BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27017_g1_i1 len=1072 path=[1074:0-1071]

Length=1072
                                                                      Score     E

ref|XP_011100515.1|  PREDICTED: uncharacterized protein LOC105178683    222   3e-68   
ref|XP_009594810.1|  PREDICTED: uncharacterized protein LOC104091232    220   2e-67   
ref|XP_002526022.1|  conserved hypothetical protein                     219   2e-67   Ricinus communis
emb|CDP00774.1|  unnamed protein product                                219   3e-67   
ref|XP_004295065.1|  PREDICTED: uncharacterized protein LOC101303101    217   2e-66   
ref|XP_010913074.1|  PREDICTED: uncharacterized protein LOC105038...    216   5e-66   
ref|XP_006360410.1|  PREDICTED: uncharacterized protein LOC102578...    216   5e-66   
gb|KDP38055.1|  hypothetical protein JCGZ_04698                         216   7e-66   
gb|ABK94228.1|  unknown                                                 215   1e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002284349.1|  PREDICTED: uncharacterized protein LOC100262974    214   2e-65   Vitis vinifera
ref|XP_002311501.2|  hypothetical protein POPTR_0008s12880g             215   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_008243366.1|  PREDICTED: uncharacterized protein LOC103341597    214   4e-65   
ref|XP_011038649.1|  PREDICTED: uncharacterized protein LOC105135...    213   7e-65   
ref|XP_011023402.1|  PREDICTED: uncharacterized protein LOC105124906    213   9e-65   
ref|XP_004237010.1|  PREDICTED: uncharacterized protein LOC101262711    213   9e-65   
ref|XP_009339670.1|  PREDICTED: uncharacterized protein LOC103931863    212   2e-64   
ref|XP_008800902.1|  PREDICTED: uncharacterized protein LOC103715143    212   2e-64   
ref|XP_007225817.1|  hypothetical protein PRUPE_ppa013429mg             212   2e-64   
ref|XP_010553905.1|  PREDICTED: uncharacterized protein LOC104823847    211   3e-64   
ref|XP_008339556.1|  PREDICTED: uncharacterized protein LOC103402592    211   4e-64   
ref|XP_006448264.1|  hypothetical protein CICLE_v10017195mg             211   5e-64   
ref|XP_010557270.1|  PREDICTED: uncharacterized protein LOC104826...    211   5e-64   
gb|AFK33962.1|  unknown                                                 209   2e-63   
ref|XP_002315883.1|  hypothetical protein POPTR_0010s12250g             207   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011038645.1|  PREDICTED: uncharacterized protein LOC105135...    207   2e-62   
ref|NP_001235318.1|  uncharacterized protein LOC100306456               207   2e-62   
ref|XP_010557269.1|  PREDICTED: uncharacterized protein LOC104826...    206   3e-62   
ref|XP_010557267.1|  PREDICTED: uncharacterized protein LOC104826...    206   3e-62   
ref|XP_003553924.1|  PREDICTED: uncharacterized protein LOC100788...    206   4e-62   
ref|XP_010691059.1|  PREDICTED: uncharacterized protein LOC104904496    206   5e-62   
ref|XP_002892844.1|  hypothetical protein ARALYDRAFT_471687             205   1e-61   
ref|XP_004149132.1|  PREDICTED: uncharacterized protein LOC101204884    205   1e-61   
ref|XP_007161744.1|  hypothetical protein PHAVU_001G094900g             204   2e-61   
ref|XP_006304251.1|  hypothetical protein CARUB_v10010473mg             206   2e-61   
ref|XP_002455920.1|  hypothetical protein SORBIDRAFT_03g027290          204   3e-61   Sorghum bicolor [broomcorn]
ref|XP_010037349.1|  PREDICTED: uncharacterized protein LOC104426...    204   3e-61   
ref|XP_006840467.1|  hypothetical protein AMTR_s00045p00181160          204   3e-61   
ref|NP_172952.2|  uncharacterized protein                               204   4e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81689.1|  BnaC08g39120D                                          202   8e-61   
ref|XP_009148885.1|  PREDICTED: uncharacterized protein LOC103872290    202   9e-61   
ref|XP_008454751.1|  PREDICTED: uncharacterized protein LOC103495...    202   1e-60   
ref|NP_001132036.1|  uncharacterized protein LOC100193445               202   1e-60   Zea mays [maize]
ref|XP_006644348.1|  PREDICTED: uncharacterized protein LOC102704370    202   1e-60   
ref|XP_010496716.1|  PREDICTED: uncharacterized protein LOC104773762    202   1e-60   
ref|XP_010037321.1|  PREDICTED: uncharacterized protein LOC104426080    201   2e-60   
gb|AAF31021.1|AC012189_3  T15D22.3                                      201   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117858.1|  PREDICTED: uncharacterized protein LOC103842927    201   3e-60   
ref|XP_004508268.1|  PREDICTED: uncharacterized protein LOC101493130    202   3e-60   
ref|XP_004969105.1|  PREDICTED: uncharacterized protein LOC101776...    201   3e-60   
gb|KFK43759.1|  hypothetical protein AALP_AA1G169100                    201   5e-60   
gb|KEH42450.1|  transmembrane protein, putative                         201   5e-60   
gb|KDO64670.1|  hypothetical protein CISIN_1g032809mg                   201   5e-60   
dbj|BAB92466.1|  hypothetical protein                                   200   6e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010037357.1|  PREDICTED: uncharacterized protein LOC104426...    200   1e-59   
gb|ACG42794.1|  hypothetical protein                                    199   1e-59   Zea mays [maize]
emb|CDY33725.1|  BnaA09g45310D                                          199   2e-59   
ref|XP_010274737.1|  PREDICTED: uncharacterized protein LOC104609983    199   3e-59   
ref|XP_010476574.1|  PREDICTED: uncharacterized protein LOC104755808    198   4e-59   
ref|XP_004969104.1|  PREDICTED: uncharacterized protein LOC101775704    197   1e-58   
gb|KCW84463.1|  hypothetical protein EUGRSUZ_B01298                     200   1e-58   
ref|XP_009409928.1|  PREDICTED: uncharacterized protein LOC103992074    196   3e-58   
ref|NP_001184998.1|  uncharacterized protein                            196   4e-58   
gb|EPS58842.1|  hypothetical protein M569_15971                         195   4e-58   
ref|XP_003569320.1|  PREDICTED: uncharacterized protein LOC100842136    196   4e-58   
dbj|BAJ93605.1|  predicted protein                                      192   1e-56   
ref|XP_010462712.1|  PREDICTED: uncharacterized protein LOC104743314    189   1e-55   
gb|EMS65121.1|  hypothetical protein TRIUR3_34650                       188   4e-55   
ref|XP_010913073.1|  PREDICTED: uncharacterized protein LOC105038...    187   2e-54   
ref|XP_010913070.1|  PREDICTED: uncharacterized protein LOC105038...    186   5e-54   
ref|XP_008389215.1|  PREDICTED: uncharacterized protein LOC103451577    185   5e-54   
gb|ACG25910.1|  hypothetical protein                                    181   9e-53   Zea mays [maize]
emb|CDY39594.1|  BnaC05g11230D                                          180   5e-52   
ref|XP_006416953.1|  hypothetical protein EUTSA_v10009435mg             178   2e-51   
emb|CAN68104.1|  hypothetical protein VITISV_019559                     184   6e-51   Vitis vinifera
gb|ADE75598.1|  unknown                                                 177   1e-50   
ref|XP_008454752.1|  PREDICTED: uncharacterized protein LOC103495...    173   2e-49   
ref|XP_010101720.1|  hypothetical protein L484_017350                   167   9e-47   
gb|EMS51285.1|  hypothetical protein TRIUR3_05794                       165   4e-46   
gb|EMT11107.1|  hypothetical protein F775_28937                         166   2e-45   
emb|CDX97362.1|  BnaC08g12270D                                          163   2e-45   
gb|EYU42780.1|  hypothetical protein MIMGU_mgv1a023382mg                154   2e-42   
ref|XP_007225818.1|  hypothetical protein PRUPE_ppa013429mg             151   3e-41   
ref|XP_010058523.1|  PREDICTED: uncharacterized protein LOC104446360    142   1e-37   
ref|XP_001768861.1|  predicted protein                                  142   2e-37   
gb|KCW73154.1|  hypothetical protein EUGRSUZ_E01608                     136   1e-35   
gb|KCW86216.1|  hypothetical protein EUGRSUZ_B02904                     124   3e-31   
ref|NP_001172456.1|  Os01g0606050                                       119   3e-29   
tpg|DAA39893.1|  TPA: hypothetical protein ZEAMMB73_811407            50.1    3e-04   



>ref|XP_011100515.1| PREDICTED: uncharacterized protein LOC105178683 [Sesamum indicum]
 ref|XP_011100516.1| PREDICTED: uncharacterized protein LOC105178683 [Sesamum indicum]
Length=123

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = -2

Query  672  MW-LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            MW L +GW EILKIQKFRR+VSY GFYCF  L++Y YTNNTTRAGYSRADQ YASYPAGT
Sbjct  1    MWRLYDGWKEILKIQKFRRMVSYAGFYCFVTLISYAYTNNTTRAGYSRADQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD  KLYK AL NCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHL S+GQ+D
Sbjct  61   ELLTDTEKLYKAALGNCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLTSHGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_009594810.1| PREDICTED: uncharacterized protein LOC104091232 [Nicotiana tomentosiformis]
 ref|XP_009594811.1| PREDICTED: uncharacterized protein LOC104091232 [Nicotiana tomentosiformis]
 ref|XP_009791176.1| PREDICTED: uncharacterized protein LOC104238506 [Nicotiana sylvestris]
 ref|XP_009791177.1| PREDICTED: uncharacterized protein LOC104238506 [Nicotiana sylvestris]
 ref|XP_009791178.1| PREDICTED: uncharacterized protein LOC104238506 [Nicotiana sylvestris]
 ref|XP_009791179.1| PREDICTED: uncharacterized protein LOC104238506 [Nicotiana sylvestris]
Length=123

