQALIVKERKSNDELQEARKEL  477

Query  722   IQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPN  543
             +  L +   + ++ IG++RMGE+D   F N  K+ F  +E  VKA ELCS W++ ++DPN
Sbjct  478   VNCLME--RTSQTSIGVKRMGEMDDVPFKNAAKRMFRRKEIAVKAAELCSQWEDHLRDPN  535

Query  542   WHPFRVINIHDRP--EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  369
             WHPF+++   D    +++I+ +DE+L KLK ++G E+  AV  A+ E+NEYN SGRY IP
Sbjct  536   WHPFKIVKTDDSKGHKEVIDTEDEKLKKLKNKFGNEVYEAVTTALMELNEYNPSGRYAIP  595

Query  368   ELWNFKEGRKATLKEVVSFIFKQLKTHKRKRHD  270
             ELWN+ + R+ATLKE V++I +Q K  K K  D
Sbjct  596   ELWNYNQKRRATLKEGVAYIMEQWKCLKWKTKD  628



>gb|EMT15579.1| hypothetical protein F775_11438 [Aegilops tauschii]
Length=632

 Score =   390 bits (1001),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 237/576 (41%), Positives = 365/576 (63%), Gaps = 31/576 (5%)
 Frame = -1

Query  1973  ATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQRA---------VAPEDNNLYC  1821
             ATG G   ANR          L K L+ +  D +EP P R           A   +  + 
Sbjct  27    ATGAGP-DANRD----GGDRVLTKRLKDESPDTSEPPPSRLKKDVELEPHPAQNRDEQFV  81

Query  1820  WPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDW  1644
             WPW G++VNV  +   G  V E    LK + S +   +V    + +  T   +++   D+
Sbjct  82    WPWMGVLVNVPTEWKGGRQVGESGNRLKEQLSAFCPHKVIPLWNHRGHTGNAIVEFGKDY  141

Query  1643  NGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQL  1464
               + NA  FEN FEAE + K++W   +      ++GW A+ +D  A G +G +L++   L
Sbjct  142   ASFCNAFKFENHFEAEGYGKRDWEQHKYR-GPEMFGWVARAEDQRAPGPIGEHLQKNGDL  200

Query  1463  KTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKD-TLHR-  1290
             KT+ +L  E  R  DK+++NL + +++K ++   L  ++NE   SL +++EEK+  L R 
Sbjct  201   KTVAELENEGTRKTDKLVANLASAIEVKTKHAQELECKYNETTTSLDKVMEEKELVLQRY  260

Query  1289  ------------AFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKR  1146
                         A   E R MQ+LAR H Q +L+E + L SELE K + L+  +R+L++ 
Sbjct  261   NDGCYLIIHFELALSPEIRNMQQLARRHSQMILNENQKLRSELEAKMQDLELKSRQLDEL  320

Query  1145  EVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILEL  966
              V ++ ++  L++EK++N+ +   L+MA+ EQ++ADENVL+L+ +HKREK+AAL +I++L
Sbjct  321   AVRSDSDRRNLEKEKEKNEIKAKYLKMATSEQQRADENVLKLVAKHKREKKAALDEIIKL  380

Query  965   EKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMN  786
             E+ +DAKQKLE+EI++L+GKL+VM+HM G++DS  + KI E+  +L +K ++M  ++ ++
Sbjct  381   EQKLDAKQKLELEIKQLQGKLEVMKHMPGEEDSESKRKIDELSAELQDKYDEMDAVEALH  440

Query  785   NALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE  606
             + L++KER SNDELQ+ARK LI GL D + + R+ IG++RMG++D K+F   CK + S E
Sbjct  441   HTLLMKERISNDELQDARKKLIDGLRD-VTTARATIGVKRMGDLDLKSFAKACKGKMSEE  499

Query  605   EADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAV  426
             +A+V A  LCS W+E++K+P WHPF+VI +  R ++I+ EDDE+L +LKEE GEE+   V
Sbjct  500   DAEVTASILCSKWEEEIKNPEWHPFKVIMVEGREKEILREDDEKLQELKEEHGEEVYGLV  559

Query  425   IKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVV  318
              KA+ EVNEYN SGRY +PELWN+KE RKATLKEVV
Sbjct  560   TKALLEVNEYNPSGRYSVPELWNYKENRKATLKEVV  595



>ref|XP_010520107.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
 ref|XP_010520108.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
 ref|XP_010520109.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Tarenaya hassleriana]
Length=645

 Score =   388 bits (996),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 254/623 (41%), Positives = 379/623 (61%), Gaps = 26/623 (4%)
 Frame = -1

Query  2096  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRSVKQKAN  1920
             K YE+L+ GK  VK       CP+C  KKK  Y+YKDLLQHA+GVG   S  RSVK+KA+
Sbjct  30    KIYEKLKGGKPVVKVSPQDFVCPYCPKKKKSSYQYKDLLQHASGVGNSNSEKRSVKEKAS  89

Query  1919  HVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVS-KDNANGTA  1764
             H+ALAKYL  DL D     P  AV   D    C        PW GIVVN+      +G +
Sbjct  90    HLALAKYLGKDLADST--TPSTAVKSSDPLQGCDHYEKLVSPWKGIVVNIPITKTEDGRS  147

Query  1763  VEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEA  1599
               E      D +++R   Y    V+   +    +   +++   +W G  NA+LFE  ++A
Sbjct  148   TGESGSKLRDEYIQR--GYNPVRVRPLWNYMGHSGTAIVEFNKEWTGLHNALLFEKEYQA  205

Query  1598  ECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKD  1419
             + H KK+W   ++ P S +Y W A+ DDY A+  +G +LR+   LKTI+ L++EE R + 
Sbjct  206   DGHGKKDWL--KNGPKSGLYAWLARADDYNAKNIIGEHLRKIGDLKTISGLMEEEARKQQ  263

Query  1418  KILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHV  1239
              ++ NLT  ++ KN ++  +  + +  +L L  +IE+K+ L + + EE +K Q++  +H 
Sbjct  264   MLVQNLTQMVEDKNRHMKEIKEKCSSASLELKEVIEKKEKLLQGYNEELKKTQQIQMDHF  323

Query  1238  QRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMAS  1059
              R+  + E     LE  +++L+    EL +RE   E E+ KL EE + N  +NSSL++A+
Sbjct  324   YRIFGDHEKQKILLETLRQELEWRGLELEQREAHNEIERKKLAEELEENAIKNSSLQLAA  383

Query  1058  KEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGG  879
              EQ+KADE V +L EE +  K+   +K +ELE+ +D KQ LE+EI++L G+L VM+HMG 
Sbjct  384   MEQQKADEEVRKLAEEQQSLKKKLHEKTIELERQLDQKQALELEIEQLNGQLKVMKHMGS  443

Query  878   DDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             DDD  V +K++ M   L EK  ++ DLD+ + +L+++ER+ NDELQ+ARK LI  L D+ 
Sbjct  444   DDDVEVVKKVETMVSDLSEKERELADLDKFHQSLIVRERKINDELQDARKELISILKDM-  502

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVIN  519
                 S+IGI+RMGE+D + F    K++++ EE + K +E+  LW+E +KDP+WHPF+ I 
Sbjct  503   ---NSYIGIKRMGELDNQPFLEAMKRKYNEEEVEYKTVEVYQLWEEYLKDPDWHPFKRIK  559

Query  518   IH--DRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
             +   DR  ++IN+DDE L  LK+E GE    AV  A+ E+NEYN SGRY+  ELWN +EG
Sbjct  560   VDNGDREMEVINDDDERLKDLKKELGEGPYKAVTSALLEINEYNPSGRYITSELWNLREG  619

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             RKA L+E V+ + +     KRKR
Sbjct  620   RKALLQEAVTCLLELYDKAKRKR  642



>dbj|BAJ97190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=704

 Score =   389 bits (1000),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 244/667 (37%), Positives = 387/667 (58%), Gaps = 67/667 (10%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y+EK Y  L+SG ++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S +R   
Sbjct  48    SDYEEKSYGLLKSGNHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGVSSKHRRHG  107

Query  1934  KQKANHVALAKYLEIDLGDQAE-----PLPQRAVAPEDN---------------------  1833
             +++A H A A+++  D     E      +P   V P  N                     
Sbjct  108   RERAFHRAFARFVRADPSFAQELSTIVGIPGATVTPTANADATDKGKAISNGHTSGSTPV  167

Query  1832  -----------NLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDK  1686
                          + WPW GI+       A G     E++   R + +  +++     D 
Sbjct  168   AVAEGPPQGGEEKFAWPWCGIL-------AAGAGFNAENF-ADRVAMFSPEDIVPLVFDD  219

Query  1685  SRTSQ--VVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS-----------H  1545
             +  S+   +++    W  + +A+  EN F      K EW A  S   +            
Sbjct  220   TEMSECFAIVRFSPGWGEFSDALALENQFSVNKLGKNEWEARSSCGGAVDGEENVIGEVK  279

Query  1544  VYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLS  1365
             VYGW A+  DY A G VG YLR+   +KTI ++ + ++    KI+++L  +L+ KN+ L 
Sbjct  280   VYGWVAREVDYTAGGLVGRYLRKHTDIKTIDEITKTQREPMGKIVASLATQLETKNQYLQ  339

Query  1364  ALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKK  1185
              L T+ N    S++R+ ++   LH A+ EE RK+ R AR++  R+  + E L  E+E  K
Sbjct  340   DLETKKNATEFSIARLEQDNRRLHEAYNEEMRKLHRKARDNALRIFQDNENLKLEIENSK  399

Query  1184  KQLDSWNRELNKREVLTerek---lkldeekkrndeRNSSLEMASKEQKKADENVLRLIE  1014
             +++    ++L K       ++    +L +EK++  +  S LE+AS EQ++ D ++L+L+E
Sbjct  400   REMTLRAKKLEKLSAENANDRKKLAELSDEKQKAKDDKSELELASIEQQRNDLDILKLVE  459

Query  1013  EHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKE  834
             + KREKE AL ++LELEK++  K++LE+E+  L G L VM+H+ GDDD  + +K++++ E
Sbjct  460   DQKREKEDALARMLELEKELHEKRELELEVTRLNGTLQVMKHLEGDDDGDIHDKMEKLSE  519

Query  833   QLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEI  654
             +L+    + K L+E++  LV KER+SNDELQEARK LI GL D+L SGR+ IGI+RMGE+
Sbjct  520   KLE---HERKRLEELSGELVKKERESNDELQEARKELIAGLEDML-SGRAAIGIKRMGEL  575

Query  653   DGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE-QIINedde  477
             D + F N C++++   + +  A EL S WQE++K P W P++ +   D  + +++N++D 
Sbjct  576   DERPFQNACRRKYGNNDYETSAAELVSSWQEEIKKPTWQPYKFVKAEDGTDKEVVNDEDP  635

Query  476   elsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQL  297
              L +L  E+G+++C AV  A+ EVNEYNASGRYV+ ELWNF++ RKAT+KEV+ FIF+Q+
Sbjct  636   RLKQLWIEYGDDVCNAVKTALSEVNEYNASGRYVVSELWNFRKNRKATMKEVLRFIFQQM  695

Query  296   KTHKRKR  276
             +   ++R
Sbjct  696   EVPGKRR  702



>ref|XP_010922973.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Elaeis guineensis]
Length=491

 Score =   382 bits (981),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 229/471 (49%), Positives = 330/471 (70%), Gaps = 10/471 (2%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVK  1932
             ++Y+EK Y  L+ GK KVK  +   +CPFCAGKKKQDY YKDLLQHA GVG  ++NR  K
Sbjct  17    DDYEEKFYLHLKDGKLKVKNTDSIYKCPFCAGKKKQDYNYKDLLQHANGVG--TSNRKAK  74

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRAVA------PEDNNLYCWPWTGIVVNVSKDNANG  1770
              KA H ALA+YL+ DL + +    Q  +       P+D + + WPW GI+VNV  +  NG
Sbjct  75    VKAKHXALARYLKNDLAEASSSSMQLMIVQHHPFKPKDEDQFVWPWMGILVNVPTEYKNG  134

Query  1769  TAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               V E    LK + S++   +V    + +  T   ++    DW G+K+A+ FEN ++A+ 
Sbjct  135   RYVGESGNRLKEQLSRFNPLKVHALWNYRGHTGNAIVDFNKDWTGFKDAMAFENYYDAQH  194

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
               K++W  ER    + +YGW A+  DY + G +G +LR+   LKT+ DL  EE R  DK+
Sbjct  195   LGKRDWN-ERRHQGTEIYGWVARAVDYNSTGPIGDHLRKNGDLKTVNDLTTEETRKTDKL  253

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             ++NL +++++KN++L  L  ++NE  LSL RM+E++D L RA+ EE +KMQ ++R+H +R
Sbjct  254   VANLASQIEVKNKHLQELECKYNETTLSLDRMMEDRDKLLRAYNEEIQKMQCISRDHSRR  313

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +  E E L +EL+ K+K+LD   ++L+K  V  E E+ KLD EK++N  ++SSL++AS E
Sbjct  314   IFEENEKLRAELDSKRKELDVRRKQLDKLAVQNEIERRKLDVEKQKNAMKDSSLQLASME  373

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             QKKAD+NVLRL+EE KREKEAAL+KIL+LEK +DAKQKLE+EIQ+L+G+L VM+HMGG++
Sbjct  374   QKKADKNVLRLVEEQKREKEAALRKILQLEKQLDAKQKLELEIQQLRGQLQVMKHMGGEE  433

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             DS V++K++EM EQL EK+E+M+DL+ +N  LV+KER+SNDELQEARK LI
Sbjct  434   DSEVKKKVEEMSEQLKEKVEEMEDLEVLNQTLVVKERKSNDELQEARKELI  484



>gb|EMT14402.1| hypothetical protein F775_20219 [Aegilops tauschii]
Length=845

 Score =   393 bits (1009),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 245/622 (39%), Positives = 399/622 (64%), Gaps = 20/622 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             YK+K Y +LRS K KV+      RCPFC GKKK+DY  KDLLQHA+G+G  +  R  + +
Sbjct  228   YKDKIYAQLRSQKLKVQYGEKIFRCPFCLGKKKRDYNVKDLLQHASGIG-AAQKRKPRVR  286

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAVA----PE-DNNLYCWPWTGIVVNVSKDNANGTAV  1761
             A H+ALA+Y++ DLG   EP  Q A+     P+ + + + WPW GI+VN+  D  +   V
Sbjct  287   AAHLALAEYVKNDLGSSLEPSLQLAIVEYKPPKIEQDKFVWPWMGILVNIPADLMDTNFV  346

Query  1760  EEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSK  1584
              E ++ LK + S++   EV I  D K +T   ++K   DW G+K+A+ FEN F  E +SK
Sbjct  347   RESEHMLKSQLSRFRPCEVTILLDSKGQTDHSIVKFAEDWTGFKDALAFENHFIVEQYSK  406

Query  1583  KEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSN  1404
              +WT  R+     +YGW A+ DDY + G +G +LR+   LK++ D     + ++ + +++
Sbjct  407   TDWT-RRNCKMDDLYGWLARSDDYNSHGTIGEHLRKIGVLKSVGD----REHERTERIAH  461

Query  1403  LTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLH  1224
              T +++ KN++L  L  + N+  + L  M+++KD +   + E+ RKMQ  AR +  +++ 
Sbjct  462   FTRQMEEKNKHLQELELKHNQTAMKLESMMKDKDRMVEEYNEKIRKMQEDARGNSSKIVE  521

Query  1223  EQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKK  1044
             + + L  EL+ +++Q    +++L +    +  ++ K++ EK++N   N  L++A+ + KK
Sbjct  522   DNQRLQQELKTRREQAIRRHKQLEELARKSNIDRAKVEAEKEKNANENVLLDLATLKHKK  581

Query  1043  ADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSA  864
             A E + +L+++H++EKE A ++  +LE+D+ +KQ LEME+ +L+GKL+VM+HMG + D+ 
Sbjct  582   AREELRQLLKKHEQEKEDAFRRQYKLEEDLTSKQNLEMELAQLRGKLEVMKHMGAEADTT  641

Query  863   VQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS  684
              +E   ++ E+L EK E ++ ++  N AL++ ER++NDEL++A+K LIQGL  +    RS
Sbjct  642   SKE-FDKVSEELKEKDEQLEAMESANQALIIVERRTNDELEQAKKELIQGLQQI-QVTRS  699

Query  683   HIGIRRMGEIDGKAFHNVCKQR----FSTEEA--DVKALELCSLWQEKVKDPNWHPFRVI  522
              IG++RMG +D KAF   CK++     S + A  DV+A  + S W++++K P+WHPF+VI
Sbjct  700   TIGVKRMGVLDEKAFVAACKKKEGNGVSKKNAKYDVEATLVLSKWEDEIKQPDWHPFKVI  759

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
             ++  + ++I+ EDDE+L  LKEE G+E    V+KA+ E+NEYN SGRY +P LWNFKE R
Sbjct  760   DVDGQTKEIVREDDEKLQALKEELGQEAHDVVVKALLEMNEYNPSGRYPVPVLWNFKENR  819

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             +A L E V++I KQ K  K KR
Sbjct  820   RAPLDEAVAYILKQWKASKNKR  841



>ref|XP_003557426.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
 ref|XP_010228249.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
 ref|XP_010228250.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
 ref|XP_010228251.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=700

 Score =   386 bits (992),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 250/667 (37%), Positives = 388/667 (58%), Gaps = 72/667 (11%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y++K Y  L+SG ++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S +R   
Sbjct  49    SDYEDKSYGLLKSGNHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGISSKHRRHG  108

Query  1934  KQKANHVALAKYLEIDL------------------------------GDQAEPLPQRAVA  1845
             K++A H A A+++  D                               GD  EP    A  
Sbjct  109   KERAFHRAFARFVRTDPSFAHELAGITGIPGAIANADTIDNGKADANGDATEPSMAAAER  168

Query  1844  P--EDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRT--  1677
             P  + +  + WPW GI+       A G     E++   + + +   ++     D++    
Sbjct  169   PRQDGDEKFAWPWCGIL-------AAGAGFNSENF-ADKVAMFSVDDIVPLLYDEAEGME  220

Query  1676  SQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS-----------HVYGWF  1530
             S  +++  + W G+ +A+  EN F      K EW A  S   +            VYGW 
Sbjct  221   SFAIVQFTNGWGGFGDALALENHFNKNKLGKIEWEARSSCEGAVTGDENRIGEIKVYGWV  280

Query  1529  AKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTR  1350
             A+  DY A   VG YLR+   L TI ++ + ++    KI++ L  +L+ KN+ L  L T+
Sbjct  281   AREMDYTAGSLVGRYLRKHTNLMTIDEITKSQREPMGKIVATLATQLEAKNQYLQDLETK  340

Query  1349  FNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDS  1170
              N   LS++R+ E+   LH A+ EE R + R AR++  RV  + E L  E+E  K++L S
Sbjct  341   KNATELSIARLEEDNRRLHEAYNEEMRNLHRKARDNAVRVFQDNENLKLEIENSKRKLSS  400

Query  1169  WNRELNKREVLTerek------lkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEH  1008
               ++L K   LT           +L +EK++  +  S LE+AS EQ++ DE++L+L+E+ 
Sbjct  401   HAKQLEK---LTAENTNDRKKLAELADEKQKAKDDKSELELASIEQQRNDEDILKLVEDQ  457

Query  1007  KREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQL  828
             KREKE AL ++LELEK++  K++LE+E+  L G L VM+H+ GDDD  +  K++++ E+L
Sbjct  458   KREKEDALARMLELEKELHEKRELELEVTRLNGTLQVMKHLEGDDDGDIHNKMEKLNERL  517

Query  827   DEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDG  648
             +   ++ K L+E++  LV KER+SNDELQEARK L++GL D+L SG + IG++RMGE+D 
Sbjct  518   E---QEKKRLEELSGELVRKERESNDELQEARKELMEGLEDML-SGHTAIGVKRMGELDE  573

Query  647   KAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI---NIHDRPEQIINedde  477
             + F N C+++F  ++ +  A +L S WQE++K P WHP++ +   N  D+  +++N+DD 
Sbjct  574   RPFQNACRKKFGNDDYETIAAQLVSSWQEEIKKPAWHPYKFVKDENGEDK--EVVNDDDP  631

Query  476   elsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQL  297
              L +L  E+G+++C AV  A+ EVNEYN SGRY + ELWNFK+ RKAT+KEV+ +IF Q 
Sbjct  632   RLRELWIEYGDDVCNAVKTALSEVNEYNPSGRYAVLELWNFKKARKATMKEVLRYIFLQT  691

Query  296   KTHKRKR  276
              T  ++R
Sbjct  692   GTMSKRR  698



>ref|NP_001041898.1| Os01g0126600 [Oryza sativa Japonica Group]
 dbj|BAF03812.1| Os01g0126600, partial [Oryza sativa Japonica Group]
Length=403

 Score =   376 bits (966),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 305/404 (75%), Gaps = 1/404 (0%)
 Frame = -1

Query  1487  YLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEE  1308
             YLR+   LKT+ DL  E  R  DK+++NL +++++K  ++  L +++NE   SL R++E+
Sbjct  1     YLRKNGDLKTVADLENEGTRKTDKLVANLASQVEVKKRHVEELESQYNETTASLERVMEQ  60

Query  1307  KDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTer  1128
             ++   +A+ EE RKMQ LA  H QR++ E + L S+LE K + LDS ++EL+K  V +  
Sbjct  61    REQQLQAYNEEIRKMQDLALRHSQRIMDENKKLRSDLESKMQLLDSRSKELDKLAVQSNS  120

Query  1127  eklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDA  948
             +++ L++EK++ND +   L+MA+ EQ+KADE+VL+L+EEHKREK+AAL KIL+LE+ ++A
Sbjct  121   DRMNLEKEKEKNDIKTKHLKMATLEQQKADESVLKLVEEHKREKQAALDKILKLEQQLNA  180

Query  947   KQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLK  768
             KQKLE+EIQ+L+GKL+VM+HM G +DS  + KI E+ E+L +K  +M+ ++ +N ALV+K
Sbjct  181   KQKLELEIQQLQGKLEVMKHMPGKEDSEAKSKIHELSEELKDKYAEMESIESLNQALVIK  240

