BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27009_g1_i1 len=2050 path=[2028:0-2049]

Length=2050
                                                                      Score     E

ref|XP_009607703.1|  PREDICTED: uncharacterized protein LOC104101873    302   4e-91   
ref|XP_009767786.1|  PREDICTED: uncharacterized protein LOC104218862    281   3e-83   
ref|XP_006348833.1|  PREDICTED: uncharacterized serine-rich prote...    265   2e-77   
emb|CDP15879.1|  unnamed protein product                                259   4e-75   
ref|XP_011100235.1|  PREDICTED: uncharacterized protein LOC105178...    240   4e-68   
ref|XP_011100237.1|  PREDICTED: uncharacterized protein LOC105178...    239   8e-68   
ref|XP_004243389.1|  PREDICTED: uncharacterized protein LOC101255214    235   2e-66   
ref|XP_011100238.1|  PREDICTED: uncharacterized protein LOC105178...    216   3e-59   
ref|XP_007043708.1|  Uncharacterized protein isoform 2                  196   1e-51   
ref|XP_008232052.1|  PREDICTED: uncharacterized protein LOC103331215    191   5e-50   
emb|CBI21908.3|  unnamed protein product                                187   2e-48   
ref|XP_010657010.1|  PREDICTED: uncharacterized protein LOC100242390    186   3e-48   
ref|XP_007043707.1|  Uncharacterized protein isoform 1                  186   1e-47   
ref|XP_010260341.1|  PREDICTED: uncharacterized protein LOC104599...    181   2e-46   
gb|KDO49568.1|  hypothetical protein CISIN_1g012781mg                   175   2e-44   
ref|XP_008394101.1|  PREDICTED: uncharacterized protein LOC103456213    173   3e-44   
ref|XP_009355767.1|  PREDICTED: uncharacterized protein LOC103946718    172   6e-44   
ref|XP_006469074.1|  PREDICTED: lisH domain-containing protein C1...    173   9e-44   
ref|XP_009346179.1|  PREDICTED: uncharacterized protein LOC103937923    172   1e-43   
ref|XP_002517843.1|  conserved hypothetical protein                     172   1e-43   Ricinus communis
ref|XP_006469075.1|  PREDICTED: lisH domain-containing protein C1...    172   1e-43   
gb|KDO49569.1|  hypothetical protein CISIN_1g012781mg                   171   4e-43   
ref|XP_007221034.1|  hypothetical protein PRUPE_ppa015217mg             169   4e-43   
gb|KDO49570.1|  hypothetical protein CISIN_1g012781mg                   170   1e-42   
gb|KDP24072.1|  hypothetical protein JCGZ_25729                         169   2e-42   
ref|XP_006372766.1|  hypothetical protein POPTR_0017s04850g             166   3e-41   
ref|XP_010260342.1|  PREDICTED: uncharacterized protein LOC104599...    165   3e-41   
ref|XP_006592445.1|  PREDICTED: uncharacterized protein LOC102660628    165   4e-41   
ref|XP_004287059.1|  PREDICTED: uncharacterized protein LOC101291364    159   2e-39   
ref|XP_010093966.1|  hypothetical protein L484_010532                   154   3e-37   
gb|KGN43477.1|  hypothetical protein Csa_7G039250                       152   6e-37   
ref|XP_008455489.1|  PREDICTED: uncharacterized protein LOC103495640    152   6e-37   
ref|XP_010522583.1|  PREDICTED: uncharacterized protein LOC104801157    152   1e-36   
ref|XP_011043605.1|  PREDICTED: uncharacterized protein LOC105139...    153   1e-36   
ref|XP_010494418.1|  PREDICTED: uncharacterized protein LOC104771572    144   3e-34   
gb|KHF99833.1|  Phosphorelay luxU                                       144   5e-34   
ref|XP_006446713.1|  hypothetical protein CICLE_v10015198mg             144   8e-34   
ref|XP_006403135.1|  hypothetical protein EUTSA_v10003234mg             142   1e-33   
ref|XP_007134956.1|  hypothetical protein PHAVU_010G089800g             142   4e-33   
ref|XP_003526252.1|  PREDICTED: uncharacterized protein LOC100790093    142   5e-33   
emb|CDY36980.1|  BnaC09g17960D                                          137   6e-32   
gb|AFK34852.1|  unknown                                                 133   9e-32   
ref|XP_010481773.1|  PREDICTED: uncharacterized protein LOC104760528    135   4e-31   
gb|AES89714.2|  hypothetical protein MTR_4g079100                       133   4e-30   
ref|XP_002863607.1|  predicted protein                                  130   2e-29   
ref|NP_199228.2|  uncharacterized protein                               128   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961216.1|  PREDICTED: uncharacterized protein LOC101773758    129   1e-28   
dbj|BAB10982.1|  unnamed protein product                                127   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ22611.1|  At5g44150                                               126   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004505535.1|  PREDICTED: uncharacterized protein LOC101496234    127   4e-28   
ref|XP_006281830.1|  hypothetical protein CARUB_v10028019mg             126   6e-28   
ref|XP_010445873.1|  PREDICTED: uncharacterized protein LOC104728610    126   7e-28   
gb|EPS58931.1|  hypothetical protein M569_15881                         117   2e-25   
ref|XP_002441519.1|  hypothetical protein SORBIDRAFT_09g028510          117   1e-24   Sorghum bicolor [broomcorn]
gb|EEE64698.1|  hypothetical protein OsJ_19553                          117   1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010689778.1|  PREDICTED: uncharacterized protein LOC104903441    117   1e-24   
gb|EEC79700.1|  hypothetical protein OsI_20989                          112   3e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_010919192.1|  PREDICTED: uncharacterized protein LOC105043...    113   5e-23   
ref|XP_009113938.1|  PREDICTED: uncharacterized protein LOC103839198    110   8e-23   
ref|XP_010919199.1|  PREDICTED: uncharacterized protein LOC105043...    112   8e-23   
ref|XP_008649998.1|  PREDICTED: uncharacterized protein LOC103630731    110   2e-22   
emb|CDY13120.1|  BnaA09g16970D                                          108   5e-22   
ref|XP_008352186.1|  PREDICTED: uncharacterized protein LOC103415657    103   4e-21   
ref|XP_009416534.1|  PREDICTED: uncharacterized protein LOC103997114    107   4e-21   
ref|XP_003567895.1|  PREDICTED: uncharacterized protein LOC100821400  96.3    1e-17   
ref|XP_004144603.1|  PREDICTED: uncharacterized protein LOC101207509  92.0    4e-17   
dbj|BAJ98196.1|  predicted protein                                    94.0    6e-17   
gb|ADE77785.1|  unknown                                               94.4    6e-17   
ref|XP_006654788.1|  PREDICTED: uncharacterized protein LOC102721553  90.9    2e-16   
ref|XP_006852570.1|  hypothetical protein AMTR_s00021p00206430        86.7    3e-15   
emb|CAN60169.1|  hypothetical protein VITISV_003665                   85.9    4e-14   Vitis vinifera
gb|EYU42151.1|  hypothetical protein MIMGU_mgv11b019228mg             75.5    2e-12   
ref|XP_011043606.1|  PREDICTED: uncharacterized protein LOC105139...  79.3    3e-12   
ref|XP_011047711.1|  PREDICTED: uncharacterized protein LOC105141...  74.7    4e-12   
ref|XP_004163436.1|  PREDICTED: uncharacterized LOC101207509          74.7    2e-11   
ref|XP_004173052.1|  PREDICTED: uncharacterized LOC101207751          69.7    3e-10   
ref|XP_004144604.1|  PREDICTED: uncharacterized protein LOC101207751  67.4    2e-09   
gb|EYU42153.1|  hypothetical protein MIMGU_mgv1a0148261mg             67.4    2e-09   
ref|XP_003607517.1|  Lysine-specific histone demethylase-like pro...  67.4    2e-08   
gb|EMS51945.1|  hypothetical protein TRIUR3_03632                     57.4    3e-05   
gb|EMT17991.1|  hypothetical protein F775_17565                       54.7    1e-04   
ref|XP_006852572.1|  hypothetical protein AMTR_s00021p00206960        51.6    6e-04   



>ref|XP_009607703.1| PREDICTED: uncharacterized protein LOC104101873 [Nicotiana tomentosiformis]
Length=436

 Score =   302 bits (773),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 218/457 (48%), Positives = 285/457 (62%), Gaps = 43/457 (9%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaST-GDKKQSGKQVKEKPVQGHGSR  1721
             MDAK+LAKSKRAHSLH +KK+  HH+SKG+S+    ST GDKK + KQVKEKP       
Sbjct  1     MDAKALAKSKRAHSLHLNKKHNPHHASKGSSAGSGTSTAGDKKPTEKQVKEKP-----KS  55

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLY  1541
              LPSNW RY    EEEY  DSE   PQ   S+A +DVV PKSKGADYAYL+SEA+A   Y
Sbjct  56    KLPSNWHRY----EEEYDSDSET-APQGGASRA-SDVVVPKSKGADYAYLLSEAQAHFQY  109

Query  1540  SSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLH  1361
             SS  S+PL+DDVL DFYQGLG LLS KGQS  S I++DNF  EDK PPP +ASFLSL+LH
Sbjct  110   SS-ESIPLYDDVLDDFYQGLGALLSAKGQSKLSWIAEDNFAMEDKAPPPTKASFLSLDLH  168

Query  1360  TLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQ----AKNKAGVAEE-------  1214
              L+EQL +A+LSERLFIEPDLLP E C+E  Q  +E +     + +K+  AE+       
Sbjct  169   ALSEQLERASLSERLFIEPDLLPLEPCSEASQAAAEEKCQGGLSSSKSSTAEKDSNSLTS  228

Query  1213  --VFDSSAHRNGSEESGSMHQYLRSPYN--TAGtstssstSARDEILQAKGIGQTDLPRY  1046
               V++ + +R+   E   +     S ++  +A  S+++ +   DE  +++G G  D    
Sbjct  229   TSVYEGNKNRHQHSEFSHLGTTASSSWHPTSADESSNALSVYEDEAGKSEGAGINDSLLC  288

Query  1045  TPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSS  866
               E+N ++  KKP  F+  +AEAELDMLL S  E +  ES            + Q+    
Sbjct  289   ASELNTSSVVKKPFAFKSTAAEAELDMLLDSVTEIEISESTNA---------IDQSSTPC  339

Query  865   SFSERGS---LSQKVPTRSDVTDP---DPGLGGTAARDMKLDDIVDDLLRETSILTNKNE  704
             S ++ G+   L +   +RS+V+     D  L   A  D+ LDD  DDLLRETS +TNKN+
Sbjct  340   SVAQAGTPTPLLEGTSSRSEVSSQPKRDHDLAKPAISDLGLDDSPDDLLRETSTVTNKND  399

Query  703   GSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             G   +E  S   +TPS+S PV+KSK+ DDFDSWFDT+
Sbjct  400   GLPSNEVNSNAGHTPSASQPVSKSKIMDDFDSWFDTL  436



>ref|XP_009767786.1| PREDICTED: uncharacterized protein LOC104218862 [Nicotiana sylvestris]
Length=435

 Score =   281 bits (720),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 287/457 (63%), Gaps = 44/457 (10%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknq-qhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR  1721
             MDAK+LAKSKRAHSLH +KK+   H S   ++   +++TGDKK + KQVKEKP       
Sbjct  1     MDAKALAKSKRAHSLHLNKKHNPHHASKASSAGSGASTTGDKKPTVKQVKEKP-----KS  55

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLY  1541
              LPSNWDRY    EEEY  DSEN  PQ   +KA +DVV PKSKGADYAYL+SEA+AQ  Y
Sbjct  56    KLPSNWDRY----EEEYASDSEN-APQGGANKA-SDVVVPKSKGADYAYLLSEAQAQFQY  109

Query  1540  SSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLH  1361
             SS  S+PL+DDVL DFYQGLG LLS K QS  S I++DNF  EDK PPP +ASFLSL+LH
Sbjct  110   SS-ESIPLYDDVLDDFYQGLGALLSAKRQSKLSWIAEDNFAMEDKAPPPSKASFLSLDLH  168

Query  1360  TLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQ----AKNKAGVAEE-------  1214
              L+EQL +A+LSERLFIEPDLLP E C E  Q  +E ++    + +K+  AE+       
Sbjct  169   ALSEQLERASLSERLFIEPDLLPLEPCAEASQAAAEEKRQGGLSSSKSSTAEKDSNSLTS  228

Query  1213  --VFDSSAHRNGSEESGSMHQYLRSPYN--TAGtstssstSARDEILQAKGIGQTDLPRY  1046
               V++ + +R+   E   +     S ++  +A   ++  ++  DE  +++G G  D    
Sbjct  229   TSVYEGNKNRHQHSEFSHLGTTTGSSWHPTSADEPSNPLSAYGDEAGKSEGAGINDSLLC  288

Query  1045  TPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSS  866
               E+N ++ AKKP+ F+  +AEAELDMLL S +E +  ES    ++S             
Sbjct  289   ASELNTSSVAKKPSAFKATAAEAELDMLLDSVSEIEIFESTNAIDQS----------SPC  338

Query  865   SFSERGS---LSQKVPTRS-DVTDP--DPGLGGTAARDMKLDDIVDDLLRETSILTNKNE  704
             S ++ G+   LS+   +RS D + P  D  L   A  D+ LDD +DDLLRETS +TNKN+
Sbjct  339   SVAQAGTPTPLSEGTSSRSEDSSQPKRDHDLAKPAISDLSLDDSLDDLLRETSTVTNKND  398

Query  703   GSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             G   +E  S   +T S+S PV+KSK+ DDFDSWFDT+
Sbjct  399   GLPSNEVNSTAGHTASASQPVSKSKIMDDFDSWFDTL  435



>ref|XP_006348833.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006348834.1| PREDICTED: uncharacterized serine-rich protein C215.13-like isoform 
X2 [Solanum tuberosum]
Length=416

 Score =   265 bits (678),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 211/442 (48%), Positives = 270/442 (61%), Gaps = 33/442 (7%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHSLH +KK+  HH+SKG+S+V   S GDKK + KQVKEKP        
Sbjct  1     MDAKALAKSKRAHSLHLNKKHNPHHASKGSSAVSGTSVGDKKATVKQVKEKP-----KPK  55

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY EE       DSE   P  + +  A+DVV PKSKGADYAYL+SEAK Q  YS
Sbjct  56    LPSNWDRYEEENS-----DSETATPAGASN--ASDVVEPKSKGADYAYLLSEAKDQLQYS  108

Query  1537  SSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLHT  1358
             S   V   DD+L DFYQGLG LLS KGQS  S I+++NF  EDK PPP +ASFLSL+L  
Sbjct  109   S-EDVSFGDDILDDFYQGLGALLSAKGQSKLSWIAEENFAMEDKAPPPTKASFLSLDLQA  167

Query  1357  LAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQ----AKNKAGVAEEVFDSSAHR  1190
             L+EQL +A L ERLFIEPDLLP  L  +E Q  ++ +     A +K+  AE+ F+S    
Sbjct  168   LSEQLERARLQERLFIEPDLLPLVLSDQESQSAAKEKHDGDLASSKSSTAEKDFNSLTST  227

Query  1189  NGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAAKK  1010
             N S E+   H +L +  +++   T +  S+          GQ D         +   +KK
Sbjct  228   NKSNENRHQHSHLGTTSSSSRHPTLAYESSNPSTAFKDEAGQND--------TLMCVSKK  279

Query  1009  PAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKV  830
             P+ F+ A+AEAELDMLL S  E +  ES  V ++S     +TQ    +  +E  S +++V
Sbjct  280   PSAFKAAAAEAELDMLLDSVTEIEICESTNVIDQSIRPYPVTQAGTPTPLAEGTSSTREV  339

Query  829   ---PTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTP  659
                P R     P P +      D+ LDD +DDLL+ETS +TNKNE SL  E  S   +TP
Sbjct  340   STQPRRGHDLLPTPAIS-----DISLDDTLDDLLKETSTVTNKNEHSLPTEVSSIAGHTP  394

Query  658   SSSNPVTKSKLTDDFDSWFDTI  593
             S+S PV+KSK+ DDFDSWFDT+
Sbjct  395   SASQPVSKSKIIDDFDSWFDTL  416



>emb|CDP15879.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   259 bits (662),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 204/443 (46%), Positives = 267/443 (60%), Gaps = 41/443 (9%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHSLHHSKK+    +SK   S  ++S+G KK + KQ ++KP Q   S+ 
Sbjct  1     MDAKALAKSKRAHSLHHSKKHHSSPTSKATPSSATSSSG-KKPTNKQARDKPYQSQSSKA  59

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS-LY  1541
             LP+NWDRY    EEEYG  SE+  PQ S  +A +DVV PKSKGADYAYLISEAKAQS   
Sbjct  60    LPTNWDRY----EEEYGSGSEDS-PQVSTGQA-SDVVVPKSKGADYAYLISEAKAQSQAN  113

Query  1540  SSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLH  1361
             SSS S  LFDD L  F QGLG LLSV+G+ + S IS+D F  +DKG    EASFLSLNLH
Sbjct  114   SSSESFSLFDDFLDGFNQGLGSLLSVRGEHLLSRISNDVFPFDDKGTSSHEASFLSLNLH  173

Query  1360  TLAEQLAKATLSERLFIEPDLLPPELCTE---ELQKLSENEQAKNKAGVAEEVFDSSAHR  1190
             +LAEQL+KA L+ERLFIEPDLLPPE+CTE     +K  +  QA       E  F      
Sbjct  174   SLAEQLSKANLAERLFIEPDLLPPEMCTELDANNEKNPDELQATGSTEATESEFAGQPSS  233

Query  1189  NGSEESGSM---HQYLRSPYNTAGtstssstSARDEIL-QAKGIGQTDLPRYTPEINVNT  1022
               S+E+ ++    +Y+ S  N++  S  S  ++ D      K I ++   + T  +++++
Sbjct  234   IISKENRNILLSQEYMSS--NSSRVSQFSVPTSTDHRADDLKEISRSTSVKLTSGVSIDS  291

Query  1021  AAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSL  842
             +++KP++FE A AEAELDMLL SF ETKF +S                        +GS 
Sbjct  292   SSEKPSRFEAAKAEAELDMLLDSFGETKFFDS------------------------KGST  327

Query  841   SQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNT  662
              Q V   +      P    +   D  LDD +DD+L++TS L N    S  +E ++A    
Sbjct  328   FQSVSVAAQHVREGPDATYSGRMDAALDDSLDDILKDTSHLINTKAVSPLNEVKAASNEG  387

Query  661   PSSSNPVTKSKLTDDFDSWFDTI  593
             P++S P +KSK+ DDFDSW DTI
Sbjct  388   PTASQPHSKSKILDDFDSWLDTI  410



>ref|XP_011100235.1| PREDICTED: uncharacterized protein LOC105178465 isoform X1 [Sesamum 
indicum]
 ref|XP_011100236.1| PREDICTED: uncharacterized protein LOC105178465 isoform X1 [Sesamum 
indicum]
Length=425

 Score =   240 bits (613),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 197/454 (43%), Positives = 254/454 (56%), Gaps = 59/454 (13%)
 Frame = -1

Query  1900  KMDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR  1721
             KMD K+LAKSKRAHSLHHSKK+  + +SK ASS     +GDKK  GKQ KEKP Q HG+R
Sbjct  13    KMDMKALAKSKRAHSLHHSKKHHPNPASKAASSS----SGDKKPVGKQAKEKPAQSHGAR  68

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLY  1541
              LPSNWDRY     E+    SE+     + S   T+ V PKSKGADY +LISEA AQS  
Sbjct  69    PLPSNWDRY----NEDSDVGSEDTA--GTSSSQPTEFVMPKSKGADYGHLISEATAQSEA  122

Query  1540  S-SSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNL  1364
             + SS  + LFDDV+HDF Q  GP+L+ KGQSI S I+DD+F  E K     EA FLSLNL
Sbjct  123   NYSSDVLSLFDDVIHDFTQDFGPMLAAKGQSILSWIADDSFEFESKTSSNFEAPFLSLNL  182

Query  1363  HTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAHRNG  1184
             + LAEQL KA LSERLF+EPDLLPPEL  +E Q   E+  ++    +     D+     G
Sbjct  183   NALAEQLGKAKLSERLFLEPDLLPPELLGDESQACGEDNDSQTAVAI-----DTGTSTLG  237

Query  1183  SEESGSMH-QYLRSP---YNTAGtstssstSA-------RDEILQAKGIGQTDLPRYTPE  1037
              ++ GS + +  R P     T+G  +  ++         +++  Q++G  ++       E
Sbjct  238   YKQEGSKNFEQFREPSSFTTTSGNLSVQTSEGLKAIKQIKEDTFQSQGNYRSISSNPISE  297

Query  1036  INVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFS  857
               V++ +  P  FE ASAEAELDMLL SF E K L S+           L+    S+   
Sbjct  298   RIVDSTSGNPPIFEAASAEAELDMLLSSFNEAKLLGSSSAAS----TGILSTAAASAETL  353

Query  856   ERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARS  677
             ++G         +D+  P       A   + + D +DDLL ETS L  K EG      R 
Sbjct  354   KKG---------TDIMKP-------ATTPVDVYDGIDDLLEETSHLI-KTEGK-----RP  391

Query  676   AFRNTP------SSSNPVTKSKLTDDFDSWFDTI  593
             +   TP      S+ NP +KSKL DDFDSW DTI
Sbjct  392   SQMVTPSPDDISSAMNPTSKSKLLDDFDSWLDTI  425



>ref|XP_011100237.1| PREDICTED: uncharacterized protein LOC105178465 isoform X2 [Sesamum 
indicum]
Length=412

 Score =   239 bits (610),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 196/453 (43%), Positives = 253/453 (56%), Gaps = 59/453 (13%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD K+LAKSKRAHSLHHSKK+  + +SK ASS     +GDKK  GKQ KEKP Q HG+R 
Sbjct  1     MDMKALAKSKRAHSLHHSKKHHPNPASKAASSS----SGDKKPVGKQAKEKPAQSHGARP  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY     E+    SE+     + S   T+ V PKSKGADY +LISEA AQS  +
Sbjct  57    LPSNWDRY----NEDSDVGSEDTA--GTSSSQPTEFVMPKSKGADYGHLISEATAQSEAN  110

Query  1537  -SSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLH  1361
              SS  + LFDDV+HDF Q  GP+L+ KGQSI S I+DD+F  E K     EA FLSLNL+
Sbjct  111   YSSDVLSLFDDVIHDFTQDFGPMLAAKGQSILSWIADDSFEFESKTSSNFEAPFLSLNLN  170