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = -2

Query  672  MW-LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            MW L EGW EILKIQKFRR+VSYTGFYCFTAL+TY YTNNTTRAG+SR DQ YASYPAGT
Sbjct  1    MWQLYEGWKEILKIQKFRRIVSYTGFYCFTALITYAYTNNTTRAGHSRDDQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD +KLYK AL N FEEEEWGPIEW ++AKHFERQGKSPYAYH+QYMAHL+S+GQ+D
Sbjct  61   ELLTDTAKLYKAALGNVFEEEEWGPIEWCVLAKHFERQGKSPYAYHSQYMAHLVSHGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_002526022.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36362.1| conserved hypothetical protein [Ricinus communis]
Length=122

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M LL+G+ EILKIQKFRR+VSYTGFYCFT L++Y YT+NTTRAGYSRADQ YASYPAGTE
Sbjct  1    MMLLDGFKEILKIQKFRRIVSYTGFYCFTVLVSYAYTSNTTRAGYSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGPIE+ IM+KHFERQGKSPYAYHAQYMAHL+S+GQ+DG
Sbjct  61   LLTDTAKLYKSALGNCFESEEWGPIEYCIMSKHFERQGKSPYAYHAQYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>emb|CDP00774.1| unnamed protein product [Coffea canephora]
Length=122

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L EGW EILKIQKFRR+V YTGFYCFTAL++Y YT+NTTRAGYSR DQ YASYPAGTE
Sbjct  1    MRLYEGWKEILKIQKFRRIVGYTGFYCFTALISYAYTSNTTRAGYSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFEEEEWGPIEW ++AKHFERQGKSPYAYHAQYMAHL S+GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCFEEEEWGPIEWLVLAKHFERQGKSPYAYHAQYMAHLASHGQVDG  120

Query  312  SG  307
            +G
Sbjct  121  NG  122



>ref|XP_004295065.1| PREDICTED: uncharacterized protein LOC101303101 [Fragaria vesca 
subsp. vesca]
Length=123

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M L  G+L+ILKIQKFRR+VSYTGFYCFTA+L+Y YT+NTTRAG+SR DQ YASYPAGT
Sbjct  1    MMRLYNGFLDILKIQKFRRIVSYTGFYCFTAVLSYAYTSNTTRAGFSRGDQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTDQ+KLYK AL NCFE EEWGPIE+ IMAKHFERQGK PYAYHAQYMAHL+S GQ+D
Sbjct  61   ELLTDQAKLYKAALGNCFETEEWGPIEYCIMAKHFERQGKGPYAYHAQYMAHLLSLGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_010913074.1| PREDICTED: uncharacterized protein LOC105038857 isoform X3 [Elaeis 
guineensis]
Length=123

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M +LE W  ILKIQKFRR+ SY GFYCF +L+TY YT+NTTRAG SRADQ YASYPAGT
Sbjct  1    MMEMLEQWKAILKIQKFRRMASYAGFYCFVSLITYAYTSNTTRAGMSRADQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD +KLYKVAL NCFEEEEWGPIE+SIMAKHFERQGKSPY YHAQYMAHL+S+GQ+D
Sbjct  61   ELLTDTAKLYKVALGNCFEEEEWGPIEFSIMAKHFERQGKSPYVYHAQYMAHLLSHGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_006360410.1| PREDICTED: uncharacterized protein LOC102578591 isoform X1 [Solanum 
tuberosum]
 ref|XP_006360411.1| PREDICTED: uncharacterized protein LOC102578591 isoform X2 [Solanum 
tuberosum]
Length=123

 Score =   216 bits (550),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 1/123 (1%)
 Frame = -2

Query  672  MW-LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            MW L EGW +ILKIQKFRR+VSYTGFYCF  ++TY YTNNTTRAGYSRADQ YASYPAGT
Sbjct  1    MWRLYEGWNDILKIQKFRRIVSYTGFYCFVTVITYAYTNNTTRAGYSRADQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD +KLYK AL N FE EEWGP+EWS++AKHFERQGKSPYAYHAQYMAHL S+GQ+D
Sbjct  61   ELLTDTAKLYKAALGNVFELEEWGPVEWSVLAKHFERQGKSPYAYHAQYMAHLASHGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>gb|KDP38055.1| hypothetical protein JCGZ_04698 [Jatropha curcas]
Length=122

 Score =   216 bits (549),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L +G+ EILKIQKFRR+VSYTGFYCF A+L+Y YT+NTTRAGYSRADQ YASYPAGTE
Sbjct  1    MMLYDGFKEILKIQKFRRIVSYTGFYCFVAVLSYAYTSNTTRAGYSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK A+ NCFE E+WGPIE+ IMAKHF+RQGKSPYAYHAQYMAHL+S+GQ+DG
Sbjct  61   LLTDTAKLYKAAVGNCFESEDWGPIEFCIMAKHFDRQGKSPYAYHAQYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>gb|ABK94228.1| unknown [Populus trichocarpa]
Length=124

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M L +G+ EI+KIQK RRVVSYTGFYCF A+++Y YT NTTRAGYSR DQ YA+YPAGT
Sbjct  2    MMMLYDGFKEIIKIQKLRRVVSYTGFYCFVAVMSYAYTTNTTRAGYSRGDQFYAAYPAGT  61

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYHAQYMAHL+S+GQ D
Sbjct  62   ELLTDATKLYKAALVNCFEAEEWGPIEFSIMAKHFERQGKSPYAYHAQYMAHLLSHGQFD  121

Query  315  GSG  307
            GSG
Sbjct  122  GSG  124



>ref|XP_002284349.1| PREDICTED: uncharacterized protein LOC100262974 [Vitis vinifera]
 emb|CBI26905.3| unnamed protein product [Vitis vinifera]
Length=122

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L +G+ EILKIQKFRR+VSYTGFYCFTA++ Y YTNNTTRAGYSRADQ YAS+P+GTE
Sbjct  1    MRLYDGFTEILKIQKFRRLVSYTGFYCFTAVIAYAYTNNTTRAGYSRADQFYASFPSGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK+PYAYHAQYMAHL+S GQ+DG
Sbjct  61   LLTDTTKLYKTALGNCFEVEEWGPIEYCIMAKHFERQGKTPYAYHAQYMAHLLSLGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_002311501.2| hypothetical protein POPTR_0008s12880g [Populus trichocarpa]
 ref|XP_006379762.1| hypothetical protein POPTR_0008s12880g [Populus trichocarpa]
 gb|EEE88868.2| hypothetical protein POPTR_0008s12880g [Populus trichocarpa]
 gb|ERP57559.1| hypothetical protein POPTR_0008s12880g [Populus trichocarpa]
Length=124

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M L +G+ EI+KIQK RRVVSYTGFYCF A+++Y YT NTTRAGYSR DQ YA+YPAGT
Sbjct  2    MMMLYDGFKEIIKIQKLRRVVSYTGFYCFVAVMSYAYTTNTTRAGYSRGDQFYAAYPAGT  61

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYHAQYMAHL+S+GQ D
Sbjct  62   ELLTDATKLYKAALGNCFEAEEWGPIEFSIMAKHFERQGKSPYAYHAQYMAHLLSHGQFD  121

Query  315  GSG  307
            GSG
Sbjct  122  GSG  124



>ref|XP_008243366.1| PREDICTED: uncharacterized protein LOC103341597 [Prunus mume]
Length=123

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M L +G  EILKIQKFRR+VSY GFYCFTA+L+Y YT+NTTRAG+SR DQ YASYPAGT
Sbjct  1    MMRLYDGVKEILKIQKFRRIVSYAGFYCFTAVLSYAYTSNTTRAGFSRGDQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK+PYAYHAQYMAHL+S+GQ+D
Sbjct  61   ELLTDTAKLYKAALGNCFENEEWGPIEYCIMAKHFERQGKTPYAYHAQYMAHLLSHGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_011038649.1| PREDICTED: uncharacterized protein LOC105135466 isoform X2 [Populus 
euphratica]
 ref|XP_011038650.1| PREDICTED: uncharacterized protein LOC105135466 isoform X2 [Populus 
euphratica]
Length=123

 Score =   213 bits (542),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  666  LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELL  487
            L +G+ EILKIQK RRVVSYTGFYCF A+++Y YT NTTRAGYSR DQ YA+YPAGTELL
Sbjct  4    LYDGFKEILKIQKLRRVVSYTGFYCFVAVMSYAYTTNTTRAGYSRGDQFYAAYPAGTELL  63

Query  486  TDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            TD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYHAQYMAHL+S+GQ+DGSG
Sbjct  64   TDATKLYKAALGNCFESEEWGPIEYSIMAKHFERQGKSPYAYHAQYMAHLLSHGQLDGSG  123



>ref|XP_011023402.1| PREDICTED: uncharacterized protein LOC105124906 [Populus euphratica]
Length=124