Query  767   ERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKA  588
             ERQSNDELQ ARK+LI+G  D++  GR++IGI+RMG ID KAF N  KQR   E+ADV A
Sbjct  241   ERQSNDELQHARKVLIEGFQDII-VGRTNIGIKRMGVIDFKAFTNAYKQRSLEEDADVSA  299

Query  587   LELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEE  408
              ELCSLW+ ++K+ +WHPFRV+ +  +  +I++EDD +L +LKEE GEEICA V KA+ E
Sbjct  300   AELCSLWENEIKNSDWHPFRVVMVDGKEMEILSEDDGKLCELKEEHGEEICAMVTKALLE  359

Query  407   VNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             +NEYN SGRY +PELWNFKE RKATLKEVV ++  Q K +KRKR
Sbjct  360   LNEYNPSGRYPVPELWNFKENRKATLKEVVQYVLNQWKKNKRKR  403



>gb|EMS45500.1| hypothetical protein TRIUR3_12203 [Triticum urartu]
Length=638

 Score =   384 bits (986),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 245/624 (39%), Positives = 396/624 (63%), Gaps = 22/624 (4%)
 Frame = -1

Query  2105  YKEKPYEELR--SGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVK  1932
             YK+K Y +LR  S K KV+      RCPFC GK+KQDY  KDLLQHA+G+G  +  R  +
Sbjct  19    YKDKIYAQLRLRSQKLKVQYGEKIFRCPFCLGKRKQDYNVKDLLQHASGIG-AAQKRKPR  77

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRAVA----PE-DNNLYCWPWTGIVVNVSKDNANGT  1767
              +A H+ALA+Y++ DLG   EP  Q A+     P+ +   + WPW GI+VN+  D  +  
Sbjct  78    VRAAHLALAEYVKNDLGSSLEPSLQLAIVEYKPPKIEQEKFVWPWMGILVNLPADLMDTN  137

Query  1766  AVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              V E ++ LK + S++   EV I  D K +T   +IK   DW G+K+A+ FEN F  E +
Sbjct  138   FVRESEHMLKSQLSRFRPCEVTILLDSKGQTDHSIIKFAEDWTGFKDALAFENHFIVEQY  197

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK +W   R+     +YGW A+ DDY + G +G +LR+   LK++ D     + ++ + +
Sbjct  198   SKTDWN-RRNCKMDDLYGWLARSDDYNSHGTIGEHLRKIGVLKSVGD----REHERTERI  252

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             ++ T +++ KN++L  L  + N+  + L  M+++KD +     E+ RKMQ  AR +  ++
Sbjct  253   AHFTRQIEEKNKHLQELELKHNQTAMKLESMMKDKDRMVEEHNEKIRKMQEDARWNSSKI  312

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             + + + L  EL+ +++Q    +++L +    +  ++ K++ EK++N   N  L++A+ + 
Sbjct  313   VEDNQRLQQELKTRREQAIRRHKQLEELARKSNIDRAKVEAEKEKNANENVLLDLATLKH  372

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             KKA E + +L+++H++EKE A ++  +LE+D+ +KQ LEME+ +L+GKL+VM+HMG + D
Sbjct  373   KKAREELRQLLKKHEQEKEDAFRRQYKLEEDLTSKQNLEMELAQLRGKLEVMKHMGAEAD  432

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSG  690
             +  +E   ++ E+L EK E ++ ++  N AL++ ER++NDEL++A+K LIQGL  +    
Sbjct  433   TTSKE-FDKVSEELKEKDEQLEAMESANQALIIVERRTNDELEQAKKELIQGLQQI-QVT  490

Query  689   RSHIGIRRMGEIDGKAFHNVCKQR----FSTEEA--DVKALELCSLWQEKVKDPNWHPFR  528
             RS IG++RMG +D KAF   CK++     S + A  DV+A  + S W++++K P+WHPF+
Sbjct  491   RSTIGVKRMGVLDEKAFVAACKKKEGNGVSKKNAKYDVEATLVLSKWEDEIKQPDWHPFK  550

Query  527   VINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKE  348
             VI++  + ++I+ EDDE+L  LKEE G+E    V+KA+ E+NEYN SGRY +P LWNFKE
Sbjct  551   VIDVDGQTKEIVREDDEKLQALKEELGQEAHDVVVKALLEMNEYNPSGRYPVPVLWNFKE  610

Query  347   GRKATLKEVVSFIFKQLKTHKRKR  276
              R+A L E V++I KQ K  K KR
Sbjct  611   NRRAPLDEAVAYILKQWKASKNKR  634



>gb|EMS64523.1| hypothetical protein TRIUR3_35150 [Triticum urartu]
Length=736

 Score =   387 bits (993),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 252/699 (36%), Positives = 393/699 (56%), Gaps = 99/699 (14%)
 Frame = -1

Query  2111  NEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SV  1935
             ++Y+E+ Y  L+SGK++V+ P+G  RCPFC GKKKQDYK KDLLQHA G+G  S +R   
Sbjct  48    SDYEEESYGLLKSGKHRVRNPDGTFRCPFCPGKKKQDYKLKDLLQHADGIGVSSKHRRHG  107

Query  1934  KQKANHVALAKYLEI-------------------------DLGDQAEPLP------QRAV  1848
             +++A H A A+++                           D  D+ + +         AV
Sbjct  108   RERAFHRAFARFVRAEPSFAQELSTIVGIPGATVTATANADATDKGKAVANGHTSGSSAV  167

Query  1847  A-----PEDNN-LYCWPWTGIVVNVSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDK  1686
             A     P+D    + WPW GI+       A G     E++   R + +  +++     D 
Sbjct  168   AVTEGPPQDGEEKFAWPWCGIL-------AAGAGFNAENF-ADRVAMFSPEDIVPLVFDD  219

Query  1685  SRTSQ--VVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSS-----------H  1545
             +  S+   +++    W G+ +A+  EN F      KKEW    S   +            
Sbjct  220   TEKSECFAIVRFSPGWGGFSDALALENQFSVNKLGKKEWETRSSCGGAVDGEENENGEVK  279

Query  1544  VYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLS  1365
             VYGW A+  DY A G VG YLR+   +KTI ++ + ++    KI++ L  +L+ KN++L 
Sbjct  280   VYGWVAREVDYTAGGLVGRYLRKHTDIKTIDEITKSQREPLGKIVAALATQLEAKNQDLQ  339

Query  1364  ALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKK  1185
              L T+ N    S++R+ E+   LH A+ EE RK+ R AR++  R+  + E L  E+E  K
Sbjct  340   DLETKKNATEFSIARLEEDNRRLHEAYNEEMRKLHRKARDNALRIFQDNENLKLEIENNK  399

Query  1184  -------KQLDSWNRE-LNKREVLTere---------------------------klkld  1110
                    KQL+  + E  N R+ L E                               K  
Sbjct  400   REMVLRAKQLEKLSVENANDRKKLAELSDEKQKLLVYGQLISFYSIRVTLNNFLVSHKAT  459

Query  1109  eekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEM  930
                 +  +  S LE+AS EQ++ D+++L+L+E+ KREKE AL ++LELEK++  K++LE+
Sbjct  460   VATFKAKDDKSELELASIEQQRNDQDILKLVEDQKREKEDALARMLELEKELHEKRELEL  519

Query  929   EIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSND  750
             E+  L G L VM+H+ GDDD  + +K++++ E+L+    + K L+E++  LV KER+SND
Sbjct  520   EVTRLNGTLQVMKHLEGDDDGDIHDKMEKLSEKLE---HERKRLEELSGELVRKERESND  576

Query  749   ELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSL  570
             ELQEARK LI GL D+L SGR+ IGI+RMGE+D + F N CK+++  ++ + +A EL S 
Sbjct  577   ELQEARKELIMGLEDIL-SGRTAIGIKRMGELDERPFQNACKRKYGNDDHETRAAELVSS  635

Query  569   WQEKVKDPNWHPFRVINIHDRPE-QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYN  393
             WQE++K P WHP++ +   D  + +++N++D  L +L  E+G+++C AV  A+ EVNEYN
Sbjct  636   WQEEIKKPAWHPYKFVKAEDGSDKEVVNDEDPRLKQLWIEYGDDVCNAVKTALSEVNEYN  695

Query  392   ASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
              SGRYV+ ELWNF++ RKAT+KEV+ FIF+Q++   ++R
Sbjct  696   PSGRYVVSELWNFRKNRKATMKEVLRFIFQQMEVPGKRR  734



>ref|XP_006488337.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Citrus sinensis]
 ref|XP_006488338.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Citrus sinensis]
Length=630

 Score =   383 bits (983),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 252/630 (40%), Positives = 386/630 (61%), Gaps = 30/630 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             + +Y+ K Y +L+ G  KV+      RCPFC GKK+ DY YK+LLQHA+ VG+ S +R  
Sbjct  15    LKDYEYKKYNQLKKGDLKVEVSETAYRCPFCRGKKETDYLYKELLQHASDVGR-SRSRGA  73

Query  1934  KQKANHVALAKYL----------EIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV-S  1788
             ++KA H+AL KY+          +++ G  +E L      P  + L  +PW GIV N+ +
Sbjct  74    REKAQHLALEKYVSKYLVVKDRSQLEPGTSSECLKITDHQP--DQLLVYPWVGIVANIKT  131

Query  1787  KDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             +   +G  V E    L+   R   +   +V      +  +   V++   DW G+KNAI+F
Sbjct  132   QRGEDGRYVGESGSKLRDEFRSKGFNPLKVHPLWSRRGHSGFAVVEFYKDWAGFKNAIMF  191

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E +FE + H KK++ A ++     +YGW A+ DDY ++  +G +LR+   LKT++    E
Sbjct  192   EKSFEVDHHGKKDFYAVKNL-GDKLYGWIARDDDYNSKSLIGDHLRKNGDLKTVSGKEAE  250

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             ++R    +++NLT  L++K+     +  ++ E +  L   +E+ D ++++  EE RKMQ+
Sbjct  251   DQRKTSTLVTNLTRTLEVKDMRYKEMEMKYLETSTYLDLTMEQMDEMNKSRNEEIRKMQQ  310

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              A +H Q++  E E   S+LE +KKQL+   ++L  RE   E E+ KL  EK  N     
Sbjct  311   SAHDHFQKIYLEHEKATSQLEARKKQLEEREKQLQYREAKNETERKKLHSEKIMN-----  365

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
               E A+ EQKKADE V RL + HK EKE   +KI+EL+K +DAKQ LE+EI++ +G + V
Sbjct  366   --ERATLEQKKADEKVWRLAQVHKEEKEKLRRKIIELQKGLDAKQALELEIEQKRGTIQV  423

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HM  +++  VQEK+  + +++ EK  +M  ++ +N +L+++ER+SNDELQEARK LI 
Sbjct  424   MKHM-REENVEVQEKMDAIIKEIKEKEGEMDVVEALNQSLIVRERKSNDELQEARKELIN  482

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
              L +     R+ IG++RMGEID + F    K +F  EEAD K LELCSLW+E ++DPNWH
Sbjct  483   SLKE--GRTRATIGVKRMGEIDNRPFLAAAKAKFPAEEADEKGLELCSLWEEYLRDPNWH  540

Query  536   PFRV-INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELW  360
             PF++ ++     ++II+ +D++L  LK E+GE++  AV  A  E+N+YN SGRY IPELW
Sbjct  541   PFKILVDKEGNCKEIIDVEDQKLKSLKNEYGEQVHNAVALAQSEMNQYNPSGRYTIPELW  600

Query  359   NFKEGRKATLKEVVSFIFKQLKTH-KRKRH  273
             NFKE RKATLKE    +  Q + + KRKR+
Sbjct  601   NFKENRKATLKEGAIHLLNQWRVNRKRKRN  630



>gb|KDO72840.1| hypothetical protein CISIN_1g038527mg [Citrus sinensis]
Length=630

 Score =   381 bits (978),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 251/630 (40%), Positives = 385/630 (61%), Gaps = 30/630 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             + +Y+ K Y +L+ G  KV+      RCPFC GKK+ DY YK+LLQHA+ VG+ S +R  
Sbjct  15    LKDYEYKKYNQLKKGDLKVEVSETAYRCPFCRGKKETDYLYKELLQHASDVGR-SRSRGA  73

Query  1934  KQKANHVALAKYL----------EIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV-S  1788
             ++KA H+AL KY+          +++ G  +E L      P  + L  +PW GIV N+ +
Sbjct  74    REKAQHLALEKYVSKYLVVKDRSQLEPGTSSECLKITDHQP--DQLLVYPWVGIVANIKT  131

Query  1787  KDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             +   +G  V E    L+   R   +   +V      +  +   V++   DW G+KNAI+F
Sbjct  132   QRGEDGRYVGESGSKLRDEFRSKGFNPLKVHPLWSRRGHSGFAVVEFYKDWAGFKNAIMF  191

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E +FE + H KK++ A ++     +YGW A+ DDY ++  +G +LR+   LKT++    E
Sbjct  192   EKSFEVDHHGKKDFYAVKNL-GDKLYGWIARDDDYNSKSLIGDHLRKNGDLKTVSGKEAE  250

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             ++R    +++NLT  L++K+     +  ++ E +  L   +E+ D ++++  EE RKMQ+
Sbjct  251   DQRKTSTLVTNLTRTLEVKDMRYKEMEMKYLETSTYLDLTMEQMDEMNKSRNEEIRKMQQ  310

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              A +H Q++  E E   S+LE +K QL+   ++L  RE   E E+ KL  EK  N     
Sbjct  311   SAHDHFQKIYLEHEKATSQLEAQKMQLEEHEKQLQYREAKNETERKKLHSEKIMN-----  365

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
               E A+ EQKKADE V RL + HK EKE   +KI+EL+K +DAKQ LE+EI++ +G + V
Sbjct  366   --ERATLEQKKADEKVWRLAQVHKEEKEKLRRKIIELQKGLDAKQALELEIEQKRGTIQV  423

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HM  +++  VQEK+  + +++ EK  +M  ++ +N +L+++ER+SNDELQEARK LI 
Sbjct  424   MKHM-REENVEVQEKMDAIIKEIKEKEGEMDVVEALNQSLIVRERKSNDELQEARKELIN  482

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
              L +     R+ IG++RMGEID + F    K +F  EEAD K LELCSLW+E ++DPNWH
Sbjct  483   SLKE--GRTRATIGVKRMGEIDNRPFLAAAKAKFPAEEADEKGLELCSLWEEYLRDPNWH  540

Query  536   PFRV-INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELW  360
             PF++ ++     ++II+ +D++L  LK E+GE++  AV  A  E+N+YN SGRY IPELW
Sbjct  541   PFKILVDKEGNCKEIIDVEDQKLKSLKNEYGEQVHNAVALAQSEMNQYNPSGRYTIPELW  600

Query  359   NFKEGRKATLKEVVSFIFKQLKTH-KRKRH  273
             NFKE RKATLKE    +  Q + + KRKR+
Sbjct  601   NFKENRKATLKEGAIHLLNQWRVNRKRKRN  630



>ref|XP_004161917.1| PREDICTED: uncharacterized LOC101219429 [Cucumis sativus]
Length=631

 Score =   380 bits (977),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 227/547 (41%), Positives = 349/547 (64%), Gaps = 22/547 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++E + K Y+EL++GK  VK  +    CP+C  K+K+D+ YKDLLQHA+GVGK  +N RS
Sbjct  19    MDERESKSYDELKNGKRIVKLSHETFTCPYCTKKRKRDFLYKDLLQHASGVGKSPSNKRS  78

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNVSKDN  1779
              K+KANH+AL KYLE DL D   P      +  D  + C       WPW GIVVN+    
Sbjct  79    TKEKANHLALLKYLEKDLADAVGPSKPATASNNDPVMDCNHDEKFVWPWRGIVVNIPTRR  138

Query  1778  AN------GTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
              +      G+  +  D   +R   +    V    + +  +   +++   DW G  NAI F
Sbjct  139   TDDGRFVGGSGSKFRDELKER--GFNPSRVTPLWNYRGHSGCAIVEFNKDWPGLHNAISF  196

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E A+EA+ H KK+W A  ++    VY W A+ DDY +   +G +LR+   LKTI++++QE
Sbjct  197   ERAYEADRHGKKDWLANGTTEKLGVYAWVARADDYNSNNIIGEHLRKIGDLKTISEIIQE  256

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             E R +D+++SNLT+ ++LKN++L+ +  R NE + ++  ++ E + L +A Y E +K+Q 
Sbjct  257   EARKQDRLVSNLTSIIELKNKHLTEMEKRCNETSATVDSLMREIEKLLQA-YNEDKKIQL  315

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              AR+H++++  + E L  +LE +KK+ +   REL KRE   E E   L EE ++ + RNS
Sbjct  316   GARDHLKKIFSDHEKLKLKLESQKKEFELRGRELEKREAQNENESKYLAEEIEKYEVRNS  375

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
             SL++A  EQ+KADE+ ++L ++ K++KE    +I+ LEK +DAKQ LE+EI+ L+G L+V
Sbjct  376   SLQLAELEQQKADEDFMKLADDQKKQKEDLHDRIIRLEKQLDAKQALELEIERLRGTLNV  435

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HM   +D+   +K + + + L EK  D+++LD++N AL++K+R+SNDELQEARK +I 
Sbjct  436   MKHM---EDAEDVQKAESILKDLSEKERDLEELDDLNQALIVKQRKSNDELQEARKEIIN  492

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
                DL   GRSH+ I+RMGE+D K FH   K+ ++ +EAD +A ELCSLW E +KDP+WH
Sbjct  493   AFKDL--PGRSHLRIKRMGELDTKPFHEAMKKIYNEDEADERASELCSLWAEYLKDPDWH  550

Query  536   PFRVINI  516
             PF+VI +
Sbjct  551   PFKVIKV  557



>ref|XP_006424841.1| hypothetical protein CICLE_v10029911mg [Citrus clementina]
 gb|ESR38081.1| hypothetical protein CICLE_v10029911mg [Citrus clementina]
Length=732

 Score =   383 bits (984),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 252/629 (40%), Positives = 385/629 (61%), Gaps = 30/629 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             + +Y+ K Y +L+ G  KV+      RCPFC GKK+ DY YK+LLQHA+ VG+ S +R  
Sbjct  117   LKDYEYKKYNQLKKGDLKVEVSETAYRCPFCRGKKETDYLYKELLQHASDVGR-SRSRGA  175

Query  1934  KQKANHVALAKYL----------EIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNV-S  1788
             ++KA H+AL KY+          +++ G  +E L      P  + L  +PW GIV N+ +
Sbjct  176   REKAQHLALEKYVSKYLVVKDRSQLEPGTSSECLKITDHQP--DQLLVYPWVGIVANIKT  233

Query  1787  KDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILF  1617
             +   +G  V E    L+   R   +   +V      +  +   V++   DW G+KNAI+F
Sbjct  234   QRGEDGRYVGESGSKLRDEFRSKGFNPLKVHPLWSRRGHSGFAVVEFYKDWAGFKNAIMF  293

Query  1616  ENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQE  1437
             E +FE + H KK++ A ++     +YGW A+ DDY ++  +G +LR+   LKT++    E
Sbjct  294   EKSFEVDHHGKKDFYAVKNL-GDKLYGWIARDDDYNSKSLIGDHLRKNGDLKTVSGKEAE  352

Query  1436  EKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQR  1257
             ++R    +++NLT  L++K+     +  ++ E +  L   +E+ D ++++  EE RKMQ+
Sbjct  353   DQRKTSTLVTNLTRTLEVKDMRYKEMEMKYLETSTYLDLTMEQMDEMNKSRNEEIRKMQQ  412

Query  1256  LAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNS  1077
              A +H Q++  E E   S+LE +KKQL+   ++L  RE   E E+ KL  EK  N     
Sbjct  413   SAHDHFQKIYLEHEKATSQLEARKKQLEEREKQLQYREAKNETERKKLHSEKIMN-----  467

Query  1076  SLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDV  897
               E A+ EQKKADE V RL + HK EKE   +KI+EL+K +DAKQ LE+EI++ +G + V
Sbjct  468   --ERATLEQKKADEKVWRLAQVHKEEKEKLRRKIIELQKGLDAKQALELEIEQKRGTIQV  525

Query  896   MEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQ  717
             M+HM  +++  VQEK+  + +++ EK  +M  ++ +N +L+++ER+SNDELQEARK LI 
Sbjct  526   MKHM-REENVEVQEKMDAIIKEIKEKEGEMDVVEALNQSLIVRERKSNDELQEARKELIN  584

Query  716   GLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWH  537
              L +     R+ IG++RMGEID + F    K +F  EEAD K LELCSLW+E ++DPNWH
Sbjct  585   SLKE--GRTRATIGVKRMGEIDNRPFLAAAKAKFPAEEADEKGLELCSLWEEYLRDPNWH  642

Query  536   PFRV-INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELW  360
             PF++ ++     ++II+ +D++L  LK E+GE++  AV  A  E+N+YN SGRY IPELW
Sbjct  643   PFKILVDKEGNCKEIIDVEDQKLKSLKNEYGEQVHNAVALAQSEMNQYNPSGRYTIPELW  702

Query  359   NFKEGRKATLKEVVSFIFKQLKTH-KRKR  276
             NFKE RKATLKE    +  Q + + KRKR
Sbjct  703   NFKENRKATLKEGAIHLLNQWRVNRKRKR  731



>gb|KHN07563.1| hypothetical protein glysoja_019670 [Glycine soja]
Length=566

 Score =   378 bits (970),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 224/546 (41%), Positives = 348/546 (64%), Gaps = 18/546 (3%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             I+EY++K YEEL++G   V+       CP+C  K+KQDY YK+LLQHA+GVG+ S+  R 
Sbjct  17    ISEYEDKSYEELKNGSQDVRTSGKTFTCPYCPKKRKQDYLYKELLQHASGVGQSSSQKRK  76