Query  1360  TLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAHRNGS  1181
              LAEQL KA LSERLF+EPDLLPPEL  +E Q   E+  ++    +     D+     G 
Sbjct  171   ALAEQLGKAKLSERLFLEPDLLPPELLGDESQACGEDNDSQTAVAI-----DTGTSTLGY  225

Query  1180  EESGSMH-QYLRSP---YNTAGtstssstSA-------RDEILQAKGIGQTDLPRYTPEI  1034
             ++ GS + +  R P     T+G  +  ++         +++  Q++G  ++       E 
Sbjct  226   KQEGSKNFEQFREPSSFTTTSGNLSVQTSEGLKAIKQIKEDTFQSQGNYRSISSNPISER  285

Query  1033  NVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSE  854
              V++ +  P  FE ASAEAELDMLL SF E K L S+           L+    S+   +
Sbjct  286   IVDSTSGNPPIFEAASAEAELDMLLSSFNEAKLLGSSSAAS----TGILSTAAASAETLK  341

Query  853   RGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSA  674
             +G         +D+  P       A   + + D +DDLL ETS L  K EG      R +
Sbjct  342   KG---------TDIMKP-------ATTPVDVYDGIDDLLEETSHLI-KTEGK-----RPS  379

Query  673   FRNTP------SSSNPVTKSKLTDDFDSWFDTI  593
                TP      S+ NP +KSKL DDFDSW DTI
Sbjct  380   QMVTPSPDDISSAMNPTSKSKLLDDFDSWLDTI  412



>ref|XP_004243389.1| PREDICTED: uncharacterized protein LOC101255214 [Solanum lycopersicum]
Length=399

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 202/439 (46%), Positives = 258/439 (59%), Gaps = 44/439 (10%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHSLH +KK+  HH+SKG+S+V   S GDKK + KQVKEKP        
Sbjct  1     MDAKALAKSKRAHSLHLNKKHNPHHASKGSSAVSGTSAGDKKVTVKQVKEKP-----KPK  55

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY     EE   DSE   P  + +  A+DVV P+SKGADYAYL+SEAK Q L  
Sbjct  56    LPSNWDRY-----EEENSDSETATPAGASN--ASDVVEPRSKGADYAYLLSEAKDQ-LQF  107

Query  1537  SSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLHT  1358
             SS  V   DD+L DFYQGLG LLS KGQS +S I++DNF  EDK PPP +ASFLSL+L  
Sbjct  108   SSEDVSFGDDILDDFYQGLGALLSAKGQSKSSWIAEDNFAMEDKAPPPTKASFLSLDLQA  167

Query  1357  LAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQ----AKNKAGVAEEVFDSSAHR  1190
             L+EQL +A+L ERLFIEPDLLP  L  +E Q  ++ +     A +K+  AE+  +S    
Sbjct  168   LSEQLERASLQERLFIEPDLLPLVLNDQESQSAAKEKHDSDLASSKSSTAEKDSNSLTST  227

Query  1189  NGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAAKK  1010
             N S E+     +L +  N +   T +  S+          GQ D         +   +KK
Sbjct  228   NKSNENRHQDSHLGTTSNNSRHPTLADESSNPSTASKDEAGQND--------TLMCVSKK  279

Query  1009  PAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKV  830
             P+ F+ A+AEAELDMLL S  E +  ES  V ++S      TQ    +  SE  +     
Sbjct  280   PSAFKAAAAEAELDMLLDSVTEIEICESTNVIDQSIRPFPATQAGTPTPLSEVST----Q  335

Query  829   PTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSS  650
             P R D   P P +      D+ LDD +DDLL+ETSI+T         +  S   +  S+S
Sbjct  336   PKR-DHDQPKPAIS-----DISLDDTLDDLLKETSIVT---------KVSSTAGHASSAS  380

Query  649   NPVTKSKLTDDFDSWFDTI  593
              PV+KSK+ DDFDSWFDT+
Sbjct  381   QPVSKSKIIDDFDSWFDTL  399



>ref|XP_011100238.1| PREDICTED: uncharacterized protein LOC105178465 isoform X3 [Sesamum 
indicum]
Length=400

 Score =   216 bits (549),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 178/412 (43%), Positives = 232/412 (56%), Gaps = 48/412 (12%)
 Frame = -1

Query  1900  KMDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR  1721
             KMD K+LAKSKRAHSLHHSKK+  + +SK ASS     +GDKK  GKQ KEKP Q HG+R
Sbjct  13    KMDMKALAKSKRAHSLHHSKKHHPNPASKAASSS----SGDKKPVGKQAKEKPAQSHGAR  68

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLY  1541
              LPSNWDRY     E+    SE+     + S   T+ V PKSKGADY +LISEA AQS  
Sbjct  69    PLPSNWDRY----NEDSDVGSEDTA--GTSSSQPTEFVMPKSKGADYGHLISEATAQSEA  122

Query  1540  S-SSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNL  1364
             + SS  + LFDDV+HDF Q  GP+L+ KGQSI S I+DD+F  E K     EA FLSLNL
Sbjct  123   NYSSDVLSLFDDVIHDFTQDFGPMLAAKGQSILSWIADDSFEFESKTSSNFEAPFLSLNL  182

Query  1363  HTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAHRNG  1184
             + LAEQL KA LSERLF+EPDLLPPEL  +E Q   E+  ++    +     D+     G
Sbjct  183   NALAEQLGKAKLSERLFLEPDLLPPELLGDESQACGEDNDSQTAVAI-----DTGTSTLG  237

Query  1183  SEESGSMH-QYLRSP---YNTAGtstssstSA-------RDEILQAKGIGQTDLPRYTPE  1037
              ++ GS + +  R P     T+G  +  ++         +++  Q++G  ++       E
Sbjct  238   YKQEGSKNFEQFREPSSFTTTSGNLSVQTSEGLKAIKQIKEDTFQSQGNYRSISSNPISE  297

Query  1036  INVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFS  857
               V++ +  P  FE ASAEAELDMLL SF E K L S+           L+    S+   
Sbjct  298   RIVDSTSGNPPIFEAASAEAELDMLLSSFNEAKLLGSSSAAS----TGILSTAAASAETL  353

Query  856   ERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEG  701
             ++G         +D+  P       A   + + D +DDLL ETS L  K EG
Sbjct  354   KKG---------TDIMKP-------ATTPVDVYDGIDDLLEETSHLI-KTEG  388



>ref|XP_007043708.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007043709.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX99539.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX99540.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=465

 Score =   196 bits (499),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 179/475 (38%), Positives = 250/475 (53%), Gaps = 50/475 (11%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS HHSKK       K      + +   KKQ+GKQ++EK  Q      
Sbjct  1     MDAKALAKSKRAHSQHHSKKPHSSQKPKPPLVGGNDAANAKKQTGKQIREKTHQAQRVSA  60

Query  1717  LPSNWDRY---VeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
             LPSNWD Y    + G E+   DS + VP         DVV PKSKGAD+ +LI+EA++Q 
Sbjct  61    LPSNWDHYEEEFDSGSEDQSGDSTSQVP---------DVVLPKSKGADFHHLIAEAQSQ-  110

Query  1546  LYSSSHSVPLF--DDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFL  1376
             L S+ ++  L   DD+L  DF Q +G +LSV+G+ I S I +DNF  ED+      ASFL
Sbjct  111   LESNPYTDSLCSSDDILPGDFNQFVGIMLSVRGEGILSLIQNDNFVVEDRTTATHAASFL  170

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTE--------ELQKLSENEQAKNKAGVA  1220
             SLNLH LAEQL K  LSERLFIE DLL PEL  E        E  ++    + K  A + 
Sbjct  171   SLNLHALAEQLEKVNLSERLFIEEDLLSPELHAEGSKANSNQESDQMQTTSEGKAAAQIT  230

Query  1219  EEVF--DSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEIL------QAKGIGQ  1064
             EE+   DS+   N + ++     +     +   T ++    + DE+       Q    G+
Sbjct  231   EELTLNDSTDKVNIAAKNVEHISFSSGSKSVDATLSNEGLDSVDEVYSDFISSQRDKSGK  290

Query  1063  TDLPRYTPEINVNTAA---KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNS  893
             +     +   N N+A+   KK + FE  +AEAELDMLL SF+ETK L+S+ +  +   N 
Sbjct  291   SRALESSTHDNSNSASVPNKKVSTFEAVAAEAELDMLLNSFSETKLLDSSGLKTQKSSND  350

Query  892   FLTQNDVS-SSFSERG--SLSQKVPTRSDV----------TDPDPGLGGTAARDMKLDDI  752
             + T+   S +  + +G  S ++     S V          T      G  +++   +   
Sbjct  351   YYTEGSPSLAQLARKGDDSSNKSAGVNSSVDDLLDDLLKETSTMVNQGVDSSKSAAVTST  410

Query  751   VDDLLRETSILTNKNEGSLGDEARSA--FRNTPSSSNPVTKSKLTDDFDSWFDTI  593
              DDLL+ETS L N+N  S   + ++A     + SSS+ V K K+ +DFDSW DTI
Sbjct  411   FDDLLQETSTLVNRNGLSRHTDVKAAQDSGQSSSSSHSVPKPKVLNDFDSWLDTI  465



>ref|XP_008232052.1| PREDICTED: uncharacterized protein LOC103331215 [Prunus mume]
Length=420

 Score =   191 bits (484),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 174/462 (38%), Positives = 229/462 (50%), Gaps = 69/462 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGD---KKQSGKQVKEKPVQGHG  1727
             MD K+LAKS RAH+  HSKK+  +  +K  +     ++     KK  GKQVKEK    HG
Sbjct  1     MDVKALAKSNRAHAQRHSKKHHPNQKAKAPAVDGGKASDAGPAKKPLGKQVKEKTNPTHG  60

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
             +  LP+NWDRY EE E      + +  P       A DV  P SKGADY +LI+EA+AQS
Sbjct  61    ASALPTNWDRYEEEFE------AGSEEPAGDGLNRAPDVAVPMSKGADYRHLIAEAQAQS  114

Query  1546  -LYSSSHSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLS  1373
              L   S   P  D+VL  D+ +G+G +LSV+G+SI S I DDNF  EDK     E SFLS
Sbjct  115   ELTIYSDPFPSLDNVLPGDWNEGIGSMLSVRGESILSRIGDDNFVVEDKTAAHQEVSFLS  174

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLPPEL-------------------CTEELQKLSEN  1250
             LNLH LAEQL K  L ERLFIE +LLPPEL                   C EE  +   +
Sbjct  175   LNLHALAEQLEKIALPERLFIEAELLPPELHVEGQDVTCSQSSNRMQATCNEEATQGMPH  234

Query  1249  EQAKNKAGVAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGI  1070
             E   +K  VA+   D     +GS  SG     L +  + +    +         +    +
Sbjct  235   ESISDKVQVADH--DIEITISGSTGSGHPDPILPNLGSVSVIQGN---------INPSKL  283

Query  1069  GQTDLPRYTPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSF  890
             G++D      E     + K    FE ++AEAELDMLL SF ETK                
Sbjct  284   GKSDYQSKLSECETQFSVKS---FEASTAEAELDMLLDSFGETKI---------------  325

Query  889   LTQNDVSSSFSERGSLS-QKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTN  713
                ND SS FS   ++S Q+ P  + +  P      +       DD +DDL+ ETS+   
Sbjct  326   ---ND-SSGFSSVKTVSGQEAPFMAPLQLPRKAPDSSVLATANFDDELDDLINETSVQIR  381

Query  712   KNEGSLGDEARSA--FRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             ++  S   + R+   FR++ S     TKS+  DDFDSW DTI
Sbjct  382   QSGPSQAQKERAVHEFRSSHSGG---TKSEEQDDFDSWLDTI  420



>emb|CBI21908.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   187 bits (474),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 191/463 (41%), Positives = 246/463 (53%), Gaps = 60/463 (13%)
 Frame = -1

Query  1900  KMDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR  1721
             KMDAK+LAKSKRAHS HHSK+   + +SK  S+    +   KKQ GKQ++EKP Q  G  
Sbjct  24    KMDAKALAKSKRAHSQHHSKRPHSNKTSKAPSAGNVGAGNAKKQPGKQIREKPHQSMGLS  83

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLY  1541
              LPSNWDRY EE      FDS +  P  + +  A DV+ PKSKGADY  LISEA +QS  
Sbjct  84    RLPSNWDRYEEE------FDSGSEGPSINSTNQANDVIVPKSKGADYGELISEAISQS--  135

Query  1540  SSSHSVPLFD------DVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASF  1379
                 S P FD      DV+ DF QG+G LLSV+GQ I S I D+NF  ED+     EA F
Sbjct  136   ---RSNPYFDSFASLDDVVPDFNQGVGSLLSVRGQGILSWIGDNNFIVEDRATTSHEAPF  192

Query  1378  LSLNLHTLAEQLAKATLSERLFIEPDLLPPEL--CTEELQKLSENEQAKNKAGVAEE---  1214
             LSLNLH+LAEQL K  LS+RLF+E DLL PEL   + E  K+S N++A      +E    
Sbjct  193   LSLNLHSLAEQLTKVDLSQRLFVEEDLLSPELMSVSSEGVKVSSNQEANQMQRTSEGAKI  252

Query  1213  VFDSSAHRNGSEESGSMHQ----------YLRSP-YNTAGtstssstSARDEILQAKGIG  1067
             + D SA R+  E+   + +           +R+P  ++   S  S    +D+  Q     
Sbjct  253   IVDESAVRSFPEKDKIVDKNKEVMSSDTTRIRNPVISSPNQSAKSENQVKDKAKQFGRAA  312

Query  1066  QTDLPRYTPEINVNTAA---KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDN  896
             QT       +IN  + A   KK + FE A+AEAELDMLL SF ET   +S          
Sbjct  313   QTRDLELAAQINKVSVADPEKKQSVFEAAAAEAELDMLLDSFNETNKFDS---------L  363

Query  895   SFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILT  716
              F    +    F ++ S++    +R  VT               LDD +DDLL ETS L 
Sbjct  364   GFKKSRNALPVFQQKPSMTPPQLSRKVVT-------------ANLDDALDDLLEETSNLM  410

Query  715   NKNEGSLGDEAR--SAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             ++N      +A+  S      SSS+    SK+ DDFDSW DTI
Sbjct  411   DQNGTKPPQQAKPTSPGIQCSSSSHSGQGSKVLDDFDSWLDTI  453



>ref|XP_010657010.1| PREDICTED: uncharacterized protein LOC100242390 [Vitis vinifera]
 ref|XP_010657011.1| PREDICTED: uncharacterized protein LOC100242390 [Vitis vinifera]
Length=429

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 189/462 (41%), Positives = 246/462 (53%), Gaps = 60/462 (13%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS HHSK+   + +SK  S+    +   KKQ GKQ++EKP Q  G   
Sbjct  1     MDAKALAKSKRAHSQHHSKRPHSNKTSKAPSAGNVGAGNAKKQPGKQIREKPHQSMGLSR  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY EE      FDS +  P  + +  A DV+ PKSKGADY  LISEA +QS   
Sbjct  61    LPSNWDRYEEE------FDSGSEGPSINSTNQANDVIVPKSKGADYGELISEAISQS---  111

Query  1537  SSHSVPLFD------DVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFL  1376
                S P FD      DV+ DF QG+G LLSV+GQ I S I D+NF  ED+     EA FL
Sbjct  112   --RSNPYFDSFASLDDVVPDFNQGVGSLLSVRGQGILSWIGDNNFIVEDRATTSHEAPFL  169

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPEL--CTEELQKLSENEQAKNKAGVAEE---V  1211
             SLNLH+LAEQL K  LS+RLF+E DLL PEL   + E  K+S N++A      +E    +
Sbjct  170   SLNLHSLAEQLTKVDLSQRLFVEEDLLSPELMSVSSEGVKVSSNQEANQMQRTSEGAKII  229

Query  1210  FDSSAHRNGSEESGSMHQ----------YLRSP-YNTAGtstssstSARDEILQAKGIGQ  1064
              D SA R+  E+   + +           +R+P  ++   S  S    +D+  Q     Q
Sbjct  230   VDESAVRSFPEKDKIVDKNKEVMSSDTTRIRNPVISSPNQSAKSENQVKDKAKQFGRAAQ  289

Query  1063  T---DLPRYTPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNS  893
             T   +L     +++V    KK + FE A+AEAELDMLL SF ET   +S           
Sbjct  290   TRDLELAAQINKVSVADPEKKQSVFEAAAAEAELDMLLDSFNETNKFDS---------LG  340

Query  892   FLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTN  713
             F    +    F ++ S++    +R  VT               LDD +DDLL ETS L +
Sbjct  341   FKKSRNALPVFQQKPSMTPPQLSRKVVT-------------ANLDDALDDLLEETSNLMD  387

Query  712   KNEGSLGDEAR--SAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             +N      +A+  S      SSS+    SK+ DDFDSW DTI
Sbjct  388   QNGTKPPQQAKPTSPGIQCSSSSHSGQGSKVLDDFDSWLDTI  429



>ref|XP_007043707.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX99538.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=499

 Score =   186 bits (471),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 178/505 (35%), Positives = 249/505 (49%), Gaps = 76/505 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS HHSKK       K      + +   KKQ+GKQ++EK  Q      
Sbjct  1     MDAKALAKSKRAHSQHHSKKPHSSQKPKPPLVGGNDAANAKKQTGKQIREKTHQAQRVSA  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQ----  1550
             LPSNWD Y EE      FDS +       +    DVV PKSKGAD+ +LI+EA++Q    
Sbjct  61    LPSNWDHYEEE------FDSGSEDQSGDSTSQVPDVVLPKSKGADFHHLIAEAQSQLESN  114

Query  1549  ----SLYSSSHSVP------------LFDDVLH------DFYQGLGPLLSVKGQSIASSI  1436
                 SL SS   +P            + D  L+      DF Q +G +LSV+G+ I S I
Sbjct  115   PYTDSLCSSDDILPGKYAIHVSFYFGILDGNLYIGNLPGDFNQFVGIMLSVRGEGILSLI  174

Query  1435  SDDNFGSEDKGPPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCT-------  1277
              +DNF  ED+      ASFLSLNLH LAEQL K  LSERLFIE DLL PEL +       
Sbjct  175   QNDNFVVEDRTTATHAASFLSLNLHALAEQLEKVNLSERLFIEEDLLSPELVSPIPYIDI  234

Query  1276  -----------EELQKLSENEQAKNKAGVAEEVF--DSSAHRNGSEESGSMHQYLRSPYN  1136
                        +E  ++    + K  A + EE+   DS+   N + ++     +     +
Sbjct  235   QHAEGSKANSNQESDQMQTTSEGKAAAQITEELTLNDSTDKVNIAAKNVEHISFSSGSKS  294

Query  1135  TAGtstssstSARDEIL------QAKGIGQTDLPRYTPEINVNTAA---KKPAQFEVASA  983
                T ++    + DE+       Q    G++     +   N N+A+   KK + FE  +A
Sbjct  295   VDATLSNEGLDSVDEVYSDFISSQRDKSGKSRALESSTHDNSNSASVPNKKVSTFEAVAA  354

Query  982   EAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVS-SSFSERG--SLSQKVPTRSDV  812
             EAELDMLL SF+ETK L+S+ +  +   N + T+   S +  + +G  S ++     S V
Sbjct  355   EAELDMLLNSFSETKLLDSSGLKTQKSSNDYYTEGSPSLAQLARKGDDSSNKSAGVNSSV  414

Query  811   ----------TDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSA--FR  668
                       T      G  +++   +    DDLL+ETS L N+N  S   + ++A    
Sbjct  415   DDLLDDLLKETSTMVNQGVDSSKSAAVTSTFDDLLQETSTLVNRNGLSRHTDVKAAQDSG  474

Query  667   NTPSSSNPVTKSKLTDDFDSWFDTI  593
              + SSS+ V K K+ +DFDSW DTI
Sbjct  475   QSSSSSHSVPKPKVLNDFDSWLDTI  499



>ref|XP_010260341.1| PREDICTED: uncharacterized protein LOC104599483 isoform X1 [Nelumbo 
nucifera]
Length=437

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 184/464 (40%), Positives = 242/464 (52%), Gaps = 56/464 (12%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MDAK+LAKSKRAHS HHSKK+    +SK  +   SA    KK S KQ +EK  Q  GS  
Sbjct  1     MDAKALAKSKRAHSQHHSKKSHASPASKAPAVAASAGNS-KKPSAKQTREKNRQFRGSST  59

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLY  1541
              LPSNWDRY EE      +DS +  P    +   +DVV PKSKGAD+ YLISEA++Q   
Sbjct  60    ALPSNWDRYEEE------YDSGSEDPSLGGTSRTSDVVVPKSKGADFRYLISEAQSQLQS  113

Query  1540  SSSHSVPLFDDV---LHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSL  1370
              S  S+  FD     L  F QG+  +LS +G++I S I +DNF  ED      +ASFLS+
Sbjct  114   PSDLSLESFDSFGGFLPGFNQGVSTVLSARGKNILSWIGNDNFAVED-NETASQASFLSM  172

Query  1369  NLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEV-------  1211
             +LH LAEQLAK  +S+RLFI+  LLPPE+ +E LQK    +    +A    E        
Sbjct  173   DLHALAEQLAKVDVSQRLFIDAYLLPPEMHSEGLQKSKCQDYDHTEATHESEADDHYLDK  232

Query  1210  --FDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQ--AKG-----IGQTD  1058
               F  SA  NG +  G+      SP  T    +  +      +L   AKG     +GQT 
Sbjct  233   MEFHGSA--NGEDIMGNRPDI--SPATTENVHSVPALLPEGSMLVNLAKGGDSTQVGQTC  288

Query  1057  LPRYTPEI-------NVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWD  899
               ++   +       +V+    KP++FE A+AEAELDMLL SF ETK   S     +   
Sbjct  289   PTKFMNSMEQPNRSSSVDLKENKPSRFEAAAAEAELDMLLDSFGETKLFYSGFPVVKQEP  348

Query  898   NSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSIL  719
             +   +Q  VS             P  S V  PD     + A D  LD+ +D+ LRETS  
Sbjct  349   SHVSSQQQVSG-----------FPQPS-VQAPDASKNASGAFD--LDNAIDE-LRETSNP  393

Query  718   TNKNEGSLGDEARSAFRNTPSSSNPVT--KSKLTDDFDSWFDTI  593
             TN+N      + ++  RN PS S+  +  KS + DDFDSW +TI
Sbjct  394   TNQNNAMRDQQEKAVRRNPPSDSSLASAHKSSVLDDFDSWLETI  437



>gb|KDO49568.1| hypothetical protein CISIN_1g012781mg [Citrus sinensis]
Length=439