 Score =   213 bits (542),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M L +G+ EI+KIQK RRVVSY GFYCF A+++Y YT NTTRAGYSR DQ YA+YPAGT
Sbjct  2    MMMLYDGFKEIIKIQKLRRVVSYAGFYCFVAVMSYAYTTNTTRAGYSRGDQFYAAYPAGT  61

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYHAQYMAHL+S+GQ D
Sbjct  62   ELLTDATKLYKAALGNCFEAEEWGPIEFSIMAKHFERQGKSPYAYHAQYMAHLLSHGQFD  121

Query  315  GSG  307
            GSG
Sbjct  122  GSG  124



>ref|XP_004237010.1| PREDICTED: uncharacterized protein LOC101262711 [Solanum lycopersicum]
 ref|XP_004237011.1| PREDICTED: uncharacterized protein LOC101262711 [Solanum lycopersicum]
 ref|XP_010319392.1| PREDICTED: uncharacterized protein LOC101262711 [Solanum lycopersicum]
Length=123

 Score =   213 bits (542),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 109/123 (89%), Gaps = 1/123 (1%)
 Frame = -2

Query  672  MW-LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            MW L EGW +ILKIQKFRR+VSYTGFYCF  ++TY YTNNTTRAGYSRADQ YASYPAGT
Sbjct  1    MWRLYEGWNDILKIQKFRRIVSYTGFYCFVTVITYAYTNNTTRAGYSRADQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            E+LTD +KLYK AL N FE EEWGP+EWS++AKHFERQGKSPYAYHA YMAHL S+GQ+D
Sbjct  61   EILTDTAKLYKAALGNVFEVEEWGPVEWSVLAKHFERQGKSPYAYHALYMAHLASHGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_009339670.1| PREDICTED: uncharacterized protein LOC103931863 [Pyrus x bretschneideri]
Length=122

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +  G  EILKIQKFRR+VSY GFYCFTA+LTY YT+NTTRAG+SRADQ YASYPAGTE
Sbjct  1    MNVFNGCKEILKIQKFRRIVSYAGFYCFTAVLTYAYTSNTTRAGFSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK PYAYHA YMAHL+S+GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCFENEEWGPIEYCIMAKHFERQGKGPYAYHAHYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_008800902.1| PREDICTED: uncharacterized protein LOC103715143 [Phoenix dactylifera]
Length=123

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M +LE W  ILKIQKFRRV SY GFYCF +L++Y YT+NTTRAG SRADQ YASYPAGT
Sbjct  1    MMEMLEQWKAILKIQKFRRVASYAGFYCFVSLISYAYTSNTTRAGMSRADQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELL D +KLYK AL NCFEEE+WGPIE+SIMAKHF+RQGKSPYAYHAQYMAHL+S+GQ+D
Sbjct  61   ELLADTAKLYKAALGNCFEEEDWGPIEFSIMAKHFDRQGKSPYAYHAQYMAHLLSHGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_007225817.1| hypothetical protein PRUPE_ppa013429mg [Prunus persica]
 gb|EMJ27016.1| hypothetical protein PRUPE_ppa013429mg [Prunus persica]
Length=123

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M L +G  EILKIQKFRR+VSY GFYCFTA+L+Y Y +NTTRAG+SR DQ YASYPAGT
Sbjct  1    MMRLYDGVKEILKIQKFRRIVSYAGFYCFTAVLSYAYASNTTRAGFSRGDQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            ELLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK+PYAYHAQYMAHL+S+GQ+D
Sbjct  61   ELLTDTAKLYKAALGNCFENEEWGPIEYCIMAKHFERQGKTPYAYHAQYMAHLLSHGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_010553905.1| PREDICTED: uncharacterized protein LOC104823847 [Tarenaya hassleriana]
Length=122

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M + +   EILKIQK RR+VSY GFYCFTA LT+ YTNNTTRAGYSRADQ YASYPAGTE
Sbjct  1    MMVYDVLREILKIQKLRRIVSYAGFYCFTAALTFFYTNNTTRAGYSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYH+QYMAHL+S GQ+DG
Sbjct  61   LLTDTTKLYKAALGNCFETEEWGPIEYSIMAKHFERQGKSPYAYHSQYMAHLLSLGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_008339556.1| PREDICTED: uncharacterized protein LOC103402592 [Malus domestica]
Length=122

 Score =   211 bits (538),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L  G  EILKIQKFRR+VSY GFYCFTA+LTY YT+NTTRAG+SRADQ YASYPAGTE
Sbjct  1    MNLYNGCKEILKIQKFRRMVSYAGFYCFTAVLTYAYTSNTTRAGFSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK PYAYHA YMAHL+S+GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCFENEEWGPIEYCIMAKHFERQGKGPYAYHAHYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_006448264.1| hypothetical protein CICLE_v10017195mg [Citrus clementina]
 ref|XP_006448265.1| hypothetical protein CICLE_v10017195mg [Citrus clementina]
 ref|XP_006469174.1| PREDICTED: uncharacterized protein LOC102607903 isoform X1 [Citrus 
sinensis]
 gb|ESR61504.1| hypothetical protein CICLE_v10017195mg [Citrus clementina]
 gb|ESR61505.1| hypothetical protein CICLE_v10017195mg [Citrus clementina]
 gb|KDO64667.1| hypothetical protein CISIN_1g032809mg [Citrus sinensis]
 gb|KDO64668.1| hypothetical protein CISIN_1g032809mg [Citrus sinensis]
 gb|KDO64669.1| hypothetical protein CISIN_1g032809mg [Citrus sinensis]
Length=122

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L E   EILKIQKFRR+VSYTGFYCF A+L+Y YTNNTTRAGYSR DQ YASYPAGTE
Sbjct  1    MMLYETCKEILKIQKFRRIVSYTGFYCFVAVLSYAYTNNTTRAGYSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK PYAYHA+YMAH++S+G++DG
Sbjct  61   LLTDTTKLYKAALGNCFESEEWGPIEYCIMAKHFERQGKDPYAYHAKYMAHVLSHGELDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_010557270.1| PREDICTED: uncharacterized protein LOC104826327 isoform X3 [Tarenaya 
hassleriana]
Length=122

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M + E   EILKIQK RR+VSY GFYCFTA LT+ YTNNTTRAG+SRADQ YASYPAGTE
Sbjct  1    MMVYEVLREILKIQKSRRIVSYAGFYCFTAALTFFYTNNTTRAGFSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYH+QYMAHL+S GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCFESEEWGPIEFSIMAKHFERQGKSPYAYHSQYMAHLLSLGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>gb|AFK33962.1| unknown [Lotus japonicus]
Length=122

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L + + EILKIQKFRR+VSYTGFYCF  L++Y Y +NTTRAGYSRADQ YASYPAGTE
Sbjct  1    MRLYDQFTEILKIQKFRRIVSYTGFYCFATLISYAYVSNTTRAGYSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGP E+ +MAKHFERQGK+PYAYHAQYMAHL+S+GQIDG
Sbjct  61   LLTDTTKLYKAALGNCFEVEEWGPFEFCVMAKHFERQGKAPYAYHAQYMAHLLSHGQIDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_002315883.1| hypothetical protein POPTR_0010s12250g [Populus trichocarpa]
 gb|ABK93372.1| unknown [Populus trichocarpa]
 gb|EEF02054.1| hypothetical protein POPTR_0010s12250g [Populus trichocarpa]
Length=123

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  666  LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELL  487
            L  G  EI KIQK RRVVSYTGFYCF A+++Y YT NTTRAGYSR DQ YA+YPAGTELL
Sbjct  4    LYHGLKEISKIQKLRRVVSYTGFYCFVAVMSYAYTTNTTRAGYSRGDQFYAAYPAGTELL  63

Query  486  TDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            TD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYHAQYMAHL+S+GQ+DG+G
Sbjct  64   TDATKLYKAALGNCFESEEWGPIEYSIMAKHFERQGKSPYAYHAQYMAHLLSHGQLDGNG  123



>ref|XP_011038645.1| PREDICTED: uncharacterized protein LOC105135466 isoform X1 [Populus 
euphratica]
 ref|XP_011038646.1| PREDICTED: uncharacterized protein LOC105135466 isoform X1 [Populus 
euphratica]
 ref|XP_011038647.1| PREDICTED: uncharacterized protein LOC105135466 isoform X1 [Populus 
euphratica]
 ref|XP_011038648.1| PREDICTED: uncharacterized protein LOC105135466 isoform X1 [Populus 
euphratica]
Length=129

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 108/126 (86%), Gaps = 6/126 (5%)
 Frame = -2

Query  666  LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELL  487
            L +G+ EILKIQK RRVVSYTGFYCF A+++Y YT NTTRAGYSR DQ YA+YPAGTELL
Sbjct  4    LYDGFKEILKIQKLRRVVSYTGFYCFVAVMSYAYTTNTTRAGYSRGDQFYAAYPAGTELL  63

Query  486  TDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA------QYMAHLISNG  325
            TD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYHA      QYMAHL+S+G
Sbjct  64   TDATKLYKAALGNCFESEEWGPIEYSIMAKHFERQGKSPYAYHAVSFTMLQYMAHLLSHG  123

Query  324  QIDGSG  307
            Q+DGSG
Sbjct  124  QLDGSG  129



>ref|NP_001235318.1| uncharacterized protein LOC100306456 [Glycine max]
 ref|XP_006598700.1| PREDICTED: uncharacterized protein LOC100306456 isoform X1 [Glycine 
max]
 gb|ACU14640.1| unknown [Glycine max]
 gb|KHN10807.1| hypothetical protein glysoja_027420 [Glycine soja]
Length=122