Query  1937  VKQKANHVALAKYLEIDLGDQAEPLPQRAVAPED--------NNLYCWPWTGIVVNV-SK  1785
              + KANH+AL KYL+ DL +    +P     PED        N+ + WPW G+VVN+ ++
Sbjct  77    ARDKANHLALVKYLKKDLMNV--DVPSNDSKPEDESDPSVNSNDQFVWPWIGVVVNIPTR  134

Query  1784  DNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
                +G  V E    L+   R   +    V    + +  +   +++   +W G  NA+ FE
Sbjct  135   RTEDGRCVGESGSRLRDEYRSRGFNPVRVNPLWNFRGHSGTALVEFNKNWPGLHNALAFE  194

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
              A+E + H KK+W    S   S +Y W A+ DDY+     G +LR    +KTI++L++EE
Sbjct  195   RAYELDHHGKKDWFT-NSGQKSGLYAWVARADDYKMNSIYGEHLRRMGDVKTISELMEEE  253

Query  1433  KRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRL  1254
              R +DK++SNLTN + +KN++L  +  R +E    ++ ++++KD L +A+ EE +K+Q  
Sbjct  254   ARRQDKLVSNLTNIIQVKNKHLKEIEVRCHETTDKMNLVMKDKDKLIQAYNEEIQKIQSS  313

Query  1253  AREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSS  1074
             AR+H QR+  + E L  +LE  K +L+    EL KRE   E E+ KL EE + N  +N+S
Sbjct  314   ARDHFQRIFTDHEKLKLQLESHKNELELRKVELEKREAHNESERKKLAEEIEENASKNTS  373

Query  1073  LEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVM  894
             L+MA+ EQ KADENV++L E+ KR+KE    KI++L+K +D KQ+LE+EIQ+LKG L V+
Sbjct  374   LQMAALEQMKADENVMKLAEDQKRQKEQLHAKIIQLQKQLDMKQELELEIQQLKGSLSVL  433

Query  893   EHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQG  714
             +HM  D+D+ +  K+  +++ L +K + ++DLD +N  L++KER+SNDELQEAR+ L+  
Sbjct  434   KHMEDDEDAEILNKVDTLQKDLRDKEQSLQDLDALNQTLIIKERESNDELQEARQALVDA  493

Query  713   LSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHP  534
             + +L + G  +I  +RMGE+D + F    KQR++ E+A+ +A ELCSLW+E +KDP+WHP
Sbjct  494   IKELQSHG--NIRFKRMGELDTRPFLEAMKQRYNEEDAEERASELCSLWEEYLKDPDWHP  551

Query  533   FRVINI  516
             F+VI +
Sbjct  552   FKVIMV  557



>ref|XP_006378650.1| XH/XS domain-containing family protein [Populus trichocarpa]
 gb|ERP56447.1| XH/XS domain-containing family protein [Populus trichocarpa]
Length=676

 Score =   381 bits (979),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 253/674 (38%), Positives = 395/674 (59%), Gaps = 78/674 (12%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             EY+E+ YE+L+  + +V+      +CP+C G+     +      HA+ +G+GS   ++K+
Sbjct  17    EYEERHYEDLKKERIRVRVSGSVYKCPYCHGRDYHLRELLQ---HASDLGRGSRRGTLKE  73

Query  1928  KANHVALAKYL--EIDLGDQAEPLPQR---------------------------------  1854
             +A H+ALA+Y+   +D+ D++E   +R                                 
Sbjct  74    EAQHLALARYIRRHLDVKDRSESSSKRFKTEPPAVYDHNKEQLFVHSAKRPKTESLAACD  133

Query  1853  -------------------AVAPEDN-NLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK-  1737
                                AV   D   L  WPW G++ N+  +  +G  V E    L+ 
Sbjct  134   HDKEQPFVPSAKRPKTECHAVHDHDKEQLLVWPWMGVLANIQTEMKDGRRVGESGSKLRD  193

Query  1736  --RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAER  1563
                   +    V         +   +++ K DW+G+ NAI+FE  F+     KKE+T   
Sbjct  194   ELARKGFNPVRVHPLWGRYGHSGFAIVEFKKDWDGFSNAIMFEKDFDLNHCGKKEYT---  250

Query  1562  SSP----SSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTN  1395
              +P       +YGW A+ DDY+A G VG +LR+   LK++     E++R   K++SNL +
Sbjct  251   ETPVRDRGQRLYGWIAQEDDYKASGLVGDHLRKNGDLKSVDGKQAEDQRKDAKLVSNLKS  310

Query  1394  ELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQE  1215
              L+ K+++L  + +R+ E + SL++++++K+ + +++ EE RKMQ+   +H + +  E E
Sbjct  311   TLERKHDHLREMESRYKETSASLNKVMDQKEAMEKSYNEEIRKMQQNEHDHFEEISVEHE  370

Query  1214  TLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADE  1035
              +   L  ++++L    ++L +REV  E ++LKL  EKK N       E A+ EQK ADE
Sbjct  371   KVTRLLLAQREELKQREKQLQRREVQNENDRLKLHHEKKMN-------ERATLEQKMADE  423

Query  1034  NVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQE  855
             +VLRL EE KREKE   +KI +LEK +DAKQ LE+EI+ +K  L +M+HMG D+D  V++
Sbjct  424   SVLRLAEEQKREKEKLHKKIFDLEKKLDAKQALELEIECMKNSLQIMKHMGEDEDLDVKK  483

Query  854   KIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIG  675
             K+  ++E+L EK E++  L+++N AL++KER++NDELQ+ARK LI  L     + R+ IG
Sbjct  484   KMDTVREELKEKEEELDGLEQLNQALIIKERKTNDELQDARKELISYLGQ--GTTRAFIG  541

Query  674   IRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-NIHDRPEQ  498
             ++RMG++DGK FH   K +F  EEAD KALELCSLW+++++DP+WHPF+VI +     ++
Sbjct  542   VKRMGDLDGKPFHEASKIKFLDEEADEKALELCSLWEDRLRDPSWHPFKVILDKEGNSKE  601

Query  497   IINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVV  318
             IINEDDE L  LK E+G+E+  AV+ A++E+NEYN SGRYVI ELWNFKE RKATL E V
Sbjct  602   IINEDDENLRSLKSEFGDEVFNAVVTALKEMNEYNPSGRYVIKELWNFKEERKATLSEGV  661

Query  317   SFIFKQLKTHKRKR  276
               I KQ +  KR++
Sbjct  662   MHILKQWRQLKRRK  675



>ref|NP_001054677.1| Os05g0153200 [Oryza sativa Japonica Group]
 gb|AAU44158.1| putative transcription factor [Oryza sativa Japonica Group]
 dbj|BAF16591.1| Os05g0153200 [Oryza sativa Japonica Group]
Length=617

 Score =   379 bits (972),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 238/615 (39%), Positives = 369/615 (60%), Gaps = 16/615 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y    Y  L +G  KV       +CPFC+  +K DY    LLQHA  VG    +R  K+K
Sbjct  14    YGSDTYALLEAGDIKVMNDKNMYQCPFCS-DEKNDYNAHGLLQHALAVGSAD-DRPAKEK  71

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAVAPED--NNLYCWPWTGIVVNVSKDNANGTAVEEE  1752
             ANH ALA +L+ D  + + PL Q    P+   N+L+ WPW GI+VN+  +    +A   +
Sbjct  72    ANHRALALHLKDDTAESSRPLSQ---PPQHSKNDLFVWPWMGIIVNMPAEYVGKSANRLK  128

Query  1751  DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWT  1572
             ++    FS Y   +V         +   +I+   DW+ ++NA+ FE+ FE +   KK W 
Sbjct  129   EH----FSCYHPSKVYSVYSKGRPSGNAIIEFGKDWSSFRNALQFESEFEKKGCGKKAWL  184

Query  1571  -AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTN  1395
              + R  P    +GW A+ DDY + G +G +L+    LKT++D+  E     DK++++L  
Sbjct  185   DSGRGGPEP--FGWIARADDYNSSGPIGEHLKRNGDLKTVSDVENEGTVKTDKLMASLAC  242

Query  1394  ELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQE  1215
             ++  K  +L  L + ++E+ LSL +M+E ++ + ++   E +KMQ+LA E  QR + E +
Sbjct  243   QVKEKEIHLEKLQSVYDERYLSLGKMMESRENMLKSCNTEIQKMQQLAYEQAQRTVDENQ  302

Query  1214  TLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADE  1035
              L   L+    +LD+  + L +     + +K  L+   ++N ++   L +A  EQ+KAD 
Sbjct  303   KLRLNLQSMMHELDANCKRLEELTAQADSDKRNLEVLMQKNAKKADHLRLAELEQQKADG  362

Query  1034  NVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQE  855
             NVLRL+EEH REKEA L   + L + +D KQKLE+EI  LKGKL V +H  G +DS +++
Sbjct  363   NVLRLVEEHNREKEATLNSNMRLHEQLDRKQKLELEIAHLKGKLQVTKHTQGTEDSDLEK  422

Query  854   KIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS--H  681
              I+ +  +L+EKIEDM  +D MN  L+LKE++S DELQEARKL+I  L  L +  RS   
Sbjct  423   TIEALTNELEEKIEDMNYMDNMNQTLILKEKRSKDELQEARKLVIDSLQRLPSDIRSQAQ  482

Query  680   IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE  501
             IGI+R+GE+D K F + C++RFS + A+V++  LCS WQ ++KDP WHPF+ + ++ +  
Sbjct  483   IGIKRIGELDLKVFSDACRRRFSEDFAEVESSVLCSKWQNEIKDPEWHPFKSVWVNGKES  542

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
             ++I EDDE+L +LKEE+G+E+  AV  A+ E++ ++  GR    ELWN++EGRKA  +EV
Sbjct  543   KVIREDDEKLQQLKEEYGQEVYDAVTNALFELDMHSIGGRDPFLELWNYEEGRKAGTREV  602

Query  320   VSFIFKQLKTHKRKR  276
             +  + K  K  KR+R
Sbjct  603   IQQVIKLYKATKRRR  617



>ref|XP_007141865.1| hypothetical protein PHAVU_008G232300g [Phaseolus vulgaris]
 gb|ESW13859.1| hypothetical protein PHAVU_008G232300g [Phaseolus vulgaris]
Length=1146

 Score =   391 bits (1005),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 236/622 (38%), Positives = 373/622 (60%), Gaps = 23/622 (4%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKGSAN-RSVK  1932
             Y  K YE L+   + VK       CP+C  KK++       + +HA+GVG+ S+  RS  
Sbjct  533   YVHKSYEALKKVSHIVKTSEMTFACPYCPNKKRKRDYVYREILEHASGVGQSSSQKRSAT  592

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNL---YCWPWTGIVVNV-------SKD  1782
             +KANH+AL KYL+ DL +   P     +  ++ N    + WPW GI+VN+        + 
Sbjct  593   EKANHLALMKYLQKDLMNVDGP----PITVDEGNAEEQFVWPWAGILVNIPTRQTEDGRV  648

Query  1781  NANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
               +G+ + +E     R   +    V+   D    +   V++   DW G  NA+ FE A+E
Sbjct  649   GGSGSKLRDE----HRSRGFNPCRVRTLSDVCGHSGTAVMEFNKDWTGLDNALAFERAYE  704

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
              + H KK+W +  +   S +Y W A+ DDY+    +G  L++   ++TI++L++EE R  
Sbjct  705   LDHHGKKDWFS-NTEQKSGIYAWIARADDYKMNNIIGEQLQKMGDIQTISELMKEEARIH  763

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
              K++S L N + +K + L  +  ++NE +  +  ++ E D L +   +E +K+Q  A +H
Sbjct  764   GKLVSCLNNTIQVKKKRLMEMEEKYNETSRHMEIVMGEIDKLTQDHNQEMKKIQSSATQH  823

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
              Q + +  E L  +LE +K++ +    EL KRE   E E+ KL+EE   N  +NS++EMA
Sbjct  824   FQNIFNGHERLKLQLESQKREFELRRIELEKREAHNESERKKLEEEIMENALKNSAMEMA  883

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
               EQ+KA  NV +L  + KR+KE    KI+ LEK ++ KQKLE+EIQ+LKGKL+VM+++ 
Sbjct  884   VLEQQKAGVNVWKLAADQKRQKEQLRHKIIRLEKQLEVKQKLELEIQQLKGKLNVMQYIE  943

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
              D DS V   +  + + L EK + ++D+D +N  L++KERQSNDELQEARK LI G+ ++
Sbjct  944   DDGDSEVLNTVNVLHKDLREKEQSLRDVDALNQTLIIKERQSNDELQEARKELINGIKEI  1003

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
               S R+ +G++RMGE+D + F    K++++ E+A+ +A ELCSLW+E +KDP WHPF++ 
Sbjct  1004  --SCRASVGVKRMGELDIRPFLEAMKKKYNVEDAEDRASELCSLWEEYIKDPEWHPFKIT  1061

Query  521   NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGR  342
              I  + ++II+ +DE+L  L+ E G  +  AV+ AV E+N YN SGRY   ELWN++EG+
Sbjct  1062  VIEGKEQEIIDNEDEKLKALQNELGAGVYQAVVTAVTEINTYNPSGRYTTSELWNYEEGK  1121

Query  341   KATLKEVVSFIFKQLKTHKRKR  276
             +ATL+E V  +  Q K  K+KR
Sbjct  1122  RATLQEGVKLLLMQWKLSKQKR  1143


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 2/76 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y +  Y+EL+ G YKVK  +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20    YVDISYQELKKGSYKVKSSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSGKRTAKE  78

Query  1928  KANHVALAKYLEIDLG  1881
             KANH+AL KYLE DL 
Sbjct  79    KANHLALVKYLEKDLA  94


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 77/135 (57%), Gaps = 6/135 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkk-kqdykykdllQHATGVGKG-SANR  1941
             I  Y +K YEEL+ G++ VK  +    CP+C  KK  +DY Y+++L+HA+GVG+  S  R
Sbjct  410   IGRYVDKFYEELKKGRHCVKTSDETFTCPYCPNKKLNRDYVYREILEHASGVGQSRSQKR  469

Query  1940  SVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAV  1761
             S  ++ANH+AL KYL+ D+ +     P + +  +       P   ++ + S+ + N +A 
Sbjct  470   SFFERANHLALEKYLKKDVMNVGASFPSKPM--DQGTTTATPGETVMGHYSQKDNNISAT  527

Query  1760  EEEDYWLKRFSKYEA  1716
             +   +++ +   YEA
Sbjct  528   QISGWYVHK--SYEA  540


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y +K Y+EL+ G + V+       CP+C  K+KQDY Y++LL HA+GVG+ S+  RSV++
Sbjct  250   YVDKFYKELKKGNHIVQTSEETFSCPYCPKKRKQDYVYRELLDHASGVGQSSSQKRSVRE  309

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             KA H+AL KYL+ DL    +P
Sbjct  310   KATHLALMKYLKNDLMHMNDP  330


 Score = 54.7 bits (130),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y +  YEEL+ G Y VK  +    CP+C  ++KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  134   YVDTSYEELKKGSYNVKTSDVTFICPYCP-RRKQDYLYRELLEHAYMVGRSSSEKRSARE  192

Query  1928  KANHVALAKYLEIDL  1884
             +ANH+AL KYLE DL
Sbjct  193   RANHLALVKYLENDL  207



>ref|XP_006435547.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
 gb|ESR48787.1| hypothetical protein CICLE_v10030937mg [Citrus clementina]
Length=574

 Score =   376 bits (966),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 235/540 (44%), Positives = 356/540 (66%), Gaps = 17/540 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19    YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  1928  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  1767
             KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79    KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  1766  AVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
             +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139   SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             A+ H KK+W A     S  +Y W A+ DDY  +  +G +LR+   LKTI+++++EE R +
Sbjct  197   ADHHGKKDWYASNQEKSG-LYAWVARSDDYNLKNIIGDHLRKIGDLKTISEMMEEEARKQ  255

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             + ++SNLTN +++K+++L  +  RF E + S+ +++EEKD L +++ EE +K+Q  AR+H
Sbjct  256   NLLVSNLTNMIEVKDKHLEEMKERFTETSNSVEKLMEEKDRLLQSYNEEIKKIQLSARDH  315

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
              QR+  + E L  +LE +KK+L+    EL KRE   E ++  L EE ++N  RN+SL++A
Sbjct  316   FQRIFTDHEKLKLQLESQKKELELRGEELEKRETQNENDRKILAEEIEKNAMRNNSLQLA  375

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             S  Q+KADENV +L E+ K++KE    +I++LEK +DAKQ L +EI+ LKG L+VM+HMG
Sbjct  376   SLVQQKADENVRKLAEDQKKQKEDLHNRIIQLEKQLDAKQALALEIERLKGSLNVMKHMG  435

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
              D D  V +K++ + + L EK  ++ DL+ +N  L+++ER+SNDELQ+ARK LI  L +L
Sbjct  436   DDGDIEVLQKMETVLKDLREKEGELDDLEALNQTLIIRERKSNDELQDARKELINALKEL  495

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
               +GR+HIG++RMGE+D K F  V  ++++ EEA+ +A ELCSLW+E +KDP+WHPF+VI
Sbjct  496   --AGRAHIGLKRMGELDNKPFLEVMNRKYNEEEAEERASELCSLWEEYLKDPDWHPFKVI  553



>ref|XP_006486475.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X2 [Citrus sinensis]
Length=597

 Score =   377 bits (967),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 235/540 (44%), Positives = 356/540 (66%), Gaps = 17/540 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19    YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  1928  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  1767
             KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79    KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  1766  AVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
             +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139   SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             A+ H KK+W A     S  +Y W A+ DDY  +  +G +LR+   LKTI+++++EE R +
Sbjct  197   ADHHGKKDWYASNQEKSG-LYAWVARSDDYNLKNIIGDHLRKIGDLKTISEMMEEEARKQ  255

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             + ++SNLTN +++K+++L  +  RF E + S+ +++EEKD L +++ EE +K+Q  AR+H
Sbjct  256   NLLVSNLTNMIEVKDKHLEEMKERFTETSNSVEKLMEEKDRLLQSYNEEIKKIQLSARDH  315

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
              QR+  + E L  +LE +KK+L+    EL KRE   E ++  L EE ++N  RN+SL++A
Sbjct  316   FQRIFTDHEKLKLQLESQKKELELRGEELEKRETQNENDRKILAEEIEKNAMRNNSLQLA  375

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             S  Q+KADENV +L E+ K++KE    +I++LEK +DAKQ L +EI+ LKG L+VM+HMG
Sbjct  376   SLVQQKADENVRKLAEDQKKQKEDLHNRIIQLEKQLDAKQALALEIERLKGSLNVMKHMG  435

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
              D D  V +K++ + + L EK  ++ DL+ +N  L+++ER+SNDELQ+ARK LI  L +L
Sbjct  436   DDGDIEVLQKMETVLKDLREKEGELDDLEALNQTLIIRERKSNDELQDARKELINALKEL  495

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
               +GR+HIG++RMGE+D K F  V  ++++ EEA+ +A ELCSLW+E +KDP+WHPF+VI
Sbjct  496   --AGRAHIGLKRMGELDNKPFLEVMNRKYNEEEAEERASELCSLWEEYLKDPDWHPFKVI  553



>gb|EEE62370.1| hypothetical protein OsJ_17159 [Oryza sativa Japonica Group]
Length=691

 Score =   379 bits (972),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 238/615 (39%), Positives = 369/615 (60%), Gaps = 16/615 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y    Y  L +G  KV       +CPFC+  +K DY    LLQHA  VG    +R  K+K
Sbjct  88    YGSDTYALLEAGDIKVMNDKNMYQCPFCS-DEKNDYNAHGLLQHALAVGSAD-DRPAKEK  145

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAVAPED--NNLYCWPWTGIVVNVSKDNANGTAVEEE  1752
             ANH ALA +L+ D  + + PL Q    P+   N+L+ WPW GI+VN+  +    +A   +
Sbjct  146   ANHRALALHLKDDTAESSRPLSQ---PPQHSKNDLFVWPWMGIIVNMPAEYVGKSANRLK  202

Query  1751  DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWT  1572
             ++    FS Y   +V         +   +I+   DW+ ++NA+ FE+ FE +   KK W 
Sbjct  203   EH----FSCYHPSKVYSVYSKGRPSGNAIIEFGKDWSSFRNALQFESEFEKKGCGKKAWL  258

Query  1571  -AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTN  1395
              + R  P    +GW A+ DDY + G +G +L+    LKT++D+  E     DK++++L  
Sbjct  259   DSGRGGPEP--FGWIARADDYNSSGPIGEHLKRNGDLKTVSDVENEGTVKTDKLMASLAC  316

Query  1394  ELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQE  1215
             ++  K  +L  L + ++E+ LSL +M+E ++ + ++   E +KMQ+LA E  QR + E +
Sbjct  317   QVKEKEIHLEKLQSVYDERYLSLGKMMESRENMLKSCNTEIQKMQQLAYEQAQRTVDENQ  376

Query  1214  TLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADE  1035
              L   L+    +LD+  + L +     + +K  L+   ++N ++   L +A  EQ+KAD 
Sbjct  377   KLRLNLQSMMHELDANCKRLEELTAQADSDKRNLEVLMQKNAKKADHLRLAELEQQKADG  436

Query  1034  NVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQE  855
             NVLRL+EEH REKEA L   + L + +D KQKLE+EI  LKGKL V +H  G +DS +++
Sbjct  437   NVLRLVEEHNREKEATLNSNMRLHEQLDRKQKLELEIAHLKGKLQVTKHTQGTEDSDLEK  496

Query  854   KIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS--H  681
              I+ +  +L+EKIEDM  +D MN  L+LKE++S DELQEARKL+I  L  L +  RS   
Sbjct  497   TIEALTNELEEKIEDMNYMDNMNQTLILKEKRSKDELQEARKLVIDSLQRLPSDIRSQAQ  556

Query  680   IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE  501
             IGI+R+GE+D K F + C++RFS + A+V++  LCS WQ ++KDP WHPF+ + ++ +  
Sbjct  557   IGIKRIGELDLKVFSDACRRRFSEDFAEVESSVLCSKWQNEIKDPEWHPFKSVWVNGKES  616

