BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c27000_g1_i1 len=1775 path=[1:0-1774]

Length=1775
                                                                      Score     E

ref|XP_011081681.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    620   0.0      
ref|XP_010097058.1|  Fatty acid desaturase 3                            613   0.0      
ref|XP_009792309.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    608   0.0      
gb|ABO31111.1|  sphingolipid delta-8 desaturase                         607   0.0      Nicotiana tabacum [American tobacco]
emb|CDP08267.1|  unnamed protein product                                603   0.0      
ref|XP_009631585.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    602   0.0      
ref|XP_002516430.1|  fatty acid desaturase, putative                    601   0.0      Ricinus communis
ref|XP_007012291.1|  Fatty acid/sphingolipid desaturase                 600   0.0      
ref|XP_006360999.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     596   0.0      
ref|XP_002279189.1|  PREDICTED: delta(8)-fatty-acid desaturase 1        595   0.0      Vitis vinifera
gb|AAZ23035.1|  delta-6 desaturase                                      595   0.0      Echium sabulicola
gb|AAL23580.1|  delta-6-desaturase                                      595   0.0      Echium gentianoides
gb|AAZ08559.1|  delta-6 desaturase                                      594   0.0      Echium plantagineum
gb|AAL23581.1|  delta-6-desaturase                                      592   0.0      Echium pitardii var. pitardii
ref|XP_004245093.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    592   0.0      
gb|ADA68870.2|  delta-6 desaturase                                      590   0.0      Echium amoenum
gb|ADD10720.1|  delta-6-desaturase                                      590   0.0      Camellia oleifera [abura-tsubaki]
gb|AFX86441.1|  delta-6-desaturase                                      589   0.0      
gb|AAD01410.1|  delta 6-desaturase                                      585   0.0      Borago officinalis
ref|XP_006450852.1|  hypothetical protein CICLE_v10010195mg             585   0.0      
ref|XP_011023257.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    585   0.0      
ref|XP_006475919.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     584   0.0      
ref|XP_002302613.1|  fatty acid desaturase/cytochrome b5 fusion p...    584   0.0      Populus trichocarpa [western balsam poplar]
gb|AAD01240.1|  desaturase/cytochrome b5 protein                        583   0.0      Ricinus communis
ref|XP_007051674.1|  Fatty acid/sphingolipid desaturase                 583   0.0      
ref|XP_010092888.1|  Fatty acid desaturase 3                            582   0.0      
gb|AAC49700.1|  delta 6 desaturase                                      582   0.0      Borago officinalis
ref|XP_002308556.1|  hypothetical protein POPTR_0006s24460g             580   0.0      Populus trichocarpa [western balsam poplar]
gb|AAO13090.1|  delta-6-desaturase                                      580   0.0      Camellia sinensis [black tea]
gb|ABP01349.1|  D8-sphingolipid desaturase                              580   0.0      Jatropha curcas
gb|AHF70965.1|  delta8-sphingolipid desaturase                          580   0.0      
ref|XP_010261428.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     579   0.0      
ref|XP_008377689.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     579   0.0      
gb|AHF70967.1|  delta8-sphingolipid desaturase                          579   0.0      
ref|XP_011019447.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     579   0.0      
gb|ABD60318.1|  delta-6 fatty acid desaturase                           578   0.0      Nonea caspica
ref|XP_011098230.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    577   0.0      
ref|XP_010526057.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    577   0.0      
gb|EPS73310.1|  d8-sphingolipid desaturase                              575   0.0      
ref|XP_010669398.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     575   0.0      
ref|XP_008220482.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     573   0.0      
ref|XP_007222102.1|  hypothetical protein PRUPE_ppa005677mg             573   0.0      
ref|XP_010047339.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    573   0.0      
ref|XP_011037262.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    571   0.0      
ref|XP_010917106.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    570   0.0      
ref|XP_010559105.1|  PREDICTED: delta(8)-fatty-acid desaturase 2        570   0.0      
ref|XP_008805633.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    570   0.0      
ref|XP_002320834.1|  hypothetical protein POPTR_0014s08750g             569   0.0      Populus trichocarpa [western balsam poplar]
gb|ACB47482.1|  delta6-fatty acid desaturase                            569   0.0      
ref|XP_007157636.1|  hypothetical protein PHAVU_002G086300g             569   0.0      
ref|XP_002511936.1|  fatty acid desaturase, putative                    569   0.0      Ricinus communis
ref|XP_006444926.1|  hypothetical protein CICLE_v10020141mg             568   0.0      