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M + + + EI+KIQKFRR+VSY+GFYCF  L++Y Y NNTTRAG+SRADQ YASYPAGTE
Sbjct  1    MRIYDEFKEIVKIQKFRRLVSYSGFYCFATLISYFYVNNTTRAGFSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGP E+ +MAKHFERQGKSPYAYHAQYMAHL+S+GQ+DG
Sbjct  61   LLTDTTKLYKAALGNCFEAEEWGPFEFCVMAKHFERQGKSPYAYHAQYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_010557269.1| PREDICTED: uncharacterized protein LOC104826327 isoform X2 [Tarenaya 
hassleriana]
Length=123

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M + E   EILKIQK RR+VSY GFYCFTA LT+ YTNNTTRAG+SRADQ YASYPAGTE
Sbjct  1    MMVYEVLREILKIQKSRRIVSYAGFYCFTAALTFFYTNNTTRAGFSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA-QYMAHLISNGQID  316
            LLTD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYH+ QYMAHL+S GQ+D
Sbjct  61   LLTDTAKLYKAALGNCFESEEWGPIEFSIMAKHFERQGKSPYAYHSQQYMAHLLSLGQLD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_010557267.1| PREDICTED: uncharacterized protein LOC104826327 isoform X1 [Tarenaya 
hassleriana]
Length=124

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M + E   EILKIQK RR+VSY GFYCFTA LT+ YTNNTTRAG+SRADQ YASYPAGTE
Sbjct  1    MMVYEVLREILKIQKSRRIVSYAGFYCFTAALTFFYTNNTTRAGFSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA--QYMAHLISNGQI  319
            LLTD +KLYK AL NCFE EEWGPIE+SIMAKHFERQGKSPYAYH+  QYMAHL+S GQ+
Sbjct  61   LLTDTAKLYKAALGNCFESEEWGPIEFSIMAKHFERQGKSPYAYHSQQQYMAHLLSLGQL  120

Query  318  DGSG  307
            DGSG
Sbjct  121  DGSG  124



>ref|XP_003553924.1| PREDICTED: uncharacterized protein LOC100788088 isoform X1 [Glycine 
max]
 gb|KHN24328.1| hypothetical protein glysoja_043424 [Glycine soja]
Length=123

 Score =   206 bits (524),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            EI+KIQKFRR+VSYTGFYCF  L++Y Y NNTTRAG+SRADQ YASYPAGTELLTD +KL
Sbjct  10   EIVKIQKFRRLVSYTGFYCFATLISYFYVNNTTRAGFSRADQFYASYPAGTELLTDTTKL  69

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            YK AL NCFE EEWGP E+ +MAKHFERQGKSPYAYHAQYMAHL+S+GQ+DGSG
Sbjct  70   YKAALGNCFEAEEWGPFEFCVMAKHFERQGKSPYAYHAQYMAHLLSHGQLDGSG  123



>ref|XP_010691059.1| PREDICTED: uncharacterized protein LOC104904496 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691060.1| PREDICTED: uncharacterized protein LOC104904496 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691061.1| PREDICTED: uncharacterized protein LOC104904496 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691062.1| PREDICTED: uncharacterized protein LOC104904496 [Beta vulgaris 
subsp. vulgaris]
Length=123

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M + +   EILKIQKFRR+VSYTGFYCF  +L+Y Y NNTTRAG SR DQ YASYPAGT
Sbjct  1    MMRIYDATCEILKIQKFRRIVSYTGFYCFVTVLSYAYNNNTTRAGISRGDQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            E+LTD +KLYK AL NCFE E+WGPIE+ IMAKHFERQGKSPYAYHAQYMAHL+S+G++D
Sbjct  61   EMLTDTAKLYKAALGNCFEVEDWGPIEFCIMAKHFERQGKSPYAYHAQYMAHLLSHGELD  120

Query  315  GSG  307
            GSG
Sbjct  121  GSG  123



>ref|XP_002892844.1| hypothetical protein ARALYDRAFT_471687 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69103.1| hypothetical protein ARALYDRAFT_471687 [Arabidopsis lyrata subsp. 
lyrata]
Length=122

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L+   E+LKIQK RR VSY GFYCFTA LT+ YTNNTTRAGYSR DQ YASYPAGTE
Sbjct  1    MTVLDVCAEVLKIQKLRRFVSYAGFYCFTAALTFFYTNNTTRAGYSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCYESEDWGPVEFCIMAKHFERQGKSPYVYHSQYMAHLLSQGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_004149132.1| PREDICTED: uncharacterized protein LOC101204884 [Cucumis sativus]
 gb|KGN49556.1| hypothetical protein Csa_5G001030 [Cucumis sativus]
Length=122

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L  G  EILKIQKFRR+VSYTGFY F ++L+Y YT+NTTRAGYSR DQ YASYPAGTE
Sbjct  1    MRLYYGAKEILKIQKFRRIVSYTGFYLFASVLSYAYTSNTTRAGYSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGPIE+ IMAKHF+RQGKSPYAYH+QYMAHL+S+GQ+DG
Sbjct  61   LLTDTTKLYKAALGNCFELEEWGPIEFCIMAKHFDRQGKSPYAYHSQYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_007161744.1| hypothetical protein PHAVU_001G094900g [Phaseolus vulgaris]
 gb|ESW33738.1| hypothetical protein PHAVU_001G094900g [Phaseolus vulgaris]
Length=122

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L E   EI+KIQKFRR+VSYTGFYCF  L++Y Y +NTTRAGYSRADQ YASYPAGTE
Sbjct  1    MRLYEELREIVKIQKFRRLVSYTGFYCFATLISYAYVSNTTRAGYSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE E+WGP E+ IMAKHF+RQGKSPYAYHAQYMAHL+S GQ+DG
Sbjct  61   LLTDTTKLYKAALGNCFEAEDWGPFEFCIMAKHFDRQGKSPYAYHAQYMAHLLSLGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_006304251.1| hypothetical protein CARUB_v10010473mg, partial [Capsella rubella]
 gb|EOA37149.1| hypothetical protein CARUB_v10010473mg, partial [Capsella rubella]
Length=170

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L+   EILKIQK RRVVSY GFYCFTA LT+ YTNNTTRAGYSR DQ YASYPAGTE
Sbjct  49   MTILDVCSEILKIQKLRRVVSYAGFYCFTAALTFFYTNNTTRAGYSRGDQFYASYPAGTE  108

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S G +DG
Sbjct  109  LLTDTAKLYKAALGNCYESEDWGPVEFCIMAKHFERQGKSPYVYHSQYMAHLLSQGLLDG  168

Query  312  SG  307
            SG
Sbjct  169  SG  170



>ref|XP_002455920.1| hypothetical protein SORBIDRAFT_03g027290 [Sorghum bicolor]
 gb|EES01040.1| hypothetical protein SORBIDRAFT_03g027290 [Sorghum bicolor]
Length=122

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L    E+LKIQKFRR+VSY GFYCFTAL+TY YT+NTTRAG SRADQ YASYPAGTE
Sbjct  1    MDILYQCKEVLKIQKFRRMVSYAGFYCFTALITYAYTSNTTRAGISRADQYYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE +EWGPIE+SIMAKHF+RQGK PYAYHAQY+AHL+S+GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCFEIDEWGPIEFSIMAKHFDRQGKPPYAYHAQYLAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_010037349.1| PREDICTED: uncharacterized protein LOC104426100 isoform X1 [Eucalyptus 
grandis]
Length=139

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -2

Query  705  GVHASVV*AKLMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRAD  526
            G   S V +  M + EG+ + LKIQKFRR V Y+ FYCFTA+L+Y YTNNTTRAGYSRAD
Sbjct  7    GFFFSSVRSSKMMVYEGFKDTLKIQKFRRFVGYSVFYCFTAVLSYAYTNNTTRAGYSRAD  66

Query  525  QLYASYPAGTELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYM  346
            Q YA+YPAGTELL D  KLYK AL NCFE EEWG IE+ IM+KHFERQGK+PYAYHAQYM
Sbjct  67   QYYAAYPAGTELLGDSDKLYKAALGNCFEAEEWGSIEFCIMSKHFERQGKAPYAYHAQYM  126

Query  345  AHLISNGQIDGSG  307
            AHL+S GQ+DGSG
Sbjct  127  AHLLSLGQLDGSG  139



>ref|XP_006840467.1| hypothetical protein AMTR_s00045p00181160 [Amborella trichopoda]
 gb|ERN02142.1| hypothetical protein AMTR_s00045p00181160 [Amborella trichopoda]
Length=149

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  654  WLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQS  475
            W +ILKIQKFRR+VSY GFYCFTA+L+Y YT+NTTRAG SR DQ YASYPAGTELLTD +
Sbjct  33   WRDILKIQKFRRLVSYAGFYCFTAVLSYAYTSNTTRAGISRGDQFYASYPAGTELLTDTA  92

Query  474  KLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            KLYK AL N FEEE+WGPIE+SIMAKHFERQGK PYAYHAQYMAHL+S+GQ+DG+G
Sbjct  93   KLYKAALGNIFEEEDWGPIEYSIMAKHFERQGKPPYAYHAQYMAHLLSHGQLDGAG  148



>ref|NP_172952.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC43486.1| unknown protein [Arabidopsis thaliana]
 gb|ABD38910.1| At1g14990 [Arabidopsis thaliana]
 gb|AEE29250.1| uncharacterized protein AT1G14990 [Arabidopsis thaliana]
Length=122