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 179/474 (38%), Positives = 235/474 (50%), Gaps = 74/474 (16%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS  H  K+  +   K        + G +KQ GKQ      +      
Sbjct  1     MDAKALAKSKRAHSQQHKNKSHPNQKLKAPVVASDNAGGKEKQPGKQAGAGTREARRLSK  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY          D  +M  +D+ S+A +D V PKSKGADY +LI+EA++QSL  
Sbjct  61    LPSNWDRYE---------DGSDMDSEDTTSQA-SDFVVPKSKGADYRHLIAEAQSQSLSQ  110

Query  1537  SSH-----SVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLS  1373
             S       + PL DDV+  F  G+GP+LSV+G+ I S + DDNF  EDK     EASFLS
Sbjct  111   SQSHSYSDTFPLLDDVMPGFAPGMGPMLSVRGEGILSWVGDDNFVVEDKTTAFQEASFLS  170

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLPPELCTE-------------ELQKLSENEQAKNK  1232
             LNL+ LAE LAK  LS+RLF+E DLLP E  TE             + +  SE +  + +
Sbjct  171   LNLNALAEHLAKVDLSQRLFVEADLLPSESGTEGSIASSNQEPGLMQTEHESEADGEEEE  230

Query  1231  AGVAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEIL---QAKGIGQT  1061
               VA +V    A  N SE+  S     +       +++       D I    ++  + QT
Sbjct  231   ESVAHKV---KAAANISEDKASTDFREKVKIVDTKSTSVVGHKNVDAIFSNQRSALVNQT  287

Query  1060  --DLP--RYTPEINVNTAAKKPAQF--------------EVASAEAELDMLLGSFAETKF  935
               D+P  +Y      + A + PAQF              E  +AEAELDMLL SF +T F
Sbjct  288   KNDVPSSQYD-RFGQDKALEPPAQFNENSVSVSKNLPTFEATAAEAELDMLLDSFNDTGF  346

Query  934   LESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDD  755
               S+     +   S  T +      S +G                P L  +A+     DD
Sbjct  347   SYSSSSKFSNSSVSQQTSSTAPPQLSRKG----------------PDLSKSASVTASFDD  390

Query  754   IVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             ++DDLL ETS L N N  S   EA+S+     SSS  V KSK+ DDFDSW DTI
Sbjct  391   VLDDLLEETSNLMNPNGLSRPHEAQSS-----SSSQSVKKSKVLDDFDSWLDTI  439



>ref|XP_008394101.1| PREDICTED: uncharacterized protein LOC103456213 [Malus domestica]
Length=390

 Score =   173 bits (438),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 167/445 (38%), Positives = 221/445 (50%), Gaps = 65/445 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassv--psaSTGDKKQS-GKQVKEKPVQGHG  1727
             MDAK+LAKSKRAHS HHSKK   +  +K A+         G  K   GKQV+EK     G
Sbjct  1     MDAKALAKSKRAHSEHHSKKYHPNPKAKSAAVGGGKGNEAGTAKNPLGKQVQEKTHPTKG  60

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
             +  LPSNWDRY    EEE    SE+ VP    S  A DVV PKSKGAD+ +LI EA++QS
Sbjct  61    ASALPSNWDRY----EEELDLGSEDPVPAADGSNRAPDVVIPKSKGADFCHLIDEARSQS  116

Query  1546  L-YSSSHSVP-LFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKG-PPPDEASFL  1376
               ++ S + P L +D+L ++ +G+  +LSV+G+S+ S I DDNF  EDK    P E SFL
Sbjct  117   QSFAYSDTFPGLENDLLGEWNKGIETMLSVRGESVLSRIGDDNFVVEDKNTAAPHEVSFL  176

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSA  1196
             SLNLH+LAEQL K  L +RLFIE DLLPPEL           EQA      A  + + S 
Sbjct  177   SLNLHSLAEQLEKIDLPQRLFIEADLLPPELYA---------EQATCGEEAARRLPEESP  227

Query  1195  HRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAA  1016
               + SEE                                       +P    EI ++ + 
Sbjct  228   CSDFSEE-------------------------------------VQVPDXDIEIRISDSP  250

Query  1015  KKP----AQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERG  848
               P    +++E    E+E  + + SF  +       +            ND S++F  R 
Sbjct  251   TDPXLGKSEYEHKLPESETQISVKSFEPSTAEAELELDLLLDSFGETKIND-STAFESRT  309

Query  847   SLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFR  668
             + S +V        P   +  ++A    +DD +D+L+ ETSIL N+   S   E R A  
Sbjct  310   TFSVQVDASLMPIQPRRKVPDSSA---TIDDELDELINETSILINQGGLSQPQEQR-AVH  365

Query  667   NTPSSSNPVTKSKLTDDFDSWFDTI  593
             +  SSS   TKSK  DDFDSW DTI
Sbjct  366   DXQSSSISGTKSKEVDDFDSWLDTI  390



>ref|XP_009355767.1| PREDICTED: uncharacterized protein LOC103946718 [Pyrus x bretschneideri]
Length=392

 Score =   172 bits (437),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 226/446 (51%), Gaps = 65/446 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassv--psaSTGDKKQS-GKQVKEKPVQGHG  1727
             MDAK+LAKSKRAHS HHSKK      +K ++         G  +   GK+V+EK     G
Sbjct  1     MDAKALAKSKRAHSEHHSKKYHPKPKAKSSAVGGGKGNEAGTARNPLGKEVQEKTHPTKG  60

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
             +  LPSNWDRY    EEE    SE+ VP    S  A+DVV PKSKGAD+ +LI EA++QS
Sbjct  61    ASALPSNWDRY----EEELDLGSEDPVPAGDGSNRASDVVVPKSKGADFCHLIDEARSQS  116

Query  1546  L-YSSSHSVP-LFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDK-GPPPDEASFL  1376
                + S + P L +D+L ++ +G+  +LSV+G+S+ S I DDNF  EDK    P E SFL
Sbjct  117   QSIAYSDTFPGLENDLLGEWNKGIETMLSVRGESVLSRIGDDNFVVEDKNAAAPHEVSFL  176

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSA  1196
             SLNLH+LAEQL K  L +RLFIE DLLPPEL  E+                     D  A
Sbjct  177   SLNLHSLAEQLEKIDLPQRLFIEADLLPPELYAEQT------------------TCDEEA  218

Query  1195  HRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAA  1016
              R   EE         SP +                       +  +P +  EI ++ + 
Sbjct  219   ARRLPEE---------SPCSDFSE-------------------EVQVPDHDIEIMISDSP  250

Query  1015  KKP----AQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSF-LTQNDVSSSFSER  851
               P    ++++    E+E  + + SF  +       +  +   +SF  T+ + S++F  R
Sbjct  251   TDPKLGKSEYDHKLPESETQISIKSFEPSTAEAELELELDLLLDSFGETKINDSTAFKPR  310

Query  850   GSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAF  671
              + S +V        P   +  ++A    +DD +D+L+ ETSIL N+   S   E R A 
Sbjct  311   NTFSVQVDASLMPIQPQRKVLDSSA---TIDDELDELINETSILINQGGLSQPQEQR-AV  366

Query  670   RNTPSSSNPVTKSKLTDDFDSWFDTI  593
              +  SSS   TKSK  DDFDSW DTI
Sbjct  367   HDFQSSSISGTKSKEVDDFDSWLDTI  392



>ref|XP_006469074.1| PREDICTED: lisH domain-containing protein C1711.05-like isoform 
X1 [Citrus sinensis]
Length=456

 Score =   173 bits (439),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 179/488 (37%), Positives = 239/488 (49%), Gaps = 85/488 (17%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS  H  K+  +   K        + G +KQ GKQ      +      
Sbjct  1     MDAKALAKSKRAHSQQHKNKSHPNQKLKAPVVASDNAGGKEKQPGKQAGAGTREARRLSK  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY          D  +M  +D+ S+A +D V PKSKGADY +LI+EA++QSL  
Sbjct  61    LPSNWDRYE---------DGSDMDSEDTTSQA-SDFVVPKSKGADYRHLIAEAQSQSLSQ  110

Query  1537  SSH-----SVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFL  1376
             S       + PL DDV+   F  G+GP+LSV+G+ I S + DDNF  EDK     EASFL
Sbjct  111   SRSLSYSDTFPLLDDVMPGGFAPGMGPMLSVRGEGILSWVGDDNFVVEDKTTAFQEASFL  170

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTE--------ELQKLSENEQAKNKAGVA  1220
             SLNL+ LAE LAK  LS+RLF+E DLLP EL TE        E   +    +++   G++
Sbjct  171   SLNLNALAEHLAKVDLSQRLFVEADLLPSELGTEGSIASSNQEPGLMQTEHESEADVGIS  230

Query  1219  EEV-------------FDSSAHR-----NGSEESGSMHQYLRSPYNTAGtstssstSARD  1094
              ++              +S AH+     N SE+  S     +       +++       D
Sbjct  231   RDIDIASKDFPEGEEEEESGAHKVKAAANISEDKASTDFREKVKIVDTKSTSVVGHKNVD  290

Query  1093  EIL---QAKGIGQT--DLP--RYTPEINVNTAAKKPAQF--------------EVASAEA  977
              I    ++  + QT  D+P  +Y      + A + PAQF              E  +AEA
Sbjct  291   AIFSNQRSALVNQTKNDVPSSQYD-RFGQDKALEPPAQFNENSVSVSKNLPTFEATAAEA  349

Query  976   ELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDP  797
             ELDMLL SF +T F  S+     +   S  T +      S +G                P
Sbjct  350   ELDMLLDSFNDTGFSYSSSSKFSNSSVSQQTSSTAPPQLSRKG----------------P  393

Query  796   GLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDD  617
              L  +A+     DD++DDLL ETS L N N  S   EA+S+     SSS  V KSK+ DD
Sbjct  394   DLSKSASVTASFDDVLDDLLEETSNLMNPNGLSRPHEAQSS-----SSSQSVKKSKVLDD  448

Query  616   FDSWFDTI  593
             FDSW DTI
Sbjct  449   FDSWLDTI  456



>ref|XP_009346179.1| PREDICTED: uncharacterized protein LOC103937923 [Pyrus x bretschneideri]
Length=390

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 164/445 (37%), Positives = 222/445 (50%), Gaps = 65/445 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassv--psaSTGDKKQS-GKQVKEKPVQGHG  1727
             MDAK+LAKSKRAHS HHSKK      +K ++         G  +   GK+V+EK     G
Sbjct  1     MDAKALAKSKRAHSEHHSKKYHPKPKAKSSAVGGGKGNEAGTARNPLGKEVQEKTHPTKG  60

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
             +  LPSNWDRY    EEE    SE+ VP    S  A+DVV PKSKGAD+ +LI EA++QS
Sbjct  61    ASALPSNWDRY----EEELDLGSEDPVPAGDGSNRASDVVVPKSKGADFCHLIDEARSQS  116

Query  1546  L-YSSSHSVP-LFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDK-GPPPDEASFL  1376
                + S + P L +D+L ++ +G+  +LSV+G+S+ S I DDNF  EDK    P + SFL
Sbjct  117   QSIAYSDTFPGLENDLLGEWNKGIETMLSVRGESVLSRIGDDNFVVEDKNAAAPHDVSFL  176

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSA  1196
             SLNLH+LAEQL K  L +RLFIE DLLPPEL  E+                     D  A
Sbjct  177   SLNLHSLAEQLEKIDLPQRLFIEADLLPPELYAEQT------------------TCDEEA  218

Query  1195  HRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAA  1016
              R   EE         SP +                       +  +P +  EI V+ + 
Sbjct  219   ARRLPEE---------SPCSDFSE-------------------EVQVPDHDIEIMVSDSP  250

Query  1015  KKP----AQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERG  848
               P    +++E    E+E  + + SF  +       +            ND S++F  R 
Sbjct  251   TDPKLGKSEYEHKLPESETQVSVKSFEPSTAEAELELDLLLDSFGETKIND-STAFKPRN  309

Query  847   SLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFR  668
             + S +V     +  P   +  ++A    +DD +D+L+ ETSIL N+   S   E R A  
Sbjct  310   TFSVQVDASLMLIQPQRKVPDSSA---TIDDELDELINETSILINQGGLSQPQEQR-AVH  365

Query  667   NTPSSSNPVTKSKLTDDFDSWFDTI  593
             +  SSS   TKSK  DDFDSW DTI
Sbjct  366   DFQSSSISGTKSKEVDDFDSWLDTI  390



>ref|XP_002517843.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44361.1| conserved hypothetical protein [Ricinus communis]
Length=434

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 176/471 (37%), Positives = 235/471 (50%), Gaps = 73/471 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaST---GDKKQSGKQVKEKPVQGHG  1727
             MD+K+LAKSKRAHSLHHSKK           +    +T      K  GKQ +EK  Q   
Sbjct  1     MDSKALAKSKRAHSLHHSKKQFHSGQKAKVKAPTGGATDAASGNKAVGKQTREKARQS--  58

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
               GLPSN DRY EE      FDS +  P       A+D++ PKSKGADY +LI+EA++Q 
Sbjct  59    --GLPSNCDRYEEE------FDSGSGDPLGDSINNASDIILPKSKGADYRHLIAEAQSQC  110

Query  1546  LYSSSHSV-PLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLS  1373
                S   + P  +D+L  DF  G+GP+LSV+G+ I S   DDNF  ED+     EA FLS
Sbjct  111   QSGSYLDMFPSLEDILPADFKLGVGPMLSVRGEGILSWTGDDNFVVEDESAVSPEAHFLS  170

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLPPEL--------------------------CTEE  1271
             LNL  LAEQL K  +SERLF+E D+LPPEL                           +EE
Sbjct  171   LNLSALAEQLLKVDISERLFMEADILPPELSGHGAKATSSLESEQKQTSEMKVNSTVSEE  230

Query  1270  --LQKLSE-NEQAKNKAGVAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSA  1100
               L+ LSE NE AK  +    EV  S +   G  +  S++Q       T G  ++S  S+
Sbjct  231   LILKDLSEKNEFAKQSS----EVMSSESILTGQSDPISLNQEFDMINKTEGDFSASRHSS  286

Query  1099  RDEILQAKGIGQTDLPRYTPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNR  920
               E    +       P      ++    KKP  FE  +AEAELDMLL SF ETKFL+S+ 
Sbjct  287   SCENRAMES------PAEISGSSIADPKKKPYMFEATAAEAELDMLLDSFNETKFLDSSG  340

Query  919   VTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDL  740
              T  ++    L++ +   +  +   L +  P+ S  +     +  T    +         
Sbjct  341   FTSAAFP---LSKKEAPRALPQ---LIRNTPSSSKTS-----ISATLDDALDDLL-----  384

Query  739   LRETSILTNKNEG--SLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
               +TS L+N+N    S+   A S    + SSS  VTKSK+ DDFDSW DT+
Sbjct  385   -EQTSNLSNQNNSYQSVKVTATSNEMQSSSSSRSVTKSKVLDDFDSWLDTL  434



>ref|XP_006469075.1| PREDICTED: lisH domain-containing protein C1711.05-like isoform 
X2 [Citrus sinensis]
Length=440

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 177/472 (38%), Positives = 230/472 (49%), Gaps = 69/472 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS  H  K+  +   K        + G +KQ GKQ      +      
Sbjct  1     MDAKALAKSKRAHSQQHKNKSHPNQKLKAPVVASDNAGGKEKQPGKQAGAGTREARRLSK  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY          D  +M  +D+ S+A +D V PKSKGADY +LI+EA++QSL  
Sbjct  61    LPSNWDRYE---------DGSDMDSEDTTSQA-SDFVVPKSKGADYRHLIAEAQSQSLSQ  110

Query  1537  SSH-----SVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFL  1376
             S       + PL DDV+   F  G+GP+LSV+G+ I S + DDNF  EDK     EASFL
Sbjct  111   SRSLSYSDTFPLLDDVMPGGFAPGMGPMLSVRGEGILSWVGDDNFVVEDKTTAFQEASFL  170

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTE----------ELQKLSENEQAKNKAG  1226
             SLNL+ LAE LAK  LS+RLF+E DLLP EL TE           L +     +A  +  
Sbjct  171   SLNLNALAEHLAKVDLSQRLFVEADLLPSELGTEGSIASSNQEPGLMQTEHESEADGEEE  230

Query  1225  VAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEIL---QAKGIGQT--  1061
                      A  N SE+  S     +       +++       D I    ++  + QT  
Sbjct  231   EESGAHKVKAAANISEDKASTDFREKVKIVDTKSTSVVGHKNVDAIFSNQRSALVNQTKN  290

Query  1060  DLP--RYTPEINVNTAAKKPAQF--------------EVASAEAELDMLLGSFAETKFLE  929
             D+P  +Y      + A + PAQF              E  +AEAELDMLL SF +T F  
Sbjct  291   DVPSSQYD-RFGQDKALEPPAQFNENSVSVSKNLPTFEATAAEAELDMLLDSFNDTGFSY  349

Query  928   SNRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIV  749
             S+     +   S  T +      S +G                P L  +A+     DD++
Sbjct  350   SSSSKFSNSSVSQQTSSTAPPQLSRKG----------------PDLSKSASVTASFDDVL  393

Query  748   DDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             DDLL ETS L N N  S   EA+S+     SSS  V KSK+ DDFDSW DTI
Sbjct  394   DDLLEETSNLMNPNGLSRPHEAQSS-----SSSQSVKKSKVLDDFDSWLDTI  440



>gb|KDO49569.1| hypothetical protein CISIN_1g012781mg [Citrus sinensis]
Length=440

 Score =   171 bits (433),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 179/475 (38%), Positives = 235/475 (49%), Gaps = 75/475 (16%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS  H  K+  +   K        + G +KQ GKQ      +      
Sbjct  1     MDAKALAKSKRAHSQQHKNKSHPNQKLKAPVVASDNAGGKEKQPGKQAGAGTREARRLSK  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY          D  +M  +D+ S+A +D V PKSKGADY +LI+EA++QSL  
Sbjct  61    LPSNWDRYE---------DGSDMDSEDTTSQA-SDFVVPKSKGADYRHLIAEAQSQSLSQ  110

Query  1537  SSH-----SVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFL  1376
             S       + PL DDV+   F  G+GP+LSV+G+ I S + DDNF  EDK     EASFL
Sbjct  111   SQSHSYSDTFPLLDDVMPGGFAPGMGPMLSVRGEGILSWVGDDNFVVEDKTTAFQEASFL  170

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTE-------------ELQKLSENEQAKN  1235
             SLNL+ LAE LAK  LS+RLF+E DLLP E  TE             + +  SE +  + 
Sbjct  171   SLNLNALAEHLAKVDLSQRLFVEADLLPSESGTEGSIASSNQEPGLMQTEHESEADGEEE  230

Query  1234  KAGVAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEIL---QAKGIGQ  1064
             +  VA +V    A  N SE+  S     +       +++       D I    ++  + Q
Sbjct  231   EESVAHKV---KAAANISEDKASTDFREKVKIVDTKSTSVVGHKNVDAIFSNQRSALVNQ  287

Query  1063  T--DLP--RYTPEINVNTAAKKPAQF--------------EVASAEAELDMLLGSFAETK  938
             T  D+P  +Y      + A + PAQF              E  +AEAELDMLL SF +T 
Sbjct  288   TKNDVPSSQYD-RFGQDKALEPPAQFNENSVSVSKNLPTFEATAAEAELDMLLDSFNDTG  346

Query  937   FLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLD  758
             F  S+     +   S  T +      S +G                P L  +A+     D
Sbjct  347   FSYSSSSKFSNSSVSQQTSSTAPPQLSRKG----------------PDLSKSASVTASFD  390

Query  757   DIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             D++DDLL ETS L N N  S   EA+S+     SSS  V KSK+ DDFDSW DTI
Sbjct  391   DVLDDLLEETSNLMNPNGLSRPHEAQSS-----SSSQSVKKSKVLDDFDSWLDTI  440



>ref|XP_007221034.1| hypothetical protein PRUPE_ppa015217mg, partial [Prunus persica]
 gb|EMJ22233.1| hypothetical protein PRUPE_ppa015217mg, partial [Prunus persica]
Length=383

 Score =   169 bits (429),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 160/416 (38%), Positives = 206/416 (50%), Gaps = 62/416 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGD---KKQSGKQVKEKPVQGHG  1727
             MD K+LAKS RAH+  HSKK+  +  +K  +     ++     KK  GKQVKEK    HG
Sbjct  1     MDVKALAKSNRAHAQRHSKKHHPNQKAKAPAVDGGKASDAGPAKKPLGKQVKEKTNPTHG  60

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
             +  LP+NWDRY EE E      + +  P       A DV  P SKGADY +LI+EA+AQS
Sbjct  61    ASALPTNWDRYEEEFE------AGSEEPASDGLNRAPDVAVPMSKGADYRHLIAEAQAQS  114

Query  1546  -LYSSSHSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLS  1373
              L   S   P  D+VL  D+ +G+G +LSV+G+SI S I DDNF  EDK     E SFLS
Sbjct  115   ELTIYSDPFPSLDNVLPGDWNEGIGSMLSVRGESILSRIGDDNFVVEDKTAAHHEVSFLS  174

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLPPEL-------------------CTEELQKLSEN  1250
             LNLH LAEQL K  L ERLF+E +LLPPEL                   C EE  +    
Sbjct  175   LNLHALAEQLEKIALPERLFVEAELLPPELHVEGQEATCSQSSDPMQATCNEEATRGMPE  234

Query  1249  EQAKNKAGVAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGI  1070
             E    K  VA+   D     +GS  +GS H  L  P          S SA    +    +
Sbjct  235   ESISEKVQVADH--DIEITMSGS--TGSGHPDLILP-------NLGSVSAIQGNIDPSKL  283

Query  1069  GQTDLPRYTPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSF  890
             G++D      E     + K    FE ++AEAELDMLL SF ETK      + + S  +S 
Sbjct  284   GKSDYQSKLSESETQFSVKS---FEASTAEAELDMLLDSFGETK------INDSSGFSSV  334

Query  889   LTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSI  722
              T +   ++F     L +K P  S +   +             DD +DDL+ ETSI
Sbjct  335   KTVSVQEAAFMAPLQLPRKAPDSSVLMTAN------------FDDELDDLINETSI  378



>gb|KDO49570.1| hypothetical protein CISIN_1g012781mg [Citrus sinensis]
Length=456

 Score =   170 bits (431),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 178/488 (36%), Positives = 238/488 (49%), Gaps = 85/488 (17%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS  H  K+  +   K        + G +KQ GKQ      +      
Sbjct  1     MDAKALAKSKRAHSQQHKNKSHPNQKLKAPVVASDNAGGKEKQPGKQAGAGTREARRLSK  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY          D  +M  +D+ S+A +D V PKSKGADY +LI+EA++QSL  
Sbjct  61    LPSNWDRYE---------DGSDMDSEDTTSQA-SDFVVPKSKGADYRHLIAEAQSQSLSQ  110