ref|XP_004291044.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     566   0.0      
ref|XP_002279227.1|  PREDICTED: delta(8)-fatty-acid desaturase          566   0.0      Vitis vinifera
ref|XP_004498883.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     564   0.0      
ref|XP_010251589.1|  PREDICTED: delta(8)-fatty-acid desaturase          563   0.0      
gb|AHF70966.1|  delta8-sphingolipid desaturase                          563   0.0      
gb|EYU20353.1|  hypothetical protein MIMGU_mgv1a027096mg                563   0.0      
ref|NP_182144.1|  Fatty acid/sphingolipid desaturase                    562   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABU98945.1|  delta-8 lipid desaturase                                562   0.0      Stylosanthes hamata [Caribbean stylo]
gb|AAM94345.1|  delta-6-desaturase                                      560   0.0      Argania spinosa
ref|XP_010053767.1|  PREDICTED: delta(8)-fatty-acid desaturase 2        560   0.0      
ref|XP_004138473.1|  PREDICTED: delta(8)-fatty-acid desaturase-li...    560   0.0      
ref|XP_010506617.1|  PREDICTED: delta(8)-fatty-acid desaturase 2        560   0.0      
ref|XP_010915755.1|  PREDICTED: delta(8)-fatty-acid desaturase 2        560   0.0      
ref|XP_008458161.1|  PREDICTED: delta(8)-fatty-acid desaturase          560   0.0      
ref|XP_003517965.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     559   0.0      
ref|XP_006294209.1|  hypothetical protein CARUB_v10023205mg             559   0.0      
ref|XP_009415167.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    559   0.0      
ref|XP_003588984.1|  Delta-6-desaturase                                 559   0.0      
ref|XP_010518286.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    559   0.0      
gb|KHN01208.1|  Fatty acid desaturase 2                                 558   0.0      
gb|ACZ51243.1|  sphingolipid delta-8 desaturase                         558   0.0      
ref|XP_008232958.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     558   0.0      
ref|XP_010544777.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    558   0.0      
emb|CAA11857.1|  delta-8 sphingolipid desaturase                        557   0.0      Brassica napus [oilseed rape]
ref|XP_010925808.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     556   0.0      
ref|XP_008802041.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    555   0.0      
gb|AFX61788.1|  fatty acid desaturase 2a                                555   0.0      
ref|XP_002880224.1|  hypothetical protein ARALYDRAFT_483768             555   0.0      
ref|XP_006397805.1|  hypothetical protein EUTSA_v10001443mg             555   0.0      
ref|XP_009142680.1|  PREDICTED: delta(8)-fatty-acid desaturase 2        555   0.0      
ref|XP_008795083.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    554   0.0      
gb|ADA60228.1|  delta-8 sphingolipid desaturase                         554   0.0      Ribes nigrum [European black currant]
ref|NP_001288997.1|  delta8-sphingolipid desaturase                     553   0.0      
emb|CDY43938.1|  BnaC04g21720D                                          553   0.0      
ref|XP_009404910.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    553   0.0      
gb|AHF50176.1|  fatty acid d6 desaturase                                552   0.0      
gb|AFK34809.1|  unknown                                                 552   0.0      
gb|AIP90101.1|  omega-3 fatty acid desaturase endoplasmic reticul...    552   0.0      
gb|ADA60229.1|  delta-8 sphingolipid desaturase                         551   0.0      Ribes nigrum [European black currant]
gb|AEW24951.1|  delta8-sphingolipid desaturase                          551   0.0      
ref|XP_004306719.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     551   0.0      
ref|XP_010508055.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    550   0.0      
ref|XP_003520073.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     550   0.0      
ref|XP_007219777.1|  hypothetical protein PRUPE_ppa024455mg             550   0.0      
gb|KFK37417.1|  hypothetical protein AALP_AA4G254400                    550   0.0      
gb|AAZ23034.1|  delta-6 desaturase-related protein                      549   0.0      Echium pitardii var. pitardii
ref|XP_003550268.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     548   0.0      
gb|ADC34631.1|  delta-8 sphingolipid desaturase                         547   0.0      Primula nivalis
ref|XP_004511216.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     546   0.0      
gb|AAN03619.1|AF406816_1  sphingolipid long chain base delta 8 de...    546   0.0      Aquilegia vulgaris
gb|ADC80921.1|  delta-8 sphingolipid desaturase                         546   0.0      Vernicia fordii [tung oil tree]
gb|AAP23035.1|  sphingolipid delta-8 desaturase                         546   0.0      Primula vialii
ref|XP_011093077.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     545   0.0      
ref|XP_011093109.1|  PREDICTED: delta(8)-fatty-acid desaturase          545   0.0      
gb|AFX61783.1|  fatty acid desaturase 2                                 544   0.0      