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L+   E++KIQK RR VSY GFYCFTA LT+ YTNNTTRAGYSR DQ YASYPAGTE
Sbjct  1    MMILDVCSEVIKIQKLRRAVSYAGFYCFTAALTFFYTNNTTRAGYSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NC+E E+WGP+E+ IMAKHF+RQGKSPY YH+QYMAHL+S GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCYESEDWGPVEFCIMAKHFDRQGKSPYVYHSQYMAHLLSQGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>emb|CDX81689.1| BnaC08g39120D [Brassica napus]
Length=124

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  666  LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELL  487
            +L+   EI+KIQK RRVVSY GFYCFTA LT+ YTNNTTRAG+SR DQ YASYPAGTELL
Sbjct  5    ILDVCNEIIKIQKLRRVVSYAGFYCFTAALTFFYTNNTTRAGFSRGDQFYASYPAGTELL  64

Query  486  TDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            TD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S GQ+DGSG
Sbjct  65   TDTAKLYKAALRNCYESEDWGPVEFCIMAKHFERQGKSPYVYHSQYMAHLLSQGQLDGSG  124



>ref|XP_009148885.1| PREDICTED: uncharacterized protein LOC103872290 [Brassica rapa]
 emb|CDY36521.1| BnaA06g09740D [Brassica napus]
Length=122

 Score =   202 bits (515),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L+   EILKIQK RRVVSY GFY FTA LT+ YTNNTTRAG+SR DQ YASYPAGTE
Sbjct  1    MMILDVCNEILKIQKLRRVVSYAGFYSFTAALTFFYTNNTTRAGFSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCYESEDWGPVEFRIMAKHFERQGKSPYVYHSQYMAHLLSQGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_008454751.1| PREDICTED: uncharacterized protein LOC103495078 isoform X1 [Cucumis 
melo]
Length=122

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L  G  EILKIQKFRR+VSYTGFY F ++L+Y Y +NTTRAGYSR DQ YASY AGTE
Sbjct  1    MRLYYGAKEILKIQKFRRIVSYTGFYLFASVLSYAYASNTTRAGYSRGDQFYASYSAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD SKLYK AL NCFE EEWGPIE+ IMAKHFERQGKSPYAYH+QYMAHL+S+GQ+DG
Sbjct  61   LLTDTSKLYKAALGNCFELEEWGPIEFCIMAKHFERQGKSPYAYHSQYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|NP_001132036.1| uncharacterized protein LOC100193445 [Zea mays]
 gb|ACF80715.1| unknown [Zea mays]
 gb|ACG32408.1| hypothetical protein [Zea mays]
 tpg|DAA58887.1| TPA: hypothetical protein ZEAMMB73_063892 [Zea mays]
Length=122

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L    E+LKIQKFRR+VSY GFYCFT+L+TY YT+NTTRAG SRADQ Y+SYPAGTE
Sbjct  1    MDILYQCKEVLKIQKFRRMVSYAGFYCFTSLITYAYTSNTTRAGMSRADQYYSSYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE +EWGPIE+SIMAKHF+RQGK PYAYHAQY+AHL+S+GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCFEVDEWGPIEFSIMAKHFDRQGKPPYAYHAQYLAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_006644348.1| PREDICTED: uncharacterized protein LOC102704370 [Oryza brachyantha]
Length=122

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            EILKIQKFRR+VSY GFYCFT +LTY YT+NTTRAG SR DQ YASYPAGTELLTD +KL
Sbjct  9    EILKIQKFRRMVSYAGFYCFTTVLTYAYTSNTTRAGISRGDQFYASYPAGTELLTDTAKL  68

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            YK AL NCFE ++WGPIE+SIMAKHF+RQGK PYAYHAQYMAHL+S+GQ+DGSG
Sbjct  69   YKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPYAYHAQYMAHLLSHGQLDGSG  122



>ref|XP_010496716.1| PREDICTED: uncharacterized protein LOC104773762 [Camelina sativa]
 ref|XP_010496726.1| PREDICTED: uncharacterized protein LOC104773770 isoform X1 [Camelina 
sativa]
 ref|XP_010496734.1| PREDICTED: uncharacterized protein LOC104773770 isoform X2 [Camelina 
sativa]
Length=122

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L+   EILKIQK RR VSY GFYCFTA LT+ YTNNTTRAGYSR DQ YASYPAGTE
Sbjct  1    MTILDVCSEILKIQKLRRGVSYAGFYCFTAALTFFYTNNTTRAGYSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL  C+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S GQ+DG
Sbjct  61   LLTDTAKLYKAALGTCYESEDWGPVEFCIMAKHFERQGKSPYVYHSQYMAHLLSQGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_010037321.1| PREDICTED: uncharacterized protein LOC104426080 [Eucalyptus grandis]
 ref|XP_010037329.1| PREDICTED: uncharacterized protein LOC104426080 [Eucalyptus grandis]
 ref|XP_010037337.1| PREDICTED: uncharacterized protein LOC104426080 [Eucalyptus grandis]
Length=122

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M + EG+ +ILKIQKFRR V Y+ FYCFTA+L+Y YTNNTTRAGYSRADQ YA+YPAGTE
Sbjct  1    MMVYEGFKDILKIQKFRRFVGYSVFYCFTAVLSYAYTNNTTRAGYSRADQYYAAYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LL D  KLYK AL NCFE EEWG IE+ IM+KHFERQGK+PYAYHAQYMAHL+S GQ+DG
Sbjct  61   LLGDSDKLYKAALGNCFEAEEWGSIEFCIMSKHFERQGKAPYAYHAQYMAHLLSLGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>gb|AAF31021.1|AC012189_3 T15D22.3 [Arabidopsis thaliana]
Length=121

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  666  LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELL  487
            +L+   E++KIQK RR VSY GFYCFTA LT+ YTNNTTRAGYSR DQ YASYPAGTELL
Sbjct  2    ILDVCSEVIKIQKLRRAVSYAGFYCFTAALTFFYTNNTTRAGYSRGDQFYASYPAGTELL  61

Query  486  TDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            TD +KLYK AL NC+E E+WGP+E+ IMAKHF+RQGKSPY YH+QYMAHL+S GQ+DGSG
Sbjct  62   TDTAKLYKAALGNCYESEDWGPVEFCIMAKHFDRQGKSPYVYHSQYMAHLLSQGQLDGSG  121



>ref|XP_009117858.1| PREDICTED: uncharacterized protein LOC103842927 [Brassica rapa]
Length=124

 Score =   201 bits (512),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  666  LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELL  487
            +L+   EI+KIQK RR VSY GFYCFTA LT+ YTNNTTRAG+SR DQ YASYPAGTELL
Sbjct  5    ILDVCNEIIKIQKLRRAVSYAGFYCFTAALTFFYTNNTTRAGFSRGDQFYASYPAGTELL  64

Query  486  TDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            TD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S GQ+DGSG
Sbjct  65   TDTAKLYKAALGNCYESEDWGPVEFCIMAKHFERQGKSPYVYHSQYMAHLLSQGQLDGSG  124



>ref|XP_004508268.1| PREDICTED: uncharacterized protein LOC101493130 [Cicer arietinum]
Length=141

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L + + EILKIQKFRR+VSY GF+ FT L++Y Y NNTTRAGYSRADQ YASYPAGTE
Sbjct  20   MRLYDEFKEILKIQKFRRLVSYAGFFGFTTLISYAYCNNTTRAGYSRADQYYASYPAGTE  79

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE EEWGP E+ +MAKHF+RQGKSPY+YHAQYMAHL+S+GQ+DG
Sbjct  80   LLTDTTKLYKAALGNCFEAEEWGPFEFCVMAKHFDRQGKSPYSYHAQYMAHLLSHGQLDG  139

Query  312  SG  307
            SG
Sbjct  140  SG  141



>ref|XP_004969105.1| PREDICTED: uncharacterized protein LOC101776104 isoform X1 [Setaria 
italica]
 ref|XP_004969106.1| PREDICTED: uncharacterized protein LOC101776104 isoform X2 [Setaria 
italica]
 ref|XP_004969107.1| PREDICTED: uncharacterized protein LOC101776104 isoform X3 [Setaria 
italica]
Length=122

 Score =   201 bits (511),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            E+LKIQKFRR+VSY GFYCFT L+TY YT+NTTRAG SRADQ YASYPAGTELLTD +KL
Sbjct  9    EVLKIQKFRRMVSYAGFYCFTTLITYAYTSNTTRAGISRADQYYASYPAGTELLTDTAKL  68

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            YK AL NCFE ++WGPIE+SIMAKHF+RQGK PYAYHAQY+AHL+S+GQ+DGSG
Sbjct  69   YKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPYAYHAQYLAHLLSHGQLDGSG  122



>gb|KFK43759.1| hypothetical protein AALP_AA1G169100 [Arabis alpina]
Length=124

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            EI+KIQK RRVVSY GFYCFTA LT+ YTNNTTRAG+SR DQ YASYPAGTELLTD +KL
Sbjct  11   EIIKIQKLRRVVSYAGFYCFTAALTFFYTNNTTRAGFSRGDQFYASYPAGTELLTDTAKL  70

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            YK AL NC+E E+WGP+E+ IMAKHFERQ KSPY YH+QYMAHL+S GQ+DGSG
Sbjct  71   YKAALGNCYESEDWGPVEFCIMAKHFERQAKSPYVYHSQYMAHLLSQGQLDGSG  124