Query  1537  SSH-----SVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFL  1376
             S       + PL DDV+   F  G+GP+LSV+G+ I S + DDNF  EDK     EASFL
Sbjct  111   SQSHSYSDTFPLLDDVMPGGFAPGMGPMLSVRGEGILSWVGDDNFVVEDKTTAFQEASFL  170

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTE--------ELQKLSENEQAKNKAGVA  1220
             SLNL+ LAE LAK  LS+RLF+E DLLP E  TE        E   +    +++   G++
Sbjct  171   SLNLNALAEHLAKVDLSQRLFVEADLLPSESGTEGSIASSNQEPGLMQTEHESEADVGIS  230

Query  1219  EEV-------------FDSSAHR-----NGSEESGSMHQYLRSPYNTAGtstssstSARD  1094
              ++              +S AH+     N SE+  S     +       +++       D
Sbjct  231   RDIDIASKDFPEGEEEEESVAHKVKAAANISEDKASTDFREKVKIVDTKSTSVVGHKNVD  290

Query  1093  EIL---QAKGIGQT--DLP--RYTPEINVNTAAKKPAQF--------------EVASAEA  977
              I    ++  + QT  D+P  +Y      + A + PAQF              E  +AEA
Sbjct  291   AIFSNQRSALVNQTKNDVPSSQYD-RFGQDKALEPPAQFNENSVSVSKNLPTFEATAAEA  349

Query  976   ELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDP  797
             ELDMLL SF +T F  S+     +   S  T +      S +G                P
Sbjct  350   ELDMLLDSFNDTGFSYSSSSKFSNSSVSQQTSSTAPPQLSRKG----------------P  393

Query  796   GLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDD  617
              L  +A+     DD++DDLL ETS L N N  S   EA+S+     SSS  V KSK+ DD
Sbjct  394   DLSKSASVTASFDDVLDDLLEETSNLMNPNGLSRPHEAQSS-----SSSQSVKKSKVLDD  448

Query  616   FDSWFDTI  593
             FDSW DTI
Sbjct  449   FDSWLDTI  456



>gb|KDP24072.1| hypothetical protein JCGZ_25729 [Jatropha curcas]
Length=428

 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 193/476 (41%), Positives = 260/476 (55%), Gaps = 89/476 (19%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQS-GKQVKEKPVQGHGSR  1721
             MDAK+LAKSKRAHSLHHSKK         A S  + + G   ++ GKQ KEK  Q     
Sbjct  1     MDAKALAKSKRAHSLHHSKKPSHSSLKSKAPSGGANNAGGGNKALGKQTKEKARQS----  56

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQ-DSVSKAATDVVAPKSKGADYAYLISEAKAQSL  1544
             GLP+NWDRY EE      FDS++ VP  DS+SKA +DV+ PKSKGAD+ +LI+EA++Q  
Sbjct  57    GLPANWDRYEEE------FDSDSEVPSGDSISKA-SDVILPKSKGADFRHLIAEAQSQCQ  109

Query  1543  YSSS-HSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSL  1370
              +    + P  DD+L  DF  G+  +LSV+G+ I S   DDNF  ED+     EASF SL
Sbjct  110   SNVCLDTFPSMDDILPGDFELGVRSMLSVRGEGILSWTGDDNFVVEDETTAIPEASFFSL  169

Query  1369  NLHTLAEQLAKATLSERLFIEPDLLPPEL--------CTEELQKLSENEQAKNKAGVAEE  1214
             NL+ LAEQLAK  +S+RL+IE DLLPPEL        C  E  ++  +E  +  + VAE 
Sbjct  170   NLNALAEQLAKVDISKRLYIEEDLLPPELTDNRSKASCGPESDQMQTSE-TEATSMVAER  228

Query  1213  VF-------DSSAHRN----GSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIG  1067
             +        +  A++N     SE + + +  L SP               D + QAKG  
Sbjct  229   LAFRDISGKNKVANKNTEVISSESTANRYSNLISP-----------NQGLDRLNQAKGDQ  277

Query  1066  QTDL-PRYTPEINVNTAA---KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWD  899
              +    +++   +  + A   KK + FE A+AEAELDMLL SF+ET FL+S+   +    
Sbjct  278   YSSRDSKFSESKSQKSQADSKKKLSTFEAAAAEAELDMLLDSFSETNFLDSSAGLK----  333

Query  898   NSFLTQNDVSSSFSERGSLSQK-----VP--TRSDVTDPDPGLGGTAARDMKLDDIVDDL  740
                      SSSF     +SQK     +P  TR+  +         AA   KLDD++D L
Sbjct  334   ---------SSSF----PVSQKEAPVVMPQFTRNTSSSTSLETTAVAA---KLDDVLDGL  377

Query  739   LRETSILTNKNEGS-LG------DEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             L ET+ L+N+N    LG      +E +S+     SSS PVTKS + DDFDSW DT+
Sbjct  378   LDETTNLSNQNSSCQLGKVTVTHNEIKSS-----SSSQPVTKSIVLDDFDSWLDTL  428



>ref|XP_006372766.1| hypothetical protein POPTR_0017s04850g [Populus trichocarpa]
 gb|ERP50563.1| hypothetical protein POPTR_0017s04850g [Populus trichocarpa]
Length=474

 Score =   166 bits (421),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 174/510 (34%), Positives = 238/510 (47%), Gaps = 111/510 (22%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MD K+LAKSKRAH+L H+K                   G K    +   + P  G+  + 
Sbjct  1     MDTKALAKSKRAHTLQHNK-------------------GKKPHPNQNPSKTPSTGNNQKP  41

Query  1720  ---GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATD----VVAPKSKGADYAYLISE  1562
                 LPSNWDRY ++ E+E+G + EN    +S   +  D    +  PKSKGAD+ YL+ E
Sbjct  42    QKSKLPSNWDRYEDDEEDEFGVNLENPSGDNSKKPSFKDYGDGLALPKSKGADFKYLLDE  101

Query  1561  AKAQSLYSSSHSV---PLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP  1394
             AK     S  H V   P  +  L  +   G+GPLL+V+G+SI S I DDNF  ED+    
Sbjct  102   AK-----SKPHQVDDFPFLEGFLAEESMHGVGPLLAVRGESILSWIGDDNFVVEDETTSS  156

Query  1393  DEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELC--TEELQKLSENEQAKNKAGVA  1220
              EASFLSLNLH LAEQLAK  +SERLFIE DLLP EL   T   Q+  + +   ++A   
Sbjct  157   HEASFLSLNLHALAEQLAKVDVSERLFIEADLLPTELGSNTSSSQEFDQMQTTGSEA---  213

Query  1219  EEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKG--------IGQ  1064
                  SS H  G     + H   +     +G  T    S +++ +            IG 
Sbjct  214   -----SSNH--GPNRKQTTHD--KETKTISGELTFEDFSEKNKAVNQDAEIFVSGLTIGN  264

Query  1063  TDLPRYTPEINVN--------------TAAKKPAQ--------------FEVASAEAELD  968
             +D   +   ++V               TA + PAQ              FE A+AE+ELD
Sbjct  265   SDPISFIQGLDVKDNLNLNQHGKSNQRTAMESPAQFYASSVAPNSRLPTFEAAAAESELD  324

Query  967   MLLGSFAETKFLESN-------RVTEESWDNSF--LTQNDVSSSFSERGS---------L  842
             MLL S +E K L+S+        V+E+        LT+N   S+ +   +         L
Sbjct  325   MLLDSLSEAKLLDSSGFGSGTLPVSEKEAAVPLPQLTRNAPGSAKTTPTAATLDNVLDDL  384

Query  841   SQKVPTRSDVTDPDPGLGGTAARDMK-------LDDIVDDLLRETSILTNKNEGSLGDEA  683
              ++     +   P P L   A   +K       LDD++DDL  ETS L+N+N      E 
Sbjct  385   LEETSNLQEAAAPLPLLARNAHGSLKTTSTAATLDDVLDDLFEETSSLSNQNNLHQPSEK  444

Query  682   RSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             ++      SSS  V KSK+ DDFDSW DTI
Sbjct  445   KADHVIQSSSSQSVNKSKVLDDFDSWLDTI  474



>ref|XP_010260342.1| PREDICTED: uncharacterized protein LOC104599483 isoform X2 [Nelumbo 
nucifera]
Length=428

 Score =   165 bits (418),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 176/453 (39%), Positives = 233/453 (51%), Gaps = 54/453 (12%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MDAK+LAKSKRAHS HHSKK+    +SK  +   SA    KK S KQ +EK  Q  GS  
Sbjct  1     MDAKALAKSKRAHSQHHSKKSHASPASKAPAVAASAGNS-KKPSAKQTREKNRQFRGSST  59

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLY  1541
              LPSNWDRY EE      +DS +  P    +   +DVV PKSKGAD+ YLISEA++Q   
Sbjct  60    ALPSNWDRYEEE------YDSGSEDPSLGGTSRTSDVVVPKSKGADFRYLISEAQSQLQS  113

Query  1540  SSSHSVPLFDDV---LHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSL  1370
              S  S+  FD     L  F QG+  +LS +G++I S I +DNF  ED      +ASFLS+
Sbjct  114   PSDLSLESFDSFGGFLPGFNQGVSTVLSARGKNILSWIGNDNFAVED-NETASQASFLSM  172

Query  1369  NLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEV-------  1211
             +LH LAEQLAK  +S+RLFI+  LLPPE+ +E LQK    +    +A    E        
Sbjct  173   DLHALAEQLAKVDVSQRLFIDAYLLPPEMHSEGLQKSKCQDYDHTEATHESEADDHYLDK  232

Query  1210  --FDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQ--AKG-----IGQTD  1058
               F  SA  NG +  G+      SP  T    +  +      +L   AKG     +GQT 
Sbjct  233   MEFHGSA--NGEDIMGNRPDI--SPATTENVHSVPALLPEGSMLVNLAKGGDSTQVGQTC  288

Query  1057  LPRYTPEI-------NVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWD  899
               ++   +       +V+    KP++FE A+AEAELDMLL SF ETK   S     +   
Sbjct  289   PTKFMNSMEQPNRSSSVDLKENKPSRFEAAAAEAELDMLLDSFGETKLFYSGFPVVKQEP  348

Query  898   NSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSIL  719
             +   +Q  VS             P  S V  PD     + A D  LD+ +D+ LRETS  
Sbjct  349   SHVSSQQQVSG-----------FPQPS-VQAPDASKNASGAFD--LDNAIDE-LRETSNP  393

Query  718   TNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTD  620
             TN+N      + ++  RN PS S+  +  K +D
Sbjct  394   TNQNNAMRDQQEKAVRRNPPSDSSLASAHKSSD  426



>ref|XP_006592445.1| PREDICTED: uncharacterized protein LOC102660628 [Glycine max]
 gb|KHM99717.1| hypothetical protein glysoja_037281 [Glycine soja]
Length=429

 Score =   165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 165/456 (36%), Positives = 226/456 (50%), Gaps = 48/456 (11%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQS-----GKQVKEKPVQG  1733
             MD K+LAKSKR H+ HHSKK+   H  K  +S  S+S G    +     GKQ   +  + 
Sbjct  1     MDVKALAKSKRNHTQHHSKKSPHSHKPKAPTSSSSSSVGPNDAAKNNPLGKQQVSQKKKS  60

Query  1732  HGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKA  1553
             H S  LPSNWDRY +        + E +     ++    DVV PK+KGAD+ +L++EA++
Sbjct  61    HRS-ALPSNWDRYED--------EEEELDSGSGIASKTVDVVLPKTKGADFRHLVAEAQS  111

Query  1552  QSLYSSSHSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFL  1376
             Q+  +S    P FDD+L  +F  GL  +L V+G+ I S + DDNF  +DK     EASFL
Sbjct  112   QA-ETSLEGFPAFDDLLPGEFGVGLSSMLVVRGEGIVSWVGDDNFVVDDKTTGNPEASFL  170

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAK-----------NKA  1229
             SLNLH LAE  AK  LS+RLFIE DLLP ELC EEL  +S NE+ K           N+ 
Sbjct  171   SLNLHALAESFAKVDLSKRLFIESDLLPTELCVEELA-VSSNEEHKELKTKEDSELANRM  229

Query  1228  GVAEEVFDSSAHR-NGSEESGSMHQYLRSPY-NTAGtstssstSARDEILQAKGIGQTDL  1055
                 ++ D +A +   S  S S H     P  N       +  +A  +        +  +
Sbjct  230   SKELDLDDLAADQFTSSSSSSSSHAVSTFPLSNNVFHIPVNYVNAEAQQTSCSSKNKAFV  289

Query  1054  PRYTPEINVNTAAKKPAQFEVASAEAE--LDMLLGSFAETKFLESNRVTEESWDNSFLTQ  881
             P     ++    A+        +A+ E  LDMLL S +ETK L+S         + F + 
Sbjct  290   PCSDASLHSTEDARGKQYSAFGAADVEKELDMLLDSLSETKILDS---------SGFKSY  340

Query  880   NDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEG  701
               +  S        Q       V+  DP    TA+    LDD +D+LL ETS L N N  
Sbjct  341   TSIPVSLGVSSVYPQ-------VSKKDPVPSKTASITASLDDALDELLEETSTLMNPNVL  393

Query  700   SLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
                 E +    +  SSS+   KSK+ DDFDSWFDT+
Sbjct  394   LRPQEEKPFHHSMQSSSHSGNKSKVADDFDSWFDTL  429



>ref|XP_004287059.1| PREDICTED: uncharacterized protein LOC101291364 [Fragaria vesca 
subsp. vesca]
Length=381

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 173/453 (38%), Positives = 221/453 (49%), Gaps = 90/453 (20%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD+K+LAKSKRAHS HHSKK    +      + P       K SGKQ+            
Sbjct  1     MDSKALAKSKRAHSQHHSKKYHSPNQKAKDGAKP------NKASGKQI------------  42

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSK-AATDVVAPKSKGADYAYLISEAKAQSLY  1541
              P+NWDRY          D E     DS S+ AA+D+V PKSKGADY +LI+EA++QSL 
Sbjct  43    -PTNWDRY----------DEE----LDSGSQDAASDIVLPKSKGADYTHLIAEAQSQSLS  87

Query  1540  SSSHSVPLFDDVLH-DFYQGLGPLLSVKGQSIASSISDDNFGSEDK-GPPPDEASFLSLN  1367
                      DDVL  ++ +G+  +LS +G+SI S I DDNF  +DK      E SFLSLN
Sbjct  88    Q------FDDDVLSVEWNKGIMSMLSARGESILSWIGDDNFVVDDKTAAAHHEVSFLSLN  141

Query  1366  LHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAHRN  1187
             LH+LAEQL K  LSERLFIE DLLPPEL  E L+  S        A  A+  F +   R 
Sbjct  142   LHSLAEQLEKVDLSERLFIEADLLPPELNLEGLESTS-----SQSADQAQGTFVNKGARV  196

Query  1186  GSEESGSMHQYLRSPYNTAGtstssstSAR------DEILQAKGIGQTD-----LPRYTP  1040
               E   S+        N A        S+       D  L +  + Q D     L + T 
Sbjct  197   IPE--ASISGEFPDKINVADQDIEIMLSSSPDSDCLDSNLGSISLKQIDVDPSKLGKSTR  254

Query  1039  EINVNTAAKKP----AQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDV  872
             + ++   A  P    A FE A+AE ELDMLL SF+ETK                  +ND 
Sbjct  255   QSSMKPFADIPIKNLATFEAATAEEELDMLLDSFSETK------------------RNDP  296

Query  871   SSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLG  692
             S+  S +   S  VP    +  P  G   +      LDD +DDL+ E SI  N+   S  
Sbjct  297   SALRSLQDEAS--VPP---LQVPRKGTDSSILVAANLDDALDDLMNEISIPINQGGPSRP  351

Query  691   DEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
              E  +   +   SS   +KSK+ DDFDSWFDT+
Sbjct  352   QEKMAV--HDFQSSQTGSKSKV-DDFDSWFDTL  381



>ref|XP_010093966.1| hypothetical protein L484_010532 [Morus notabilis]
 gb|EXB54953.1| hypothetical protein L484_010532 [Morus notabilis]
Length=423

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 176/457 (39%), Positives = 233/457 (51%), Gaps = 56/457 (12%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgas--svpsaSTGDKKQSGKQVKEKPVQGHGS  1724
             MDAK+LAKSKRAHSL HS+++  +   K  S  +  S + G KK SGKQ KEKP+Q  G 
Sbjct  1     MDAKALAKSKRAHSLQHSRRHHPNQKPKAPSGVAAASETGGAKKPSGKQDKEKPLQPRGK  60

Query  1723  RGLPSNWDRYVeegeeEYGFDSENMVPQDS--VSKAATDVVAPKSKGADYAYLISEAKAQ  1550
               LPSNWDRY +E       DS +  P  S  + K   DVV PKSKGADY +LI+EA++Q
Sbjct  61    SALPSNWDRYEQET------DSGSEEPSGSGAIQKQNPDVVLPKSKGADYRHLIAEAQSQ  114

Query  1549  SLYSSSHSVPLFDDVLH-DFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLS  1373
             S ++   S P  DDVL  +F   +G +LSV+G+ I +  +DDNF   DK     EA+FLS
Sbjct  115   S-HAYLDSFPSVDDVLAGEFSLAVGSMLSVRGEGILAWSADDNFIVNDKSTTHPEAAFLS  173

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLPPELCTE-----ELQKLSENEQAKNKAGVA---E  1217
             LNLH LAEQL K  L+ RLFIE DLLPPEL  E       QK ++     +   V+   E
Sbjct  174   LNLHALAEQLEKIDLAHRLFIEADLLPPELHVEVSETSRTQKCNQMPATNDVEAVSKLPE  233

Query  1216  EVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPE  1037
             E+  +    + S   G         +     S   S+S    +     + Q D     P 
Sbjct  234   ELTFNEVSLSASPSGG---------HPDPSLSIRGSSSVSQGVSNVNRVSQYDHKSNAPH  284

Query  1036  INVNTAA--------KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQ  881
               V  ++        KK  +FE  +AEAELDMLL SF+E K            D+S L+ 
Sbjct  285   FAVAQSSVDTFADPGKKRPEFEAVAAEAELDMLLDSFSEIKIP----------DSSGLSS  334

Query  880   NDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEG  701
              D      E  +   + P +    DP+     +   +  LDD +DDLL+ETS LT++N  
Sbjct  335   ADTLPVHEEASAAVFQPPRK----DPN----SSVLTNANLDDDLDDLLKETSSLTSQNSS  386

Query  700   SLGDEARSAFRNTPSSSNPVTKSKLTDD-FDSWFDTI  593
                    +      SS    T+SK  DD FDSW DT+
Sbjct  387   FQPQRGSADHFVESSSPKSGTESKTLDDFFDSWLDTL  423



>gb|KGN43477.1| hypothetical protein Csa_7G039250 [Cucumis sativus]
Length=390

 Score =   152 bits (384),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 207/453 (46%), Gaps = 81/453 (18%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MDAKSLAKSKRAHS HH+                       K+     K+KP  G  +  
Sbjct  1     MDAKSLAKSKRAHSQHHT-----------------------KKYHSNHKQKPFNGTTNES  37

Query  1720  --------GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLIS  1565
                      LPSNWDRY            +N    ++      DV+ PKSKGADY +LI+
Sbjct  38    LKNPLPNDNLPSNWDRY-----------GQNTSTAEATPAPLPDVILPKSKGADYRHLIA  86

Query  1564  EAKAQSLYSSSHSV-PLFDDVLHDFYQGLG-PLLSVKGQSIASSISDDNFGSEDKGPPPD  1391
             EA++Q    +S  V P  DDV      G G  +L+ +G+ + S + DD+F  ++      
Sbjct  87    EARSQMQSCTSTDVFPSLDDVFPGELSGGGSAMLAARGEGLLSWVEDDSFIVDETATSIP  146

Query  1390  EASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCT-EELQKLSEN--EQAKNKAGVA  1220
             EASFLSLNLH LA+QL K  +++RLFIE D+LP EL    E Q+   N       K  V 
Sbjct  147   EASFLSLNLHMLADQLQKLNVAQRLFIEEDILPSELMQPSECQEAERNIDSSVTEKGNVE  206

Query  1219  EEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTP  1040
             + V D+    + S    +      +P  T       +       ++ +   QT  P+YT 
Sbjct  207   DRVQDAIVASSSSYFGSNQQDPTFNPSPTLSNQVQYNACP----IELEISSQTKDPKYTD  262

Query  1039  EINVN----TAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDV  872
             + N       + KK  + E  +AEAELDMLL SF++T  L +   +              
Sbjct  263   QANTKFTTENSNKKLTKLEATTAEAELDMLLNSFSDTIDLGTTAASS-------------  309

Query  871   SSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLG  692
             SS   E    S  +P +   +   P +        +LDD +D+LL++TS LT+  E  + 
Sbjct  310   SSRIDEVSKPSFHLPNKGPYSTKKPPIAS------ELDDALDELLQDTSYLTSHIEKPIN  363

Query  691   DEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
                +S   +  S +N + K    DDFDSW D+I
Sbjct  364   THIQSLSLH--SGTNSIAK----DDFDSWIDSI  390



>ref|XP_008455489.1| PREDICTED: uncharacterized protein LOC103495640 [Cucumis melo]
Length=393

 Score =   152 bits (384),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 158/460 (34%), Positives = 222/460 (48%), Gaps = 92/460 (20%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQ-----SGKQVKEKPVQG  1733
             MDAKSLAKSKRAHS HH+KK                   + KQ     +  +  +KP+  
Sbjct  1     MDAKSLAKSKRAHSQHHTKKYH----------------SNHKQKPFNGTTNEYAKKPLPK  44

Query  1732  HGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAAT----DVVAPKSKGADYAYLIS  1565
                  LP+NWDRY E               Q+SV++A      DV+ PKSKGADY +LI+
Sbjct  45    LPKDNLPANWDRYGE---------------QNSVAEATPPPLPDVILPKSKGADYRHLIA  89

Query  1564  EAKAQSLYSSSHSV-PLFDDVLHDFYQGLG-PLLSVKGQSIASSISDDNFGSEDKGPPPD  1391
             EA++Q L  +S  V P  DDV      G G  +L+ +G+ + S I DD+F  ++      
Sbjct  90    EARSQMLSCTSTDVFPSLDDVFPSELSGGGSAMLAARGEGLLSWIEDDSFIVDETATAIP  149

Query  1390  EASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELC-TEELQKLSENEQ--AKNKAGVA  1220
             EASFLSLNLH LA+QL K  +++RLFIE D+LP EL  T   Q+   N +  + N+ G  
Sbjct  150   EASFLSLNLHMLADQLQKLNVAQRLFIEEDILPSELMQTSVCQEAPRNIEISSVNEKGNV  209