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
             ++I EDDE+L +LKEE+G+E+  AV  A+ E++ ++  GR    ELWN++EGRKA  +EV
Sbjct  617   KVIREDDEKLQQLKEEYGQEVYDAVTNALFELDMHSIGGRDPFLELWNYEEGRKAGTREV  676

Query  320   VSFIFKQLKTHKRKR  276
             +  + K  K  KR+R
Sbjct  677   IQQVIKLYKATKRRR  691



>gb|KDO69293.1| hypothetical protein CISIN_1g0065972mg [Citrus sinensis]
Length=574

 Score =   375 bits (963),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 235/540 (44%), Positives = 356/540 (66%), Gaps = 17/540 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y++K Y++L+SG + VK  +    CP+C  K+KQ+Y YKDLLQHA+GVG  ++N RS K+
Sbjct  19    YEDKSYKKLKSGNHSVKISDEAFTCPYCPKKRKQEYLYKDLLQHASGVGNSTSNKRSAKE  78

Query  1928  KANHVALAKYLEIDLGDQAEPL-PQRAVAP----EDNNLYCWPWTGIVVNVSKDNA-NGT  1767
             KANH+ALAKYLE DL D   P  P     P      +  + WPWTGIVVN+    A +G 
Sbjct  79    KANHLALAKYLEKDLRDAGSPSKPVNEGDPLTGCSHDEKFVWPWTGIVVNIPTRRAEDGR  138

Query  1766  AVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
             +V E      D  ++R   +    V    + +  +   V++   DW G  NA+ FE A+E
Sbjct  139   SVGESGSKLRDELIRR--GFNPTRVHPLWNFRGHSGCAVVEFHKDWPGLHNAMSFEKAYE  196

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
             A+ + KK+W A     S  +Y W A+ DDY  +  +G +LR+   LKTI+++++EE R +
Sbjct  197   ADHYGKKDWYASNQEKSG-LYAWVARSDDYNLKNIIGDHLRKIGDLKTISEMMEEEARKQ  255

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREH  1242
             + ++SNLTN +++K+++L  +  RF E + S+ +++EEKD L +++ EE +K+Q  AR+H
Sbjct  256   NLLVSNLTNMIEVKDKHLEEMKERFTETSNSVEKLMEEKDRLLQSYNEEIKKIQLSARDH  315

Query  1241  VQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMA  1062
              QR+  + E L  +LE +KK+L+    EL KRE   E ++  L EE ++N  RN+SL++A
Sbjct  316   FQRIFTDHEKLKLQLESQKKELELRGEELEKRETQNENDRKILAEEIEKNAMRNNSLQLA  375

Query  1061  SKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMG  882
             S  Q+KADENV +L E+ K++KE    +I++LEK +DAKQ L +EI+ LKG L+VM+HMG
Sbjct  376   SLVQQKADENVRKLAEDQKKQKEDLHNRIIQLEKQLDAKQALALEIERLKGSLNVMKHMG  435

Query  881   GDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDL  702
              D D  V +K++ + + L EK  ++ DL+ +N  L+++ER+SNDELQ+ARK LI  L +L
Sbjct  436   DDGDIEVLQKMETVLKDLREKEGELDDLEALNQTLIIRERKSNDELQDARKELINALKEL  495

Query  701   LNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
               SGR+HIG++RMGE+D K F  V  ++++ EEA+ +A ELCSLW+E +KDP+WHPF+VI
Sbjct  496   --SGRAHIGLKRMGELDNKPFLEVMNRKYNEEEAEERASELCSLWEEYLKDPDWHPFKVI  553



>ref|XP_002444012.1| hypothetical protein SORBIDRAFT_07g005860 [Sorghum bicolor]
 gb|EES13507.1| hypothetical protein SORBIDRAFT_07g005860 [Sorghum bicolor]
Length=528

 Score =   373 bits (957),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 216/530 (41%), Positives = 339/530 (64%), Gaps = 23/530 (4%)
 Frame = -1

Query  1826  YCWPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKS  1650
             + WP  G++VN+  +  +G  V +    LK + S++  Q+V    + +  T   +++   
Sbjct  9     FVWPLMGVLVNMPTEWKDGRLVGQSGNRLKEQLSRFCPQKVSPLWNHRGHTGNAIVEFAK  68

Query  1649  DWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETR  1470
             DW G+KNA+ FEN FEAE + K++W   ++     ++GW A+ DD+  +G +G YLR+  
Sbjct  69    DWTGFKNALAFENHFEAEGYGKRDWKL-KNYRGLEMFGWVARADDHRCQGPIGAYLRKNG  127

Query  1469  QLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHR  1290
              LKT+  + +EE +  DK+++NL +++++KN ++  L +++N+   SL  M+E+++ + +
Sbjct  128   DLKTVGVVEREEAQKTDKLVANLASQIEVKNRHVEELKSKYNQTTASLDMMMEQREKILQ  187

Query  1289  AFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNREL------------NKR  1146
              + EE  KMQ+ +R H Q+V  E + L  ELE +  +LD  ++ L            N +
Sbjct  188   KYNEEIHKMQQDSRRHSQKVFDENKKLRKELESRMHELDLRSQHLDDIASQSDSDIRNLQ  247

Query  1145  EVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILEL  966
             +   +         + RN      L+MA+ EQ+KADENVL+L+EEHKREK+AA ++IL+L
Sbjct  248   QEKEKIIIAYGLAIRVRNKTETEHLKMATMEQQKADENVLKLVEEHKREKQAAHERILKL  307

Query  965   EKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMN  786
             ++D+DAKQKLE+EIQ LKGKL+VM+HM G+ DS  ++K+ E+ E+L EK+ + +D++ +N
Sbjct  308   QQDLDAKQKLELEIQTLKGKLEVMKHMLGEQDSESKKKMDELTEELKEKVAESEDMEALN  367

Query  785   NALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTE  606
               LV+KER+SNDELQ ARK LI G   +L + +++I  +RMGE+D KAF   C +R   E
Sbjct  368   KTLVIKERKSNDELQHARKELIDGFQ-VLVTVQANISTKRMGELDPKAFGKACGKRLPKE  426

Query  605   EADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAV  426
             +A+V +  LCS    ++++P WHPF         ++ +NEDDE L KLKEE GEE+   V
Sbjct  427   DAEVTSALLCSKLDAEIRNPKWHPF--------IKEFLNEDDEMLRKLKEEHGEEVYGLV  478

Query  425   IKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
              KA+ E+NEYN + RY +  LWN KEGR+ATLKE + ++ KQLKT KRKR
Sbjct  479   AKALLEINEYNPNDRYPVQVLWNNKEGRRATLKEGIQYMIKQLKTCKRKR  528



>ref|XP_003616411.1| Transcription factor X1-like protein [Medicago truncatula]
 gb|AES99369.1| XH/XS domain protein [Medicago truncatula]
Length=1122

 Score =   389 bits (998),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 246/638 (39%), Positives = 386/638 (61%), Gaps = 33/638 (5%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SVKQ  1929
             +  K Y EL+ G +KVK       CP+C  K+K DY+Y +LL HA GVG+  A R SV +
Sbjct  487   FVNKSYAELKKGVHKVKTSEDTFSCPYCP-KRKCDYRYSELLNHALGVGQSDAQRRSVLE  545

Query  1928  KANHVALAKYLEIDLGDQAEPLP----------------QRAVAPEDNNL-------YCW  1818
             KANH+AL KYLE DL       P                Q    P + N+       + W
Sbjct  546   KANHLALVKYLEKDLMTMNVERPLKPANKYLENNLMNVEQNRTKPVNENILVNSERQFVW  605

Query  1817  PWTGIVVNV-SKDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKS  1650
             PWTGIVVN+ +    +G  + E    L+   R   +  + V+   +    T   V++   
Sbjct  606   PWTGIVVNIPTSQTEDGRCIGESGSKLRDEYRIRGFNPRRVRTLWNSWGHTGAAVVEFNK  665

Query  1649  DWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETR  1470
              W G  NA+ FE A+E +CH KK+W +  +   S +Y W A+ DDY+    +G  L++  
Sbjct  666   SWLGLYNALAFERAYELDCHGKKDWLS-YTEQKSGLYAWVARADDYKVNNIIGEQLQKM-  723

Query  1469  QLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHR  1290
              +KTI ++++++ R  ++++ ++ N L +KN  +  +    NE  L +  ++ E D L +
Sbjct  724   DVKTIPEIMEQDARRFNRLVQSMHNILQVKNNKIKEMEVVCNEITLRMDIVMGEIDRLAQ  783

Query  1289  AFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkld  1110
             +  +E +K+Q  A +H Q VL+  E L  +LE +K++L+    EL KRE   E E+ KLD
Sbjct  784   SHSQEMKKIQSSANQHFQSVLNGHERLKLQLESQKRELELRRIELEKREARNESERKKLD  843

Query  1109  eekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEM  930
             EE  +   +N  L+MA+ EQ+KA ENVL+L  + KR+KE    KI++LEK ++ KQKLE+
Sbjct  844   EEINKTATKNHFLQMAAMEQQKAGENVLKLAADQKRQKEQLHAKIIQLEKQLNVKQKLEL  903

Query  929   EIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSND  750
             EIQ+LKGKL+VM+HM  D +  V + +  +   L EK + ++D+D +N  L++KER+SND
Sbjct  904   EIQQLKGKLNVMKHMEDDGELDVLDMMDALHIDLREKEQSLRDMDALNQTLIIKERKSND  963

Query  749   ELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSL  570
             ELQEARK LI  + ++    R+ I ++RMGE+D + F    K++++ + A+ +A ELCSL
Sbjct  964   ELQEARKELITTIKEM--PSRADIRVKRMGELDFRPFLEAMKKKYNEDVAEDRASELCSL  1021

Query  569   WQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNA  390
             W+E +KDP+WHPF++  I  + ++ I+++DE+L++L+ E GEE+  AV+ A++E+NEYN 
Sbjct  1022  WEEYLKDPDWHPFKISTIEGKHQEAIDDEDEKLNELRNEMGEEVYKAVVAALKEINEYNP  1081

Query  389   SGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             SGRY+  ELWN+ EG++ATL+E V  +  Q K +++KR
Sbjct  1082  SGRYITSELWNYAEGKRATLQEGVKVLLNQWKLNRQKR  1119


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y    YEEL++GK KVK       CP+C  ++KQDYK  +LL HATG+G+ S+  RS K+
Sbjct  20    YLVSSYEELKTGKQKVKTSAETFSCPYCP-ERKQDYKLNELLNHATGIGRSSSEKRSAKE  78

Query  1928  KANHVALAKYLEIDLGDQ---AEPLPQ  1857
             K +H+AL KYLE DL  +   + P+ Q
Sbjct  79    KGSHLALVKYLEQDLNSKDGASRPIDQ  105


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 67/111 (60%), Gaps = 10/111 (9%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y +K Y+EL++   KV+  +    CP+C   KK DY Y+++L+HA+GVG+ S+  RSV++
Sbjct  247   YVDKLYQELKNRSLKVRISDDAFTCPYCPKMKKPDYVYREILEHASGVGQSSSQKRSVRE  306

Query  1928  KANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNA  1776
             KA H+AL KYL+ D+     P P + V   D+       +G ++   ++NA
Sbjct  307   KATHLALMKYLKQDI--IYVPAPSKPVTEGDS-------SGAMIQSREENA  348


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y +  YEEL++G   VK  +G   CP+C  +K+     + L  HA  VG+ S+  RS ++
Sbjct  131   YVDTAYEELKNGTRNVKTSDGTFICPYCPNRKQDYLYRELLE-HAFMVGRSSSEKRSARE  189

Query  1928  KANHVALAKYLEIDLGDQAEPLPQRAV  1848
             +ANH+AL KYLE D+   + P P + V
Sbjct  190   RANHLALLKYLEKDI--TSMPGPSKPV  214



>gb|KHG17770.1| suppressor of gene silencing 3 -like protein [Gossypium arboreum]
Length=999

 Score =   386 bits (991),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 252/615 (41%), Positives = 389/615 (63%), Gaps = 24/615 (4%)
 Frame = -1

Query  2075  SGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVG-KGSANRSVKQKANHVALAKY  1899
             +GK+ VK  +    CP+C   +K+ Y+Y DL+QHA+GVG   SA R+   KANH+ALAKY
Sbjct  391   NGKHIVKASDETYTCPYCP--EKKIYRYLDLVQHASGVGNSSSARRTPIMKANHLALAKY  448

Query  1898  LEIDLGDQAEPLPQRAVAPEDNNLYC-------WPWTGIVVNV-SKDNANGTAVEEE---  1752
             LE  L      L  +  A ED    C       WPWTGIVVN+ ++ + +G  V E    
Sbjct  449   LEKGLVPLVSSL--KPAAQEDPLSGCDHDEKIVWPWTGIVVNIPTRKSEDGRTVGESGSR  506

Query  1751  --DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKE  1578
               D  ++R   +    V+   ++   +   V++ + DW+G  NA+ FENA+EA+   KK+
Sbjct  507   LRDELIRR--GFNPIRVRPLWNNCGHSGIAVVEFRKDWSGLHNALSFENAYEADHRGKKD  564

Query  1577  WTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLT  1398
             W A        +Y W A+ DD+++   +G +LR+T  +KTI+ L++EE R +D+++S LT
Sbjct  565   WGANNDVKYG-LYAWIARADDHKSSSIIGEHLRKTSDIKTISKLMEEEARKQDRLVSYLT  623

Query  1397  NELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQ  1218
             N L+ KN++L  +       + SL  ++EEKD L +A+ +E  K Q+ AR H Q+V  + 
Sbjct  624   NILETKNKHLKEMEAMCTVTSESLKVLMEEKDNLIQAYNKEINKTQQSARLHYQKVFSDH  683

Query  1217  ETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKAD  1038
             E + S+LE  +K L+    EL KRE L ERE+ KL EE + N  +NS+L +A+ EQK+AD
Sbjct  684   EKVKSQLESHRKDLELREVELEKREALIERERKKLAEELEENVVQNSALRLAALEQKRAD  743

Query  1037  ENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQ  858
             EN+++L E+ KR+KE    +I++LEK +  KQ LE+EI++L+G ++V+  +G +DD  V 
Sbjct  744   ENLMKLAEDQKRQKEELHNRIIQLEKQLAQKQALELEIEQLRGSMNVIRELGDEDDDIVL  803

Query  857   EKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHI  678
               I+   ++L EK  +++DL+ +N  L++ ER+SN+ELQEARK LI GL ++  S  ++I
Sbjct  804   TIIEASFKELREKERELEDLEALNQTLIVSERKSNNELQEARKELINGLKEI--SSCANI  861

Query  677   GIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIH-DRPE  501
             G++RMGE+D K F    K+R++ E A+ +A+ELCSLW+E +KDPNWHPF+ I +  +  +
Sbjct  862   GVKRMGELDNKPFLEAMKRRYNEELAEERAVELCSLWEEYLKDPNWHPFKRIKLEGEEYQ  921

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
             ++I+++DE+L  LK+E G E+  +V   + E+NEYN SGRY   ELWN+ EGR+A+L+E 
Sbjct  922   EVIDDEDEKLKDLKDEMGNEVYKSVTSVINEINEYNPSGRYATSELWNYGEGRRASLQEG  981

Query  320   VSFIFKQLKTHKRKR  276
             V F+       K KR
Sbjct  982   VEFLLNLWNATKGKR  996


 Score =   137 bits (344),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 151/259 (58%), Gaps = 17/259 (7%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVG-KGSANRS  1938
             + +Y+++ YE L+ G+  VK  +    CP+C  KKK+ Y+Y+DLLQHA+GVG   SA R 
Sbjct  1     MGKYEDRCYETLKKGRCIVKVSDKTYICPYCPPKKKRYYRYEDLLQHASGVGDSSSAKRR  60

Query  1937  VKQKANHVALAKYLE---IDLGDQAEPLPQRAVAP--EDNNLYCWPWTGIVVNVS-KDNA  1776
                KA+H ALAKYL+   + L   ++   Q       +D+    WPWTGIVVN+  + + 
Sbjct  61    PIVKASHRALAKYLKKNHVPLVSSSKLSAQEDTPSGHDDDEKIVWPWTGIVVNIPIRKSE  120

Query  1775  NGTAVEE-----EDYWLKR-FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
             NG +V +     +D  ++R F+      ++ +      +   V++ + DW G  +A+ FE
Sbjct  121   NGQSVGKSGSKLKDELIRRGFNPITVHPLRNY---HGHSGTAVVEFQKDWQGLHHALSFE  177

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEE  1434
             NA++A+ H KK+W+A  +     +Y W A+ DDY++   +G +L +TR LKTI  L++EE
Sbjct  178   NAYKADHHGKKDWSAN-TEVKYGLYAWVARADDYKSSSIIGEHLCQTRDLKTIPKLMEEE  236

Query  1433  KRDKDKILSNLTNELDLKN  1377
              R +D+++S LTN    KN
Sbjct  237   ARKQDRLVSYLTNITGTKN  255



>ref|XP_010232024.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like isoform X2 [Brachypodium 
distachyon]
Length=539

 Score =   373 bits (957),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 202/486 (42%), Positives = 326/486 (67%), Gaps = 5/486 (1%)
 Frame = -1

Query  1976  HATGVGKGSANRSVKQKANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVV  1797
             HA+G G  + NR  + KA H    +  E +   Q+   P+   A   + L+ WPW G++V
Sbjct  31    HASGAG-SADNRQGRDKATHRGSYQNHEKNELPQSSG-PRSQPAQNRDELFVWPWMGVLV  88

Query  1796  NVSKDNANGTAVEEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAIL  1620
             NV  +   G  V E    LK + S++  Q+V    + +  T   +++   D+ G+K A  
Sbjct  89    NVPTEWKGGRQVGESGNRLKEQLSRFCPQKVVPLWNYRGHTGNAIVEFGKDYKGFKAAFS  148

Query  1619  FENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQ  1440
             FEN FEAE + K++W A++    S ++GW A+VDD    G +G YL++   LKTI DL  
Sbjct  149   FENHFEAEGYGKQDWKAQKHR-GSEMFGWVARVDDQRTPGPIGEYLQKNGDLKTIADLEN  207

Query  1439  EEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQ  1260
             E  R  DK+++NL  ++++K +++  L  ++NE   SL +++EEK+ + + + +E  +MQ
Sbjct  208   EGTRKTDKLVANLAGQIEVKAKHVQELECKYNETTTSLDKVMEEKELILQKYNDEIHEMQ  267

Query  1259  RLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRN  1080
             ++AR H QR++ E + L SELE K + LD  +++L++  V ++ ++  L+ EK+++  + 
Sbjct  268   QVARRHSQRIIDENQKLRSELESKMQNLDLKSKQLDELAVRSDSDRRNLEREKEKHVVKT  327

Query  1079  SSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLD  900
               L+MA+ EQ++ADENVL+L+E+HKREK+AAL +I++LE+ +DAKQKLE+EI++L+GKL+
Sbjct  328   KYLKMAAMEQQRADENVLKLVEKHKREKQAALDEIIKLEQKLDAKQKLELEIKQLQGKLE  387

Query  899   VMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLI  720
             VM+HM G++DS  + KI E+ E+L EK +DM  ++ ++  L++KER+SNDELQ+ARK LI
Sbjct  388   VMKHMPGEEDSESKRKIDELNEELQEKYDDMDLMESLHQTLLIKERKSNDELQDARKKLI  447

Query  719   QGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNW  540
              GL D + +GR++IGI+RMG++D K+F   CK +FS E+A+V A  LCS WQE++K+P+W
Sbjct  448   DGLRDTI-TGRTNIGIKRMGDLDLKSFAIACKSKFSKEDAEVSASILCSKWQEEIKNPDW  506

Query  539   HPFRVI  522
             HPFRV+
Sbjct  507   HPFRVV  512



>ref|XP_010503501.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Camelina sativa]
 ref|XP_010503502.1| PREDICTED: protein INVOLVED IN DE NOVO 2-like [Camelina sativa]
Length=648

 Score =   375 bits (964),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 242/633 (38%), Positives = 394/633 (62%), Gaps = 28/633 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  +S
Sbjct  21    MDEYGDKMYLNLKGGKLKVKLSPQAFLCPYCPTKKKPSFQYKDLLQHASGVGNSNSEKKS  80

Query  1937  VKQKANHVALAKYLEIDLGDQA----EPLPQR-----AV--APEDNNLYCWPWTGIVVNV  1791
              K+KA+H+AL KYL+ DL D A    EP  +R     A+     D  L C PW GIVVN+
Sbjct  81    AKEKASHLALVKYLQQDLADSASDAAEPSAKRQKNGNAIQDCDHDEKLVC-PWKGIVVNI  139

Query  1790  -SKDNANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  1629
              +    +G +  E      D +++R   +    V+        +   +++   DWNG  N
Sbjct  140   PTTKGVDGRSAGESGSKLRDEYIQRG--FNPTRVRPLWSHWGHSGTAIVEFNKDWNGLHN  197

Query  1628  AILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITD  1449
             A+LF+ A+  + H KK+W  ++  P S +Y W A+ DDY     +G  LR+T  LKTI +
Sbjct  198   ALLFDKAYRVDGHGKKDWL-KKGCPKSGLYAWIARADDYNGNNIIGENLRKTGDLKTIAE  256

Query  1448  LLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESR  1269
             L +EE R + +++ NLT  ++ K +++  +      K+  L++++EEK+      Y E  
Sbjct  257   LTEEEARKQQRLVQNLTQLVEEKKKDMKEMEELCKVKSKELNQLMEEKEKNEEKHYRELN  316

Query  1268  KMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrnd  1089
              MQ     HVQ+++ +       LE +KK+L+    EL KREV    E++KL E+ ++N 
Sbjct  317   AMQERTFSHVQKIVDDHAKKKMLLESEKKKLEIRGIELAKREVHNVAERMKLTEDLEQNA  376

Query  1088  eRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKG  909
              +NSSLE+A+ EQ+KADE+V +L ++ +R+KE   +KI+ LE+  D KQ +E+E+++LKG
Sbjct  377   SKNSSLELATMEQQKADEDVKKLADDQRRQKEELHEKIIRLERQRDQKQAVELEVEQLKG  436