ref|XP_007153598.1|  hypothetical protein PHAVU_003G049200g             543   0.0      
ref|XP_009392458.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    543   0.0      
gb|ADA60230.1|  delta-6 desaturase                                      543   0.0      Ribes nigrum [European black currant]
gb|ADA60232.1|  delta-6 desaturase                                      542   0.0      Ribes nigrum [European black currant]
ref|XP_003544536.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     541   0.0      
ref|XP_010413381.1|  PREDICTED: delta(8)-fatty-acid desaturase 1        540   0.0      
ref|XP_009138767.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    540   0.0      
ref|XP_010469097.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    538   0.0      
gb|ADA60231.1|  delta-6 desaturase                                      538   0.0      Ribes nigrum [European black currant]
ref|XP_008344403.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     537   0.0      
ref|XP_010669699.1|  PREDICTED: delta(8)-fatty-acid desaturase          537   0.0      
ref|XP_010469096.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    537   0.0      
gb|AAM64895.1|  delta-8 sphingolipid desaturase                         537   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009338790.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    537   0.0      
ref|XP_003628379.1|  Delta-8 sphingolipid desaturase                    537   0.0      
ref|XP_010512510.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    537   0.0      
ref|NP_191717.1|  Fatty acid/sphingolipid desaturase                    536   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847040.1|  hypothetical protein AMTR_s00017p00184030          537   0.0      
ref|XP_002876622.1|  delta-8 sphingolipid desaturase                    535   0.0      
gb|AAP23033.1|  sphingolipid delta-8 desaturase                         535   0.0      Primula farinosa [birds-eye primrose]
ref|XP_009116822.1|  PREDICTED: delta(8)-fatty-acid desaturase 1        535   0.0      
ref|XP_009338791.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    535   0.0      
ref|XP_008344317.1|  PREDICTED: LOW QUALITY PROTEIN: delta(8)-fat...    535   0.0      
ref|XP_008384543.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     534   0.0      
emb|CDY11363.1|  BnaA09g39290D                                          534   0.0      
emb|CDX71730.1|  BnaC08g31440D                                          534   0.0      
sp|Q9FR82.1|SLD1_BOROF  RecName: Full=Delta(8)-fatty-acid desatur...    533   0.0      Borago officinalis
ref|XP_008382455.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     533   0.0      
gb|AEW24954.1|  delta8-sphingolipid desaturase                          533   0.0      
ref|XP_009350120.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    532   0.0      
ref|XP_009350121.1|  PREDICTED: delta(8)-fatty-acid desaturase 1-...    532   0.0      
gb|EYU32187.1|  hypothetical protein MIMGU_mgv1a006322mg                531   0.0      
ref|XP_003532059.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     531   0.0      
gb|ABA55805.1|  delta-8 sphingolipid desaturase                         531   1e-180   Crepis alpina
gb|KHN17384.1|  Fatty acid desaturase 2                                 530   1e-180   
ref|XP_007161019.1|  hypothetical protein PHAVU_001G036200g             530   2e-180   
gb|ADK91077.1|  delta-8 sphingolipid desaturase                         531   2e-180   
ref|XP_006291124.1|  hypothetical protein CARUB_v10017244mg             530   2e-180   
ref|XP_008232960.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     530   2e-180   
ref|XP_007218002.1|  hypothetical protein PRUPE_ppa005694mg             528   5e-180   
ref|XP_006402468.1|  hypothetical protein EUTSA_v10005967mg             528   1e-179   
gb|AAP23034.1|  fatty acid delta-6 desaturase                           528   1e-179   Primula farinosa [birds-eye primrose]
ref|XP_006358651.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     527   2e-179   
ref|XP_009104319.1|  PREDICTED: delta(8)-fatty-acid desaturase 1        527   2e-179   
ref|XP_009759732.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     527   2e-179   
gb|AAQ10732.1|  delta-8-sphingolipid desaturase                         527   2e-179   Anemone leveillei
gb|AAP23036.1|  fatty acid delta-6 desaturase                           527   2e-179   Primula vialii
ref|XP_009790286.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     526   3e-179   
emb|CBI20658.3|  unnamed protein product                                528   4e-179   
emb|CDY53911.1|  BnaA07g38190D                                          526   6e-179   
gb|ADC34632.1|  delta-8 sphingolipid desaturase                         526   7e-179   Primula auricula
gb|KFK35341.1|  hypothetical protein AALP_AA5G272100                    526   8e-179   
ref|XP_009599904.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     525   9e-179   
ref|XP_004248068.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     525   9e-179   
sp|Q43469.1|SLD1_HELAN  RecName: Full=Delta(8)-fatty-acid desatur...    525   1e-178   Helianthus annuus
ref|XP_009611900.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     524   2e-178   