Query  1219  EEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTP  1040
             E    +    + S   GS+HQ    P      + S+        ++ +   QT  P+Y+ 
Sbjct  210   EGRVQNVTVASSSSCFGSIHQ---DPTFNPSPTLSNQVQYNARPIELEISSQTKDPKYSK  266

Query  1039  EINVN----TAAKKPAQFEVASAEAELDMLLGSFAETKFL------ESNRVTEESWDNSF  890
             + N       + KK ++ E  +AEAELDMLL SF++T  L       S+R+ E S     
Sbjct  267   QANTKYTTENSNKKLSKLEATTAEAELDMLLNSFSDTIDLGTTAASSSSRIDEVS-----  321

Query  889   LTQNDVSSSFSERGSLS-QKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTN  713
                   SS    +G  S +K P  S                 +LDD +D+LL++TS  T+
Sbjct  322   ----KPSSHLPHKGPYSTKKAPIAS-----------------QLDDALDELLQDTSYPTH  360

Query  712   KNEGSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             K E  +    +S       S +  T S   DDFDSW D+I
Sbjct  361   K-EKPINTHIQSL------SLHSGTNSIANDDFDSWIDSI  393



>ref|XP_010522583.1| PREDICTED: uncharacterized protein LOC104801157 [Tarenaya hassleriana]
 ref|XP_010522584.1| PREDICTED: uncharacterized protein LOC104801157 [Tarenaya hassleriana]
 ref|XP_010522585.1| PREDICTED: uncharacterized protein LOC104801157 [Tarenaya hassleriana]
 ref|XP_010522587.1| PREDICTED: uncharacterized protein LOC104801157 [Tarenaya hassleriana]
Length=425

 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 229/475 (48%), Gaps = 90/475 (19%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVK----EKPVQGH  1730
             MDAK+LAKSKRAHSLHHSKK+   H  K            KKQ G Q      + PVQ  
Sbjct  1     MDAKALAKSKRAHSLHHSKKSHSGHKPKVQPESSENVRNLKKQQGNQAAAENAKNPVQSR  60

Query  1729  GSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQ  1550
                 LPSNWDRY E+ + +    S N+    ++     D + PKSKGADY +LI+EA+A+
Sbjct  61    RQPALPSNWDRYDEDLDLDMDSTSGNLSVDQTI-----DAIIPKSKGADYRHLIAEAEAE  115

Query  1549  S---LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEAS  1382
             S   +   S S+   DDVLHD F + +G +LS KG+ I S I DDNF  ED      E +
Sbjct  116   SQSKINIVSDSLCSLDDVLHDEFSRLVGSMLSAKGEGILSWIEDDNFIVEDGSASSHEPA  175

Query  1381  FLSLNLHTLAEQLAKATLSERLFIEPDLLPPE-LCTEELQKLSENEQAKNKAGVAEEVFD  1205
             FLSLNL+ LAE+L K  L E L++E D+   E L  ++ Q+ S+  Q    A + +  F 
Sbjct  176   FLSLNLNALAEKLEKVELHEALYVEADIFLTEPLNGDQGQRQSQTIQEAQAASMVQPDF-  234

Query  1204  SSAHRNGSEESGSMHQYL-RS--PYNTAGtstssstSARDEILQAKGI----GQTDLPRY  1046
                  +G E+   +   + RS   Y+T                Q K I    G+T+ P  
Sbjct  235   -----SGKEKLEWLEPIVPRSDLEYDTDS--------------QVKDIPIITGRTEKPSN  275

Query  1045  TPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSS  866
             T E       K PA       EAELDMLL SFAE    ES+       +++F T +  S 
Sbjct  276   TLE-----DVKSPA------FEAELDMLLDSFAENGVQESHNKPRPVRNSTFHTGS--SD  322

Query  865   SFSERGSLSQKVPTRSDV-----TDPDPGLGGT-----AARDM--------------KLD  758
             + SE+ S  Q     S++       P  GL  +       RD+              + D
Sbjct  323   NASEKSSAFQWTSAESELDTLLNASPASGLQESDDKPNPVRDLTKETNPSDKMLQAARFD  382

Query  757   DIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             +++DDLL +TS            +     +N  +SS+ V +SK+ D+FDSW DTI
Sbjct  383   EVLDDLLGQTS------------DTLKPQQNQTASSSSVGRSKVLDEFDSWLDTI  425



>ref|XP_011043605.1| PREDICTED: uncharacterized protein LOC105139018 isoform X1 [Populus 
euphratica]
Length=474

 Score =   153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 171/510 (34%), Positives = 236/510 (46%), Gaps = 111/510 (22%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MD K+LAKSKRAH+L H+K                   G K    ++  + P  G+  + 
Sbjct  1     MDTKALAKSKRAHTLQHNK-------------------GKKPHPNQKPSKTPSTGNNQKP  41

Query  1720  ---GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATD----VVAPKSKGADYAYLISE  1562
                 LPSNWDRY ++ E+E+G + EN    +S   +  D    +  PKSKGAD+ YL+ E
Sbjct  42    QKSKLPSNWDRYGDDEEDEFGVNLENPSGDNSKKPSFKDYGDGLALPKSKGADFRYLLDE  101

Query  1561  AKAQSLYSSSHSV---PLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP  1394
             AK     S  H V   P  +  L  +   G+GPLL+V+G+SI S I DDNF  ED+    
Sbjct  102   AK-----SKPHQVDDFPFLEHFLAEESMHGVGPLLAVRGESILSWIGDDNFVVEDETTSS  156

Query  1393  DEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELC--TEELQKLSENEQAKNKAGVA  1220
              EASFLSLNLH LAEQLAK  +SERLFIE DLLP EL   T   Q+  + +   ++AG  
Sbjct  157   HEASFLSLNLHALAEQLAKVDVSERLFIEADLLPTELGSNTSSSQEFDQMQTTGSEAG--  214

Query  1219  EEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKG--------IGQ  1064
                       +G     + H   +     +G  T    S +++ +            IG 
Sbjct  215   --------GNHGPNRKQTTHD--KETKTISGELTFEDLSEKNKAVNQDAEIFVSGLTIGN  264

Query  1063  TDLPRYTPEINV--------------NTAAKKPAQFEVASA--------------EAELD  968
             +D   +   ++V              + A + PAQ    S               E+ELD
Sbjct  265   SDPISFIQGLDVKDNLNLNQHGKFNQSAAMESPAQLYACSVAPSSRLPAFEAAAAESELD  324

Query  967   MLLGSFAETKFLESN-------RVTEESWDNSF--LTQNDVSSSFSERGS------LSQK  833
             MLL S +ETK L+S+        V+E+        LT+N   S+ +   +      L   
Sbjct  325   MLLDSLSETKLLDSSGFGSGTLPVSEKEAAVPLPQLTRNAPGSAKTTPTAATLDNVLDDL  384

Query  832   VPTRSDVTD---PDPGLGGTAARDMK-------LDDIVDDLLRETSILTNKNEGSLGDEA  683
             +   SD+ +   P P L   A   +K       LDD++DDL  ETS L N+N      E 
Sbjct  385   LEESSDLQEAAAPLPLLARNAHGSLKTTSTAATLDDVLDDLFEETSSLPNQNNLYQPSER  444

Query  682   RSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             ++      SSS  V KSK+ DDFDSW DTI
Sbjct  445   KADHVIQSSSSQSVNKSKVLDDFDSWLDTI  474



>ref|XP_010494418.1| PREDICTED: uncharacterized protein LOC104771572 [Camelina sativa]
Length=387

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 162/445 (36%), Positives = 219/445 (49%), Gaps = 68/445 (15%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD+KSLAKSKRAH+ HH+KK+   H  KG           +K  G Q K  PVQ      
Sbjct  1     MDSKSLAKSKRAHTQHHNKKSHSVHKPKGPVVSEK---NPEKLQGNQTK-TPVQSRRVSA  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSNWDRY +  ++E    +++     S+S+  TDV  PKSKGADY +L+SEA+A+S   
Sbjct  57    LPSNWDRYDDGDDDELDAAADS-----SISQTTTDVTLPKSKGADYLHLLSEAQAESPSK  111

Query  1546  LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP-DEASFLS  1373
             +  SS  +   DD+LHD F + +G ++S +G+ I S + DDNF  E+ G     E  FLS
Sbjct  112   IDVSSDCLSSLDDLLHDEFSRVVGSMISARGEGILSWMEDDNFVVEEDGSASYQEPGFLS  171

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLP-PELCTEELQKLSENEQAKNKAGVAEEVFDSSA  1196
             LNL+ LAE L K  L ERL+IEPDLLP PELCT +  K+S +E+        E V     
Sbjct  172   LNLYALAETLEKVDLHERLYIEPDLLPLPELCTSQ-SKVSCDEED------TEAVLTRLN  224

Query  1195  HRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAA  1016
                  E SG +           G S+     ++D++         D+P    E +V ++A
Sbjct  225   KPAQQESSGKVK------VAAQGVSSVLEAESQDQV--------KDIPILADE-SVKSSA  269

Query  1015  KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSL--  842
                        E +LD LL S +ET    S      S  N   +    S+  +E  SL  
Sbjct  270   ----------IEDDLDFLLNSVSETHAQPSPVANASSTSNQNPSVQKSSAFETELDSLLN  319

Query  841   --SQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFR  668
               S   P  +     D  L  +       DD++DDLL  TS        S+  +     +
Sbjct  320   FHSSAEPYNNPANSSDQKLHTSG-----FDDVLDDLLESTS-------SSIKPQ-----Q  362

Query  667   NTPSSSNPVTKSKLTDDFDSWFDTI  593
             N  SSS  V KSK+ DDFDSW DTI
Sbjct  363   NQTSSSPSVGKSKVLDDFDSWLDTI  387



>gb|KHF99833.1| Phosphorelay luxU [Gossypium arboreum]
Length=397

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 160/447 (36%), Positives = 232/447 (52%), Gaps = 63/447 (14%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS HHSKK      SK  S   +  +  KKQ+ KQ+KEK  Q      
Sbjct  2     MDAKALAKSKRAHSQHHSKKPHSVQKSKPPSPGVNEPSNSKKQTIKQIKEKAHQAQRISA  61

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNW+RY      E  FDS +  P  +      DV+ PK     ++ L S         
Sbjct  62    LPSNWNRY------EEEFDSGSEDPNQT-----PDVIVPKR----FSQLQSNPY------  100

Query  1537  SSHSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLH  1361
              S+++P  DDV   DF Q +G +L+V+G+ I S   +DNF  +D      EASFLSLNLH
Sbjct  101   -SNNIPSLDDVFPGDFNQFVGSMLAVRGEGILSWTGNDNFVVDDSTTATPEASFLSLNLH  159

Query  1360  TLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAHRNGS  1181
              LAEQL K  LSERLFIE DLLPP+L +E  +   +N+Q  ++     +  +++    G 
Sbjct  160   ALAEQLEKVDLSERLFIEEDLLPPDLRSERSK--VKNDQEPDQMQAPPDQKEAAKITEGP  217

Query  1180  EESGSMHQYLRSPYNTAGtstssstSAR---DEILQAKGI------GQTDLPRYTPEINV  1028
                        +P +  G+    +  +    D + + +G+      G++   R    +N 
Sbjct  218   -----------TPNDLPGSKAIDAILSNSGLDSMAEVQGVSISGQHGESSESRAPNNLNS  266

Query  1027  NTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERG  848
              TA+ K        AEA+LDMLL SF ETK L+++ ++ +   +S +     S+  S   
Sbjct  267   TTASNKKV-----PAEAKLDMLLNSFNETKLLDTSDLSSKK--SSSIGSLKASNLDSLLD  319

Query  847   SLSQKVPTRSDVTDPDPGL--GGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSA  674
              L Q+  T  +      G+    TAA +   +D++DDLL+ETS  +   +  LG +  + 
Sbjct  320   DLLQETSTTVNR-----GIDSSKTAAVNSTSEDLLDDLLQETS--STIVDAKLGSD--NN  370

Query  673   FRNTPSSSNPVTKSKLTDDFDSWFDTI  593
              R++ SSS  V+KSK+ +DFDSW DTI
Sbjct  371   VRSSSSSSQSVSKSKILNDFDSWLDTI  397



>ref|XP_006446713.1| hypothetical protein CICLE_v10015198mg [Citrus clementina]
 ref|XP_006446714.1| hypothetical protein CICLE_v10015198mg [Citrus clementina]
 gb|ESR59953.1| hypothetical protein CICLE_v10015198mg [Citrus clementina]
 gb|ESR59954.1| hypothetical protein CICLE_v10015198mg [Citrus clementina]
Length=456

 Score =   144 bits (364),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 127/214 (59%), Gaps = 16/214 (7%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS  H  K+  +   K        +   +KQ GKQ      +      
Sbjct  1     MDAKALAKSKRAHSQQHKNKSHPNQKLKAPVVASDNAGSKEKQPGKQAGAGTREARRLSK  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY          D  +M  +D+ S+A +D V PKSKGADY +LI+EA++QSL  
Sbjct  61    LPSNWDRYE---------DGSDMDSEDTTSQA-SDFVVPKSKGADYRHLIAEAQSQSLSQ  110

Query  1537  SSH-----SVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFL  1376
             S       + PL DDV+   F  G+GP+LSV+G+ I S + DDNF  EDK     EASFL
Sbjct  111   SQSHSYSDTFPLLDDVMPGGFAPGMGPMLSVRGEGILSWVGDDNFVVEDKTTAFQEASFL  170

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTE  1274
             SLNL+ LAE LAK  LS+RLF+E DLLP E  TE
Sbjct  171   SLNLNALAEHLAKVDLSQRLFVEADLLPSESGTE  204



>ref|XP_006403135.1| hypothetical protein EUTSA_v10003234mg [Eutrema salsugineum]
 gb|ESQ44588.1| hypothetical protein EUTSA_v10003234mg [Eutrema salsugineum]
Length=371

 Score =   142 bits (358),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 150/449 (33%), Positives = 213/449 (47%), Gaps = 92/449 (20%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQV----KEKPVQGH  1730
             MD K+LAKSKRAH+ HH KK+   H  KG +        +KK  G Q      + PVQ  
Sbjct  1     MDTKALAKSKRAHTQHHFKKSHSVHKPKGVTETSK--NPEKKPQGNQTGALKTKSPVQSR  58

Query  1729  GSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQ  1550
                 LPSNWDRY  + E + G D+       S   + ++V+ PKSKGADY +LISEA+A+
Sbjct  59    RVSALPSNWDRY--DDELDLGLDNA------SGDSSTSEVIVPKSKGADYLHLISEAQAE  110

Query  1549  S---LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEAS  1382
             S   + ++S  +   DD+LHD F + +G ++S +G+ I S + DDNF  E+ G   +   
Sbjct  111   SQSKIETNSDCLSSLDDLLHDEFSRVVGSMISARGEGILSWMEDDNFIVEEDGSASNH-E  169

Query  1381  FLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDS  1202
             FLSLNL+ L + L K  L ERL+IE D+LPPELCT                     V  +
Sbjct  170   FLSLNLNALEKMLEKVDLHERLYIEADVLPPELCT---------------------VQSN  208

Query  1201  SAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQT-DLPRYTPEINVN  1025
              +H      S  +   L  P                 +L+A+ + Q  D+P  T +    
Sbjct  209   VSHDEEPCHSKDITMRLNEPVQ----------QEESSVLEAESLDQVKDIPILTDQ----  254

Query  1024  TAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSER--  851
               ++K ++      EA++D+LL S+++    E N V   S      T    SS+F +   
Sbjct  255   --SEKSSEI-----EADIDLLLNSYSD----EPNSVASAS-----STSIQKSSAFEDELD  298

Query  850   ---GSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEAR  680
                 S S+  P        D  L  T       DD++DDLL  TS+             +
Sbjct  299   SLLNSRSEAEPFNKPAKPSDQKLKSTG-----FDDVLDDLLESTSV-----------SIK  342

Query  679   SAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
                  T SSS+ V KSK+ D+FDSW DTI
Sbjct  343   PQQSQTSSSSSSVGKSKVLDEFDSWLDTI  371



>ref|XP_007134956.1| hypothetical protein PHAVU_010G089800g [Phaseolus vulgaris]
 gb|ESW06950.1| hypothetical protein PHAVU_010G089800g [Phaseolus vulgaris]
Length=407

 Score =   142 bits (357),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 161/453 (36%), Positives = 228/453 (50%), Gaps = 64/453 (14%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQS-GKQV--KEKPVQGHG  1727
             MD K+LAKSKR+H+ HHSKK+   H  K  SS  S      K   GKQ   +EK  + H 
Sbjct  1     MDVKALAKSKRSHTQHHSKKSHHSHKPKAQSSSSSDPKDPAKNPPGKQQVNEEKKKKSHR  60

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
             S  LPSNWDRY        G + ++  P+  ++    DVV PKSKGADY +L++EA++ +
Sbjct  61    SV-LPSNWDRY--------GEEEDDSTPE--IASKTLDVVLPKSKGADYRHLVAEAQSHA  109

Query  1546  LYSSSHSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSL  1370
               +S    P FDD+L  +F  GL  +L+ +G+ I     DDNF  EDK     EASFLSL
Sbjct  110   -ETSLEGFPAFDDLLLGEFGVGLSSMLASRGEGIILWNGDDNFVVEDKTSGNQEASFLSL  168

Query  1369  NLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAHR  1190
             NL  LA+  AK  LS+RLFIE DLL  ELC EEL  ++ NE+ K      +    +S  +
Sbjct  169   NLLALADNFAKVDLSKRLFIESDLLSTELCAEELA-VNSNEEHKELETKEDNELANSMSK  227

Query  1189  NGSEESGSMHQYLRSPYNTAGtstssstSARD----------EILQAKGIGQTDLPRYTP  1040
               + ++ +  Q+  S  +++  ++S+   + D          E  QA   G+      + 
Sbjct  228   EFNLDNRAADQFAPSSSSSSSPASSTFPLSNDFNIPVNSVIAEFQQASSSGKHKAFVLSS  287

Query  1039  EINVNTA----AKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDV  872
             + ++++      K+ + FE A+AE ELDMLL S                          V
Sbjct  288   DSSLHSTEHMRGKQYSTFEAAAAEKELDMLLDSPVSL---------------------GV  326

Query  871   SSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLG  692
             SS +  +            +   DP     A+    LDD +DDLL ETS +   N   L 
Sbjct  327   SSGYPPQ------------ILKKDPVSSKIASITASLDDALDDLLEETSTVIKPNVLLLP  374

Query  691   DEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
              E +    +  SSS+P +KSK+TDDFDSWFDT+
Sbjct  375   QEEKPVNHSMKSSSHPGSKSKVTDDFDSWFDTL  407



>ref|XP_003526252.1| PREDICTED: uncharacterized protein LOC100790093 [Glycine max]
 gb|KHN07784.1| hypothetical protein glysoja_033870 [Glycine soja]
Length=433

 Score =   142 bits (357),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 173/462 (37%), Positives = 229/462 (50%), Gaps = 56/462 (12%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaS-------TGDKKQSGKQ--VKEK  1745
             MD K+LAKSKR+H+ HHSK +   H    A+S  S+S          K   GKQ   +EK
Sbjct  1     MDVKALAKSKRSHTQHHSKNSHHSHKPNKAASSSSSSSSVGPNDAAKKNPLGKQQVSEEK  60

Query  1744  PVQGHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLIS  1565
               + H S  LPSNWDRY +        + E +     ++    DVV PKSKGAD+ +L++
Sbjct  61    KKKSHHS-ALPSNWDRYED--------EEEELDSGSGIASKTVDVVLPKSKGADFRHLVA  111

Query  1564  EAKAQSLYSSS-HSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPD  1391
             EA  QSL  +S    P F+D+L  +F  GL  +L V+G+ I S   DDNF  EDK     
Sbjct  112   EA--QSLAETSLEGFPAFNDLLPGEFGVGLSSMLVVRGEGIVSWAGDDNFVVEDKTNGNL  169

Query  1390  EASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCT-----------EELQKLSENEQ  1244
             EASFLSLNLH LAE  AK  L++RLFIE DLLP ELC            EEL+   E+E 
Sbjct  170   EASFLSLNLHALAESFAKVDLAKRLFIEADLLPTELCVEESAMSSSEEHEELKTKDESEL  229

Query  1243  AKNKAGVAEEV-FDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIG  1067
             A     ++EE+  D  A       S S   +  S +  +            E  Q    G
Sbjct  230   ANR---MSEELDVDDLAADQFISSSSSSSSHAASTFPLSNDFRIPVNYVDAEAQQTSSSG  286

Query  1066  QTDLPRYTPEINVN----TAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWD  899
             +      + + +++    T  K  + FE A AE ELDMLL SF ET  L+S+       +
Sbjct  287   KNKAFVLSSDASLHSTEDTRGKPYSTFEAADAEKELDMLLDSFGETNILDSSGFKS---N  343

Query  898   NSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSIL  719
              S    + V+S +    S    VP++            TA     LDD++DDLL  TS L
Sbjct  344   TSIPVSSGVASVYPPHISNKDPVPSK------------TAPITASLDDVLDDLLEGTSTL  391

Query  718   TNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             TN N      E +    +  SSSN  +KSK+ DDFDSWFDT+
Sbjct  392   TNPNVLLRPQEEKPVHHSMQSSSNSGSKSKVADDFDSWFDTL  433



>emb|CDY36980.1| BnaC09g17960D [Brassica napus]
Length=364

 Score =   137 bits (346),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 149/445 (33%), Positives = 213/445 (48%), Gaps = 91/445 (20%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD K+LAKSKRAH+ HHSKK+   H  K            +K    Q K  PVQ      
Sbjct  1     MDTKALAKSKRAHTQHHSKKSHPLHKPK----------APEKGQVNQTK-SPVQSRRVSA  49

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSN +RY  + E + G  +              DV+ PKSKGADY +LISEAKA+S   
Sbjct  50    LPSNLNRY--DDEPDLGLSTNQ----------PADVIVPKSKGADYLHLISEAKAESHSK  97

Query  1546  LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPD-EASFLS  1373
             + +SS  +   DD+LHD F + +G ++S +G+ + S + DDNF  E+ G   + E  FLS
Sbjct  98    IENSSDCLSSLDDLLHDEFSRVVGSMISARGEGMLSWMEDDNFIVEEDGSASNHEPGFLS  157

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAH  1193
             L+L+ L + L K  + ERL+IE DLLPPELCT           A++K    +E++   +H
Sbjct  158   LDLNALEKMLEKVEVHERLYIEADLLPPELCT-----------AQSKVSQDKELY--CSH  204