Query  908   KLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARK  729
             +L+VM+HMG D D+ + +K++ + + L+EK+E++ DLD++N  L+L+ER++NDELQEARK
Sbjct  437   QLNVMKHMGSDGDAEIVQKVETIYKDLNEKLEELSDLDKLNQTLILRERRTNDELQEARK  496

Query  728   LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  549
              L+    +++   +++IG++RMGE+  K F +  +Q++  ++ + +A+++  LW+  +KD
Sbjct  497   ELV----NIMREWKTNIGVKRMGELVTKPFMDAMQQKYCQQDVEDRAVDVLQLWEGYLKD  552

Query  548   PNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  375
             P+W P++ + + ++    ++I+E DE+L +LKE+ G+    AV +A+ E+NEYN SGRY+
Sbjct  553   PDWQPYKRVKLENQETEVEVIDETDEKLKELKEDLGDGPYNAVTQALLEINEYNPSGRYI  612

Query  374   IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
               ELWN KE RKATL+E V+ +  Q +  KRKR
Sbjct  613   TSELWNIKEDRKATLEEGVTCLLDQWEKAKRKR  645



>ref|XP_002875916.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52175.1| XH/XS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=647

 Score =   375 bits (964),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 238/633 (38%), Positives = 393/633 (62%), Gaps = 29/633 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21    MDEYGDKMYLNLKGGKLKVRLSPQAFVCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRS  80

Query  1937  VKQKANHVALAKYLEIDLGD---QAEPLPQRAV-------APEDNNLYCWPWTGIVVNVS  1788
              K+KA+H+AL KYL+ DL D   +AEP  +R           +D  L  +PW GIVVN+ 
Sbjct  81    AKEKASHLALVKYLQQDLADSAVEAEPSSKRQKNGNPIQDCDQDEKL-VYPWKGIVVNIP  139

Query  1787  KDNA-NGTAVEE------EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  1629
                A +G +  E      ++Y L+ F+      V+   +    +   +++   DWNG  N
Sbjct  140   TTKAQDGRSAGESGSKLRDEYILRGFN---PTRVRPLWNYWGHSGTAIVEFNKDWNGLHN  196

Query  1628  AILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITD  1449
              +LF+ A+  + H KK+W  ++  P   +Y W A+ DDY     +G  LR+T  LKTI +
Sbjct  197   GLLFDKAYRVDGHGKKDWL-KKDGPKLGLYAWIARADDYNGNNIIGENLRKTGDLKTIAE  255

Query  1448  LLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESR  1269
             L +EE R + K++ NLT  ++ K +++  +    + K+  L++++EEK+   +  Y E  
Sbjct  256   LTEEEARKQQKLVQNLTQLVEEKKKDMKQIEELCSVKSKELNQLMEEKEKNEQTHYRELN  315

Query  1268  KMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrnd  1089
              +Q     H+Q+++ + E L   LE +KK+L+    EL KREV    E++KL E+ ++N 
Sbjct  316   AIQERTMSHIQKIVDDHEKLKRLLESEKKKLEIKGNELAKREVHNGTERMKLSEDLEQNA  375

Query  1088  eRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKG  909
              +NSSLE+A+ EQ+KADE V +L E+ +R+KE   +KI+ LE+  D KQ +E+E+++LKG
Sbjct  376   SKNSSLELAAMEQQKADEEVKKLAEDQRRQKEELHEKIIRLERQRDQKQAIELEVEQLKG  435

Query  908   KLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARK  729
             +L+VM+HM  D D+ + +K++ + + L EK  +++DLD+ N  L+L+ER++NDELQEARK
Sbjct  436   QLNVMKHMASDGDAEIVKKVEIIFKDLGEKEGELEDLDKFNQTLILRERRTNDELQEARK  495

Query  728   LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  549
              L+    +++   ++ IG++RMGE+  + F +  +Q++  ++ + +A+E+  LW+  ++D
Sbjct  496   ELV----NIMKEWKTTIGVKRMGELVTQPFVDAMQQKYCQQDVEDRAVEVLQLWEGYLRD  551

Query  548   PNWHPFRVINI--HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  375
             P+WHP++ I +   DR  ++I++ DE+L +LK + G+    AV KA+ E+NEYN SG Y+
Sbjct  552   PDWHPYKRIKLENQDREVEVIDDRDEKLRELKADLGDGPYNAVAKALLEINEYNPSGSYI  611

Query  374   IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
               ELWN KE ++ATL+E V+ +  Q +  KRKR
Sbjct  612   TTELWNLKEDKRATLEEGVTCLLDQWEKAKRKR  644



>gb|EAY96594.1| hypothetical protein OsI_18500 [Oryza sativa Indica Group]
Length=617

 Score =   372 bits (956),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 236/615 (38%), Positives = 366/615 (60%), Gaps = 16/615 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y    Y  L +G  KV       +CPFC+  +K DY    LLQHA  VG    +R  K+K
Sbjct  14    YGSDTYALLEAGDIKVMNDKNMYQCPFCS-DEKNDYNAHGLLQHALAVGSAD-DRPAKEK  71

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAVAPED--NNLYCWPWTGIVVNVSKDNANGTAVEEE  1752
             ANH ALA +L+ D  + + PL Q    P+   N+L+ WPW GI+VN+  +    +A   +
Sbjct  72    ANHRALALHLKDDTAESSRPLSQ---PPQHSKNDLFVWPWMGIIVNMPAEYVGKSANRLK  128

Query  1751  DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWT  1572
             +++L     Y   +V         +   +I+   DW+ ++NA+ FE+ FE +   KK W 
Sbjct  129   EHFLC----YHPSKVYSVYSKGRPSGNAIIEFGKDWSSFRNALQFESEFEKKGCGKKAWL  184

Query  1571  -AERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTN  1395
              + R  P    +GW A+ DDY + G +G +L+    LKT++D+  E     DK++++L  
Sbjct  185   DSGRGGPEP--FGWIARADDYNSSGPIGEHLKRNGDLKTVSDVENEGTVKTDKLMASLAC  242

Query  1394  ELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQE  1215
             ++  K  +L  L + ++E+ LSL +M+E ++ + ++   E +KMQ+LA E  QR + E +
Sbjct  243   QVKEKEIHLEKLQSVYDERYLSLGKMMESRENMLKSCNTEIQKMQQLAYEQAQRTVDENQ  302

Query  1214  TLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADE  1035
              L   L+    +LD   + L +     + +K  L+   ++N ++   L +A  EQ+KAD 
Sbjct  303   KLRLNLQSMMHELDVNCKRLEELTAQADSDKRNLEVLMQKNAKKADHLRLAELEQQKADG  362

Query  1034  NVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQE  855
             NVLRL+EEH REKEA L   + L + +D KQKLE+EI  LKGKL V +H  G +DS +++
Sbjct  363   NVLRLVEEHNREKEATLNSNMRLHEQLDRKQKLELEIAHLKGKLQVTKHTQGTEDSDLEK  422

Query  854   KIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRS--H  681
              I+ +  +L+EKIEDM  +D MN  L+LKE++S DELQEARKL+I  L  L    RS   
Sbjct  423   TIEALTNELEEKIEDMNYMDNMNQTLILKEKRSKDELQEARKLVIDSLQRLPTDIRSQAQ  482

Query  680   IGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPE  501
             IGI+R+GE+D K F + C++R S + A+V++  LCS WQ ++KDP WHPF+ + ++ +  
Sbjct  483   IGIKRIGELDLKVFSDACRRRLSEDFAEVESSVLCSKWQNEIKDPEWHPFKSVWVNGKES  542

Query  500   QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEV  321
             ++I EDDE+L +LKEE+G+E+  AV  A+ E++ ++  GR    ELWN++EGRKA  +EV
Sbjct  543   KVIREDDEKLQQLKEEYGQEVYDAVTNALFELDMHSIGGRDPFLELWNYEEGRKAGTREV  602

Query  320   VSFIFKQLKTHKRKR  276
             +  + K  K  KR+R
Sbjct  603   IQQVIKLYKATKRRR  617



>ref|XP_006431941.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
 gb|ESR45181.1| hypothetical protein CICLE_v10000571mg [Citrus clementina]
Length=564

 Score =   370 bits (951),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 226/537 (42%), Positives = 348/537 (65%), Gaps = 12/537 (2%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             +Y++K YE+L+SG Y VK  +    CP+C  K+K DY+YKDLLQHA+G+G  S+ RS K+
Sbjct  18    DYEDKSYEKLKSGNYNVKISDETFTCPYCPKKRKHDYRYKDLLQHASGIG-NSSKRSAKE  76

Query  1928  KANHVALAKYLEIDLGD-QAEPLPQRAVAPED---NNLYCWPWTGIVVNV-SKDNANGTA  1764
             KANH+ALAK+LE DL D  ++  P   V P +   +  + WPW GIVVN+ ++   +G +
Sbjct  77    KANHLALAKFLETDLSDVGSQSKPVNGVDPLNVCSDGKFVWPWIGIVVNIPTRRGQDGRS  136

Query  1763  VEEEDYWLKR---FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
             V E    LK            V+   + +  +   +++   +W G  NA+ FE ++EA+ 
Sbjct  137   VGESGSKLKDELIRRGLHPTRVQSLWNFRGHSGCALVQFNKNWPGLDNAMAFEKSYEADH  196

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             H KK+W  E +   S +YGW A+ DDY     +G +LR+ R LKTI+ L++EE R K+ +
Sbjct  197   HGKKDWN-EGNQEKSGLYGWVARSDDYSLNNIIGEHLRKNRDLKTISGLVEEEARKKNLL  255

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +SNLTN +++KN++L  +  R  E +  +  ++EEKD L + + EE +K+Q  A++H QR
Sbjct  256   VSNLTNTIEVKNKHLEEMKERCIETSNFIENLMEEKDRLVQGYNEEIKKIQLSAQDHFQR  315

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +  E E    +LE +KK+L+    +L KRE   E ++  L EE ++N  RNSSL++A+ E
Sbjct  316   IFTEHENFKLQLEAQKKELEFLGVDLQKREAKNENDRKALAEEIEKNAMRNSSLQLATLE  375

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
             Q+KAD+NV +L E+ K EKE    KI++LEK +DAKQ LE+EI+ L+G   VM+H+    
Sbjct  376   QQKADDNVRKLAEDQKIEKEELHNKIIQLEKQLDAKQALELEIERLRGTSKVMKHVSDGG  435

Query  872   DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNS  693
             D+ VQ+K++ + + L EK  +++DL+ +N  L++KER+SND+LQ+ARK LI  + +   S
Sbjct  436   DAEVQQKMETVLKDLREKEGELEDLEALNQTLIIKERKSNDDLQDARKELINAMKE--TS  493

Query  692   GRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI  522
             G +HIG++RMGE+DGK F    K+ ++ EEA+ K  ELCSLW E ++D +WHPF+V+
Sbjct  494   GHAHIGLKRMGELDGKPFFEAMKKWYNEEEAEEKGSELCSLWDEYLRDSDWHPFKVV  550



>ref|XP_004490889.1| PREDICTED: uncharacterized protein LOC101499007 isoform X1 [Cicer 
arietinum]
 ref|XP_004490890.1| PREDICTED: uncharacterized protein LOC101499007 isoform X2 [Cicer 
arietinum]
 ref|XP_004490891.1| PREDICTED: uncharacterized protein LOC101499007 isoform X3 [Cicer 
arietinum]
Length=1122

 Score =   385 bits (988),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 250/634 (39%), Positives = 376/634 (59%), Gaps = 31/634 (5%)
 Frame = -1

Query  2096  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANR-SVKQKAN  1920
             K YEEL+ G  KVK       CP+C  K+K DYKY +LL HA GVG+  A R SV +KAN
Sbjct  490   KSYEELKKGSLKVKTSEETFACPYCP-KRKWDYKYNELLNHALGVGQSDAQRRSVLEKAN  548

Query  1919  HVALAKYLEIDLGDQ---------------------AEPLPQRAVAPEDNNLYCWPWTGI  1803
             H+AL KYL+ DL +                       +P  +  +     N + WPWTGI
Sbjct  549   HLALVKYLKKDLMNMEYRIKPVNKYLEKDLMNVEHPTKPTNKGRLLVSSENQFVWPWTGI  608

Query  1802  VVNV-SKDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGY  1635
             VVN+ ++   +G    E    L+   R   +    V+   +    T   V++    W G 
Sbjct  609   VVNIPTRQTEDGRCFGESGSKLRDEYRSKGFNPCRVRTLWNSWGHTGAAVVEFNKSWLGL  668

Query  1634  KNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTI  1455
              NA+ FE A+  + H K +W A  +   S +Y W A+VDDY  +  +G  L++   +KTI
Sbjct  669   HNALAFEKAYAVDHHGKNDWLA-YTEMKSGLYAWVARVDDYNMDNVIGEQLQKMGDVKTI  727

Query  1454  TDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEE  1275
              ++++EE R  DK++S++   L +KN  L  L    NE  L +  ++ E D L ++  +E
Sbjct  728   PEIMEEEARRLDKLVSSVNKILQVKNNQLKELEVVCNEITLRMDIVVGEIDRLTQSHSQE  787

Query  1274  SRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkr  1095
              +K+Q  A +H Q +L+  E L  +LE +K++L+    EL KRE   E E+ KL+EE   
Sbjct  788   MKKIQSSATQHFQNILNGHERLKLQLESQKRELEMRRIELEKREAHNETERRKLEEEINE  847

Query  1094  ndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQEL  915
                +N  L+MAS EQ+KA ENVL+L  + KR+KE    KI+ LEK ++ K  LE+EIQ+L
Sbjct  848   TATKNHFLQMASLEQQKAGENVLKLAADQKRQKEQLHAKIIRLEKQLNVKHNLELEIQQL  907

Query  914   KGKLDVMEHMGGDD-DSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQE  738
             KGKL+VM+HM  DD D  V   +  + + L EK + ++D+D +N  L++KER+SNDELQE
Sbjct  908   KGKLNVMKHMEDDDGDLDVLYTMDALHKDLREKEQSLRDMDALNQTLIVKERKSNDELQE  967

Query  737   ARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEK  558
             ARK LI  + ++    R  IG++RMGE+D + F    K++++ E A+ +A ELCSLW+E 
Sbjct  968   ARKELINSIKEM--PSRGDIGVKRMGELDIRPFIEAMKKKYNDEYAEDRASELCSLWEEY  1025

Query  557   VKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRY  378
             +KDP WHPF++  I  + +++I+++DE+L +LK E   E+  AV+ A++E+NEYN SGRY
Sbjct  1026  LKDPEWHPFKISVIEGKHQEVIDDEDEKLKELKNETSVEVYKAVVAALKEINEYNPSGRY  1085

Query  377   VIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             V  ELWN+ + ++ATL+E +  + KQ K H++KR
Sbjct  1086  VTSELWNYAKRKRATLQEGIQVLLKQWKFHRQKR  1119


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y    YEEL+ G++KVK       CP+C  ++K DYKY +LL HATGVG+ S++ RS K+
Sbjct  20    YVVSSYEELKQGRHKVKTSAETFTCPYCP-ERKHDYKYNELLNHATGVGRSSSDKRSAKE  78

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             K +H+AL KYLE DL  +  P
Sbjct  79    KGSHLALVKYLEEDLPSKDSP  99


 Score = 57.0 bits (136),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRSVKQ  1929
             Y +K Y+EL+ G   V+  +    CP+C   +K  Y+Y++LL+HA+GVG+  S  RSV++
Sbjct  249   YVDKFYKELKKGSLNVRISDAAFTCPYCPKMRKPTYEYRELLEHASGVGQSCSQKRSVRE  308

Query  1928  KANHVALAKYLEIDL  1884
             KA H+AL KYL+ D+
Sbjct  309   KATHLALVKYLKNDI  323


 Score = 56.6 bits (135),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = -1

Query  2096  KPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVG-KGSANRSVKQKA  1923
             K YE+L+ G   VK  +    CP+C  KK++       + +HA+GVG   S NRS  +KA
Sbjct  372   KSYEQLKKGIQNVKSSDDTFICPYCPNKKRKRDYAYREILEHASGVGWSSSQNRSAIEKA  431

Query  1922  NHVALAKYLE---IDLGDQAEPLPQRAV  1848
             NH+AL KYL+   I++G  +EP+ +  +
Sbjct  432   NHLALVKYLKKDLINVGGSSEPMDEGTI  459


 Score = 53.5 bits (127),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 87/179 (49%), Gaps = 9/179 (5%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y +  YEEL++G    K  +G   CP+C  K+KQDY Y++LL+HA  VG+ S+  RS ++
Sbjct  131   YVDTAYEELKNGTQNAKTSDGNFICPYCP-KRKQDYAYRELLEHAFMVGRSSSEKRSARE  189

Query  1928  KANHVALAKYLEIDLGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEED  1749
             +ANH+AL KYLE D+   + P P + V  +  NL     T + V     N +    E + 
Sbjct  190   RANHLALLKYLEKDV--VSMPGPSKPVE-KGTNLISQEQT-VTVTAHNSNKDTDTSESQI  245

Query  1748  YWL---KRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKK  1581
              W    K + + +   + +   D + T     K++     Y+  +   +     C  K+
Sbjct  246   SWFYVDKFYKELKKGSLNVRISDAAFTCPYCPKMRKPTYEYRELLEHASGVGQSCSQKR  304



>gb|EPS61376.1| hypothetical protein M569_13419, partial [Genlisea aurea]
Length=626

 Score =   371 bits (953),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 226/611 (37%), Positives = 380/611 (62%), Gaps = 17/611 (3%)
 Frame = -1

Query  2081  LRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVG-KGSANRSVKQKANHVALA  1905
             +++GK+ V+  +    CPFC+ K+K+D++YKDLLQHA+ +G +GS  RS  +KA+H+AL 
Sbjct  21    MKNGKHMVRVSDEAFSCPFCSKKRKRDFQYKDLLQHASAIGTQGSQKRSSLEKASHLALL  80

Query  1904  KYLEIDLG-DQAEPLPQ---RAVAPEDNN-LYCWPWTGIVVNVSKDNANGTAVEEEDYWL  1740
             KYL+ ++  D   P P     A+A +D   ++ WPW GI+VN+  +  +G  V      L
Sbjct  81    KYLQNEIAADNGAPKPSLETDALADQDREEMFVWPWIGIIVNIPTEFKDGRFVGNSGSKL  140

Query  1739  K---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTA  1569
             +       +    V+   + +  +    ++ + DW+G+ NA+ FE  +EA  H KK+W A
Sbjct  141   RDQLASKGFNPIRVRPLWNYQGHSGTATVEFRKDWSGFGNAMAFEKEYEANHHGKKDWIA  200

Query  1568  ERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNEL  1389
              +    S +Y W A+ DDY +   +G +LR+   L+T++D+++EE R  ++++ NLTN +
Sbjct  201   -KDEKKSDLYAWAARADDYNSNSIIGEHLRKIGDLRTVSDIMEEESRKTNQLVGNLTNVI  259

Query  1388  DLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETL  1209
             + K   +  +  +F E   SLS ++ EKD LH+A+ EE ++++  AR+H +++  + E +
Sbjct  260   EAKKMCIQEMENKFQETETSLSELVSEKDKLHQAYNEEMKRIEASARDHFKKIFSDHEKM  319

Query  1208  NSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENV  1029
               +LE +KK L+   +EL KRE   E EK +L E+ ++N   N SL+ A++E++KA+E  
Sbjct  320   KFQLEAQKKDLELRGQELQKREAHNEIEKKRLSEDLEQNAVENCSLQAAAEEERKANETA  379

Query  1028  LRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKI  849
             + L E+HK+E+E    KI++LEK +DAKQ LE+E+ +L+GK +VM+HM    +  V +++
Sbjct  380   MSLAEKHKKEQEVLHTKIIDLEKKLDAKQALELELAQLRGKAEVMKHMEDGGNVEVLKQV  439

Query  848   KEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIR  669
              E+++QL EK +D++  D     LV+ + + N ELQEARK L+        +  SHIG +
Sbjct  440   DELQKQLREKEQDLEIADASYQDLVVHDFKKNTELQEARKELVAKYV----TANSHIGRK  495

Query  668   RMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIIN  489
             +MG++D K FH   K+++S  EA+ KA EL  LW+E ++DP WHPF V+ +  + +++  
Sbjct  496   KMGDLDYKPFHESMKRKYSGAEAEEKATELHKLWEEYLRDPGWHPFNVVLVDGKEQRVFK  555

Query  488   eddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFI  309
             E DE+L +L++ + E+I  AV+  + E+NE NASG YV+  LWN +E R+A+L E +  +
Sbjct  556   EGDEKLRELRDHYDEDIYTAVVTCLREINENNASGGYVVSVLWNDRENREASLSEGIEVL  615

Query  308   ---FKQLKTHK  285
                +K+LK  K
Sbjct  616   VNHWKELKQQK  626



>ref|XP_010426360.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Camelina sativa]
 ref|XP_010426361.1| PREDICTED: protein INVOLVED IN DE NOVO 2 [Camelina sativa]
Length=648

 Score =   371 bits (953),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 239/633 (38%), Positives = 392/633 (62%), Gaps = 28/633 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  RS
Sbjct  21    MDEYGDKMYLNLKGGKLKVKLSPQAFLCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRS  80

Query  1937  VKQKANHVALAKYLEIDLGDQA----EPLPQR-----AV--APEDNNLYCWPWTGIVVNV  1791
              K+KA+H+AL KYL+ DL D A    EP  +R     A+    +D  L C PW GIVVN+
Sbjct  81    AKEKASHLALVKYLQQDLADSASDAAEPSAKRQKNGNAIQDCDQDEKLVC-PWKGIVVNI  139

Query  1790  -SKDNANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  1629
              +    +G +  E      D +++R   +    V+   +    +   +++   DWNG  N
Sbjct  140   PTTKGVDGRSAGESGSKLRDEYIQRG--FNPTRVRPLWNYWGHSGTAIVEFNKDWNGLHN  197

Query  1628  AILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITD  1449
             A+LF+ A+  + H KK+W  ++  P S +Y W A+ DDY     +G  LR+T  LKTI +
Sbjct  198   ALLFDKAYRVDGHGKKDWL-KKDCPKSGLYAWVARADDYNGNNIIGENLRKTGDLKTIAE  256