>gb|KEH42450.1| transmembrane protein, putative [Medicago truncatula]
Length=122

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L E + EILKIQK RR VS+ GFY FT L+ Y Y NNTTRAGYSRADQ YASYPAGTE
Sbjct  1    MRLYEEFKEILKIQKLRRCVSFAGFYGFTTLIIYAYVNNTTRAGYSRADQYYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD SKLYK AL NCFE EEWGP E+ +M KHFERQGKSPYAYHAQYMAHL+S+GQ+DG
Sbjct  61   LLTDTSKLYKAALGNCFEAEEWGPFEFCVMTKHFERQGKSPYAYHAQYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>gb|KDO64670.1| hypothetical protein CISIN_1g032809mg [Citrus sinensis]
 gb|KDO64671.1| hypothetical protein CISIN_1g032809mg [Citrus sinensis]
Length=133

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 107/133 (80%), Gaps = 11/133 (8%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNT-----------TRAGYSRAD  526
            M L E   EILKIQKFRR+VSYTGFYCF A+L+Y YTNNT           TRAGYSR D
Sbjct  1    MMLYETCKEILKIQKFRRIVSYTGFYCFVAVLSYAYTNNTFFVIGGVNHFWTRAGYSRGD  60

Query  525  QLYASYPAGTELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYM  346
            Q YASYPAGTELLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK PYAYHA+YM
Sbjct  61   QFYASYPAGTELLTDTTKLYKAALGNCFESEEWGPIEYCIMAKHFERQGKDPYAYHAKYM  120

Query  345  AHLISNGQIDGSG  307
            AH++S+G++DGSG
Sbjct  121  AHVLSHGELDGSG  133



>dbj|BAB92466.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY74885.1| hypothetical protein OsI_02774 [Oryza sativa Indica Group]
 gb|EAZ12628.1| hypothetical protein OsJ_02539 [Oryza sativa Japonica Group]
Length=122

 Score =   200 bits (509),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L    E LKIQKFRR  SY GFYCFTAL+TY YT+NTTRAG SR DQ YASYPAGTE
Sbjct  1    MDILYQCKEFLKIQKFRRTASYAGFYCFTALMTYAYTSNTTRAGISRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL NCFE ++WGPIE+SIMAKHF+RQGK PYAYHAQYMAHL+S+GQ+DG
Sbjct  61   LLTDTAKLYKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPYAYHAQYMAHLLSHGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_010037357.1| PREDICTED: uncharacterized protein LOC104426100 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010037367.1| PREDICTED: uncharacterized protein LOC104426100 isoform X2 [Eucalyptus 
grandis]
Length=122

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M + EG+ + LKIQKFRR V Y+ FYCFTA+L+Y YTNNTTRAGYSRADQ YA+YPAGTE
Sbjct  1    MMVYEGFKDTLKIQKFRRFVGYSVFYCFTAVLSYAYTNNTTRAGYSRADQYYAAYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LL D  KLYK AL NCFE EEWG IE+ IM+KHFERQGK+PYAYHAQYMAHL+S GQ+DG
Sbjct  61   LLGDSDKLYKAALGNCFEAEEWGSIEFCIMSKHFERQGKAPYAYHAQYMAHLLSLGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>gb|ACG42794.1| hypothetical protein [Zea mays]
Length=122

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            E+LKIQKFRR VSY GFYCFT+L+TY YT+NTTRAG SRADQ Y+SYPAGTELLTD +KL
Sbjct  9    EVLKIQKFRRXVSYAGFYCFTSLITYAYTSNTTRAGMSRADQYYSSYPAGTELLTDTAKL  68

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGS  310
            YK AL NCFE +EWGPIE+SIMAKHF+RQGK PYAYHAQY+AHL+S+GQ+DGS
Sbjct  69   YKAALGNCFEVDEWGPIEFSIMAKHFDRQGKPPYAYHAQYLAHLLSHGQLDGS  121



>emb|CDY33725.1| BnaA09g45310D [Brassica napus]
Length=124

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  666  LLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELL  487
            +L+   EI+KIQK RR VSY GFYCFTA LT+ YTNNTTRAG+SR DQ YASYPAGTELL
Sbjct  5    ILDVCNEIIKIQKLRRAVSYAGFYCFTAALTFFYTNNTTRAGFSRGDQFYASYPAGTELL  64

Query  486  TDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            TD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S GQ++GSG
Sbjct  65   TDTAKLYKAALGNCYESEDWGPVEFCIMAKHFERQGKSPYVYHSQYMAHLLSQGQLEGSG  124



>ref|XP_010274737.1| PREDICTED: uncharacterized protein LOC104609983 [Nelumbo nucifera]
Length=144

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -2

Query  654  WLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQS  475
            W  IL+IQKFRR+VSYTGFYCF +LL+Y YTNNTTRAG SR DQ YAS+PAGTELLTD +
Sbjct  29   WKAILRIQKFRRIVSYTGFYCFVSLLSYAYTNNTTRAGISRGDQFYASFPAGTELLTDTA  88

Query  474  KLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            KLYK AL  CFE EEWGPIE+++MAKHF+RQGK+PYAYH+QYMAHL+S+GQ+DGSG
Sbjct  89   KLYKAALGYCFEAEEWGPIEFAVMAKHFDRQGKAPYAYHSQYMAHLLSHGQLDGSG  144



>ref|XP_010476574.1| PREDICTED: uncharacterized protein LOC104755808 [Camelina sativa]
Length=122

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L    EILKIQK RR  SY GFYCFTA LT+ YTNNTTRAGYSR DQ YASYPAGTE
Sbjct  1    MTILNVCSEILKIQKLRRGFSYAGFYCFTAALTFFYTNNTTRAGYSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYK AL  C+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S GQ+DG
Sbjct  61   LLTDTAKLYKAALGACYESEDWGPVEFCIMAKHFERQGKSPYVYHSQYMAHLLSQGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|XP_004969104.1| PREDICTED: uncharacterized protein LOC101775704 [Setaria italica]
Length=122

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            +I+KIQKFRR+ SY GFYCF+ L+TY YT+NTTRAG SRADQ YASYPAGTELLTD +KL
Sbjct  9    DIIKIQKFRRIASYAGFYCFSTLITYAYTSNTTRAGISRADQYYASYPAGTELLTDTAKL  68

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            YK AL NCFE ++WGPIE+SIM KHF+RQGK PYAYHAQYMAHL+S+GQ+DGSG
Sbjct  69   YKAALGNCFEIDDWGPIEFSIMTKHFDRQGKPPYAYHAQYMAHLLSHGQLDGSG  122



>gb|KCW84463.1| hypothetical protein EUGRSUZ_B01298 [Eucalyptus grandis]
Length=214

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -2

Query  693  SVV*AKLMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYA  514
            + V +  M + EG+ +ILKIQKFRR V Y+ FYCFTA+L+Y YTNNTTRAGYSRADQ YA
Sbjct  86   TCVRSSKMMVYEGFKDILKIQKFRRFVGYSVFYCFTAVLSYAYTNNTTRAGYSRADQYYA  145

Query  513  SYPAGTELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLI  334
            +YPAGTELL D  KLYK AL NCFE EEWG IE+ IM+KHFERQGK+PYAYHAQYMAHL+
Sbjct  146  AYPAGTELLGDSDKLYKAALGNCFEAEEWGSIEFCIMSKHFERQGKAPYAYHAQYMAHLL  205

Query  333  SNGQIDGSG  307
            S GQ+DGSG
Sbjct  206  SLGQLDGSG  214



>ref|XP_009409928.1| PREDICTED: uncharacterized protein LOC103992074 [Musa acuminata 
subsp. malaccensis]
Length=122

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L E W  IL+IQKFRR+VSY GFY F  L++Y +T+NT RAG+S ADQ YA+YPA  E
Sbjct  1    MDLYEQWKGILRIQKFRRMVSYAGFYGFVTLISYAFTSNTKRAGFSNADQYYAAYPASIE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            LLTD +KLYKVAL NCFEEEEWGPIE+SIMAKHFERQGK PYAYHAQYMAHL+S GQ+DG
Sbjct  61   LLTDTAKLYKVALGNCFEEEEWGPIEFSIMAKHFERQGKPPYAYHAQYMAHLLSQGQLDG  120

Query  312  SG  307
            SG
Sbjct  121  SG  122



>ref|NP_001184998.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE29251.1| uncharacterized protein AT1G14990 [Arabidopsis thaliana]
Length=132

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 104/132 (79%), Gaps = 10/132 (8%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L+   E++KIQK RR VSY GFYCFTA LT+ YTNNTTRAGYSR DQ YASYPAGTE
Sbjct  1    MMILDVCSEVIKIQKLRRAVSYAGFYCFTAALTFFYTNNTTRAGYSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA----------QYMA  343
            LLTD +KLYK AL NC+E E+WGP+E+ IMAKHF+RQGKSPY YH+          QYMA
Sbjct  61   LLTDTAKLYKAALGNCYESEDWGPVEFCIMAKHFDRQGKSPYVYHSVSFHKSRILMQYMA  120

Query  342  HLISNGQIDGSG  307
            HL+S GQ+DGSG
Sbjct  121  HLLSQGQLDGSG  132



>gb|EPS58842.1| hypothetical protein M569_15971, partial [Genlisea aurea]
Length=115

 Score =   195 bits (496),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  654  WLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQS  475
            W ++LKIQK RRVVSY+ FY FTAL+TY YTNNTTRAGYSR DQ YASYPAGTELLTD +
Sbjct  3    WKDVLKIQKLRRVVSYSIFYGFTALITYAYTNNTTRAGYSRGDQFYASYPAGTELLTDTT  62