gb|AEW24953.1|  delta8-sphingolipid desaturase                          524   3e-178   
ref|XP_009624554.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     522   1e-177   
ref|XP_004240093.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     522   1e-177   
ref|XP_006660549.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     523   2e-177   
ref|XP_006602301.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     522   2e-177   
ref|XP_010326991.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     521   4e-177   
ref|XP_009788557.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     518   3e-176   
ref|XP_006345577.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     517   1e-175   
ref|XP_004306721.1|  PREDICTED: delta(8)-fatty-acid desaturase-li...    517   2e-175   
gb|EMT29164.1|  Fatty acid desaturase 2-like protein                    517   4e-175   
dbj|BAK00580.1|  predicted protein                                      517   4e-175   
emb|CDY52010.1|  BnaC06g42900D                                          516   5e-175   
gb|AAD00895.1|  fatty acid desaturase/cytochrome b5 fusion protein      516   5e-175   
gb|AAD10250.1|  S276                                                    516   8e-175   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003578001.2|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    516   9e-175   
gb|AFK42352.1|  unknown                                                 514   3e-174   
ref|NP_001130866.1|  uncharacterized protein LOC100191970               514   4e-174   Zea mays [maize]
ref|XP_004956618.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     513   1e-173   
gb|EPS70430.1|  delta-8 sphingolipid desaturase                         511   1e-173   
ref|XP_002460077.1|  hypothetical protein SORBIDRAFT_02g022420          512   3e-173   Sorghum bicolor [broomcorn]
ref|NP_001062915.1|  Os09g0338500                                       512   4e-173   Oryza sativa Japonica Group [Japonica rice]
gb|EMS63061.1|  Fatty acid desaturase 3                                 509   2e-172   
ref|NP_001145881.1|  desaturase/cytochrome b5 protein isoform 1         509   5e-172   Zea mays [maize]
gb|ACF85036.1|  unknown                                                 507   3e-171   Zea mays [maize]
gb|ACG40941.1|  desaturase/cytochrome b5 protein                        504   2e-170   Zea mays [maize]
ref|XP_002455788.1|  hypothetical protein SORBIDRAFT_03g025270          494   3e-166   Sorghum bicolor [broomcorn]
gb|AAQ10731.1|  delta-6-fatty acid desaturase                           486   2e-163   Anemone leveillei
ref|XP_004971923.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     484   2e-162   
gb|EEE69508.1|  hypothetical protein OsJ_28957                          477   7e-160   Oryza sativa Japonica Group [Japonica rice]
emb|CDX79995.1|  BnaA05g01610D                                          469   2e-157   
ref|XP_008675512.1|  PREDICTED: delta(8)-fatty-acid desaturase 2-...    463   1e-154   
emb|CDY42017.1|  BnaC04g00950D                                          459   1e-153   
ref|XP_008356929.1|  PREDICTED: LOW QUALITY PROTEIN: delta(8)-fat...    458   6e-153   
gb|AAT85664.1|  putative desaturase                                     456   3e-151   Marchantia polymorpha
emb|CBI40451.3|  unnamed protein product                                455   6e-151   
ref|XP_001778179.1|  predicted protein                                  452   1e-149   
gb|ACF85529.1|  unknown                                                 403   1e-132   Zea mays [maize]
ref|XP_002968817.1|  hypothetical protein SELMODRAFT_231254             405   7e-132   
gb|KHN12218.1|  Fatty acid desaturase 3                                 388   9e-127   
tpg|DAA59013.1|  TPA: hypothetical protein ZEAMMB73_379395              389   1e-124   
gb|ACJ84950.1|  unknown                                                 373   7e-121   Medicago truncatula
emb|CDP08743.1|  unnamed protein product                                363   1e-117   
ref|XP_003588983.1|  Esterase/lipase/thioesterase                       367   2e-114   
gb|AFK46578.1|  unknown                                                 351   8e-113   
ref|XP_002108055.1|  hypothetical protein TRIADDRAFT_36979              326   5e-101   Trichoplax adhaerens
ref|XP_001640617.1|  predicted protein                                  319   2e-98    Nematostella vectensis
ref|XP_002506304.1|  predicted protein                                  309   2e-94    Micromonas commoda
gb|AEV77089.1|  delta-6 fatty acid desaturase                           305   7e-93    
gb|AIP90100.1|  omega-3 fatty acid desaturase endoplasmic reticul...    296   2e-92    
ref|XP_005823399.1|  hypothetical protein GUITHDRAFT_97578              295   6e-89    
emb|CEG01739.1|  Cytochrome b5-like heme/steroid binding domain         294   2e-88    
ref|XP_001417552.1|  predicted protein                                  290   6e-87    Ostreococcus lucimarinus CCE9901
gb|KCW78123.1|  hypothetical protein EUGRSUZ_D02331                     278   4e-84    
ref|XP_003063519.1|  predicted protein                                  283   6e-84    