Query  1192  RNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAAK  1013
              +  EE+ +                    ++ ++++Q +  G+ D P+      +     
Sbjct  205   TSQDEEAVT--------------------TSLNKLVQQESSGKID-PQGKSSSALKDMQT  243

Query  1012  KPAQFEVAS-AEAELDMLLGSFA-ETKFLESNRVTEE---SWDNSFLTQNDVSSSFSERG  848
                Q E++S  EA+LD LL SF+ E K + S   T     S   S   + ++ S  S  G
Sbjct  244   LTDQPEISSEVEADLDFLLDSFSKEPKPVASASSTSSQNPSVQRSSAFETELDSLLSSHG  303

Query  847   SLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFR  668
                   P+   +T  D              D++DDLL  TS+ T   E            
Sbjct  304   GAEPANPSDQKLTTTD------------FVDMLDDLLESTSVATKPQEN-----------  340

Query  667   NTPSSSNPVTKSKLTDDFDSWFDTI  593
              TP SS  V KSKL ++FDSW DTI
Sbjct  341   QTPLSST-VGKSKLIEEFDSWLDTI  364



>gb|AFK34852.1| unknown [Medicago truncatula]
Length=219

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 125/217 (58%), Gaps = 21/217 (10%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MD KSLAKSKR H+ H+ K +  H       S     +         VKE+ ++   +R 
Sbjct  1     MDVKSLAKSKRNHTQHNKKHHANHKPKLQPQSHSPFLSSSNPNQNGAVKERAIEKKTNRS  60

Query  1720  -----GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAK  1556
                   LP NWDRY EE       DS   VP+  +     DVV PKSKGAD+ +L++EA+
Sbjct  61    KRDSSALPGNWDRYEEEE-----LDS---VPE--IGSKTLDVVVPKSKGADFRFLVAEAQ  110

Query  1555  AQSLYSSSHSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASF  1379
             +    ++  ++  F++ L  +F  GL  +L V+G+ I S + DDNF  +DK     EASF
Sbjct  111   S----NADKTLDGFNEALPWEFGVGLSSILEVRGEGIVSWVGDDNFVVQDKTSAYQEASF  166

Query  1378  LSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEEL  1268
             +SLNLH +AE+LAK  LS+RLFIEPDLLP ELC E+L
Sbjct  167   ISLNLHAIAEKLAKVDLSKRLFIEPDLLPSELCVEDL  203



>ref|XP_010481773.1| PREDICTED: uncharacterized protein LOC104760528 [Camelina sativa]
Length=386

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 152/441 (34%), Positives = 209/441 (47%), Gaps = 61/441 (14%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD+KSLAKSKRAH+ HH+KK+   H  KG           +K  G Q    PVQ      
Sbjct  1     MDSKSLAKSKRAHTQHHNKKSHSVHKPKGPVVSEK---NQEKLQGNQTN-TPVQSRRVSA  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSNWDRY ++ ++    +        S+S+  TDV  PKSKGADY  LISEA+A+S   
Sbjct  57    LPSNWDRYDDDDDDLDAAEDS------SISQTTTDVTLPKSKGADYVILISEAQAESQSK  110

Query  1546  LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP-DEASFLS  1373
             +  SS  +   DD+LHD F + +G ++S + + I S + DDNF  E  G     E  FLS
Sbjct  111   IDVSSDCLSSLDDLLHDEFSRVVGSMISARREGILSWMEDDNFVVEADGSASYQEPGFLS  170

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLP-PELCTEELQKLSENEQAKNKAGVAEEVFDSSA  1196
             LNL+ LAE L K  L ERL+IEPDLLP  ELCT +  K+S +E+       AE +     
Sbjct  171   LNLNALAETLEKVDLHERLYIEPDLLPLSELCTAQ-SKVSRDEED------AESMI---T  220

Query  1195  HRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAA  1016
              RN   + GS  +   +    +             +L+A+ + Q        E +V ++A
Sbjct  221   RRNEQAQQGSSRKVKVAAQGVSS------------VLEAESLDQVKEIPILAEESVKSSA  268

Query  1015  KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQ  836
                        E +LD LL + +E            S  N   +    S+  +E  SL  
Sbjct  269   ----------IEDDLDFLLNNVSEAHTQPKPVANASSTSNQNPSVQKSSAFETELDSLLN  318

Query  835   KVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTPS  656
                +     +P     G        DD++DDLL  TS        S+  +     +N  S
Sbjct  319   FHSSAEPYNNP-ANSSGQKLHTTGFDDVLDDLLESTS-------ASIKPQ-----QNQTS  365

Query  655   SSNPVTKSKLTDDFDSWFDTI  593
             SS  V KSK+ D+FDSW DTI
Sbjct  366   SSPSVGKSKVLDEFDSWLDTI  386



>gb|AES89714.2| hypothetical protein MTR_4g079100 [Medicago truncatula]
Length=411

 Score =   133 bits (335),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 125/217 (58%), Gaps = 21/217 (10%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MD KSLAKSKR H+ H+ K +  H       S     +         VKE+ ++   +R 
Sbjct  1     MDVKSLAKSKRNHTQHNKKHHANHKPKLQPQSHSPFPSSSNPNQNGAVKERAIEKKTNRS  60

Query  1720  -----GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAK  1556
                   LP NWDRY     EE   DS   VP+  +     DVV PKSKGAD+ +L++EA+
Sbjct  61    KRDSSALPGNWDRY-----EEEELDS---VPE--IGSKTLDVVVPKSKGADFRFLVAEAQ  110

Query  1555  AQSLYSSSHSVPLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASF  1379
             +    ++  ++  F++ L  +F  GL  +L V+G+ I S + DDNF  +DK     EASF
Sbjct  111   S----NADKTLDGFNEALPWEFGVGLSSILEVRGEGIVSWVGDDNFVVQDKTSAYQEASF  166

Query  1378  LSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEEL  1268
             +SLNLH +AE+LAK  LS+RLFIEPDLLP ELC E+L
Sbjct  167   ISLNLHAIAEKLAKVDLSKRLFIEPDLLPSELCVEDL  203



>ref|XP_002863607.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39866.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=371

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 146/445 (33%), Positives = 201/445 (45%), Gaps = 84/445 (19%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD+KSLAKSKRAH+ HHSKK+   H  KG           +K  G Q K  PVQ      
Sbjct  1     MDSKSLAKSKRAHTQHHSKKSHSVHKPKGPGVSEK---NPEKLQGTQTK-SPVQSRRVSA  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSNWDRY          D E    +DS     +DV+ PKSKGADY +LISEA+A S   
Sbjct  57    LPSNWDRY----------DDELDAAEDSSISQPSDVILPKSKGADYLHLISEAQAVSHSK  106

Query  1546  LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP-DEASFLS  1373
             + ++   +   DD+LHD F + +G ++S + + I S + DDNF  ++ G     E  FLS
Sbjct  107   IENNLDCLSSLDDLLHDEFSRVVGSMISARREGILSWMEDDNFVVDEDGSASYQEPGFLS  166

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLP-PELCTEELQKLSENEQAKNKAGVAEEVFDSSA  1196
             LNL+ LA+ L K  L ERL+IEPDLLP  ELCT +  K+S NE+               +
Sbjct  167   LNLNALAKTLEKVDLHERLYIEPDLLPLSELCTSQ-TKVSRNEEP--------------S  211

Query  1195  HRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAA  1016
             H + +E           P    G S      + D +         D+P  T E   ++A 
Sbjct  212   HSHTAE---------NDPVVVPGESLVVEAESLDLV--------NDIPILTDESGKSSAI  254

Query  1015  KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSL--  842
                        E +LD+LL SF+E+    +   +  S  N   +    S+  +E  SL  
Sbjct  255   -----------ETDLDLLLNSFSESHTQPNPVASSSSTSNQNRSVQKSSAFETELDSLLN  303

Query  841   --SQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFR  668
               S + P        D  +  T       +D++DDLL  TS+ +   +      +     
Sbjct  304   SHSSEEPYNKPANPSDQKIHTTG-----FNDVLDDLLESTSVSSKPKQTQTSSSSSVGKS  358

Query  667   NTPSSSNPVTKSKLTDDFDSWFDTI  593
                            DDFDSW DTI
Sbjct  359   KV------------LDDFDSWLDTI  371



>ref|NP_199228.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AED95067.1| uncharacterized protein AT5G44150 [Arabidopsis thaliana]
Length=355

 Score =   128 bits (321),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 131/224 (58%), Gaps = 21/224 (9%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD+KSLAKSKRAH+LHHSKK+   H  K            +K  G Q K  PVQ      
Sbjct  1     MDSKSLAKSKRAHTLHHSKKSHSVHKPKVPGVSEK---NPEKLQGNQTK-SPVQSRRVSA  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSNWDRY          D E    +DS     +DV+ PKSKGADY +LISEA+A+S   
Sbjct  57    LPSNWDRY----------DDELDAAEDSSISLHSDVIVPKSKGADYLHLISEAQAESNSK  106

Query  1546  LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP-DEASFLS  1373
             + ++   +   DD+LHD F + +G ++S +G+ I S + DDNF  E+ G     E  FLS
Sbjct  107   IENNLDCLSSLDDLLHDEFSRVVGSMISARGEGILSWMEDDNFVVEEDGSGSYQEPGFLS  166

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLP-PELCTEELQKLSENEQ  1244
             LNL+ LA+ L    L ERL+I+PDLLP PEL T +  K+S NE+
Sbjct  167   LNLNVLAKTLENVDLHERLYIDPDLLPLPELNTSQ-TKVSRNEE  209



>ref|XP_004961216.1| PREDICTED: uncharacterized protein LOC101773758 [Setaria italica]
Length=457

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 128/430 (30%), Positives = 188/430 (44%), Gaps = 64/430 (15%)
 Frame = -1

Query  1735  GHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAK  1556
             G  SR LPSNWDRY          D+E      + +   T  VAP+SKGAD+ +L+ +A+
Sbjct  43    GPRSRNLPSNWDRY----------DAEGEAEDPAPAAEWTGEVAPRSKGADFGFLLEQAR  92

Query  1555  AQSLYSSSHSVPLF--DDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEAS  1382
             AQ   +     P     D   DF Q    +   KG+ I S  +DDNF  ED   P  E  
Sbjct  93    AQPREARGLGAPWLPSQDSPFDFMQASTSMFEAKGEGILSWCADDNFILEDDLAPDFEVP  152

Query  1381  FLSLNLHTLAEQLAKATLSERLFIEPDLLPPELC-----TEELQKLSENEQAKNKAGVAE  1217
             FLS++LH LA QL+K  LS+RLF+E DLLP +L       E L +   + ++  K     
Sbjct  153   FLSMDLHALANQLSKLKLSQRLFVEEDLLPEDLADASKDNEILIECDTSVESDAKVSSVG  212

Query  1216  EVFDSSAHRNGSEESGSMHQY----LRSPYNTAGtstssstSARDEILQAKGIGQTDLP-  1052
                +    ++ S    + + Y    ++S   +      ++TS +          + D   
Sbjct  213   HNLNFEPWKDASHHECAGNTYSDDQMKSERQSQCFEHEATTSPKISTHLVNSDSEEDKTY  272

Query  1051  RYTPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESN-----------RVTEES  905
             + T + + +T   K  +FEV SAE ELDMLL SF+ T    SN           +  + S
Sbjct  273   KRTMDTDPDTGLSKGLKFEVGSAEEELDMLLNSFSGTHLSSSNLDESFGHDSTSQGAKIS  332

Query  904   WDNSFLTQNDVSSS------------------------FSERGSLSQKVPTRSDVTDPDP  797
             W N  +T +  S S                        F+ + S SQ  PT     + D 
Sbjct  333   WSNKKVTPSMSSQSPLAPVDNALDDLLSETSIPEQNEGFATQVSTSQ--PTVRSGQNFDS  390

Query  796   GLGGTAARDMKLDDIVDDLLRETSILTN--KNEGSLGDEARSAFRNTPSSSNPVTKSKLT  623
             G          +DD VD+LL  TS+  +  K   ++     +   + P+ S P   S  +
Sbjct  391   GYAMKIDVIASIDDSVDNLLEGTSLCLSEPKETTTVQGPNTTPHDSVPTHSGP---SNAS  447

Query  622   DDFDSWFDTI  593
             DDFDSWFD++
Sbjct  448   DDFDSWFDSL  457



>dbj|BAB10982.1| unnamed protein product [Arabidopsis thaliana]
Length=352

 Score =   127 bits (320),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 131/223 (59%), Gaps = 22/223 (10%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD+KSLAKSKRAH+LHHSKK+   H  K            +K  G Q K  PVQ      
Sbjct  1     MDSKSLAKSKRAHTLHHSKKSHSVHKPKVPGVSEK---NPEKLQGNQTK-SPVQSRRVSA  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSNWDRY          D E    +DS     +DV+ PKSKGADY +LISEA+A+S   
Sbjct  57    LPSNWDRY----------DDELDAAEDSSISLHSDVIVPKSKGADYLHLISEAQAESNSK  106

Query  1546  LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSL  1370
             + ++   +   DD+LHD F + +G ++S +G+ I S + DDNF  E+ G    +  FLSL
Sbjct  107   IENNLDCLSSLDDLLHDEFSRVVGSMISARGEGILSWMEDDNFVVEEDGSV--KPGFLSL  164

Query  1369  NLHTLAEQLAKATLSERLFIEPDLLP-PELCTEELQKLSENEQ  1244
             NL+ LA+ L    L ERL+I+PDLLP PEL T +  K+S NE+
Sbjct  165   NLNVLAKTLENVDLHERLYIDPDLLPLPELNTSQ-TKVSRNEE  206



>gb|AAQ22611.1| At5g44150 [Arabidopsis thaliana]
 dbj|BAE99596.1| hypothetical protein [Arabidopsis thaliana]
Length=355

 Score =   126 bits (316),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 130/224 (58%), Gaps = 21/224 (9%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD+KSLAKSKRAH+LHHSKK+   H  K            +K  G Q K  PVQ      
Sbjct  1     MDSKSLAKSKRAHTLHHSKKSHSVHKPKVPGVSEK---NPEKLQGNQTK-SPVQSRRVSA  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSNWDRY          D E    +DS     +DV+ PKSKGADY +LISEA+A+S   
Sbjct  57    LPSNWDRY----------DDELDAAEDSSISLHSDVIVPKSKGADYLHLISEAQAESNSK  106

Query  1546  LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP-DEASFLS  1373
             + ++   +   DD+LHD F + +G ++S  G+ I S + DDNF  E+ G     E  FLS
Sbjct  107   IENNLDCLSSLDDLLHDEFSRVVGSMISAGGEGILSWMEDDNFVVEEDGSGSYQEPGFLS  166

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLP-PELCTEELQKLSENEQ  1244
             LNL+ LA+ L    L ERL+I+PDLLP PEL T +  K+S NE+
Sbjct  167   LNLNVLAKTLENVDLHERLYIDPDLLPLPELNTSQ-TKVSRNEE  209



>ref|XP_004505535.1| PREDICTED: uncharacterized protein LOC101496234 [Cicer arietinum]
Length=417

 Score =   127 bits (319),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 167/469 (36%), Positives = 226/469 (48%), Gaps = 86/469 (18%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGD--KKQSGK--QVKEKPV---  1739
             MD KSLAKSKR H+  H+KK+   H  K  SS P  +  D  K+  GK  QV EK     
Sbjct  1     MDVKSLAKSKRDHTRQHNKKHHGSHKLKVQSSGPGPNPNDAAKEPFGKQQQVIEKKTNRF  60

Query  1738  QGHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAAT---DVVAPKSKGADYAYLI  1568
             +  GS  LP NWDRY          + E +   DSV +++T   DVV PKSKGAD+ YL+
Sbjct  61    RSQGSSALPGNWDRY----------EEEEL---DSVPESSTKTLDVVVPKSKGADFRYLV  107

Query  1567  SEAKAQSLYSSSHSVPLFDDVLHDFYQ--------GLGPLLSVKGQSIASSISDDNFGSE  1412
             +EA++ +           D  L DF++        GL  +L V+G+   S + DDNF  +
Sbjct  108   AEAQSNA-----------DKTLDDFHELLPWEFGVGLSSILEVRGEGFVSWVGDDNFVVQ  156

Query  1411  DKGPPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEEL----------QK  1262
             DK     EASF+SLNLH +AE+LAK  LS+RLFIE DL+P EL  E+L          Q+
Sbjct  157   DKTSANQEASFISLNLHAIAEKLAKVDLSKRLFIESDLIPSELRVEDLTVDIDEEPDEQE  216

Query  1261  LSENEQAKNKAGVAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQ  1082
              +EN +   +      + D  A +  S  SGS      +P   +      + +   E  Q
Sbjct  217   TTENCELSERMSKELNLDDFVADQFTSCSSGSSSHLSSTPA-LSNDILIPANNINGEFQQ  275

Query  1081  AKGIGQTDLPRYTPEINVN-----TAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRV  917
             A   G+     + P I+ N        +K   FE A+AE ELDMLL S  ETK       
Sbjct  276   AGSSGKN--KAFQPSIDTNFHSNEDTVEKHTTFEAAAAEEELDMLLDSLDETK-------  326

Query  916   TEESWDNSFLTQNDVSSSF-SERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDL  740
                            S+SF    G  S  +P    +++  P     A+    LDD +DDL
Sbjct  327   --------------SSASFPVSLGVSSMDLPQ---ISNKKPVGTRIASITASLDDTLDDL  369

Query  739   LRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
             L ETS L N N   L  +      ++  SS+   KS ++DDFDSWFDT+
Sbjct  370   LEETSTLLNPN-VLLQSQDEKPVHHSMLSSHSQNKSPVSDDFDSWFDTL  417



>ref|XP_006281830.1| hypothetical protein CARUB_v10028019mg [Capsella rubella]
 gb|EOA14728.1| hypothetical protein CARUB_v10028019mg [Capsella rubella]
Length=385

 Score =   126 bits (316),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 160/445 (36%), Positives = 215/445 (48%), Gaps = 70/445 (16%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD KSLAKSKRAH+ HHSKK+   H  K +          +K  G Q K  PVQ      
Sbjct  1     MDTKSLAKSKRAHTQHHSKKSHSVHKQKVSVVSEK---NPEKLQGNQTK-TPVQSRRVSA  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSNWDRY ++ ++E      + + Q       TDV  PKSKGADY +LISEA+A+S   
Sbjct  57    LPSNWDRYSDDDDDELDAAEGSSISQ------TTDVTLPKSKGADYLHLISEAQAESHSK  110

Query  1546  LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFG-SEDKGPPPDEASFLS  1373
             +  +S  +   DD+LHD F + +G ++S +G+ I S + DDNF   ED+ P   E  FLS
Sbjct  111   IRINSDCLSSLDDLLHDEFSRVVGSMISARGEGIVSWMEDDNFVVEEDESPSYQEPGFLS  170

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLP-PELCTEELQKLSENEQAKNKAGVAEEVFDSSA  1196
             LNL+ LA  L K  L ERL+IEPDLLP PELCT           A++K G   + +D+ A
Sbjct  171   LNLNALANALEKVDLHERLYIEPDLLPLPELCT-----------AQSKVG--GDGYDAEA  217

Query  1195  HRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAA  1016
                       +   L  P     +           +L+A+ + Q        EI + T  
Sbjct  218   ----------VIARLNEPAQQEFSGKLKVAKGESSVLEAEFLDQVK------EIRILTDE  261

Query  1015  KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDV---SSSF-SERG  848
              + A    ++ E +LD LL S +E    + N V   S   S   QN     SS+F +E  
Sbjct  262   SEKA----SAIEDDLDFLLNSVSEA-HTQPNPVGNAS---STSNQNPCVQKSSAFETELD  313

Query  847   SLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFR  668
             SL     +     +PD    G        DD++DDLL  TS      +            
Sbjct  314   SLLNFHSSPEPYNNPDSS-SGQKLHTTGFDDVLDDLLESTSASIKPQQ------------  360

Query  667   NTPSSSNPVTKSKLTDDFDSWFDTI  593
             N  SSS+ V KSK+ D+FDSW DTI
Sbjct  361   NQTSSSSSVGKSKVLDEFDSWLDTI  385



>ref|XP_010445873.1| PREDICTED: uncharacterized protein LOC104728610, partial [Camelina 
sativa]
Length=380

 Score =   126 bits (316),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 103/175 (59%), Gaps = 15/175 (9%)
 Frame = -1

Query  1777  KKQSGKQVKEKPVQGHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPK  1598
             +K  G Q K  PVQ      LPSNWDRY ++  +             S+++  TDV  PK
Sbjct  33    EKLQGNQTK-TPVQSRRVSALPSNWDRYDDDELDAAE--------DSSINQTTTDVTIPK  83

Query  1597  SKGADYAYLISEAKAQS---LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISD  1430
             SKGADY +L+ EA+A+S   +  SS  +   DD+LHD F + +G ++S + + I S + D
Sbjct  84    SKGADYLHLLCEAQAESQSKIDVSSDCLSSLDDLLHDEFSRVVGSMISARREGILSWMED  143

Query  1429  DNFGSEDKGPPP-DEASFLSLNLHTLAEQLAKATLSERLFIEPDLLP-PELCTEE  1271
             DNF  E+ G     E  FLSLNL+ LAE L K  L ERL+IEPDLLP PELCT +
Sbjct  144   DNFVVEEDGSASYQEPGFLSLNLNALAETLEKVDLHERLYIEPDLLPLPELCTSQ  198



>gb|EPS58931.1| hypothetical protein M569_15881 [Genlisea aurea]
Length=311

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 151/259 (58%), Gaps = 14/259 (5%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD K+LAKSKRAH+L HS+KN    S K +          KK SG Q KEKP Q   SR 
Sbjct  1     MDVKALAKSKRAHTLQHSRKNPPPSSKKSSIGSEEK----KKTSGNQSKEKPPQFQVSRH  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS---  1547
             LPSNWDRY    ++  G  SE    Q    + + + VAPKSKGADYAYL+SEAKAQ+   
Sbjct  57    LPSNWDRY--NDDDASGSVSEEA--QTGSVQQSLEFVAPKSKGADYAYLLSEAKAQAQPQ  112

Query  1546  LYSSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLN  1367
             ++ ++++ P  DD    F    G +L+ +G+S+ S I DD+F  + +G    +  FLSLN
Sbjct  113   VHRTTNAFPFSDD---GFGVDFGSMLAERGESLFSWIQDDDFDFDGEGGSDFQVPFLSLN  169

Query  1366  LHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAHRN  1187
             L +LA++LAK+  SERLFIEP L+   L  E  ++ S +  + + +   ++  +S   R 
Sbjct  170   LDSLADRLAKSKPSERLFIEPGLIQERLDKELPEEKSSSSSSSSISLQMKDGRNSEFERR  229