Query  474  KLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQID  316
            KLYK AL NCFE EEWGPIEWSIM+KHF+RQGKSPYAYHA YMAHL S GQ+D
Sbjct  63   KLYKAALGNCFEIEEWGPIEWSIMSKHFDRQGKSPYAYHALYMAHLASLGQLD  115



>ref|XP_003569320.1| PREDICTED: uncharacterized protein LOC100842136 [Brachypodium 
distachyon]
Length=122

 Score =   196 bits (497),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            EILKIQKFRR+VSY  FY FT L+TY YT+NTTRAG SRADQ YASYP+GTELLTD +KL
Sbjct  9    EILKIQKFRRLVSYAAFYSFTTLVTYAYTSNTTRAGISRADQYYASYPSGTELLTDTAKL  68

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            YK AL NCFE ++WGPIE+S+MAKHF+RQGK PYAYHAQYMAHL+S+GQ+DGSG
Sbjct  69   YKAALGNCFEIDDWGPIEFSVMAKHFDRQGKPPYAYHAQYMAHLLSHGQLDGSG  122



>dbj|BAJ93605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=122

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            ++LKIQKFRR+ SY GFY FT L+TY YT+NTTRAG SRADQ YA+YP+GTELLTD +KL
Sbjct  9    DVLKIQKFRRLASYAGFYSFTTLVTYAYTSNTTRAGISRADQYYAAYPSGTELLTDTAKL  68

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            YK AL NCFE ++WGPIE+SIMAKHF+RQGK PYAYHAQYM+H++S+GQ+DGSG
Sbjct  69   YKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPYAYHAQYMSHVLSHGQLDGSG  122



>ref|XP_010462712.1| PREDICTED: uncharacterized protein LOC104743314 [Camelina sativa]
Length=112

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  636  IQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKLYKVA  457
            IQK RR VSY GFYCFTA LT+ YTNNTTRAGYSR DQ YASYPAGTELLTD +KLYK A
Sbjct  3    IQKLRRGVSYAGFYCFTAALTFFYTNNTTRAGYSRGDQFYASYPAGTELLTDTAKLYKAA  62

Query  456  LANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
            L  C+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL+S GQ+DGSG
Sbjct  63   LWTCYESEDWGPVEFCIMAKHFERQGKSPYVYHSQYMAHLLSQGQLDGSG  112



>gb|EMS65121.1| hypothetical protein TRIUR3_34650 [Triticum urartu]
Length=129

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 105/129 (81%), Gaps = 7/129 (5%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L    EILKIQKFRR+ SY GFY FT L+TY YT+NTTRAG SRADQ YASYP+GTE
Sbjct  1    MDILYQCKEILKIQKFRRLASYAGFYSFTTLVTYAYTSNTTRAGISRADQYYASYPSGTE  60

Query  492  LLTDQSKL-------YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLI  334
            LLTD +KL       YK AL NCFE ++WGPIE+SIMAKHF+RQGK PYAYHAQYM+HL+
Sbjct  61   LLTDTAKLPTCFRELYKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPYAYHAQYMSHLL  120

Query  333  SNGQIDGSG  307
            S+GQ+DGSG
Sbjct  121  SHGQLDGSG  129



>ref|XP_010913073.1| PREDICTED: uncharacterized protein LOC105038857 isoform X2 [Elaeis 
guineensis]
Length=141

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M +LE W  ILKIQKFRR+ SY GFYCF +L+TY YT+NTTRAG SRADQ YASYPAGT
Sbjct  1    MMEMLEQWKAILKIQKFRRMASYAGFYCFVSLITYAYTSNTTRAGMSRADQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA  355
            ELLTD +KLYKVAL NCFEEEEWGPIE+SIMAKHFERQGKSPY YHA
Sbjct  61   ELLTDTAKLYKVALGNCFEEEEWGPIEFSIMAKHFERQGKSPYVYHA  107



>ref|XP_010913070.1| PREDICTED: uncharacterized protein LOC105038857 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913071.1| PREDICTED: uncharacterized protein LOC105038857 isoform X1 [Elaeis 
guineensis]
 ref|XP_010913072.1| PREDICTED: uncharacterized protein LOC105038857 isoform X1 [Elaeis 
guineensis]
Length=161

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 1/119 (1%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M +LE W  ILKIQKFRR+ SY GFYCF +L+TY YT+NTTRAG SRADQ YASYPAGT
Sbjct  1    MMEMLEQWKAILKIQKFRRMASYAGFYCFVSLITYAYTSNTTRAGMSRADQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQI  319
            ELLTD +KLYKVAL NCFEEEEWGPIE+SIMAKHFERQGKSPY YHA ++ +  S+ Q+
Sbjct  61   ELLTDTAKLYKVALGNCFEEEEWGPIEFSIMAKHFERQGKSPYVYHA-FLFYTHSDNQL  118



>ref|XP_008389215.1| PREDICTED: uncharacterized protein LOC103451577 [Malus domestica]
Length=121

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +  G  EILKIQKFRR+VSY GFYCFTA+LTY YT+NTTRAG+SRADQ YASYPAGTE
Sbjct  1    MNVFNGCKEILKIQKFRRIVSYAGFYCFTAVLTYAYTSNTTRAGFSRADQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA  355
            LLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK PYAYHA
Sbjct  61   LLTDTAKLYKAALGNCFENEEWGPIEYCIMAKHFERQGKGPYAYHA  106



>gb|ACG25910.1| hypothetical protein [Zea mays]
 tpg|DAA58888.1| TPA: hypothetical protein ZEAMMB73_063892 [Zea mays]
Length=104

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -2

Query  618  VVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKLYKVALANCFE  439
            +VSY GFYCFT+L+TY YT+NTTRAG SRADQ Y+SYPAGTELLTD +KLYK AL NCFE
Sbjct  1    MVSYAGFYCFTSLITYAYTSNTTRAGMSRADQYYSSYPAGTELLTDTAKLYKAALGNCFE  60

Query  438  EEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDGSG  307
             +EWGPIE+SIMAKHF+RQGK PYAYHAQY+AHL+S+GQ+DGSG
Sbjct  61   VDEWGPIEFSIMAKHFDRQGKPPYAYHAQYLAHLLSHGQLDGSG  104



>emb|CDY39594.1| BnaC05g11230D [Brassica napus]
Length=130

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 98/130 (75%), Gaps = 8/130 (6%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNN--------TTRAGYSRADQLY  517
            M + +   EILKIQK RRVVSY GFY FTA LT+ Y            TRAG+SR DQ Y
Sbjct  1    MMVFDLCNEILKIQKLRRVVSYAGFYSFTAALTFFYIYKQHVISFFKATRAGFSRGDQFY  60

Query  516  ASYPAGTELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHL  337
            ASYPAGTELLTD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+QYMAHL
Sbjct  61   ASYPAGTELLTDTAKLYKAALGNCYESEDWGPVEFRIMAKHFERQGKSPYVYHSQYMAHL  120

Query  336  ISNGQIDGSG  307
            +S GQ+D SG
Sbjct  121  LSQGQLDESG  130



>ref|XP_006416953.1| hypothetical protein EUTSA_v10009435mg, partial [Eutrema salsugineum]
 gb|ESQ35306.1| hypothetical protein EUTSA_v10009435mg, partial [Eutrema salsugineum]
Length=106

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L+   EILKIQK RRVVSY GFYCFTA LT+ YTNNTTRAG+SR DQ YASYPAGTE
Sbjct  1    MMVLDVCTEILKIQKLRRVVSYAGFYCFTAALTFFYTNNTTRAGFSRGDQFYASYPAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA  355
            LLTD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+
Sbjct  61   LLTDTAKLYKAALGNCYESEDWGPVEFCIMAKHFERQGKSPYVYHS  106



>emb|CAN68104.1| hypothetical protein VITISV_019559 [Vitis vinifera]
Length=321

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L +G+ EILKIQKFRR+VSYTGFYCFTA++ Y YTNNTTRAGYSRADQ YAS+P+GTE
Sbjct  1    MRLYDGFTEILKIQKFRRLVSYTGFYCFTAVIAYAYTNNTTRAGYSRADQFYASFPSGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA  355
            LLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK+PYAYHA
Sbjct  61   LLTDTTKLYKTALGNCFEVEEWGPIEYCIMAKHFERQGKTPYAYHA  106



>gb|ADE75598.1| unknown [Picea sitchensis]
Length=124

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = -2

Query  654  WLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQS  475
            W  ILKIQK RR  SY GFYCF   L Y YTNN+TRAG SRADQ Y+ +PAGTELL D +
Sbjct  6    WKSILKIQKVRRAASYFGFYCFFTGLVYAYTNNSTRAGISRADQFYSYFPAGTELLFDST  65

Query  474  KLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQI-DGSG  307
            KLYK AL N FEEEEWGPIE+SIM KHF+RQ K+PYAYHAQYM HL+SNG + DG+G
Sbjct  66   KLYKTALGNVFEEEEWGPIEFSIMLKHFQRQNKAPYAYHAQYMVHLLSNGLLDDGTG  122



>ref|XP_008454752.1| PREDICTED: uncharacterized protein LOC103495078 isoform X2 [Cucumis 
melo]
Length=108

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M L  G  EILKIQKFRR+VSYTGFY F ++L+Y Y +NTTRAGYSR DQ YASY AGTE
Sbjct  1    MRLYYGAKEILKIQKFRRIVSYTGFYLFASVLSYAYASNTTRAGYSRGDQFYASYSAGTE  60