gb|ERZ96241.1|  hypothetical protein GLOINDRAFT_12826                   276   4e-82    
ref|XP_002291331.1|  predicted protein                                  277   5e-82    Thalassiosira pseudonana CCMP1335
ref|XP_009039034.1|  hypothetical protein AURANDRAFT_29200              276   2e-81    
ref|XP_002158999.1|  PREDICTED: delta(8)-fatty-acid desaturase-like     274   3e-81    
ref|XP_007515499.1|  predicted protein                                  272   2e-80    
ref|XP_006675166.1|  hypothetical protein BATDEDRAFT_18307              272   7e-80    
emb|CBN74378.1|  Fatty acid desaturase                                  271   2e-79    
gb|KFH68785.1|  hypothetical protein MVEG_05590                         265   2e-77    
gb|AFK47389.1|  unknown                                                 249   2e-74    
ref|XP_002776803.1|  fatty acid desaturase, putative                    263   7e-73    Perkinsus marinus ATCC 50983
ref|XP_005647122.1|  fatty acid/sphingolipid desaturase                 246   3e-71    
gb|ACF85518.1|  unknown                                                 238   9e-71    Zea mays [maize]
gb|AIA24278.1|  delta-6 fatty acid desaturase                           236   4e-68    
gb|EIE81042.1|  hypothetical protein RO3G_05747                         235   5e-66    
gb|ACE06759.1|  delta-6 fatty acid desaturase                           234   2e-65    Mucor sp. EIM-10
ref|XP_005783065.1|  hypothetical protein EMIHUDRAFT_72565              233   3e-65    
emb|CEG79161.1|  Putative Delta-6 desaturase                            231   1e-64    
emb|CEI98987.1|  Putative Delta-6 desaturase                            231   3e-64    
gb|KDP28546.1|  hypothetical protein JCGZ_14317                         221   4e-64    
emb|CEG69766.1|  Putative Delta-6 desaturase                            230   4e-64    
gb|ABQ63083.1|  delta-6-fatty acid desaturase                           227   6e-63    Rhizomucor pusillus
emb|CDS10679.1|  hypothetical protein LRAMOSA11165                      224   1e-61    
emb|CDS10725.1|  hypothetical protein LRAMOSA11211                      221   1e-60    
ref|XP_003851524.1|  hypothetical protein MYCGRDRAFT_73189              221   3e-60    
ref|XP_001246122.1|  hypothetical protein CIMG_05563                    220   6e-60    Coccidioides immitis RS
ref|XP_003083258.1|  S68358 Delta8 sphingolipid desaturase (EC 1....    218   7e-60    
ref|XP_001555356.1|  hypothetical protein BC1G_06061                    218   1e-59    Botrytis cinerea B05.10
gb|EFW17362.1|  delta-6 fatty acid desaturase                           219   2e-59    
emb|CCD54490.1|  similar to fatty acid desaturase                       218   2e-59    
gb|AEU04700.1|  fatty acid delta-6-desaturase                           215   5e-59    
gb|AGO13078.1|  AaceriAFL079Wp                                          217   6e-59    
ref|XP_001595954.1|  hypothetical protein SS1G_02169                    216   9e-59    Sclerotinia sclerotiorum 1980 UF-70
gb|AAG36959.1|AF290983_1  delta-6 desaturase                            216   1e-58    Amylomyces rouxii
gb|EEQ84032.1|  fatty acid desaturase                                   216   1e-58    Blastomyces dermatitidis ER-3
ref|XP_002623377.1|  fatty acid desaturase                              216   2e-58    Blastomyces gilchristii SLH14081
dbj|BAO41666.1|  delta6-FADS-like protein                               216   2e-58    
gb|EQL36193.1|  hypothetical protein BDFG_02171                         216   2e-58    
gb|ADB81955.1|  delta 6 desaturase                                      214   3e-58    Lobosphaera incisa
gb|EKV19313.1|  Fatty acid desaturase, putative                         215   4e-58    
ref|XP_747146.1|  fatty acid desaturase                                 214   6e-58    Aspergillus fumigatus Af293
ref|XP_002583241.1|  hypothetical protein UREG_06208                    214   6e-58    Uncinocarpus reesii 1704
ref|XP_002562987.1|  Pc20g04400                                         214   8e-58    Penicillium rubens Wisconsin 54-1255
ref|XP_003644780.1|  hypothetical protein Ecym_2214                     213   1e-57    
gb|KGO74620.1|  Fatty acid/sphingolipid desaturase                      213   1e-57    
gb|KGO35922.1|  Fatty acid/sphingolipid desaturase                      213   1e-57    
ref|XP_011112849.1|  hypothetical protein H072_7076                     213   2e-57    
gb|KGO77584.1|  Fatty acid/sphingolipid desaturase                      213   2e-57    
emb|CDM32038.1|  Delta-9 acyl-CoA desaturase, haem/steroid bindin...    213   2e-57    
ref|XP_002567684.1|  Pc21g06390                                         213   2e-57    Penicillium rubens Wisconsin 54-1255
ref|XP_007742360.1|  hypothetical protein A1O5_03559                    213   3e-57    
ref|XP_003326715.2|  hypothetical protein PGTG_07693                    213   3e-57    
ref|XP_001826117.1|  fatty acid desaturase                              212   5e-57    Aspergillus oryzae RIB40
gb|KEQ81997.1|  fatty acid/sphingolipid desaturase                      210   7e-57    
emb|CDM30781.1|  Delta-9 acyl-CoA desaturase, haem/steroid bindin...    211   7e-57    
gb|EMF12364.1|  fatty acid/sphingolipid desaturase                      212   8e-57    