Query  1448  LLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESR  1269
             L +EE R + K++ NL   ++ K +++  +      K+  L++++EEK+      Y E  
Sbjct  257   LTEEEARKQQKLVQNLKQIVEEKKKDMKEMEELCKVKSRELNQLMEEKEKNEEKHYRELS  316

Query  1268  KMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrnd  1089
              +      H+++++ + E     LE +K++L+    EL KREV  E E+ KL ++ ++N 
Sbjct  317   ALDERTYRHIKKIVDDHEKSKRLLESEKEKLEIRGIELAKREVHNEAERKKLTQDLEQNA  376

Query  1088  eRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKG  909
              +NSSLE+A+ EQ+KADE V +L E+  R+KE   +KI+ LE+  D KQ +E+E+++LKG
Sbjct  377   SKNSSLELATMEQQKADEEVKKLAEDQSRQKEELHEKIIRLERQRDQKQAVELEVEQLKG  436

Query  908   KLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARK  729
             +L+VM+HMG D D+ + +K++ + + L+EK+E++ DLD++N  L+L+ER++NDELQEARK
Sbjct  437   QLNVMKHMGSDGDAEIVQKVETIYKDLNEKLEELSDLDKLNQTLILRERRTNDELQEARK  496

Query  728   LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  549
              L+    +++   +++IG++RMGE+  K F +  +Q++  ++ + +A+++  LW+  +KD
Sbjct  497   ELV----NIMKEWKTNIGVKRMGELVTKPFMDAMQQKYCQQDVEDRAVDVLQLWEGYLKD  552

Query  548   PNWHPFRVINIHDRPE--QIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  375
             P+W P++ + + ++    ++I+E DE+L +LK + G+    AV +A+ E+NEYN SGRY+
Sbjct  553   PDWQPYKRVKLENQETEVEVIDETDEKLRELKADLGDGPYKAVTQALLEINEYNPSGRYI  612

Query  374   IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
               ELWN KE RKATL+E V+ +  Q +  KRKR
Sbjct  613   TSELWNIKEDRKATLEEGVTCLLDQWEKAKRKR  645



>ref|XP_006846214.1| hypothetical protein AMTR_s00012p00226630 [Amborella trichopoda]
 gb|ERN07889.1| hypothetical protein AMTR_s00012p00226630 [Amborella trichopoda]
Length=638

 Score =   370 bits (950),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 249/623 (40%), Positives = 390/623 (63%), Gaps = 26/623 (4%)
 Frame = -1

Query  2090  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKANHVA  1911
             YEEL SGK+ ++  NG  RCPFC GKKKQ Y YKDLLQHA+GVG  S++R  ++K  H A
Sbjct  24    YEELTSGKHFLRNSNGTFRCPFCIGKKKQAYAYKDLLQHASGVG-SSSSRKTQEKGKHRA  82

Query  1910  LAKYLEIDLGDQAEPL--------PQRAVAPEDNNLYCWPWTGIVVNVSK--DNANGTAV  1761
             LAK+L+ ++ D  EP         P    A +D  ++ +PW GI+VN+    D  +   V
Sbjct  83    LAKFLKAEVADDPEPSNGSKEIQKPLSKSASDD--IFVYPWMGIIVNIETGYDQKSSKYV  140

Query  1760  EEEDYWLK-RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAF-EAECHS  1587
                   LK +F +++  +V    + +      ++    DW G+ NA+ FE  F E +C  
Sbjct  141   GLGANQLKAQFERFQPVKVHPIWNYQGHLGIAIVDFHKDWTGHHNAMSFEKYFAEIQC-G  199

Query  1586  KKEWTAERSSPSSH---VYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
             KK+W  ++ +  +     YGW A+VDDYEA+  +G +LR+   LKT+ +L  E K+ ++ 
Sbjct  200   KKQWLEQKKNGKNCKKIFYGWVARVDDYEADDYIGKHLRDNGDLKTVAELANEHKQRENT  259

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNL---SLSRMIEEKDTLHRAFYEESRKMQRLARE  1245
             ++ +L NE+ LK+ +L +   +  E       + R +  +D  HR   +E RK ++    
Sbjct  260   LVEDLKNEILLKSRSLESHEEKLKEMEYIKQEMDRKLALQDEAHR---DELRKERQNQAN  316

Query  1244  HVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEM  1065
                R++ E+    + L  ++ +L+  ++EL K E   + EK KL+EEK++N  +NSSL+ 
Sbjct  317   IWSRLMAERNRHEATLALERDELERRHKELEKWEARNDAEKKKLEEEKRKNALKNSSLQK  376

Query  1064  ASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHM  885
             AS EQK  DE V  L+E HK E+E     + + +K+++ KQ++E+EIQ+LKG+L +M+H+
Sbjct  377   ASLEQKIVDEKVKELMEHHKIEQERLANVVRKQQKELNEKQRVEVEIQKLKGELVMMKHL  436

Query  884   GGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD  705
              GDD++ + EKIK + E+L EK  +M+ L+++N+AL+ KER++NDELQ ARK  I+   D
Sbjct  437   QGDDNTDIDEKIKAVVEELQEKENEMQCLEDLNSALLSKERETNDELQAARKEAIEFFKD  496

Query  704   LLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRV  525
               N+ R+HIG +RMG +D + F +  K +    + ++KA ELCSLW++  +DP WHP+  
Sbjct  497   QPNT-RAHIGAKRMGALDDQPFKDAVKAKLQGGDWEIKASELCSLWEDHTRDPAWHPYMT  555

Query  524   INIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEG  345
             I I  + +++I+E+DE+L + ++E+G+E   AV +A+ E+NEYN SGRY + +LWNFKEG
Sbjct  556   IFIEGKNQEVIDENDEKLKEFRDEYGDEAFKAVERAMLELNEYNPSGRYPVWDLWNFKEG  615

Query  344   RKATLKEVVSFIFKQLKTHKRKR  276
             R+ATL+EVV  + KQLKT KRKR
Sbjct  616   RRATLQEVVHHLIKQLKTLKRKR  638



>ref|NP_190436.2| XH/XS domain-containing protein [Arabidopsis thaliana]
 ref|NP_974403.1| XH/XS domain-containing protein [Arabidopsis thaliana]
 sp|Q8VZ79.1|IDN2_ARATH RecName: Full=Protein INVOLVED IN DE NOVO 2; AltName: Full=Protein 
RNA-DIRECTED DNA METHYLATION 12 [Arabidopsis thaliana]
 gb|AAL38360.1| putative protein [Arabidopsis thaliana]
 gb|AAN15455.1| putative protein [Arabidopsis thaliana]
 gb|AEE78442.1| XH/XS domain-containing protein [Arabidopsis thaliana]
 gb|AEE78443.1| XH/XS domain-containing protein [Arabidopsis thaliana]
Length=647

 Score =   370 bits (949),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 238/633 (38%), Positives = 388/633 (61%), Gaps = 29/633 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21    MDEYGDKMYLNLKGGKLKVRLSPQAFICPYCPNKKKTSFQYKDLLQHASGVGNSNSDKRS  80

Query  1937  VKQKANHVALAKYLEIDLGD---QAEPLPQRAV-------APEDNNLYCWPWTGIVVNVS  1788
              K+KA+H+AL KYL+ DL D   +AEP  +R            D  L  +PW GIVVN+ 
Sbjct  81    AKEKASHLALVKYLQQDLADSASEAEPSSKRQKNGNPIQDCDHDEKL-VYPWKGIVVNIP  139

Query  1787  KDNA-NGTAVEE------EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  1629
                A +G +  E      ++Y L+ F+      V+   +    +   +++   DWNG  N
Sbjct  140   TTKAQDGRSAGESGSKLRDEYILRGFN---PTRVRPLWNYLGHSGTAIVEFNKDWNGLHN  196

Query  1628  AILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITD  1449
              +LF+ A+  + H KK+W  ++  P   +YGW A+ DDY     +G  LR+T  LKTI +
Sbjct  197   GLLFDKAYTVDGHGKKDWL-KKDGPKLGLYGWIARADDYNGNNIIGENLRKTGDLKTIAE  255

Query  1448  LLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESR  1269
             L +EE R ++ ++ NL   ++ K +++  +    + K+  L++++EEK+   +  Y E  
Sbjct  256   LTEEEARKQELLVQNLRQLVEEKKKDMKEIEELCSVKSEELNQLMEEKEKNQQKHYRELN  315

Query  1268  KMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrnd  1089
              +Q     H+Q+++ + E L   LE ++K+L+    EL KREV    E++KL E+ ++N 
Sbjct  316   AIQERTMSHIQKIVDDHEKLKRLLESERKKLEIKCNELAKREVHNGTERMKLSEDLEQNA  375

Query  1088  eRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKG  909
              +NSSLE+A+ EQ+KADE V +L E+ +R+KE   +KI+ LE+  D KQ +E+E+++LKG
Sbjct  376   SKNSSLELAAMEQQKADEEVKKLAEDQRRQKEELHEKIIRLERQRDQKQAIELEVEQLKG  435

Query  908   KLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARK  729
             +L+VM+HM  D D+ V +++  + + L EK   + DLD+ N  L+L+ER++NDELQEA K
Sbjct  436   QLNVMKHMASDGDAEVVKEVDIIFKDLGEKEAQLADLDKFNQTLILRERRTNDELQEAHK  495

Query  728   LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  549
              L+    +++    ++IG++RMGE+  K F +  +Q++  ++ + +A+E+  LW+  +KD
Sbjct  496   ELV----NIMKEWNTNIGVKRMGELVTKPFVDAMQQKYCQQDVEDRAVEVLQLWEHYLKD  551

Query  548   PNWHPFRVINI--HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  375
              +WHPF+ + +   DR  ++I++ DE+L +LK + G+    AV KA+ E+NEYN SGRY+
Sbjct  552   SDWHPFKRVKLENEDREVEVIDDRDEKLRELKADLGDGPYNAVTKALLEINEYNPSGRYI  611

Query  374   IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
               ELWNFK  +KATL+E V+ +  Q +  KRKR
Sbjct  612   TTELWNFKADKKATLEEGVTCLLDQWEKAKRKR  644



>emb|CDY08088.1| BnaA06g16380D [Brassica napus]
Length=697

 Score =   369 bits (947),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 244/631 (39%), Positives = 383/631 (61%), Gaps = 25/631 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             + EY +K Y  L+SGK KVK       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  71    MEEYGDKIYLSLKSGKLKVKLSPHSFTCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRS  130

Query  1937  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-S  1788
              K+KA+H+ALAKYL+ DL D  QAEP  +R           +D  L C PW G+VVN+ +
Sbjct  131   AKEKASHLALAKYLQQDLADDSQAEPSSKRRKTGDPIQDCDQDEKLVC-PWKGVVVNIPT  189

Query  1787  KDNANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAI  1623
                 NG    E      D +++R   +    V+   +    +   +++   DWNG  NA+
Sbjct  190   TKTENGRTAGESGSKLRDEYIQR--GFNPTRVRTLWNHWGFSGTAIVEFNKDWNGLHNAL  247

Query  1622  LFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLL  1443
             LF+ A+  + H KK+W  +   P S +Y W A+ DDY     +G  LR+   LKTI ++ 
Sbjct  248   LFDKAYLVDGHGKKDWLRKDGPPKSGLYAWIARADDYNGNNIIGEDLRKKGDLKTIAEVT  307

Query  1442  QEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKM  1263
             +EE R + K++ NLT  ++ K + +  +    + K+  L   +EEK+   +    E   +
Sbjct  308   EEEARKQQKLVQNLTQLVEEKKKGVKEIEELHSAKSKELKEKLEEKEKSLQKHNSELNAI  367

Query  1262  QRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeR  1083
             Q     HV ++  + E L  +LE +KK+L+    EL KRE   E E+  L E+ + N  +
Sbjct  368   QERTMGHVNKIFADHERLKMQLELEKKKLEIKGVELAKREAHNETERKNLAEDLQENASK  427

Query  1082  NSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKL  903
             NSSLE+AS EQ+KADE V +L E  +R+KE   +KI+ LE+  D KQ +E+EI+ LKG+L
Sbjct  428   NSSLELASMEQQKADEEVKKLAENQRRQKEELHEKIIRLERQRDQKQMIELEIERLKGEL  487

Query  902   DVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLL  723
             +V +HMG D D+ + ++++ + + L EK E++ DLD+ N  L+L+ER++NDELQEARK L
Sbjct  488   NVKKHMGSDGDAEIVKEVENIYKGLTEKEEELADLDKFNQTLILRERRTNDELQEARKEL  547

Query  722   IQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPN  543
             +    +++   + +IG++RMGE+  K F +  +Q++  ++ + +A+++  LW++ +KDP+
Sbjct  548   V----NIMKEWKQNIGVKRMGELVTKPFMDALQQKYCQQDVEDRAIDVLQLWEDYLKDPD  603

Query  542   WHPFRVINI--HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  369
             WHPF+ I +   +R  ++I++ DE+L  LKE+ G+    AV +A+ E+NEYN SGRY+  
Sbjct  604   WHPFKRIKLENQEREVEVIDDRDEKLRDLKEDLGDGPYNAVTRALLEINEYNPSGRYITT  663

Query  368   ELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             ELWN KE RKATL+E V+ +  + +  KRKR
Sbjct  664   ELWNLKEDRKATLEEGVTCLLDEWEKAKRKR  694



>ref|XP_009149803.1| PREDICTED: myosin-11 [Brassica rapa]
Length=647

 Score =   367 bits (942),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 243/631 (39%), Positives = 384/631 (61%), Gaps = 25/631 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             + EY +K Y  L+SGK KVK       CP+C  KKK  ++YKDLLQHA+GVG  +++ R+
Sbjct  21    MEEYGDKIYLSLKSGKLKVKLSPHSFTCPYCPNKKKPSFQYKDLLQHASGVGNSNSDKRT  80

Query  1937  VKQKANHVALAKYLEIDLGD--QAEPLPQRAVA-------PEDNNLYCWPWTGIVVNV-S  1788
              K+KA+H+ALAKYL+ DL D  QAEP  +R           +D  L C PW G+VVN+ +
Sbjct  81    AKEKASHLALAKYLQQDLADDSQAEPSSKRRKTGDPIQDCDQDEKLVC-PWKGVVVNIPT  139

Query  1787  KDNANGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAI  1623
                 NG    E      D +++R   +    V+   +    +   +++   DWNG  NA+
Sbjct  140   TKTENGRTAGESGSKLRDEYIQR--GFNPTRVRTLWNHWGFSGTAIVEFNKDWNGLHNAL  197

Query  1622  LFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLL  1443
             LF+ A+  + H KK+W  +   P S +Y W A+ DDY     +G  LR+   LKTI ++ 
Sbjct  198   LFDKAYLVDGHGKKDWLRKDGPPKSGLYAWIARADDYNGNNIIGEDLRKKGDLKTIAEVT  257

Query  1442  QEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKM  1263
             +EE R + K++ NLT  ++ K + +  +    + K+  L   +EEK+   +    E   +
Sbjct  258   EEEARKQQKLVQNLTQLVEEKKKGVKEIEELHSAKSKELKEKLEEKEKSLQKHNSELNAI  317

Query  1262  QRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeR  1083
             Q     HV ++  + E L  +LE +KK+L+    EL KRE   E E+  L E+ + N  +
Sbjct  318   QERTMGHVNKIFADHERLKMQLELEKKKLEIKGVELAKREAHNETERKNLAEDLQENASK  377

Query  1082  NSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKL  903
             NSSLE+AS EQ+KADE V +L E  +R+KE   +KI+ LE+  D KQ +E+EI+ LKG+L
Sbjct  378   NSSLELASMEQQKADEEVKKLAENQRRQKEELHEKIIRLERQRDQKQMIELEIERLKGEL  437

Query  902   DVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLL  723
             +V +HMG D D+ + ++++ + + L EK E++ DLD+ N  L+L+ER++NDELQEARK L
Sbjct  438   NVKKHMGSDGDAEIVKEVENIYKGLTEKEEELADLDKFNQTLILRERRTNDELQEARKEL  497

Query  722   IQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPN  543
             +    +++   + +IG++RMGE+  K F +  +Q++  ++ + +A+++  LW++ +KDP+
Sbjct  498   V----NIMKEWKQNIGVKRMGELVTKPFMDALQQKYCQQDVEDRAIDVLQLWEDYLKDPD  553

Query  542   WHPFRVINI--HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIP  369
             WHPF+ I +   +R  ++I++ DE+L +LKE+ G+    AV +A+ E+NEYN SGRY+  
Sbjct  554   WHPFKRIKLENQEREVEVIDDRDEKLRELKEDLGDGPYNAVTRALLEINEYNPSGRYITT  613

Query  368   ELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             ELWN KE RKATL+E V+ +  + +  KRKR
Sbjct  614   ELWNLKEDRKATLEEGVTCLLDEWEKAKRKR  644



>ref|XP_006292435.1| hypothetical protein CARUB_v10018651mg [Capsella rubella]
 gb|EOA25333.1| hypothetical protein CARUB_v10018651mg [Capsella rubella]
Length=647

 Score =   366 bits (940),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 248/632 (39%), Positives = 389/632 (62%), Gaps = 27/632 (4%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKG-SANRS  1938
             ++EY +K Y  L+ GK KVK       CP+C  KKK  ++YKDLLQHA+GVG   S  RS
Sbjct  21    MDEYGDKMYLNLKGGKVKVKLSPQAFVCPYCPNKKKPSFQYKDLLQHASGVGNSNSEKRS  80

Query  1937  VKQKANHVALAKYLEIDLGDQA---EPLPQRAV-------APEDNNLYCWPWTGIVVNVS  1788
              K+KA+H+AL KYL+ DL D A   EP  +R            D  L  WPW GIVVN+ 
Sbjct  81    AKEKASHLALVKYLQQDLADSASDAEPSSKRQKNGNPIQDCDHDEKL-VWPWKGIVVNIP  139

Query  1787  KDNA-NGTAVEEE-----DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNA  1626
                A +G +  E      D +++R   +    V+   +    +   +++   DWNG  NA
Sbjct  140   TTKALDGRSAGESGSKLRDGYIQR--GFNPTRVRPLWNHWGHSGTAIVEFNKDWNGLHNA  197

Query  1625  ILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDL  1446
             +LF+ A+  + H KK+W  ++  P S +Y W A+ DDY     +G  LR+T  LKTI +L
Sbjct  198   LLFDKAYRVDGHGKKDWL-KKDGPKSGLYAWIARADDYNGNNIIGENLRKTGDLKTIAEL  256

Query  1445  LQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRK  1266
              +EE R + K++ NLT  ++ K +++  +      K+  L++++EEK+      Y E   
Sbjct  257   TEEEARKQQKLVQNLTQLVEEKKKDMKQIEELCLVKSKELNQLMEEKEKNEEKHYRELNA  316

Query  1265  MQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrnde  1086
             +Q     H+Q+++ + E L   LE +KK+L+    EL KREV    E++KL E+ ++N  
Sbjct  317   IQARTMSHIQKIVDDHEKLKKLLESEKKKLEIKGNELAKREVHNGAERMKLSEDLEQNAS  376

Query  1085  RNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGK  906
             +NSSLE+A+ EQ+KADE V +L E+ +R+KE   +KI+ LE+  D KQ +E+EI++LKG+
Sbjct  377   KNSSLELATLEQQKADEEVKKLAEDQRRQKEELHEKIIRLERQRDQKQAVELEIEQLKGQ  436

Query  905   LDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKL  726
             L+VM+HMG D D+ + +K+  + + L EK  ++ DLD+ N AL+L+ER++NDELQEARK 
Sbjct  437   LNVMKHMGSDGDAEIVKKVGTIYKDLGEKEAELSDLDKFNQALILRERRTNDELQEARKE  496

Query  725   LIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDP  546
             L+    +++   +++IG++RMGE+  K F +  +Q++  ++ + +A+++  LW+  +KDP
Sbjct  497   LV----NIIKEWKTNIGVKRMGELVTKPFMDAMQQKYCQQDVEDRAVDVLQLWEGYLKDP  552

Query  545   NWHPFRVINI--HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVI  372
              WHPF+ + +   +R  ++I+E DE+L +LKE+ G+    AV +A+ E+NEYN SGRY+ 
Sbjct  553   EWHPFKRVQLENQEREVEVIDETDEKLRELKEDLGDGPYNAVTQALLEINEYNPSGRYIT  612

Query  371   PELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
              ELWN KE RKATL+E V+ +  Q +  K KR
Sbjct  613   SELWNIKEDRKATLEEGVTCLLDQWEKAKHKR  644



>emb|CAB62356.1| putative protein [Arabidopsis thaliana]
Length=644

 Score =   360 bits (925),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 236/633 (37%), Positives = 386/633 (61%), Gaps = 32/633 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RS  1938
             ++EY +K Y  L+ GK KV+       CP+C  KKK  ++YKDLLQHA+GVG  +++ RS
Sbjct  21    MDEYGDKMYLNLKGGKLKVRLSPQAFICPYCPNKKKTSFQYKDLLQHASGVGNSNSDKRS  80

Query  1937  VKQKANHVALAKYLEIDLGD---QAEPLPQRAV-------APEDNNLYCWPWTGIVVNVS  1788
              K+KA+H+AL KYL+ DL D   +AEP  +R            D  L  +PW GIVVN+ 
Sbjct  81    AKEKASHLALVKYLQQDLADSASEAEPSSKRQKNGNPIQDCDHDEKL-VYPWKGIVVNIP  139

Query  1787  KDNA-NGTAVEE------EDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKN  1629
                A +G +  E      ++Y L+ F+      V+   +    +   +++   DWNG  N
Sbjct  140   TTKAQDGRSAGESGSKLRDEYILRGFN---PTRVRPLWNYLGHSGTAIVEFNKDWNGLHN  196

Query  1628  AILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITD  1449
              +LF+ A+  + H KK+W  ++  P   +YGW A+ DDY     +G  LR+T  LKTI +
Sbjct  197   GLLFDKAYTVDGHGKKDWL-KKDGPKLGLYGWIARADDYNGNNIIGENLRKTGDLKTIAE  255