Query  1186  GSEESGSMHQYLRSPYNTA  1130
               +ES S  Q +++P + A
Sbjct  230   RDQESVSQQQRVKNPSSEA  248



>ref|XP_002441519.1| hypothetical protein SORBIDRAFT_09g028510 [Sorghum bicolor]
 gb|EES19949.1| hypothetical protein SORBIDRAFT_09g028510 [Sorghum bicolor]
Length=458

 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 130/444 (29%), Positives = 188/444 (42%), Gaps = 91/444 (20%)
 Frame = -1

Query  1735  GHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAK  1556
             G  SR LPSNWDRY          D E    + +     T  VAP+SKGAD+ +L+ +A+
Sbjct  43    GPRSRNLPSNWDRY----------DDEGEAEESAAVGEWTGEVAPRSKGADFGFLLEQAR  92

Query  1555  AQSLYSSSHSVPLF--DDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEAS  1382
             AQ   +   S P     D+  DF Q    +   K + I S  +DDNF  ED   P  E  
Sbjct  93    AQPPGARDLSAPCLPSQDLPFDFMQASTSMFEAKSEGILSWCADDNFILEDDLAPDFEVP  152

Query  1381  FLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFDS  1202
             FLS++L+ LA  L+K  LS RLFIE DL P     E++    E+ +   +   + E+   
Sbjct  153   FLSMDLNALANHLSKIKLSRRLFIEEDLFP-----EDMADAPEDSEIAIEPDTSVEI---  204

Query  1201  SAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQ-------TDLPRYT  1043
                   ++ S   H     P          S    D+ +Q +   Q       T L   T
Sbjct  205   -----DAKGSSVGHNLNFEPRKDTSHHEYGSNICSDDQMQTQSQSQCFAQETTTSLKIST  259

Query  1042  PEINVN----------------TAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTE  911
               +N +                T+  K  +FEV +AE ELDMLL SF+ T    +N   +
Sbjct  260   HSVNSDSEEDKSCKRIMDTDPGTSHGKGLKFEVGAAEEELDMLLNSFSGTHLSSAN--LD  317

Query  910   ESWDNS------FLTQNDVSSSFSERGSL--------------------SQKVPTRSDVT  809
             E ++++       L+   V  S S +  L                    S+    RS  +
Sbjct  318   EPFEHASTLQEVSLSNEKVEPSLSSKPPLLAPLDDALDDLLSESSLDVQSEGFAMRSTTS  377

Query  808   DPDP----GLGGTAARDM----KLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSS  653
              P       +G   A+ M     +DD VDDLL +TS  ++ NE      A+ +  +TP  
Sbjct  378   QPTANYGQNIGFRYAKKMDVTPSIDDSVDDLLEDTS--SSLNEPKQITTAQVS-NSTPLD  434

Query  652   SNPVTKSKL----TDDFDSWFDTI  593
             S P+    L    +DDFDSWFD++
Sbjct  435   SAPLHPGPLNTSASDDFDSWFDSL  458



>gb|EEE64698.1| hypothetical protein OsJ_19553 [Oryza sativa Japonica Group]
Length=426

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 116/355 (33%), Positives = 155/355 (44%), Gaps = 67/355 (19%)
 Frame = -1

Query  1735  GHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAK  1556
             G   R LPSNWDRY          D E+   + +     T  VAP+SKGAD+ +L+ +A+
Sbjct  46    GPRGRNLPSNWDRY----------DGEDDADESAAPSEWTGEVAPRSKGADFGFLLEQAR  95

Query  1555  AQSLYS---SSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEA  1385
             AQ   +   SS   P       DF Q    +L  KG+ I S   DDNF  ED   P  E 
Sbjct  96    AQPREAQRLSSQDSPF------DFMQASTSMLEAKGEEILSWCEDDNFILEDDLAPDFEV  149

Query  1384  SFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFD  1205
              FLS++LH LA  L+K  LSERLF+E DLLP     E+L   SE  Q + + G   +   
Sbjct  150   PFLSMDLHALATHLSKLKLSERLFLEKDLLP-----EDLAVASEVNQIQIQRGTDVD---  201

Query  1204  SSAHRNGSEESGSM---HQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEI  1034
                    S+  GS+   H  +R   +             D+   +       +   T E 
Sbjct  202   -------SDAKGSLIHDHDSIRCD-DQMKADCQLKCFEEDKSTSSPKTSSHSVHLDTGED  253

Query  1033  NVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSE  854
             N N+     A+FEV +AE ELDMLL +   T    SN                +  SF  
Sbjct  254   NNNSEG---AKFEVVAAEEELDMLLNTLGGTHLSGSN----------------LDESFGN  294

Query  853   RGSLSQKVPTRSDVTDPD----PGLGGTAARDMKLDDIVDDLLRETSILTNKNEG  701
             + +L Q V     V  PD    P     ++     DD +DDLL ETS  + +NEG
Sbjct  295   KSTL-QDVK----VNQPDKKVTPSTSSKSSVTAACDDALDDLLSETSP-SVQNEG  343



>ref|XP_010689778.1| PREDICTED: uncharacterized protein LOC104903441 [Beta vulgaris 
subsp. vulgaris]
Length=473

 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 98/164 (60%), Gaps = 15/164 (9%)
 Frame = -1

Query  1720  GLPSNWDRY----VeegeeEYGFDSENMVPQ---DSVSKAATDV----VAPKSKGADYAY  1574
              LPSNWDRY    +E+  E   F S++  P    DS SK+A DV      PKSKGAD+  
Sbjct  55    SLPSNWDRYEDENLEDEIEVVRFHSDSYQPSPLADSESKSAVDVDIDVFKPKSKGADFRD  114

Query  1573  LISEAKAQSLYSSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP  1394
             LI++AK    Y S    P FDD L +FYQG  P+ +V+G+ I     DD+F  E +    
Sbjct  115   LIAQAKESRSYHS----PSFDDKLPEFYQGAAPMFAVRGEKIILQDRDDDFLMECEVSGT  170

Query  1393  DEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQK  1262
             +E  FL+L+L  +AE+L+K  +++RLFIEPDL PPEL  +E  K
Sbjct  171   EEVPFLTLDLEDIAERLSKVDIAKRLFIEPDLFPPELRGQESNK  214



>gb|EEC79700.1| hypothetical protein OsI_20989 [Oryza sativa Indica Group]
Length=426

 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 116/355 (33%), Positives = 155/355 (44%), Gaps = 68/355 (19%)
 Frame = -1

Query  1735  GHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAK  1556
             G   R LPSNWDRY          D E+   + +     T  VAP+SKGAD+ +L+ +A+
Sbjct  47    GPRGRNLPSNWDRY----------DGEDDADESAAPSEWTGEVAPRSKGADFGFLLEQAR  96

Query  1555  AQSLYS---SSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEA  1385
             AQ   +   SS   P       DF Q    +L  KG+ I S   DDNF  ED   P  E 
Sbjct  97    AQPREAQRLSSQDSPF------DFMQASTSMLEAKGEEILSWCEDDNFILEDDLAPDFEV  150

Query  1384  SFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEVFD  1205
              FLS++LH LA  L+K  LSERLF+E DLLP     E+L   SE  Q + + G   +   
Sbjct  151   PFLSMDLHALATHLSKLKLSERLFLEKDLLP-----EDLAVASEVNQIQIQRGTDVD---  202

Query  1204  SSAHRNGSEESGSM---HQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEI  1034
                    S+  GS+   H  +R   +             D+   +       +   T E 
Sbjct  203   -------SDAKGSLIHDHDSIRCD-DQMKADCQLKCFEEDKSTSSPKTSSHSVHLDTGED  254

Query  1033  NVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSE  854
             N N+     A+FEV +AE ELDMLL +   T    SN                +  SF  
Sbjct  255   NNNSEG---AKFEVVAAE-ELDMLLNTLGGTHLSGSN----------------LDESFGN  294

Query  853   RGSLSQKVPTRSDVTDPD----PGLGGTAARDMKLDDIVDDLLRETSILTNKNEG  701
             + +L Q V     V  PD    P     ++     DD +DDLL ETS  + +NEG
Sbjct  295   KSTL-QDVK----VNQPDKKVTPSTSSKSSVTAACDDALDDLLSETSP-SVQNEG  343



>ref|XP_010919192.1| PREDICTED: uncharacterized protein LOC105043365 isoform X1 [Elaeis 
guineensis]
Length=506

 Score =   113 bits (282),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 132/435 (30%), Positives = 203/435 (47%), Gaps = 50/435 (11%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHG-SR  1721
             MD K+ AKSKR HS    K +    ++      P+ +      +G      P + H  SR
Sbjct  1     MDPKASAKSKRNHSHQGRKNHPTPAATSAQKKKPAPAAVAAAAAGAGEVATPRRAHARSR  60

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSL-  1544
              LPSNWDRY ++G+ +    S +     + +K A   + PKSKGAD+ +L+ +A++Q   
Sbjct  61    DLPSNWDRYDDDGDGDD---SGDGAESSAGAKRADGEIRPKSKGADFRFLVEQARSQPQD  117

Query  1543  ---YSSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLS  1373
                  +S S    D++  D+ QG+  +LSV+G+S+ S  +DDNF  +D      E + LS
Sbjct  118   HRDPGTSQSAFSLDELPSDYIQGISSMLSVRGESLLSWCADDNFIVDDDSTSSCEVNLLS  177

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQ--KLSENEQAKNKAGVAEEVFDSS  1199
             ++LH LA QL+K  LS+RLFIE DLLP EL  +EL+  ++ E  +    +   + +    
Sbjct  178   MDLHALAAQLSKLKLSQRLFIEEDLLPEELHIDELKVNQIFEQSETPTMSEHKDSLSQGR  237

Query  1198  AHRNGSEE-----------SGSMHQYLRSPYNTAGtstssstSARDEILQAKGI-----G  1067
              H N   E           S ++H   R        + S +  A    L    I     G
Sbjct  238   FHGNSELEKSVDGQIDHWNSCNVHGITREAVVEKCQTQSPTGQATKFDLSNDSIPAGLSG  297

Query  1066  QTDLPRYTPEINVNTAA----KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWD  899
             + ++     +++ +T A     + ++FE A+AE ELD+L  SF+ET+   S         
Sbjct  298   RREVQGSVSQLSKHTVADLKQNRTSRFEAAAAEEELDVLFSSFSETRLSSS---------  348

Query  898   NSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSIL  719
             +S    ND S+S +   + +  V         D    G A     L D +DDLL ETS+ 
Sbjct  349   HSDGITNDASTSHN--ATFNSSVHMSPPSVGQDLNSSGNAG--TSLADAIDDLLAETSLS  404

Query  718   TNK-------NEGSL  695
              N        NEG L
Sbjct  405   LNDQNTVCPPNEGGL  419



>ref|XP_009113938.1| PREDICTED: uncharacterized protein LOC103839198 [Brassica rapa]
 ref|XP_009113939.1| PREDICTED: uncharacterized protein LOC103839198 [Brassica rapa]
Length=361

 Score =   110 bits (276),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 126/218 (58%), Gaps = 37/218 (17%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEK-PVQGHGSR  1721
             MD K+LAKSKRAH+ HH+KK+   H               K ++G+  + K PVQ     
Sbjct  1     MDTKALAKSKRAHTQHHTKKSHPLH---------------KPKAGQVNQTKSPVQS----  41

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS--  1547
              LPSN DRY  + E + G          S ++ A DV+ PKSKGADY +LISEAKA+S  
Sbjct  42    ALPSNQDRY--DDEPDLGL---------STNQPA-DVIVPKSKGADYLHLISEAKAESHS  89

Query  1546  -LYSSSHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPD-EASFL  1376
              + + S  +   DD+LHD F + +G ++S +G+ + S + DDNF  E+ G   + E  FL
Sbjct  90    KIENDSDCLSSLDDLLHDEFSRVVGSMISARGEGVLSWMDDDNFVVEEDGSASNHEPGFL  149

Query  1375  SLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQK  1262
             SL+L+ L   L K  + ERL+IE DLL PELCT ++ +
Sbjct  150   SLDLNALETMLEKVEVHERLYIEADLLLPELCTSQVNR  187



>ref|XP_010919199.1| PREDICTED: uncharacterized protein LOC105043365 isoform X2 [Elaeis 
guineensis]
Length=497

 Score =   112 bits (280),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 129/426 (30%), Positives = 205/426 (48%), Gaps = 41/426 (10%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHG-SR  1721
             MD K+ AKSKR HS    K +    ++      P+ +      +G      P + H  SR
Sbjct  1     MDPKASAKSKRNHSHQGRKNHPTPAATSAQKKKPAPAAVAAAAAGAGEVATPRRAHARSR  60

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSL-  1544
              LPSNWDRY ++G+ +    S +     + +K A   + PKSKGAD+ +L+ +A++Q   
Sbjct  61    DLPSNWDRYDDDGDGDD---SGDGAESSAGAKRADGEIRPKSKGADFRFLVEQARSQPQD  117

Query  1543  ---YSSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLS  1373
                  +S S    D++  D+ QG+  +LSV+G+S+ S  +DDNF  +D      E + LS
Sbjct  118   HRDPGTSQSAFSLDELPSDYIQGISSMLSVRGESLLSWCADDNFIVDDDSTSSCEVNLLS  177

Query  1372  LNLHTLAEQLAKATLSERLFIEPDLLPPELCTE--ELQKLSENEQAKNK------AGVAE  1217
             ++LH LA QL+K  LS+RLFIE DLLP EL  E  E   +SE++ + ++      + + +
Sbjct  178   MDLHALAAQLSKLKLSQRLFIEEDLLPEELIFEQSETPTMSEHKDSLSQGRFHGNSELEK  237

Query  1216  EVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssst-SARDEILQAKGIGQTDLPRYTP  1040
              V     H N     G   + +     T   +  ++     ++ + A   G+ ++     
Sbjct  238   SVDGQIDHWNSCNVHGITREAVVEKCQTQSPTGQATKFDLSNDSIPAGLSGRREVQGSVS  297

Query  1039  EINVNTAA----KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDV  872
             +++ +T A     + ++FE A+AE ELD+L  SF+ET+   S         +S    ND 
Sbjct  298   QLSKHTVADLKQNRTSRFEAAAAEEELDVLFSSFSETRLSSS---------HSDGITNDA  348

Query  871   SSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNK------  710
             S+S +   + +  V         D    G A     L D +DDLL ETS+  N       
Sbjct  349   STSHN--ATFNSSVHMSPPSVGQDLNSSGNAG--TSLADAIDDLLAETSLSLNDQNTVCP  404

Query  709   -NEGSL  695
              NEG L
Sbjct  405   PNEGGL  410



>ref|XP_008649998.1| PREDICTED: uncharacterized protein LOC103630731 [Zea mays]
 gb|AFW79165.1| hypothetical protein ZEAMMB73_246056 [Zea mays]
Length=462

 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 133/296 (45%), Gaps = 49/296 (17%)
 Frame = -1

Query  1735  GHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAK  1556
             G  SR LPSNWDRY          D+E      + +   T  VAP+SKGAD+ +L+ +A+
Sbjct  47    GPRSRNLPSNWDRY----------DAEGEAEDSAAAGEWTGEVAPRSKGADFGFLLEQAR  96

Query  1555  AQSLYSSSHSVPLF--DDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPPDEAS  1382
             AQ   +     P     D+  DF Q    +L VKG+ I S  +DDNF  ED   P  E  
Sbjct  97    AQPSGARDLIAPCVPSQDLPFDFMQASTSMLEVKGEGILSWCADDNFILEDDLAPDFEVP  156

Query  1381  FLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQAKNKAGVAEEV---  1211
             FLS++L+ LA  L+K  LS RLFIE DL P     E +   SE+ +   +   + E+   
Sbjct  157   FLSMDLNALANHLSKIRLSRRLFIEDDLFP-----EAMADASEDNEIAIELDTSVEIDAK  211

Query  1210  -------------FDSSAHRNGSEESGSMH-QYLRSPY-----NTAGtstssstSARD-E  1091
                           D+S H + S        +  R P      NTA T  S+ +   D E
Sbjct  212   GSSVGHNLNFEPRKDTSHHESASNICADDQIKTERQPQCFARENTASTKVSTHSVNSDSE  271

Query  1090  ILQAKGIGQTDLPRYTPEINVNTAAKKPAQFEVASAEAELDMLLGSFAETKFLESN  923
                 K +  TD           T+  K   FEV +AE ELDMLL SF  T    SN
Sbjct  272   DKSYKQVMDTD---------PGTSHSKGLMFEVGAAEEELDMLLDSFGGTHLSSSN  318



>emb|CDY13120.1| BnaA09g16970D [Brassica napus]
Length=361

 Score =   108 bits (270),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 123/222 (55%), Gaps = 39/222 (18%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEK-PVQGHGSR  1721
             MD K+LAKSKRAH+ HH+KK+   H               K ++G+  + K PVQ     
Sbjct  1     MDTKALAKSKRAHTQHHTKKSHPLH---------------KPKAGQVNQTKSPVQS----  41

Query  1720  GLPSNWDRYVeegeeEYGFDSENMVPQDSVS-KAATDVVAPKSKGADYAYLISEAKAQSL  1544
              LPSN DRY          D E   P   +S     DV+ PKSKGADY +LISEAKA+S 
Sbjct  42    ALPSNQDRY----------DDE---PDLGLSTNQPADVIVPKSKGADYLHLISEAKAESH  88

Query  1543  YSS---SHSVPLFDDVLHD-FYQGLGPLLSVKGQSIASSISDDNFGSEDKGP-PPDEASF  1379
               +   S  +   DD+LHD F + +G ++S +G+ + S + DDNF  E+ G    +E  F
Sbjct  89    SKTENDSDCLSSLDDLLHDEFSRVVGSMISARGEGVLSWLEDDNFIVEEDGSVSHNEPGF  148

Query  1378  LSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSE  1253
             LSL+L+ L   L K  + ERL+IE DLL P+LCT ++ +  E
Sbjct  149   LSLDLNALETMLEKVEVHERLYIEADLLLPQLCTAQVNRYKE  190



>ref|XP_008352186.1| PREDICTED: uncharacterized protein LOC103415657 [Malus domestica]
Length=248

 Score =   103 bits (258),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 133/299 (44%), Gaps = 56/299 (19%)
 Frame = -1

Query  1474  LLSVKGQSIASSISDDNFGSEDKG-PPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDL  1298
             +LSV+G+S+ S I DDNF  EDK    P E SFLSLNLH+LAEQL K  L +RLFIE DL
Sbjct  1     MLSVRGESVLSRIGDDNFVVEDKNTAAPHEVSFLSLNLHSLAEQLEKIDLPQRLFIEADL  60

Query  1297  LPPELCTEELQKLSENEQAKNKAGVAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtst  1118
             LPPEL           EQA      A  + + S   + SEE                   
Sbjct  61    LPPELYA---------EQATCGEEAARRLPEESPCSDFSEE-------------------  92

Query  1117  ssstSARDEILQAKGIGQTDLPRYTPEINVNTAAKKP----AQFEVASAEAELDMLLGSF  950
                                 +P    EI ++ +   P    +++E    E+E  + + SF
Sbjct  93    ------------------VQVPDXDIEIRISDSPTDPXLGKSEYEHKLPESETQISVKSF  134

Query  949   AETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARD  770
               +       +            ND S++F  R + S +V        P   +  ++A  
Sbjct  135   EPSTAEAELELDLLLDSFGETKIND-STAFESRTTFSVQVDASLMPIQPRRKVPDSSA--  191

Query  769   MKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
               +DD +D+L+ ETSIL N+   S   E R A  +  SSS   TKSK  DDFDSW DTI
Sbjct  192   -TIDDELDELINETSILINQGGLSQPQEQR-AVHDXQSSSISGTKSKEVDDFDSWLDTI  248



>ref|XP_009416534.1| PREDICTED: uncharacterized protein LOC103997114 [Musa acuminata 
subsp. malaccensis]
Length=485

 Score =   107 bits (266),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 162/535 (30%), Positives = 217/535 (41%), Gaps = 150/535 (28%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD K+ AKSKRAH+ H    +    +              +K+ G    + P QG G  G
Sbjct  1     MDPKASAKSKRAHTQHGRANHPSPSA-----------IAQRKKHGNSKDKNPTQGGGGDG  49

Query  1717  ---------LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLIS  1565
                      LPSN DRY EE EEE           +     A   VAPKSKGAD+ YL+ 
Sbjct  50    EPKRSRVPALPSNLDRYGEEEEEEL----------NGAGNPAATEVAPKSKGADFGYLLE  99

Query  1564  EAKAQ------------SLYSSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNF  1421
             +A+ Q            S  SSS   P          QGL  +LSV+G+++ S   DDNF
Sbjct  100   QARTQQQERRNLAARGLSASSSSEEFPF------GLMQGLSSMLSVRGKALLSLCEDDNF  153

Query  1420  GSEDKGPPPD--EASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENE  1247
               +D        E  FLS++LH +  QL+K  LSERLFIE DL P E C +E  +   +E
Sbjct  154   IIDDDDDTSSSYEVPFLSIDLHAIDAQLSKLKLSERLFIESDLFPEEQCVDESNEKQISE  213

Query  1246  QAKNKAGVAEEV---------------FDSSAHRNGSE-ESGSM----HQYLRSPYNTAG  1127
             Q ++   VA ++                + S H  GSE + G++    H  L S   T  
Sbjct  214   QPED--SVASDIKHDYVPSTSMNVDGQNNPSNHYRGSEIDEGALLKKHHSQLLSENIT--  269

Query  1126  tstssstSARDEILQAKGIGQTDLPRYTPEINVNTAAKKPAQFEVASAEAELDMLLGSFA  947
                  +   R +      I Q      +     N      ++FE+A+AEAELDMLL S +
Sbjct  270   -KLHPTKELRSQEFSPSRITQGSNSNLSIYAVSNPMENTTSKFEMAAAEAELDMLLDSLS  328

Query  946   ETKFLES------NRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGG  785
              T F  +      N V+  S   S+ + N +  S  +    S  VPT S           
Sbjct  329   GTSFSGAASDDLINDVSGPSNATSYSSANTLPLSARKGSDSSINVPTSS-----------  377

Query  784   TAARDMKLDDIVDDLLRETSI-LTNKN-------EG---------------------SLG  692
                    +DD +DDLL  TS+ LT+KN       EG                     SL 
Sbjct  378   -------IDDAIDDLLAVTSLSLTDKNYNGSATEEGALHSKVHAPPAFGSKSADQSSSLR  430

Query  691   DEARSAF------------------RNTPSSSN----PVTKSKLTDDFDSWFDTI  593
              EAR+A                   +  PS+      P   SK  DDFDSW DT+
Sbjct  431   TEARTALDDAIDDLFGEKSVFSEDQKQEPSAITLPLRPPFGSKPMDDFDSWLDTL  485