gb|EWC45523.1|  hypothetical protein DRE_05381                          211   9e-57    
gb|EQK98637.1|  Fatty acid/sphingolipid desaturase                      211   1e-56    
gb|EKV10450.1|  hypothetical protein PDIP_60340                         211   1e-56    
ref|XP_002377775.1|  fatty acid desaturase, putative                    211   1e-56    Aspergillus flavus NRRL3357
gb|KFY32302.1|  hypothetical protein V493_00333                         211   1e-56    
ref|XP_007676829.1|  hypothetical protein BAUCODRAFT_34682              211   2e-56    
gb|KFY83941.1|  hypothetical protein V500_09763                         211   2e-56    
gb|KGO49369.1|  Fatty acid/sphingolipid desaturase                      210   2e-56    
gb|KFY11161.1|  hypothetical protein V491_07324                         210   2e-56    
gb|KGO43290.1|  Fatty acid/sphingolipid desaturase                      210   2e-56    
emb|CCG82557.1|  putative Fatty acid desaturase                         211   2e-56    
gb|EME42396.1|  hypothetical protein DOTSEDRAFT_73278                   210   3e-56    
gb|KFZ14154.1|  hypothetical protein V502_06220                         210   3e-56    
gb|EEQ91413.1|  fatty acid desaturase                                   210   4e-56    
gb|KFY79769.1|  hypothetical protein V499_01285                         210   4e-56    
gb|KFZ01143.1|  hypothetical protein V501_10185                         210   6e-56    
ref|XP_001272997.1|  fatty acid desaturase, putative                    209   6e-56    
ref|XP_007293882.1|  fatty acid desaturase                              209   7e-56    
ref|XP_003654066.1|  fatty acid delta-6 desaturase                      207   8e-56    
gb|KFX87189.1|  hypothetical protein V490_08463                         209   9e-56    
gb|ELR10256.1|  hypothetical protein GMDG_04642                         209   1e-55    
emb|CCX33249.1|  Similar to Fatty acid desaturase 1; acc. no. O60427    208   1e-55    
gb|KFY16155.1|  hypothetical protein V492_01535                         208   1e-55    
ref|XP_001536159.1|  hypothetical protein HCAG_08823                    208   1e-55    
gb|KEY76811.1|  fatty acid desaturase                                   208   1e-55    
ref|XP_749348.1|  fatty acid desaturase                                 208   1e-55    
gb|KFY82103.1|  hypothetical protein V498_08652                         208   1e-55    
gb|EGE80291.1|  fatty acid desaturase                                   208   1e-55    
dbj|GAD98790.1|  fatty acid desaturase                                  208   1e-55    
ref|XP_002624341.1|  fatty acid desaturase                              208   2e-55    
gb|KHJ31766.1|  putative fatty acid desaturase                          207   2e-55    
ref|XP_001932191.1|  fatty acid desaturase                              207   2e-55    
ref|XP_007756673.1|  hypothetical protein A1O7_04472                    207   2e-55    
gb|KFY47326.1|  hypothetical protein V494_00029                         207   3e-55    
ref|XP_007722290.1|  hypothetical protein A1O1_03194                    207   3e-55    
gb|EQL29866.1|  hypothetical protein BDFG_07555                         207   3e-55    
emb|CCU82607.1|  putative fatty acid desaturase 3/putative delta ...    207   3e-55    
gb|AAZ23038.1|  delta-8 desaturase related-protein 2                    195   4e-55    
ref|XP_003067738.1|  delta 8-(E)-sphingolipid desaturase, putative      206   5e-55    
gb|AAZ23037.1|  delta-8 desaturase related-protein 1                    195   6e-55    
ref|XP_002843247.1|  fatty acid desaturase                              206   7e-55    
gb|AAT85661.1|  delta6 fatty acid desaturase                            204   7e-55    
ref|XP_007416562.1|  hypothetical protein MELLADRAFT_118135             201   7e-55    
ref|XP_009159211.1|  hypothetical protein HMPREF1120_06753              206   8e-55    
gb|EFW17410.1|  fatty acid desaturase                                   206   8e-55    
gb|KEY78004.1|  fatty acid desaturase                                   202   8e-55    
dbj|GAA93710.1|  hypothetical protein E5Q_00356                         205   9e-55    
gb|EAS30266.2|  fatty acid desaturase                                   206   9e-55    
gb|KEQ71744.1|  fatty acid desaturase                                   205   1e-54    
ref|XP_009262422.1|  hypothetical protein FPSE_11030                    206   1e-54    
gb|KEQ99825.1|  hypothetical protein AUEXF2481DRAFT_76399               205   1e-54    
emb|CDR46821.1|  CYFA0S26e00452g1_1                                     206   1e-54    
ref|XP_008726786.1|  hypothetical protein G647_04220                    205   2e-54    
ref|XP_003067695.1|  linoleoyl-CoA desaturase, putative                 205   2e-54    
gb|KEF62667.1|  hypothetical protein A1O9_00640                         205   2e-54    
gb|KID92534.1|  Fatty acid/sphingolipid desaturase                      203   2e-54    
gb|KIE01505.1|  Fatty acid/sphingolipid desaturase                      203   2e-54    
gb|EGC44970.1|  fatty acid desaturase                                   205   2e-54    
gb|EEH03182.1|  fatty acid desaturase                                   205   2e-54    