Query  1448  LLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESR  1269
             L +EE R ++ ++ NL   ++ K +++  +    + K+  L++++EEK+   +  Y E  
Sbjct  256   LTEEEARKQELLVQNLRQLVEEKKKDMKEIEELCSVKSEELNQLMEEKEKNQQKHYRELN  315

Query  1268  KMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrnd  1089
              +Q     H+Q+++ + E L   LE ++K+L+    EL KREV    E++KL E+ ++N 
Sbjct  316   AIQERTMSHIQKIVDDHEKLKRLLESERKKLEIKCNELAKREVHNGTERMKLSEDLEQNA  375

Query  1088  eRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKG  909
              +NSSLE+A+ EQ+KADE V +L E+   ++E   +KI+ LE+  D KQ +E+E+++LKG
Sbjct  376   SKNSSLELAAMEQQKADEEVKKLAED---QREELHEKIIRLERQRDQKQAIELEVEQLKG  432

Query  908   KLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARK  729
             +L+VM+HM  D D+ V +++  + + L EK   + DLD+ N  L+L+ER++NDELQEA K
Sbjct  433   QLNVMKHMASDGDAEVVKEVDIIFKDLGEKEAQLADLDKFNQTLILRERRTNDELQEAHK  492

Query  728   LLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKD  549
              L+    +++    ++IG++RMGE+  K F +  +Q++  ++ + +A+E+  LW+  +KD
Sbjct  493   ELV----NIMKEWNTNIGVKRMGELVTKPFVDAMQQKYCQQDVEDRAVEVLQLWEHYLKD  548

Query  548   PNWHPFRVINI--HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYV  375
              +WHPF+ + +   DR  ++I++ DE+L +LK + G+    AV KA+ E+NEYN SGRY+
Sbjct  549   SDWHPFKRVKLENEDREVEVIDDRDEKLRELKADLGDGPYNAVTKALLEINEYNPSGRYI  608

Query  374   IPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
               ELWNFK  +KATL+E V+ +  Q +  KRKR
Sbjct  609   TTELWNFKADKKATLEEGVTCLLDQWEKAKRKR  641



>emb|CDX81740.1| BnaC08g38610D [Brassica napus]
Length=515

 Score =   356 bits (913),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 211/457 (46%), Positives = 310/457 (68%), Gaps = 15/457 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y +KPY +L++G YKVK  NG LRCPFC+GKKKQDYKYK+L+ HA+GV KGS +RS KQK
Sbjct  21    YSQKPYLKLQTGHYKVKKVNGTLRCPFCSGKKKQDYKYKELMAHASGVSKGSVSRSAKQK  80

Query  1925  ANHVALAKYLEIDLGD--QAEPLPQRA----VAPEDNNLYCWPWTGIVVNVSKD-NANGT  1767
             ANH+ALAKYLE +L     AEPLP+R       P+   +Y WPW GIV+N  K+ + +  
Sbjct  81    ANHLALAKYLETELAGSGHAEPLPRRPQLKETEPKPGEVYVWPWMGIVMNPLKETDDDKE  140

Query  1766  AVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHS  1587
              + +  YWLKR S+++  +V +F   K     VV +  SDW+G+ +A   E  FE E  S
Sbjct  141   VILDSGYWLKRLSRFKPVDVNVFLVQKDCVVAVVAEFNSDWSGFASATELEKEFEREGCS  200

Query  1586  KKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILS  1407
             KKEW  +R    S  YGW A+ +DY +EG +G YL +  +L+T++D+ QE+  D++ +L 
Sbjct  201   KKEWVEKRGDSESKAYGWCARAEDYNSEGPIGEYLSKEGKLRTVSDISQEKAEDRNSVLE  260

Query  1406  NLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVL  1227
              L++ + + NE+L+ +   +NE  + L R+ ++K  L  A+ EE++KM +++   +Q++L
Sbjct  261   ELSSMIAMTNEDLNKVQYSYNETAMLLKRVKDQKKNLDEAYAEETKKMHQMSIRSIQKIL  320

Query  1226  HEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQK  1047
              ++E L++ELE K  +L +W++EL K+E LTE E+ KLDEEKK+ND  N SL++AS EQ+
Sbjct  321   EDKERLSNELEAKMLRLKNWSKELEKKETLTELERQKLDEEKKKNDAMNISLKLASHEQE  380

Query  1046  KADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDS  867
             KAD+NVLRL+EEHKR+K+ A+ KILEL+  +D KQ LEMEIQELKGKL VM+H+G     
Sbjct  381   KADQNVLRLLEEHKRQKDEAMGKILELKTQLDTKQTLEMEIQELKGKLQVMKHLGDVGTE  440

Query  866   AV---QEKIKEMKEQLDEKIED-----MKDLDEMNNA  780
              V    EK+K++K +  E++ D     ++++DE N +
Sbjct  441   VVDEEDEKLKKLKGEWGEEVHDAVKTALEEMDEYNPS  477


 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -1

Query  452  WGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
            WGEE+  AV  A+EE++EYN SGRY  PELWNF+ GRKATLKEV+SFI   +K  KRKR
Sbjct  456  WGEEVHDAVKTALEEMDEYNPSGRYSTPELWNFEAGRKATLKEVISFISNDMKPVKRKR  514



>tpg|DAA50216.1| TPA: putative XH domain family protein [Zea mays]
Length=687

 Score =   361 bits (926),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 235/619 (38%), Positives = 373/619 (60%), Gaps = 39/619 (6%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I E+KE+   +LR+GK  VK      RCPFC GKK+QDY  KDLLQHATG+G  S  RS 
Sbjct  100   IAEHKEEICAQLRAGKLNVKRGEA-FRCPFCPGKKRQDYNLKDLLQHATGIGAAS-KRSA  157

Query  1934  KQKANHVALAKYLEIDLGDQAE-PL---PQRAVAPEDNNLYCWPWTGIVVNVSKD-NANG  1770
             K KA+H+ LA +LE D+    E PL   P +   P+D  ++ WPW GIVVN+  +     
Sbjct  158   KVKASHLGLAMFLEKDIASTLEQPLQIVPYKPKTPKDEEIFVWPWMGIVVNLQCEFKGKE  217

Query  1769  TAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECH  1590
              + E E+    +FS++   +     D K++    ++K   DW+G+K+A+ FEN F  E +
Sbjct  218   CSRESEERLTAQFSRFRPLQATTLRDGKNQQFCAIVKFAKDWSGFKDAMAFENHFVLEQY  277

Query  1589  SKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKIL  1410
             SK +W  +R+     +YGW AK DDY +   +G YLR+   L+++ DL +E  ++  + +
Sbjct  278   SKPDWK-KRNCRKDDLYGWLAKTDDYNSPEPIGEYLRKNGNLRSVGDLEREGLKETGERV  336

Query  1409  SNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRV  1230
             ++   ++D  N+++S L  + N+  + L RM+EE D              RL  EH +  
Sbjct  337   AHYARQIDATNKHMSELELKNNQNAMKLDRMLEEND--------------RLVEEHNENC  382

Query  1229  LHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQ  1050
             +   +    E+ ++ ++L+        RE L        +  K+   + N  L++A+ ++
Sbjct  383   IKNWKPRKKEIGRRHEELEKLVMNSTNREKL--------EAAKEEIAKENRLLDLATLKK  434

Query  1049  KKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDD  870
             K+ DE  L+L++E ++EKE   + + +LE  + +KQKLE+E ++L+G L+V +HMG  +D
Sbjct  435   KEEDEKFLKLVKEQEQEKENVRKMLYDLEMQLASKQKLELEREQLRGNLEVWKHMG-KED  493

Query  869   SAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN--  696
             +  +E + ++ E L EK E+M  +D +N  L++K+R++NDEL+EA+K L    +DLLN  
Sbjct  494   AKSKEMLDKLHEALKEKDEEMDHIDSINQTLIIKQRRTNDELEEAKKELT---TDLLNMS  550

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S RS +G+++MGE+D KAF   CK++ + E   +    LCS W+++++ P WHPF+VI++
Sbjct  551   SARSIVGVKKMGELDKKAFIVSCKEKTADE---LSLSILCSKWEDEIRQPEWHPFKVIDV  607

Query  515   HDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKA  336
               + ++II EDDE+L  LK E G +    V+KA+ E+NEYN SGRY IPELWNFKE R+A
Sbjct  608   GGQAKEIIREDDEKLQALKAELGVQAHDVVVKALLEMNEYNPSGRYPIPELWNFKEDRRA  667

Query  335   TLKEVVSFIFKQLKTHKRK  279
              + E V++I KQ K +KRK
Sbjct  668   PMGEAVAYIVKQWKANKRK  686



>ref|XP_010106492.1| hypothetical protein L484_025250 [Morus notabilis]
 gb|EXC10668.1| hypothetical protein L484_025250 [Morus notabilis]
Length=620

 Score =   355 bits (910),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 230/617 (37%), Positives = 374/617 (61%), Gaps = 21/617 (3%)
 Frame = -1

Query  2090  YEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQKANHVA  1911
             Y  L+ G  K+K  +   RCPFC   +K+  + K+LL HA+   + S  R +K++A H A
Sbjct  14    YRRLKDGSAKIKTSDSRYRCPFCVEDRKKYDRSKELLYHASDFSRASYKRELKERAKHSA  73

Query  1910  LAKYLE---IDLGDQAEPLPQRAV---APEDNNLYCWPWTGIVVNVSKDNANGTAVEEED  1749
             L +Y++    D  D+ EP   R V    P+    + WP  GI+ N+  +  NG  V E  
Sbjct  74    LERYIKKYYYDTKDRKEP--SRKVERETPDHEEKFVWPSMGILANIRTELRNGKRVAESG  131

Query  1748  YWLKR-FSKYEAQEVKIFC--DDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKE  1578
               L+  F +     VK+    +    +   +++   +W G++NA+ FE + +A+   K+ 
Sbjct  132   SKLRDGFIRKGLNPVKVIPLWNHLGHSGFAIVEFDKNWAGFENAMAFERSLDADNCGKRA  191

Query  1577  WTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLT  1398
             +  +R+     VYGW A+ DDY++   VG +LR+   LKT+++   E+ R   K++S LT
Sbjct  192   YETDRNR-GEKVYGWIAREDDYKSTNIVGGHLRKHGDLKTVSEKQAEDHRKDSKLVSKLT  250

Query  1397  NELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQ  1218
             + L  K+  L  + +++ E  LS  +M+ E+D + + + EE  KMQ+  REH ++ +   
Sbjct  251   DTLVTKSMCLKEMESKYTETVLSFRQMVSERDAILQDYNEEKIKMQQNEREHFEKFIKGH  310

Query  1217  ETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKAD  1038
             E    +L++++++L+S  +EL KR           D E+++       +E A+ E+KKAD
Sbjct  311   EKFRQDLKRQREELESREKELKKRTF-------HDDCERRKLIYEKKLIEKATLEEKKAD  363

Query  1037  ENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQ  858
             E + +L +E K++KE   +KI++LEK +D KQ LE+ I+  +G L+VM+HMG D+D  ++
Sbjct  364   EKMFQLAKEQKKQKEELHKKIIDLEKKLDKKQALELTIERYRGALEVMKHMGADEDMKLK  423

Query  857   EKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSD--LLNSGRS  684
             +++ E+KE L EK E+M+ L+E+N AL++KER+SNDELQ+ARK  I GL +       R 
Sbjct  424   KEMDEIKENLKEKEEEMEALEELNQALIIKERRSNDELQDARKETINGLREDSSRRGARP  483

Query  683   HIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRP  504
              IG++ +G +  K F    K++F  EEA VKA EL S+W   ++DP+WHPF+VI    + 
Sbjct  484   TIGVKGLGGLHSKPFIAAAKRKFPDEEASVKARELWSMWDSHLRDPSWHPFKVITDKGKA  543

Query  503   EQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKE  324
              +II+E+DE+L  LK++ G+E+  AV++A++EVN+YN SGRY++PELWNFKE R+A LKE
Sbjct  544   VEIIDEEDEKLKNLKDDLGDEVYEAVVRALKEVNQYNPSGRYIVPELWNFKEDRRARLKE  603

Query  323   VVSFIFKQLKTHKRKRH  273
              + FI ++ KT KR R+
Sbjct  604   GLDFILRKWKTLKRSRN  620



>emb|CDP10823.1| unnamed protein product [Coffea canephora]
Length=738

 Score =   357 bits (916),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 217/532 (41%), Positives = 342/532 (64%), Gaps = 17/532 (3%)
 Frame = -1

Query  1862  PQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLKR--FSK-YEAQEVKIFCD  1692
             P    A ED  L  WPW  +V N+  +  NG  V E    L+    SK Y   +V    +
Sbjct  217   PSTRNAKED--LIVWPWMAVVANIPVELKNGKYVAESGRKLREEWISKGYNPVKVHPLWN  274

Query  1691  DKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDY  1512
              K  +   +++   DW+G+KNAI FE AFE + H K++W A++   +S ++ W A+ ++Y
Sbjct  275   FKGHSGFAIVEFNRDWDGFKNAITFEKAFEVDLHGKRDWYAKKHK-NSGLFAWIARYEEY  333

Query  1511  EAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNL  1332
               +G +G YLR+   LKT++D+ +E+KR   +++ +LTNEL++KN+    +  + +   +
Sbjct  334   HLKGLIGDYLRKNGDLKTVSDIQREDKRKDTQLVCSLTNELEVKNQKCEDMKKKISRTEI  393

Query  1331  SLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELN  1152
              +  ++++K+ +    YE+ +KMQ+   E +Q V+ E E     LE ++++L    +EL 
Sbjct  394   LMGNVMKQKEDMIEGHYEKMKKMQQDHCEQLQHVVSEHEKSTLALEARRRELQMREKELK  453

Query  1151  KREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKIL  972
              R+ L E EK KLD++++ N       E A  EQKKADE + +L E+ KREKE   ++I+
Sbjct  454   YRQALNESEKKKLDDQQEMN-------ERAILEQKKADEKMWKLAEDQKREKEELHKRII  506

Query  971   ELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDE  792
             +LE  +D KQKLE+EI+ LKG  +VM+HMG + D   +  +  ++ +L EK E++  L+ 
Sbjct  507   DLEAKLDQKQKLELEIERLKGTAEVMKHMGEEGDKEAENNMNSIELELKEKEEELDALEA  566

Query  791   MNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFS  612
             +N AL++KER++NDE+QEARK LI GL D     R+ I ++RMGE+D K FH+  +++FS
Sbjct  567   INQALIVKERKTNDEVQEARKELINGLKD----SRAFIHVKRMGELDEKPFHSAAERKFS  622

Query  611   TEEADVKALELCSLWQEKVKDPNWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICA  432
               EA  KA+ELCSLW++ ++DP+WHP+RVI   +  ++II+E+DE+L  L++E+G+E+  
Sbjct  623   HTEAAEKAIELCSLWEDNLRDPSWHPYRVIIDGENAKEIIDENDEKLKSLEDEYGDEVYQ  682

Query  431   AVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             AV+KA++E+NEYN SGRY +PELWN K GRKA+L+E V  I K  K +KRKR
Sbjct  683   AVVKALDEMNEYNPSGRYPLPELWNLKAGRKASLREGVEHILKLWKVNKRKR  734


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 105/232 (45%), Gaps = 25/232 (11%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             + E K + Y+ELR  K +++G    LRCP+C   ++++Y +K+L++H+  +G+ S + S 
Sbjct  36    LEELKYRYYKELRDEKVRIRGSGNYLRCPYCPDCRRKEYDFKELMRHSCRIGRESKSSSF  95

Query  1934  KQKANHVALAKYLEIDLGDQAEP-----LPQRAVAPEDNNLYCWPW--------TGIVVN  1794
             ++KA H+ L KYL+  + D A P      P++  + +D      P         +G  + 
Sbjct  96    REKARHLGLLKYLQ-RIEDTAVPHSNGRSPEQIYSCKDIMSTSSPRLHKIVHLESGKTIG  154

Query  1793  VSKDNANGTAVEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFE  1614
               + +    +VE ++Y        E  E  +  D  SR   V    KS +      + F 
Sbjct  155   ARRSSGERNSVEIDEYIEDVVLSAERTE-NVETDPASRAKSVATPAKSTFPSMP-PVSFA  212

Query  1613  NAFEAECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRET-RQLK  1461
              + E    + KE           V+ W A V +   E   G Y+ E+ R+L+
Sbjct  213   TSCEPSTRNAKEDLI--------VWPWMAVVANIPVELKNGKYVAESGRKLR  256



>ref|XP_011035877.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
 ref|XP_011035879.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
 ref|XP_011035880.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
 ref|XP_011035881.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
 ref|XP_011035882.1| PREDICTED: factor of DNA methylation 4 [Populus euphratica]
Length=699

 Score =   354 bits (908),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 221/526 (42%), Positives = 340/526 (65%), Gaps = 20/526 (4%)
 Frame = -1

Query  1829  LYCWPWTGIVVNVSKDNANGTAVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIK  1659
             L  WPW G++ N+  +  +G  V E    L+       +    V         +   +++
Sbjct  185   LLVWPWMGVLANIQTEMKDGRRVGESGSKLRDELARKGFNPVRVHPLWSRYGHSGFAIVE  244

Query  1658  LKSDWNGYKNAILFENAFEAECHSKKEWTAERSSP----SSHVYGWFAKVDDYEAEGAVG  1491
              K DW+G+ NAI+FE  F++    KKE+T    +P       +YGW A+ DDY+A G VG
Sbjct  245   FKKDWDGFSNAIMFEKDFDSNHCGKKEYT---ETPVRDRGQRLYGWIAQEDDYKASGLVG  301

Query  1490  YYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIE  1311
              +LR+   LK++     E++R   K++SNL + L+ K++ L  + +R+ E + SL+++++
Sbjct  302   DHLRKNGDLKSVDGKQAEDQRKDAKLVSNLKSTLERKHDCLREMESRYKETSASLNKVMD  361

Query  1310  EKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTe  1131
             +K+ + +++ EE RKMQ+   +H + +  E E +   L  ++++L    ++L +REV  E
Sbjct  362   QKEAMEKSYNEEIRKMQQNEHDHFEEISVEHEKVTRLLLAQREELKQREKQLQRREVQNE  421

Query  1130  reklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDID  951
              ++LKL  EKK N       E A+ EQK+ADE+VLRL EE KREKE   +KI +LEK +D
Sbjct  422   NDRLKLHHEKKMN-------ERATLEQKRADESVLRLAEEQKREKEKLHKKIFDLEKKLD  474

Query  950   AKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVL  771
             AKQ LE+EI+ ++  L +M+HMG D+D  V++K+  ++E+L EK E++  L+++N ALV+
Sbjct  475   AKQALELEIECMRNSLQIMKHMGEDEDLDVKKKMDTVREELKEKEEELDGLEQLNQALVI  534

Query  770   KERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVK  591
             KER++NDELQ+ARK LI  L     + R+ IG++RMG++D K FH   K +F  EEAD K
Sbjct  535   KERKTNDELQDARKELISYLGQW--TTRAFIGVKRMGDLDSKPFHEASKIKFLDEEADEK  592

Query  590   ALELCSLWQEKVKDPNWHPFRVI-NIHDRPEQIINeddeelsklkeEWGEEICAAVIKAV  414
             ALELCSLW+++++DP+WHPF+VI +     ++IINEDDE L  LK E+G+E+C AV+ A+
Sbjct  593   ALELCSLWEDRLRDPSWHPFKVILDKEGNSKEIINEDDENLRSLKSEFGDEVCNAVVTAL  652

Query  413   EEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             +E+NEYN SGRY+I ELWNFKE RKATL E V  + KQ +  KR++
Sbjct  653   KEMNEYNPSGRYIIKELWNFKEERKATLSEGVMHLLKQWRQLKRRK  698


 Score = 54.7 bits (130),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 52/87 (60%), Gaps = 5/87 (6%)
 Frame = -1

Query  2108  EYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQ  1929
             EY+E+ Y +L+  + +V+      +CP+C G+     +      HA+ +G+GS   ++K+
Sbjct  17    EYEERHYNDLKKERIRVRVSGSVYKCPYCHGRDYHLRELLQ---HASDLGRGSRRGTLKE  73

Query  1928  KANHVALAKYL--EIDLGDQAEPLPQR  1854
             +A H+ALA+Y+   +D+ D++E   +R
Sbjct  74    EAQHLALARYIRGHLDVKDRSESSSKR  100



>ref|XP_008457475.1| PREDICTED: centrosomal protein of 83 kDa [Cucumis melo]
 ref|XP_008457476.1| PREDICTED: centrosomal protein of 83 kDa [Cucumis melo]
Length=739

 Score =   354 bits (909),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 218/541 (40%), Positives = 345/541 (64%), Gaps = 15/541 (3%)
 Frame = -1

Query  1886  LGDQAEPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK-RFSK--YEA  1716
             L DQ +P+  +     D   + WPW  IV N+  +   G  V +    L+  F +  + A
Sbjct  209   LEDQPQPVRNKQYFNHDQ-FFVWPWMAIVANIQTEIHGGRHVGDSGSKLRDEFVRQGFNA  267

Query  1715  QEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSHVYG  1536
              +V    +    +   +++   DW+G++NAILFE +FE + H KK++   R+     +YG
Sbjct  268   LKVHPLWNRFGHSGYAIVEFNKDWDGFRNAILFEKSFEVDHHGKKDYNVSRNR-GKELYG  326

Query  1535  WFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALT  1356
             W A+ DD+ ++   G YLR+   LKT++    E+     K++SNL N L+ K+ +L  +T
Sbjct  327   WVARDDDFYSKSLFGDYLRKNGDLKTVSGKEAEDNSKASKLVSNLANTLETKSLHLKEIT  386

Query  1355  TRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQL  1176
              +  E N SL+ M+E+ D   + + ++ R++Q+ AR+H + ++ E E +  ++E +KK+L
Sbjct  387   HKVLETNASLNNMMEQMDETVKIYNDKIRRLQQDARDHFKHIVSEHEKVKLQIEDQKKEL  446