>ref|XP_003567895.1| PREDICTED: uncharacterized protein LOC100821400 [Brachypodium 
distachyon]
Length=448

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 80/159 (50%), Gaps = 25/159 (16%)
 Frame = -1

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQ-  1550
             SR LPSNWDRY            E      + +   T  VAP+SKGAD+A+L+ +A+ Q 
Sbjct  51    SRNLPSNWDRYE----------DEPEADDPAAAAEWTGEVAPRSKGADFAFLLEQARTQP  100

Query  1549  --------SLYSSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNFGSEDKGPPP  1394
                     S   +S + P       DF Q    +L  KG  I S I DDNF  ED   P 
Sbjct  101   REERGLGVSGQLASQNSPF------DFMQASTSMLEAKGDGIMSWIEDDNFILEDDLAPD  154

Query  1393  DEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCT  1277
              E  FLS++L  LA QL K  LS+RLFIE DLLP +L  
Sbjct  155   FEVPFLSMDLDALATQLLKLKLSQRLFIEEDLLPEDLAV  193



>ref|XP_004144603.1| PREDICTED: uncharacterized protein LOC101207509 [Cucumis sativus]
Length=254

 Score = 92.0 bits (227),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 126/273 (46%), Gaps = 36/273 (13%)
 Frame = -1

Query  1390  EASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCT-EELQKLSEN--EQAKNKAGVA  1220
             +ASFLSLNLH LA+QL K  +++RLFIE D+LP EL    E Q+   N       K  V 
Sbjct  11    QASFLSLNLHMLADQLQKLNVAQRLFIEEDILPSELMQPSECQEAERNIDSSVTEKGNVE  70

Query  1219  EEVFDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTP  1040
             + V D+    + S    +      +P  T       +       ++ +   QT  P+YT 
Sbjct  71    DRVQDAIVASSSSYFGSNQQDPTFNPSPTLSNQVQYNACP----IELEISSQTKDPKYTD  126

Query  1039  EINVN----TAAKKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDV  872
             + N       + KK  + E  +AEAELDMLL SF++T  L +   +              
Sbjct  127   QANTKFTTENSNKKLTKLEATTAEAELDMLLNSFSDTIDLGTTAASS-------------  173

Query  871   SSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLG  692
             SS   E    S  +P +   +   P +        +LDD +D+LL++TS LT+  E  + 
Sbjct  174   SSRIDEVSKPSFHLPNKGPYSTKKPPIAS------ELDDALDELLQDTSYLTSHIEKPIN  227

Query  691   DEARSAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
                +S   +  S +N + K    DDFDSW D+I
Sbjct  228   THIQSL--SLHSGTNSIAK----DDFDSWIDSI  254



>dbj|BAJ98196.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score = 94.0 bits (232),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 88/171 (51%), Gaps = 23/171 (13%)
 Frame = -1

Query  1762  KQVKEKPVQGHG-------SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVA  1604
             KQ +E    G G       SR LPSNWDR+            E     D  ++ A +V A
Sbjct  31    KQKREAAAAGGGPSFSGPRSRNLPSNWDRF------------EEEPDADDAAEWAGEV-A  77

Query  1603  PKSKGADYAYLISEAKAQSLYS---SSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSIS  1433
             P+SKGAD+A+L+ +A+AQ L      + S     D   DF      +L  KG+ I S   
Sbjct  78    PRSKGADFAFLLEQARAQPLEERGLGAASRLASKDSPFDFVLASTSMLEAKGEGIMSWFE  137

Query  1432  DDNFGSEDKGPPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELC  1280
             DDNF  ED   P  E  FLS++LH LA +L+K   S+RLF+E DLLP +L 
Sbjct  138   DDNFILEDDLAPDFEVPFLSMDLHALAAKLSKIKPSQRLFMEEDLLPEDLA  188



>gb|ADE77785.1| unknown [Picea sitchensis]
Length=480

 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 82/149 (55%), Gaps = 19/149 (13%)
 Frame = -1

Query  1726  SRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQS  1547
             S+ LPSNWDRY          DS +   +D       + V  KSKGADY+YL+S+ + Q+
Sbjct  65    SKALPSNWDRYE---------DSHSSGAEDDFISKGEETVRVKSKGADYSYLLSQFQEQT  115

Query  1546  LYSSSHSVPLFDDVLHDFYQGLGPLLSVKGQSIASSISDDNF-GSEDKGPPPDEASFLSL  1370
                       FD  L +   G+  +L V+G ++ S   DDNF  S D      EASFLS+
Sbjct  116   G---------FDAHLPEDTAGISSMLYVRGHNLLSWGDDDNFIVSNDNMTSDYEASFLSV  166

Query  1369  NLHTLAEQLAKATLSERLFIEPDLLPPEL  1283
             +LH LA QLAK  LS+RLFIE D LP EL
Sbjct  167   DLHGLASQLAKLDLSKRLFIEDDKLPAEL  195



>ref|XP_006654788.1| PREDICTED: uncharacterized protein LOC102721553 [Oryza brachyantha]
Length=317

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 127/291 (44%), Gaps = 58/291 (20%)
 Frame = -1

Query  1474  LLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDLL  1295
             +L  KG+ I S   DDNF  ED   P  E  FLS++LH LA  L+K  LSERLF+E DLL
Sbjct  1     MLEAKGEEILSWCDDDNFILEDDLAPDFEVPFLSMDLHALATHLSKLKLSERLFLEKDLL  60

Query  1294  PPELCTEELQKLSENEQAKNKAG--VAEEVFDSSAHRNGSEESGSMHQYLRSPYNTAGts  1121
             P     E+L   SE  Q + + G  V  +   SS H+ G      +H Y     N     
Sbjct  61    P-----EDLVVASEVNQIQIQCGTDVGSDAKGSSVHQKGI----GIHDY----DNIHCDD  107

Query  1120  tssstSARDEILQAKGIGQTDLPRY-----TPEINVNTAAKKPAQFEVASAEAELDMLLG  956
                +    +   + K     +   +     T E   N+ A   A+FEV SAE ELDMLL 
Sbjct  108   QMKTDCQLNYFEEDKSTSSPNTSSHFVRSDTGEDKSNSEA---AKFEVVSAEEELDMLLN  164

Query  955   SFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPD----PGLG  788
             +   T+   SN                +  SF  + +L Q V     V  PD    P   
Sbjct  165   TLGGTRLSGSN----------------LDESFGNKSTL-QDVK----VNQPDKKVTPSTL  203

Query  787   GTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTK  635
               +   +  DD +DDLL E+S LT +NEG         F  T S+S P TK
Sbjct  204   SKSLVTVPCDDALDDLLSESS-LTVQNEG---------FSETDSTSKPTTK  244



>ref|XP_006852570.1| hypothetical protein AMTR_s00021p00206430 [Amborella trichopoda]
 gb|ERN14037.1| hypothetical protein AMTR_s00021p00206430 [Amborella trichopoda]
Length=286

 Score = 86.7 bits (213),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 138/314 (44%), Gaps = 48/314 (15%)
 Frame = -1

Query  1474  LLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDLL  1295
             +LS KG+S+ S  S DNF  +D+     EASFLS++LH LA +LA   LS+R+FIE DLL
Sbjct  1     MLSFKGKSLLSWNSYDNFIVDDEEHLNQEASFLSIDLHKLATKLANINLSKRIFIEEDLL  60

Query  1294  PPELCTEELQ-----KLSENEQAKNKAG--VAEEVFDSSAHRNGSEESGSMHQYLRSPY-  1139
             P ELC  E Q      +   ++A  K G  V   V        G+++    HQ L +   
Sbjct  61    PEELCGTERQGSTTLGIEHVKRALGKDGGNVGSSVMFQGNSDLGTKKHSQNHQDLVTSIS  120

Query  1138  -----NTAGtstssstSARDEILQAKGIGQTDLPRYTPEINV-------NTAAKKPAQFE  995
                  N +  + S    A D  L+   + Q   P  T E           T + K   FE
Sbjct  121   EDYLENYSQPTFSGIDVAVDHFLRGSELPQEPKPNKTQEEQTPRGVALDGTNSGKNKGFE  180

Query  994   VASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLSQKVPTRSD  815
              A+AE ELD LL +F ET+ L++  + E+            S+SFS+             
Sbjct  181   AAAAEVELDFLLDTFGETRRLDNFSIAEDP-----KLAIGASTSFSK-------------  222

Query  814   VTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTPSSSNPVTK  635
               +P    G   +R  K       L   T+++     G+    A     N   S + +  
Sbjct  223   --NPLDSFGAGPSRTTK---GYTSLQAPTTVI-----GAKAGIANPLNNNKDFSPSDMEG  272

Query  634   SKLTDDFDSWFDTI  593
             SK+ DDFD+W D++
Sbjct  273   SKVLDDFDAWLDSM  286



>emb|CAN60169.1| hypothetical protein VITISV_003665 [Vitis vinifera]
Length=484

 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 80/129 (62%), Gaps = 11/129 (9%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAK+LAKSKRAHS HHSK+   + +SK  S+    +   KKQ GKQ++EKP Q  G   
Sbjct  1     MDAKALAKSKRAHSQHHSKRPHSNKTSKAPSAGNVGAGNAKKQPGKQIREKPHQSMGLSR  60

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNWDRY EE      FDS +  P  + +  A DV+ PKSKGADY  LISEA +Q    
Sbjct  61    LPSNWDRYEEE------FDSGSEGPSINSTNQANDVIVPKSKGADYGELISEAISQ----  110

Query  1537  SSHSVPLFD  1511
              S S P FD
Sbjct  111   -SRSNPYFD  118


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 138/286 (48%), Gaps = 43/286 (15%)
 Frame = -1

Query  1387  ASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPEL--CTEELQKLSENEQAKNKAGVAEE  1214
             A FLSLNLH+LAEQL K  LS+RLF+E DLL PEL   + E  K+S N++A      +E 
Sbjct  221   APFLSLNLHSLAEQLTKVDLSQRLFVEEDLLSPELMSVSSEGVKVSSNQEANQMQRTSEG  280

Query  1213  ---VFDSSAHRNGSEESGSMHQ----------YLRSP-YNTAGtstssstSARDEILQAK  1076
                + D SA R+  E+   + +           +R+P  ++   S  S    +D+  Q  
Sbjct  281   AKIIVDESAVRSFPEKDKIVDKNKEVMSSDTTRIRNPVISSPNQSAKSENQVKDKAKQFG  340

Query  1075  GIGQTDLPRYTPEINVNTAA---KKPAQFEVASAEAELDMLLGSFAETKFLESNRVTEES  905
                QT       +IN  + A   KK + FE A+AEAELDMLL SF ET   +S       
Sbjct  341   RAAQTRDLELAAQINKVSVADPEKKQSVFEAAAAEAELDMLLDSFNETNKFDS-------  393

Query  904   WDNSFLTQNDVSSSFSERGSLSQKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETS  725
                 F    +    F ++ S++    +R  VT               LDD +DDLL ETS
Sbjct  394   --LGFKKSRNALPVFQQKPSMTPPQLSRKVVT-------------ANLDDALDDLLEETS  438

Query  724   ILTNKNEGSLGDEAR--SAFRNTPSSSNPVTKSKLTDDFDSWFDTI  593
              L ++N      +A+  S      SSS+    SK+ DDFDSW DTI
Sbjct  439   NLMDQNGTKPPQQAKPTSPGIQCSSSSHSGQGSKVLDDFDSWLDTI  484



>gb|EYU42151.1| hypothetical protein MIMGU_mgv11b019228mg, partial [Erythranthe 
guttata]
Length=123

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 86/134 (64%), Gaps = 12/134 (9%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MD K+LAKSKRAHSLHHSKK+  H +S+ ASS     +G KK +G Q KEKP Q  GSR 
Sbjct  1     MDTKALAKSKRAHSLHHSKKHHPHQASRPASSTN---SGPKKPTGIQSKEKPPQSEGSR-  56

Query  1717  LPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQSLYS  1538
             LPSNW+RY    +E+   DSE        S   +D V P+SKGADYA LIS+AK QS  +
Sbjct  57    LPSNWERY----DEDLNLDSEEA---QGTSNQLSDFVVPRSKGADYAQLISDAKDQSPAN  109

Query  1537  -SSHSVPLFDDVLH  1499
              S  + PLF D ++
Sbjct  110   YSPEAFPLFHDDMY  123



>ref|XP_011043606.1| PREDICTED: uncharacterized protein LOC105139018 isoform X2 [Populus 
euphratica]
Length=439

 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 92/176 (52%), Gaps = 36/176 (20%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MD K+LAKSKRAH+L H+K                   G K    ++  + P  G+  + 
Sbjct  1     MDTKALAKSKRAHTLQHNK-------------------GKKPHPNQKPSKTPSTGNNQKP  41

Query  1720  ---GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATD----VVAPKSKGADYAYLISE  1562
                 LPSNWDRY ++ E+E+G + EN    +S   +  D    +  PKSKGAD+ YL+ E
Sbjct  42    QKSKLPSNWDRYGDDEEDEFGVNLENPSGDNSKKPSFKDYGDGLALPKSKGADFRYLLDE  101

Query  1561  AKAQSLYSSSHSV---PLFDDVL-HDFYQGLGPLLSVKGQSIASSISDDNFGSEDK  1406
             AK     S  H V   P  +  L  +   G+GPLL+V+G+SI S I DDNF  ED+
Sbjct  102   AK-----SKPHQVDDFPFLEHFLAEESMHGVGPLLAVRGESILSWIGDDNFVVEDE  152



>ref|XP_011047711.1| PREDICTED: uncharacterized protein LOC105141982 isoform X2 [Populus 
euphratica]
Length=117

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -1

Query  1477  PLLSVKGQSIASSISDDNFGSEDKGPPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDL  1298
             PL   +G+SI S I DDNF  E+K     EASFL LNLH LAEQLAK  +S RLFIE DL
Sbjct  26    PLDFSQGESILSWIGDDNFSVENKTTSTHEASFLFLNLHALAEQLAKVDVSGRLFIEADL  85

Query  1297  LPPEL  1283
             L  EL
Sbjct  86    LATEL  90



>ref|XP_004163436.1| PREDICTED: uncharacterized LOC101207509 [Cucumis sativus]
Length=234

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 75/262 (29%), Positives = 116/262 (44%), Gaps = 36/262 (14%)
 Frame = -1

Query  1357  LAEQLAKATLSERLFIEPDLLPPELCT-EELQKLSEN--EQAKNKAGVAEEVFDSSAHRN  1187
             LA+QL K  +++RLFIE D+LP EL    E Q+   N      +K  V + V D+    +
Sbjct  2     LADQLQKLNVAQRLFIEEDILPSELMQPSECQEAERNIDSSVTDKGNVEDRVQDAIVASS  61

Query  1186  GSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEINVNTAAKKP  1007
              S    +      +P  T       +       ++ +   QT  P+YT + N     + P
Sbjct  62    SSYFGSNQQDPTFNPSPTLSNQVQYNACP----IELEISSQTKDPKYTDQANTKFTTENP  117

Query  1006  ----AQFEVASAEAELDMLLGSFAETKFLESNRVTEESWDNSFLTQNDVSSSFSERGSLS  839
                  + E  +AEAELDMLL SF++T  L +   +              SS   E    S
Sbjct  118   NKKLTKLEATTAEAELDMLLNSFSDTIDLGTTAASS-------------SSRIDEVSKPS  164

Query  838   QKVPTRSDVTDPDPGLGGTAARDMKLDDIVDDLLRETSILTNKNEGSLGDEARSAFRNTP  659
               +P +   +   P +        +LDD +D+LL++TS LT+  E  +    +S   +  
Sbjct  165   FHLPNKGPYSTKKPPIAS------ELDDALDELLQDTSYLTSHIEKPINTHIQSLSLH--  216

Query  658   SSSNPVTKSKLTDDFDSWFDTI  593
             S +N + K    DDFDSW D+I
Sbjct  217   SGTNSIAK----DDFDSWIDSI  234



>ref|XP_004173052.1| PREDICTED: uncharacterized LOC101207751, partial [Cucumis sativus]
Length=142

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 79/165 (48%), Gaps = 40/165 (24%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSRG  1718
             MDAKSLAKSKRAHS HH+                       K+     K+KP  G  +  
Sbjct  1     MDAKSLAKSKRAHSQHHT-----------------------KKYHSNHKQKPFNGTTNES  37

Query  1717  L----PSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAKAQ  1550
             L    PSNWDRY            +N    ++      DV+ PKSKGADY +LI+EA++Q
Sbjct  38    LKNPLPSNWDRY-----------GQNTSTAEATPAPLPDVILPKSKGADYRHLIAEARSQ  86

Query  1549  SLYSSSHSV-PLFDDVLHDFYQGLG-PLLSVKGQSIASSISDDNF  1421
                 +S  V P  DDV      G G  +L+ +G+ + S + DD+F
Sbjct  87    MQSCTSTDVFPSLDDVFPSELSGGGSAMLAARGEGLLSWVEDDSF  131



>ref|XP_004144604.1| PREDICTED: uncharacterized protein LOC101207751 [Cucumis sativus]
Length=151

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 79/170 (46%), Gaps = 45/170 (26%)
 Frame = -1

Query  1897  MDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQGHGSR-  1721
             MDAKSLAKSKRAHS HH+                       K+     K+KP  G  +  
Sbjct  1     MDAKSLAKSKRAHSQHHT-----------------------KKYHSNHKQKPFNGTTNES  37

Query  1720  --------GLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLIS  1565
                      LPSNWDRY            +N    ++      DV+ PKSKGADY +LI+
Sbjct  38    LKNPLPNDNLPSNWDRY-----------GQNTSTAEATPAPLPDVILPKSKGADYRHLIA  86

Query  1564  EAKAQSLYSSSHSV-PLFDDVLHDFYQGLG-PLLSVKGQSIASSISDDNF  1421
             EA++Q    +S  V P  DDV      G G  +L+ +G+ + S + DD+F
Sbjct  87    EARSQMQSCTSTDVFPSLDDVFPGELSGGGSAMLAARGEGLLSWVEDDSF  136



>gb|EYU42153.1| hypothetical protein MIMGU_mgv1a0148261mg, partial [Erythranthe 
guttata]
Length=148

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 78/148 (53%), Gaps = 13/148 (9%)
 Frame = -1

Query  1387  ASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEELQKLSENEQ-AKNKAGVAEEV  1211
             A FLSL+++ LA QL+KA LSER+F+EPDLLP EL  ++L    E++   +     AE V
Sbjct  1     APFLSLDMNALAAQLSKAKLSERIFVEPDLLPRELLDDDLHACVEDKHNPQTCTSSAETV  60

Query  1210  FDSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSARDEILQAKGIGQTDLPRYTPEIN  1031
               +S+     E +  + QY    +     S   +   + EI Q++          T +I 
Sbjct  61    SRASSISRNQEVAEDVKQY----HKPDERSKKPTKQTKYEISQSQKTNS-----ITEKI-  110

Query  1030  VNTAAKKPAQFEVASAEAELDMLLGSFA  947
                 + KP+ FE A+AE ELDMLL S +
Sbjct  111   --VDSSKPSVFEAANAELELDMLLESLS  136



>ref|XP_003607517.1| Lysine-specific histone demethylase-like protein [Medicago truncatula]
Length=394

 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -1

Query  1387  ASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCTEEL  1268
             ASF+SLNLH +AE+LAK  LS+RLFIEPDLLP ELC E+L
Sbjct  52    ASFISLNLHAIAEKLAKVDLSKRLFIEPDLLPSELCVEDL  91



>gb|EMS51945.1| hypothetical protein TRIUR3_03632 [Triticum urartu]
Length=429

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 78/180 (43%), Gaps = 10/180 (6%)
 Frame = -1

Query  1432  DDNFGSEDKGPPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCT-------E  1274
             DDNF  ED   P  E  FLS++LH LA +L+K  LS+RLF+E DLLP ++         E
Sbjct  6     DDNFILEDDLAPDFEVPFLSMDLHALATKLSKIKLSQRLFMEEDLLPEDMAVASEDEDDE  65

Query  1273  ELQKLSENEQAKNKAGVAEEVF-DSSAHRNGSEESGSMHQYLRSPYNTAGtstssstSAR  1097
              L +L    ++  K    +  F D    ++      + + +   P  T   S   +  A 
Sbjct  66    ILIQLGTTLESDAKGSFVQHNFRDIKPGKDAVSPDHASNIHSDDPMKTHLQSECFAEEAT  125

Query  1096  DEILQAKGIGQTDLPRYTPEINV--NTAAKKPAQFEVASAEAELDMLLGSFAETKFLESN  923
                       Q+D   YT       N   ++ ++  + + E ELDMLL S   T    SN
Sbjct  126   TSFKVIPRPMQSDTETYTGITGTVPNAGHREQSKLGMVAPEEELDMLLNSLDGTHLSSSN  185



>gb|EMT17991.1| hypothetical protein F775_17565 [Aegilops tauschii]
Length=329

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -1

Query  1432  DDNFGSEDKGPPPDEASFLSLNLHTLAEQLAKATLSERLFIEPDLLPPELCT  1277
             DDNF  ED   P  E  FLS++LH LA +L+K  LS+RLF+E DLLP ++  
Sbjct  6     DDNFILEDDLAPDFEVPFLSMDLHALATKLSKIKLSQRLFMEEDLLPEDMAV  57



>ref|XP_006852572.1| hypothetical protein AMTR_s00021p00206960 [Amborella trichopoda]
 gb|ERN14039.1| hypothetical protein AMTR_s00021p00206960 [Amborella trichopoda]
Length=219

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 68/138 (49%), Gaps = 31/138 (22%)
 Frame = -1

Query  1915  EEET*KMDAKSLAKSKRAhslhhskknqqhhsskgassvpsaSTGDKKQSGKQVKEKPVQ  1736
             EEET  M+ KS AKSKRAHSLH  + +                   KKQS + +      
Sbjct  89    EEET--MNVKSSAKSKRAHSLHGRRTHNPSPKPSP---------STKKQSDQTLTR----  133

Query  1735  GHGSRGLPSNWDRYVeegeeEYGFDSENMVPQDSVSKAATDVVAPKSKGADYAYLISEAK  1556
              H SR LPSNWDRY          D     P+D   +     V PKSKGADYAYL+S AK
Sbjct  134   -HDSR-LPSNWDRYD-------DIDFSGAQPEDPNQENVN--VGPKSKGADYAYLLSLAK  182

Query  1555  AQSLYSSSHSVPLFDDVL  1502
             ++SL     S+  FD V+
Sbjct  183   SESL-----SLLSFDSVI  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6173933421468