ref|XP_001265779.1|  fatty acid desaturase, putative                    205   2e-54    
ref|XP_007294753.1|  fatty acid desaturase                              205   2e-54    
gb|KFA72370.1|  hypothetical protein S40288_05602                       204   2e-54    
gb|KID62371.1|  Fatty acid/sphingolipid desaturase                      202   2e-54    
gb|KEY64362.1|  hypothetical protein S7711_06391                        204   2e-54    
gb|ADW79426.1|  sphingolipid delta8-desaturase                          205   2e-54    
ref|NP_985469.1|  AFL079Wp                                              204   2e-54    
ref|XP_003300043.1|  hypothetical protein PTT_11184                     204   2e-54    
gb|KFA61337.1|  hypothetical protein S40285_05865                       204   3e-54    
gb|EYE97420.1|  putative fatty acid desaturase                          204   3e-54    
ref|XP_007928701.1|  hypothetical protein MYCFIDRAFT_88087              204   3e-54    
ref|XP_390021.1|  hypothetical protein FG09845.1                        204   3e-54    
ref|XP_001823617.1|  fatty acid desaturase                              204   3e-54    
ref|XP_011120153.1|  hypothetical protein AOL_s00054g535                204   4e-54    
ref|XP_001246072.1|  hypothetical protein CIMG_05513                    205   4e-54    
ref|XP_002601535.1|  hypothetical protein BRAFLDRAFT_127728             201   5e-54    
ref|XP_002794779.1|  fatty acid desaturase                              202   6e-54    
gb|EPQ63623.1|  hypothetical protein BGT96224_1503                      203   6e-54    
gb|ENH83464.1|  fatty acid desaturase                                   204   6e-54    
ref|XP_002379029.1|  fatty acid desaturase, putative                    203   7e-54    
gb|KEQ59363.1|  fatty acid desaturase                                   203   7e-54    
tpe|CBF77189.1|  TPA: fatty acid desaturase, putative (AFU_orthol...    203   8e-54    
ref|XP_007730228.1|  hypothetical protein A1O3_01895                    203   8e-54    
gb|EGD94452.1|  fatty acid desaturase                                   202   1e-53    
ref|XP_002291529.1|  probable microsomal delta-6 desaturase             201   1e-53    
ref|XP_009494975.1|  hypothetical protein H696_02800                    201   1e-53    
gb|EUN26295.1|  hypothetical protein COCVIDRAFT_38441                   203   1e-53    
ref|XP_007713839.1|  hypothetical protein COCCADRAFT_6350               202   1e-53    
ref|XP_003716345.1|  fatty acid desaturase                              202   1e-53    
gb|KID78440.1|  Fatty acid/sphingolipid desaturase                      201   1e-53    
ref|XP_008081396.1|  Cytochrome b5-like heme/steroid binding protein    202   1e-53    
gb|EQB53289.1|  fatty acid desaturase                                   203   1e-53    
gb|ESZ90942.1|  hypothetical protein SBOR_8660                          202   1e-53    
ref|XP_006695221.1|  desaturase-like protein                            202   2e-53    
ref|XP_007286224.1|  fatty acid desaturase                              202   2e-53    
ref|XP_007682231.1|  hypothetical protein COCMIDRAFT_79519              202   2e-53    
ref|XP_001214881.1|  hypothetical protein ATEG_05703                    202   2e-53    
gb|EWY80660.1|  hypothetical protein FOYG_16593                         200   2e-53    
gb|EXM09690.1|  hypothetical protein FOIG_00038                         200   2e-53    
gb|EFY99560.2|  Fatty acid/sphingolipid desaturase                      202   2e-53    
gb|EEH41038.2|  fatty acid desaturase                                   202   2e-53    
ref|XP_010761776.1|  hypothetical protein PADG_06500                    202   2e-53    
ref|XP_007820776.1|  hypothetical protein MAA_04489                     202   2e-53    
gb|EWZ49247.1|  hypothetical protein FOZG_00208                         200   2e-53    
ref|XP_001768507.1|  predicted protein                                  201   2e-53    
emb|CBN74970.1|  delta-6 fatty acid desaturase                          199   2e-53    
gb|KDN62864.1|  putative fatty acid desaturase                          202   2e-53    
ref|XP_662196.1|  hypothetical protein AN4592.2                         201   3e-53    
gb|KID82612.1|  Fatty acid/sphingolipid desaturase                      200   4e-53    
ref|XP_504218.1|  YALI0E21131p                                          201   4e-53    
gb|EEH16934.2|  hypothetical protein PABG_07021                         201   4e-53    
ref|XP_007806452.1|  hypothetical protein MAC_00112                     202   4e-53    
gb|KHO01105.1|  Fatty acid/sphingolipid desaturase                      201   4e-53    
gb|EXM09689.1|  hypothetical protein FOIG_00038                         201   4e-53    
gb|KEZ43606.1|  Delta(8)-fatty-acid desaturase                          201   4e-53    
emb|CAB94992.1|  delta 6-fatty acetylenase                              199   4e-53    
emb|CDO94979.1|  unnamed protein product                                201   5e-53    
gb|KFH42904.1|  Delta(8)-fatty-acid desaturase-like protein             201   5e-53    
gb|EWG50673.1|  hypothetical protein FVEG_09818                         201   5e-53    
gb|AAU11444.1|  fatty acid desaturase                                   199   5e-53    