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA  355
            LLTD SKLYK AL NCFE EEWGPIE+ IMAKHFERQGKSPYAYH+
Sbjct  61   LLTDTSKLYKAALGNCFELEEWGPIEFCIMAKHFERQGKSPYAYHS  106



>ref|XP_010101720.1| hypothetical protein L484_017350 [Morus notabilis]
 gb|EXB89384.1| hypothetical protein L484_017350 [Morus notabilis]
Length=148

 Score =   167 bits (423),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  675  LMWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            +M L +G++E+LKIQK RR+VSYTGFY F A L+Y YTNNTTRAGYSR DQ YASYPAGT
Sbjct  1    MMRLYDGFVELLKIQKLRRIVSYTGFYFFAAGLSYAYTNNTTRAGYSRGDQFYASYPAGT  60

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQ  352
            ELL D +KLYK AL NCFE EEWG IE+SIMAKHF RQG S Y YH+ 
Sbjct  61   ELLVDTTKLYKAALGNCFETEEWGSIEFSIMAKHFNRQGNSAYEYHSH  108



>gb|EMS51285.1| hypothetical protein TRIUR3_05794 [Triticum urartu]
Length=145

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            ++LKIQKFRR+ SY GFY FT L+TY YT+NTTRAG SRADQ YA+YP+GT+LLTD +KL
Sbjct  9    DVLKIQKFRRLASYAGFYSFTTLVTYAYTSNTTRAGISRADQYYAAYPSGTDLLTDTAKL  68

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA  355
            YK AL NCFE ++WGPIE+SIMAKHF+RQGK PYAYHA
Sbjct  69   YKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPYAYHA  106



>gb|EMT11107.1| hypothetical protein F775_28937 [Aegilops tauschii]
Length=229

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = -2

Query  648  EILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKL  469
            +ILKIQKFRR+ SY GFY FT L+TY YT+NTTRAG SRADQ YA+YP+GT+LLTD +KL
Sbjct  95   DILKIQKFRRLASYAGFYSFTTLVTYAYTSNTTRAGISRADQYYAAYPSGTDLLTDTAKL  154

Query  468  YKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLIS  331
            YK AL NCFE ++WGPIE+SIMAKHF+RQGK PYAYHA   A + S
Sbjct  155  YKAALGNCFEIDDWGPIEFSIMAKHFDRQGKPPYAYHAPTGASVHS  200



>emb|CDX97362.1| BnaC08g12270D [Brassica napus]
Length=136

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M +L+   EILKIQK R VVSY GFYCFTA LT+ YTNNTTRAG+SR DQ YASYP GTE
Sbjct  1    MMILDVCNEILKIQKLRWVVSYVGFYCFTAALTFFYTNNTTRAGFSRGDQFYASYP-GTE  59

Query  492  LLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHL  337
            LLTD +KLYK AL NC+E E+WGP+E+ IMAKHFERQGKSPY YH+    +L
Sbjct  60   LLTDTAKLYKEALRNCYESEDWGPVEFCIMAKHFERQGKSPYVYHSVCFLNL  111



>gb|EYU42780.1| hypothetical protein MIMGU_mgv1a023382mg, partial [Erythranthe 
guttata]
Length=88

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -2

Query  552  TRAGYSRADQLYASYPAGTELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKS  373
            TRAGYSRADQ YASYPAGTELLTDQ+KLYK AL NCFE EEWGPIEWSI+AKHFERQGKS
Sbjct  1    TRAGYSRADQFYASYPAGTELLTDQAKLYKAALGNCFELEEWGPIEWSILAKHFERQGKS  60

Query  372  PYAYHAQYMAHLISNGQIDGSG  307
            PYAYH QYMAHL S G +DGSG
Sbjct  61   PYAYHGQYMAHLASQGLLDGSG  82



>ref|XP_007225818.1| hypothetical protein PRUPE_ppa013429mg [Prunus persica]
 gb|EMJ27017.1| hypothetical protein PRUPE_ppa013429mg [Prunus persica]
Length=102

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -2

Query  552  TRAGYSRADQLYASYPAGTELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKS  373
            TRAG+SR DQ YASYPAGTELLTD +KLYK AL NCFE EEWGPIE+ IMAKHFERQGK+
Sbjct  21   TRAGFSRGDQFYASYPAGTELLTDTAKLYKAALGNCFENEEWGPIEYCIMAKHFERQGKT  80

Query  372  PYAYHAQYMAHLISNGQIDGSG  307
            PYAYHAQYMAHL+S+GQ+DGSG
Sbjct  81   PYAYHAQYMAHLLSHGQLDGSG  102



>ref|XP_010058523.1| PREDICTED: uncharacterized protein LOC104446360 [Eucalyptus grandis]
Length=115

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 84/115 (73%), Gaps = 12/115 (10%)
 Frame = -2

Query  615  VSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKLYKVALANCFEE  436
            + Y+ FY F  +L+Y +TNNTTRAGYSR DQ YA+YPAGTELL D  KLYK AL NCFE 
Sbjct  1    MGYSVFYYFIVVLSYAHTNNTTRAGYSRGDQHYAAYPAGTELLGDSDKLYKAALGNCFEA  60

Query  435  EEWGPIEWSIMAKHFERQGKSPYAYHA------------QYMAHLISNGQIDGSG  307
            EEWGP+E+ IM+  FERQGK+ YAYHA            QY+AHL+S GQ++GSG
Sbjct  61   EEWGPLEFCIMSNLFERQGKASYAYHAVSDWLPKCRLRRQYVAHLLSLGQLNGSG  115



>ref|XP_001768861.1| predicted protein [Physcomitrella patens]
 gb|EDQ66414.1| predicted protein [Physcomitrella patens]
Length=132

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -2

Query  645  ILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTELLTDQSKLY  466
            I +I+K +R + Y G Y   A +TY YTN +TRAG  R +Q Y+SYPAG ++L D ++LY
Sbjct  20   IWEIRKVQRGLRYGGLYVLFAGVTYFYTNISTRAGVPRINQTYSSYPAGVDILFDATELY  79

Query  465  KVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHAQYMAHLISNGQIDG  313
            K A+ N FEE++WGP+E++IMAKHF+RQGK+PY YH+QYM HL+++GQ++G
Sbjct  80   KSAIGNVFEEDDWGPLEYAIMAKHFDRQGKTPYMYHSQYMTHLLTSGQLNG  130



>gb|KCW73154.1| hypothetical protein EUGRSUZ_E01608, partial [Eucalyptus grandis]
Length=105

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 81/107 (76%), Gaps = 3/107 (3%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFR-RVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGT  496
            M + EG+ +I KIQKF+ R + Y+ FY F  +L+Y +TNNT  AGYSR DQ YA+YPAGT
Sbjct  1    MMVYEGFKDIHKIQKFKSRFMGYSVFYYFIVVLSYAHTNNT--AGYSRGDQHYAAYPAGT  58

Query  495  ELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHFERQGKSPYAYHA  355
            ELL D  KLYK AL NCFE EEWGP+E+ IM+  FERQGK+ YAYHA
Sbjct  59   ELLGDSDKLYKAALGNCFEAEEWGPLEFCIMSNLFERQGKASYAYHA  105



>gb|KCW86216.1| hypothetical protein EUGRSUZ_B02904 [Eucalyptus grandis]
Length=95

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 1/95 (1%)
 Frame = -2

Query  672  MWLLEGWLEILKIQKFRRVVSYTGFYCFTALLTYMYTNNTTRAGYSRADQLYASYPAGTE  493
            M + EG+ +IL+IQKFRR V Y+ F+CF A+++Y+Y NNTTRAGYSR DQ YA+Y AG E
Sbjct  1    MMVYEGFKDILQIQKFRRFVGYSVFHCFIAVVSYVYKNNTTRAGYSRRDQYYAAYTAGIE  60

Query  492  LLTDQSKLY-KVALANCFEEEEWGPIEWSIMAKHF  391
            LL D  K++ + AL NCFE EEWG  E+ IM+KHF
Sbjct  61   LLGDSYKVFVQAALGNCFEAEEWGSTEFCIMSKHF  95



>ref|NP_001172456.1| Os01g0606050 [Oryza sativa Japonica Group]
 dbj|BAH91186.1| Os01g0606050 [Oryza sativa Japonica Group]
Length=115

 Score =   119 bits (299),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/85 (68%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -2

Query  570  MYTNNTTRAGYSRADQLYASYPAGTELLTDQSKLYKVALANCFEEEEWGPIEWSIMAKHF  391
            ++  + TRAG SR DQ YASYPAGTELLTD +KLYK AL NCFE ++WGPIE+SIMAKHF
Sbjct  30   VWDKSKTRAGISRGDQFYASYPAGTELLTDTAKLYKAALGNCFEIDDWGPIEFSIMAKHF  89

Query  390  ERQGKSPYAYHAQYMAHLISNGQID  316
            +RQGK PYAYHA  +  L  N QID
Sbjct  90   DRQGKPPYAYHAM-LPPLRCNVQID  113



>tpg|DAA39893.1| TPA: hypothetical protein ZEAMMB73_811407 [Zea mays]
Length=121

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 2/37 (5%)
 Frame = -2

Query  495  ELLTDQSKLYKVALANCFE--EEEWGPIEWSIMAKHF  391
            +L+T+  KLYK  L NCFE  E +WGPIE+SI AKHF
Sbjct  83   QLVTNTVKLYKATLGNCFEIAEWDWGPIEFSITAKHF  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2496906446688