Query  1175  DSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREK  996
                  +L  RE   + E+ KL +EKK N       E A+ EQKKA++ VL L  E ++EK
Sbjct  447   QQREHQLLDREAQNDNERRKLHKEKKMN-------ERATLEQKKAEDEVLHLAGEQQKEK  499

Query  995   EAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKI  816
             E   +KI+ELE+ +DA+Q LE+EI+ LKG L+VM+HMG D D   ++K+ +M++ LDEK 
Sbjct  500   EKLHKKIIELEQKLDARQALELEIERLKGSLEVMKHMGEDGDDDAKKKMHQMQQDLDEKE  559

Query  815   EDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFH  636
             E+++    +N +L++KER+SNDE+Q+ARK LI       +S R+ I ++RMG++D K F 
Sbjct  560   EELEYFQNINQSLIIKERRSNDEVQDARKELINVYGG--SSTRAFITVKRMGDLDSKPFC  617

Query  635   NVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVI-NIHDRPEQIINeddeelsklk  459
                K +++ +EAD KALELCS W+++++D +WHPFR+I +   + ++IINE+DE+L  LK
Sbjct  618   TATKLKYAKDEADAKALELCSKWEDQLRDSSWHPFRIIVDDAGQAKEIINENDEKLKNLK  677

Query  458   eEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRK  279
              E+G+E+  AV+ A+ E+NEYN SGRY++PELWNFKEGRKATLKE V+ I KQ K HKR+
Sbjct  678   NEYGDEVHKAVVTALMEMNEYNPSGRYIVPELWNFKEGRKATLKEGVAHILKQWKLHKRR  737

Query  278   R  276
             +
Sbjct  738   K  738



>gb|KDP20451.1| hypothetical protein JCGZ_05296 [Jatropha curcas]
Length=710

 Score =   353 bits (907),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 226/540 (42%), Positives = 340/540 (63%), Gaps = 21/540 (4%)
 Frame = -1

Query  1871  EPLPQRAVAPEDNNLYCWPWTGIVVNVSKDNANGTAVEEEDYWLK---RFSKYEAQEVKI  1701
             E +P        + L+ WP  GIV N+     NG  V E    L+       ++   V  
Sbjct  183   EKIPPSKHDHGKDQLFVWPCVGIVANIQTRLINGRHVAESGSKLRDELTRKGFDPVRVHP  242

Query  1700  FCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSKKEWTAERSSPSSH----VYGW  1533
               +    +   ++  K+ W+G+KNAI+FE  FE     K+++    + P  H    +YGW
Sbjct  243   LWNHLGHSGFAIVDFKNGWDGFKNAIMFEKDFEVNHCGKEDYC---NLPQWHRGDRLYGW  299

Query  1532  FAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSNLTNELDLKNENLSALTT  1353
              A+  DY + G +G +LR+   LK+++    E++R   K+++ LTN L +KNE L  +  
Sbjct  300   VARDADYYSRGVIGGHLRKYGDLKSVSGQEAEDRRKDSKLVTTLTNTLLIKNECLREMEI  359

Query  1352  RFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLHEQETLNSELEKKKKQLD  1173
             + NE N+SL+++IEEKD +  +F EE R+MQ++A +H +++  E +    +LE ++K+L+
Sbjct  360   KVNETNVSLNKVIEEKDAIITSFNEEMRRMQQIAHDHFEKIYIEHKRATLDLEAQRKELE  419

Query  1172  SWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKKADENVLRLIEEHKREKE  993
                ++L KRE   E E+ K    KK N       E A  EQKKADE V RL EE KR+KE
Sbjct  420   QREKQLQKREFQNENERRKFHHVKKMN-------ERAIVEQKKADEKVFRLAEEQKRQKE  472

Query  992   AALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSAVQEKIKEMKEQLDEKIE  813
                +KI+ELEK +DAKQ LE+EI+++KG L VM+HMG D+D  V++K+  ++E+L EK E
Sbjct  473   KLHKKIIELEKKLDAKQALELEIEQMKGTLQVMKHMGEDEDMEVKKKMDVIREELKEKEE  532

Query  812   DMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLNSGRSHIGIRRMGEIDGKAFHN  633
             ++  ++ +N  L++KER +NDELQ+ARK L+ GL +     R+ I +++MGE+DG+ FH 
Sbjct  533   ELDAMETLNQTLIVKERMNNDELQDARKELMTGLGE---DTRAFIHVKKMGELDGRPFHT  589

Query  632   VCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD-RPEQIINeddeelsklke  456
               K++FS EEAD+KA ELCSLW   ++DP WHPF++I   +   E+I+NEDDE+L +LK 
Sbjct  590   AAKRKFSDEEADMKAGELCSLWDHCLRDPGWHPFKIITDKEGHSEEILNEDDEKLKELKS  649

Query  455   EWGEEICAAVIKAVEEVNEYNASGRYVIPELWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             E+G E+  AV KA++E+NEYN SGRY++ E+WN KE RKA+LKE V  + KQ K HKRK+
Sbjct  650   EYGLEVYVAVTKALKEINEYNPSGRYIVREIWNSKENRKASLKEGVVHLLKQWKLHKRKK  709



>ref|XP_008384852.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472 
[Malus domestica]
Length=700

 Score =   353 bits (905),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 240/686 (35%), Positives = 389/686 (57%), Gaps = 85/686 (12%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             + +YK   Y+ L+ G YKVK  +   RCPFC  K+++DY+ K+L  HA+ +G+ S  R +
Sbjct  26    LEDYKYDYYDLLKKGSYKVKNSDSTYRCPFCDEKRRRDYRLKELSLHASDIGRDS--RVL  83

Query  1934  KQKANHVALAKYLE--IDLGDQAEPLP------QR---AVA------------------P  1842
             K+KA H+AL +Y++  +D+  + E  P      QR   AVA                  P
Sbjct  84    KEKAKHLALERYIDRYLDVKSRIESTPNAGQKSQRRTDAVAGVVSSQPQIREKSNHSESP  143

Query  1841  EDNNLYCWP-------------------------------------WTGIVVNVSKDNAN  1773
              +++L   P                                     W G+V NV  +  +
Sbjct  144   AESHLTACPPLAPKLPTPYPKAKPTTASSAGVRPTVHDNDQLFVWPWMGVVANVKTEFKD  203

Query  1772  GTAVEEEDYWLKR---FSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFE  1602
             G  V E    LK       +   +V      +  +   +++ +  W G+ +A  FE +FE
Sbjct  204   GRHVGESGTKLKTELASKGFNPVKVHPLWGRRGHSGYAIVEFEKSWEGFHDAKSFEKSFE  263

Query  1601  AECHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDK  1422
              +   K+++T  R+    ++YGW A+ DDY     +G +LR    LKT++    EE+R  
Sbjct  264   VDHRGKRDYTLARNR-GDNLYGWVARDDDYSLSSILGDHLRRNGDLKTVSAQQAEEQRKN  322

Query  1421  DKILSNLTNELDLKNENLSALTTRFNEKNLSLSRM---IEEKDTLHRAFYEESRKMQRLA  1251
              K++S+L + L+ KN  +  L  ++ + +  L+++   + +K+ + +A  E+  KMQ+ A
Sbjct  323   LKLVSDLASTLETKNSLVEELERKYRKTDNDLNKLASVLNKKEEMLKAINEKREKMQKAA  382

Query  1250  REHVQRVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSL  1071
             RE ++++  + +    +LE KKK       EL +RE   +  + + D E+++        
Sbjct  383   REDLEKICLDHKKAALKLETKKK-------ELQQREKQLQEHRAQNDSERRKLYHEREMN  435

Query  1070  EMASKEQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVME  891
             E A+ EQK ADE +L L EE K+EKE   ++I+ELEK +DAKQ LE+EI+ +KG + VM+
Sbjct  436   ERATLEQKTADEKMLWLAEEQKKEKETLRKRIIELEKQLDAKQVLELEIERMKGAVKVMK  495

Query  890   HMGGDDDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGL  711
             HM  D+D   ++K++E++ QL EK E+  D++E+   L++KER++NDE+QEARK LI GL
Sbjct  496   HMEEDEDLEAKKKVEEIQSQLKEKEEEYTDVEELYKTLLVKERRNNDEVQEARKELISGL  555

Query  710   SDLLNSGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPF  531
              D  ++ R+ IG++RMG++D K F    K+++S E AD KA+E CSLW+  ++DPNWHPF
Sbjct  556   WD--STHRATIGVKRMGDLDQKPFQIATKEKYSNEAADEKAVEYCSLWEAYLRDPNWHPF  613

Query  530   RVINIHD-RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPELWNF  354
             ++I   + +P +II+E+D++L  LK + G+E+  AV  A+ E+NEYN SGRY+IPELWNF
Sbjct  614   KIITDQEGKPTEIIDENDDKLKDLKNQLGDEVYKAVTTALMEMNEYNPSGRYIIPELWNF  673

Query  353   KEGRKATLKEVVSFIFKQLKTHKRKR  276
             KEGRKA+LKE   F+  + K  +++R
Sbjct  674   KEGRKASLKEGAVFLLSKWKPLRKRR  699



>ref|XP_003559697.1| PREDICTED: factor of DNA methylation 4-like [Brachypodium distachyon]
Length=637

 Score =   350 bits (898),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 244/630 (39%), Positives = 384/630 (61%), Gaps = 29/630 (5%)
 Frame = -1

Query  2114  INEYKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSV  1935
             I+E K+K Y +L++GK KVK      RCPFC GKKKQDY  KDLLQHATG+G  +  R  
Sbjct  16    IDECKDKIYAQLQAGKMKVKHSEKTFRCPFCLGKKKQDYNGKDLLQHATGIG-AAPQRKA  74

Query  1934  KQKANHVALAKYLEIDLGDQAEPLPQRAVA---PEDNN--LYCWPWTGIVVNVSKDNANG  1770
             + +A H+ALA+Y++ DL    EP  Q A+    P  N    + WPW GI+VNV  +  + 
Sbjct  75    RVRAEHLALAEYMKNDLESLLEPSLQLAIVDYEPLKNEEEKFVWPWMGILVNVPTEGHDV  134

Query  1769  TAVEEE-DYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAEC  1593
               V E  D    + S++   +V I  + K +T+  VIK   DW G+ +A+ FEN F  E 
Sbjct  135   NFVSENADMLRSQLSRFRPCQVTILWNSKGQTA--VIKFNEDWIGFNDALAFENHFILEK  192

Query  1592  HSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKI  1413
             +SK +W  + +     +YGW A+ DDY + G +G +LR+   LK+I D    ++   DK 
Sbjct  193   YSKTDWN-KSNCRMDDLYGWLARTDDYNSPGTIGEHLRKAGVLKSIGD---RQREGTDKC  248

Query  1412  LSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQR  1233
             +++  ++++ KN+ L  L  + N+  + L  M+++KD L     E+ RKMQ+ AR   ++
Sbjct  249   VAHFAHQMEEKNKQLQELELKNNQNAMKLDSMMKDKDRLVEEHNEKKRKMQQDARRTFRK  308

Query  1232  VLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKE  1053
             +L + + L+ EL  + ++    ++EL +    +  +K K++ E K+N   N  L++A  +
Sbjct  309   MLQDNQRLHQELNTRIEETSRKHKELEELATFSNIDKAKVEAEIKKNANDNVLLDLAFLK  368

Query  1052  QKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDD  873
              KK  E  ++L ++H++E E A ++  +LEKD+ +KQ LE  +  L+GKL++M+HMG ++
Sbjct  369   FKKGGEETMQLAKKHEQEMEDAFKRQYKLEKDLTSKQNLETTVAYLRGKLEIMKHMGAEE  428

Query  872   DSAVQE--KIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLL  699
             D+  +E  KI E  ++ +E++E MK     N AL++ ER++NDEL++A++ LI+GL ++ 
Sbjct  429   DTTSKELDKISEELKEKEEELEHMKS---ANQALIIVERRTNDELEQAKEELIKGLQEM-  484

Query  698   NSGRSHIGIRRMGEIDGKAFHNVCKQRF----STEEADV-----KALELCSLWQEKVKDP  546
             +  RS+IG++RMG +D KAF   CK +     S + A+       ALEL S W+ ++  P
Sbjct  485   SGTRSNIGVKRMGVLDVKAFVAACKAKSARVDSKKSANYDFEGESALEL-SKWEHEIAQP  543

Query  545   NWHPFRVINIHDRPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYNASGRYVIPE  366
              WHPF+VINI  + + I+ EDDE+L  LKE+ G++    V+KA+ E+NEYN SGRY +P 
Sbjct  544   EWHPFKVINIDGKEKLIVREDDEKLQALKEKLGQDAHDVVVKALLEMNEYNPSGRYSVPV  603

Query  365   LWNFKEGRKATLKEVVSFIFKQLKTHKRKR  276
             LWNFKE RKA L E V ++ KQ K +K K+
Sbjct  604   LWNFKENRKALLDEAVEYVLKQWKGNKNKK  633



>ref|XP_006575505.1| PREDICTED: uncharacterized protein LOC100806426 isoform X3 [Glycine 
max]
Length=1076

 Score =   360 bits (924),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 217/540 (40%), Positives = 332/540 (61%), Gaps = 14/540 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKGSA-NRSVK  1932
             Y  K YE L+ G + VK       CP+C  KK++       + +HA+GVG+ S+  RS  
Sbjct  535   YVHKSYEALKKGSHNVKTSEMTFSCPYCPNKKRKRDYLYREILEHASGVGQSSSEKRSAI  594

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRA--VAPEDN--NLYCWPWTGIVVNV-SKDNANGT  1767
             +KANH+AL KYLE DL     P P+ A   +P  N    + WPWTG+VVN+ ++   +G 
Sbjct  595   EKANHLALIKYLEKDLMIVDGP-PKTADEGSPPFNFEKQFVWPWTGVVVNIPTRLTEDGR  653

Query  1766  AVEEEDYWLK---RFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAE  1596
              V E    L+   R   +  + V+I  +    +   V++   +W G  NA+ FE A+E +
Sbjct  654   CVGESGSKLRDEYRSRGFNPRRVRILSNFCVHSGTAVVEFNKNWTGLDNALAFERAYELD  713

Query  1595  CHSKKEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDK  1416
              H KK+W A  +   S +Y W A+ DDY+    +G  LR+   +KTI++L++EE R +DK
Sbjct  714   HHGKKDWFAN-TQHKSGIYAWIAQADDYKMNNIIGEQLRKMVDIKTISELMEEEARTQDK  772

Query  1415  ILSNLTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQ  1236
             ++SNL N L +K + L  +  ++ E +  +  ++ E D L +   +E +K+Q  A +H Q
Sbjct  773   LVSNLNNTLQVKKKRLKEMEVKYYETSRRMDIVMGEIDKLTQGHNQEMKKIQSSATQHFQ  832

Query  1235  RVLHEQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASK  1056
              + +  E L  +LE +K++L+    EL KRE   E E+ KL+EE   N  +NSSL+MA  
Sbjct  833   NIFNGHERLKLQLESQKRELELRRIELEKREARNESERKKLEEEIMENALKNSSLDMAVL  892

Query  1055  EQKKADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGD  876
             EQ+KA ENVL+L  + KR+KE    KI+ LE+ ++ KQKLE+EIQ+LKGKL+VM H+  D
Sbjct  893   EQQKAGENVLKLAADQKRQKEQFHAKIILLERQLEVKQKLELEIQQLKGKLNVMAHIEDD  952

Query  875   DDSAVQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN  696
              DS V  K+  + + L EK + ++DLD +N  L++KERQSNDELQEARK LI G+ ++  
Sbjct  953   GDSEVLNKVDALHKDLREKEQSLRDLDSLNQTLIIKERQSNDELQEARKELINGIKEI--  1010

Query  695   SGRSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINI  516
             S R+++G++RMGE+D + F    K +++ E+A+ +A ELCSLW+E ++DP+WHPF++  I
Sbjct  1011  SCRANVGVKRMGELDIRPFLEAMKIKYNNEDAEDRASELCSLWEEYIRDPDWHPFKITII  1070


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdll-QHATGVGKG-SANRSVK  1932
             Y E  YEEL+ G + VK  +   RCP+C  KK         + +HA+GVG+  S  RS  
Sbjct  415   YAENFYEELKRGIHNVKTSDETFRCPYCPNKKINRDYAYREILEHASGVGQSKSQKRSFI  474

Query  1931  QKANHVALAKYLEIDLGDQAEPLPQRAV  1848
             +KANH+AL KYL+ DL +   P P + +
Sbjct  475   EKANHLALVKYLKRDLMNVGAPCPSKPM  502


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 2/75 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSA-NRSVKQ  1929
             Y +  Y+EL+ G YKV   +    CP+C  ++KQDYKY++LL HA+GVG+ S+  R+ K+
Sbjct  20    YVDISYQELKKGSYKVMRSDETFICPYCP-ERKQDYKYRELLNHASGVGRSSSEKRTAKE  78

Query  1928  KANHVALAKYLEIDL  1884
             KANH+AL KYLE DL
Sbjct  79    KANHLALVKYLEKDL  93


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSAN-RSVKQ  1929
             Y +K Y+EL+ G + V+  +  L CP+C  K+K+DY Y++LL+HA+GVG+ S+  R V++
Sbjct  251   YVDKFYKELKKGNHIVQTSDQTLSCPYCPRKRKRDYVYRELLEHASGVGQSSSQKRHVRE  310

Query  1928  KANHVALAKYLEIDLGDQAEP  1866
             K  H+AL KYL+ DL    +P
Sbjct  311   KTTHLALMKYLKNDLKYMNDP  331



>ref|XP_003568908.1| PREDICTED: factor of DNA methylation 1-like [Brachypodium distachyon]
Length=623

 Score =   348 bits (894),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 229/617 (37%), Positives = 368/617 (60%), Gaps = 16/617 (3%)
 Frame = -1

Query  2105  YKEKPYEELRSGKYKVKGPNGCLRCPFCAGkkkqdykykdllQHATGVGKGSANRSVKQK  1926
             Y    Y  L SG  KV       +CPFC+   K DY   DLLQHA GVG  + +R  K+K
Sbjct  14    YGADTYTLLLSGDIKVMIDESLYQCPFCS-DGKDDYNIHDLLQHALGVG-AAHDRQAKEK  71

Query  1925  ANHVALAKYLEIDLGDQAEPLPQRAV----APEDNN--LYCWPWTGIVVNVSKDNANGTA  1764
              +H ALAK+L+ + G    PL Q  V     P+ N   L+ WPW GIVVNV  +    +A
Sbjct  72    VDHRALAKHLKDESGKSPSPLLQPYVKDPQPPQHNRDELFVWPWMGIVVNVPHEYVGKSA  131

Query  1763  VEEEDYWLKRFSKYEAQEVKIFCDDKSRTSQVVIKLKSDWNGYKNAILFENAFEAECHSK  1584
                +++    FS +   +V         T   +++   D+ G+KNA  F++ FE + + +
Sbjct  132   NRMKEH----FSCFHPVKVYHVYSKGYPTGNAIVEFGKDFTGFKNARAFDSQFEMKGYGR  187

Query  1583  KEWTAERSSPSSHVYGWFAKVDDYEAEGAVGYYLRETRQLKTITDLLQEEKRDKDKILSN  1404
             K W  E+       +GW A+ +DY + G +G  L++   LKT   +  EE    +K++++
Sbjct  188   KAWK-EKGHGGPEPFGWIARAEDYYSPGTIGDILKKNGDLKTADGVGIEETIKNEKLVAS  246

Query  1403  LTNELDLKNENLSALTTRFNEKNLSLSRMIEEKDTLHRAFYEESRKMQRLAREHVQRVLH  1224
             L  +++ KN  L A+ +   E+ +S  RM+E+++   +++ +E +KM+ L+ +H Q++  
Sbjct  247   LACKVNEKNMRLQAVKSECEERIMSYKRMMEQREQQLQSYSKEIQKMRDLSVKHTQKIAD  306

Query  1223  EQETLNSELEKKKKQLDSWNRELNKREVLTereklkldeekkrndeRNSSLEMASKEQKK  1044
             E + L+ +L+  K +LD+ +++L++  V T+ ++  L+ EK++N  R++ L +A+ E + 
Sbjct  307   ENKKLHLDLQCMKHELDARSKQLDELSVQTDYDRRNLELEKQKNAMRSNHLMLATLEDQI  366

Query  1043  ADENVLRLIEEHKREKEAALQKILELEKDIDAKQKLEMEIQELKGKLDVMEHMGGDDDSA  864
             ADENVL+L+E+HKREKE  L  I +L + +  K +LE++I+ L GKL V++ + G++DS 
Sbjct  367   ADENVLKLVEQHKREKETTLNNIKKLSEQLHEKHRLELDIKHLMGKLQVIKQLPGNEDSE  426

Query  863   VQEKIKEMKEQLDEKIEDMKDLDEMNNALVLKERQSNDELQEARKLLIQGLSDLLN--SG  690
               ++I  + E+L EKIE+M   +  N  LV++E +   ELQEARKL+I  L  L    SG
Sbjct  427   SGKRIARLTEELAEKIEEMDYTETYNQGLVIQENKVAVELQEARKLVIDSLQHLPGPTSG  486

Query  689   RSHIGIRRMGEIDGKAFHNVCKQRFSTEEADVKALELCSLWQEKVKDPNWHPFRVINIHD  510
             RS IGIR +GE+D +AF NVC+Q F  +   VK+ +LC  W+ ++ +P WHPF V  ++ 
Sbjct  487   RSDIGIRMIGELDSEAFLNVCRQNFPEDHVKVKSADLCKKWENEINNPEWHPFIVAVVNG  546

Query  509   RPEQIINeddeelsklkeEWGEEICAAVIKAVEEVNEYN-ASGRYVIPELWNFKEGRKAT  333
             +  ++I EDD++L +LK  +GEE  AAV  A+ E+NE++  S R   PELWN+KEGRKA 
Sbjct  547   KELEVIREDDKKLQELKRVYGEEAYAAVATALTELNEHSGGSSRVPFPELWNYKEGRKAK  606

Query  332   LKEVVSFIFKQLKTHKR  282
              KE+V  + K +K  K+
Sbjct  607   SKEMVQHVIKLVKASKK  623



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6819574690890