gb|EWZ49246.1|  hypothetical protein FOZG_00208                         201   5e-53    
gb|EGU81419.1|  hypothetical protein FOXB_08072                         201   5e-53    
ref|XP_007697566.1|  hypothetical protein COCSADRAFT_35049              201   5e-53    
gb|KID95783.1|  Fatty acid/sphingolipid desaturase                      201   6e-53    
gb|EFQ30506.1|  fatty acid desaturase                                   201   7e-53    
ref|XP_009221286.1|  fatty acid desaturase                              200   7e-53    
ref|XP_001826739.2|  fatty acid desaturase                              200   7e-53    
ref|XP_008712150.1|  hypothetical protein HMPREF1541_09253              200   7e-53    
emb|CCT61567.1|  related to delta-5/delta-6 fatty acid desaturase       200   7e-53    
emb|CCT67429.1|  probable delta 8-sphingolipid desaturase               200   1e-52    
ref|XP_007599068.1|  fatty acid desaturase                              200   1e-52    
ref|XP_001550606.1|  hypothetical protein BC1G_11379                    200   1e-52    
gb|KID65479.1|  Fatty acid/sphingolipid desaturase                      200   1e-52    
gb|KFY24941.1|  hypothetical protein V491_01961                         199   1e-52    
gb|KFG86002.1|  putative delta 8-(E)-sphingolipid desaturase            200   1e-52    
ref|XP_007822830.1|  delta 8-(E)-sphingolipid desaturase, putative      200   1e-52    
gb|KFY66373.1|  hypothetical protein V496_02097                         199   1e-52    
dbj|BAE65606.1|  unnamed protein product                                200   1e-52    
ref|XP_008027353.1|  hypothetical protein SETTUDRAFT_163638             200   1e-52    
gb|EMD97125.1|  hypothetical protein COCHEDRAFT_1124227                 200   1e-52    
gb|EXV06234.1|  fatty acid desaturase                                   202   1e-52    
gb|EGU78653.1|  hypothetical protein FOXB_10839                         200   1e-52    
gb|KGB79753.1|  delta 8-sphingolipid desaturase                         196   1e-52    
ref|XP_008603336.1|  fatty acid desaturase                              200   1e-52    
gb|EMT64792.1|  Fatty acid desaturase 2                                 199   1e-52    
gb|EHK23232.1|  hypothetical protein TRIVIDRAFT_74251                   200   2e-52    
gb|EMT68695.1|  Fatty acid desaturase 2-like protein                    200   2e-52    
ref|XP_569193.1|  delta 8-sphingolipid desaturase                       199   2e-52    
gb|KGQ02574.1|  Fatty acid desaturase 2                                 199   2e-52    
gb|EJK45829.1|  hypothetical protein THAOC_35538                        197   2e-52    
ref|XP_002148297.1|  fatty acid desaturase, putative                    199   2e-52    
gb|KFX51871.1|  Delta(8)-fatty-acid desaturase                          199   3e-52    
gb|EIE83618.1|  delta-6-fatty acid desaturase                           197   3e-52    
ref|XP_007815608.1|  delta 8-(E)-sphingolipid desaturase, putative      197   3e-52    
ref|XP_006685859.1|  fatty acid/sphingolipid desaturase                 199   3e-52    
ref|XP_006666441.1|  Fatty acid/sphingolipid desaturase                 199   4e-52    
ref|XP_003051933.1|  hypothetical protein NECHADRAFT_103962             199   5e-52    
ref|XP_001391754.1|  fatty acid desaturase                              198   5e-52    
gb|EWG43730.1|  hypothetical protein FVEG_05080                         198   5e-52    
gb|EZF34990.1|  hypothetical protein H101_01472                         198   5e-52    
gb|EGE02636.1|  fatty acid desaturase                                   198   5e-52    
gb|AAZ23036.1|  delta-8 desaturase related-protein                      186   7e-52    
ref|XP_003237894.1|  fatty acid desaturase                              197   7e-52    
dbj|GAA85163.1|  fatty acid desaturase                                  197   7e-52    
ref|XP_003665460.1|  fatty acid delta-6 desaturase                      198   8e-52    
ref|XP_001929756.1|  hypothetical protein                               198   8e-52    
ref|XP_454832.1|  hypothetical protein                                  197   8e-52    
ref|XP_003020718.1|  fatty acid desaturase, putative                    197   9e-52    
ref|XP_003011242.1|  fatty acid desaturase, putative                    197   9e-52    
gb|KGO46244.1|  Fatty acid/sphingolipid desaturase                      196   1e-51    
ref|XP_009223532.1|  hypothetical protein GGTG_07444                    196   1e-51    
gb|AFR93370.1|  delta8-fatty-acid desaturase                            197   1e-51    
gb|KGO53000.1|  Fatty acid/sphingolipid desaturase                      196   1e-51    
emb|CAB94993.1|  delta 6-fatty acid desaturase                          196   1e-51    
dbj|GAA85341.1|  fatty acid desaturase                                  197   1e-51    
ref|XP_003173150.1|  fatty acid desaturase                              197   1e-51    
gb|EPS26758.1|  hypothetical protein PDE_01697                          197   1e-51    
gb|EHA22158.1|  hypothetical protein ASPNIDRAFT_48908                   196   1e-51    
ref|XP_003191294.1|  delta 8-sphingolipid desaturase                    196   1e-51    
ref|XP_002586717.1|  hypothetical protein BRAFLDRAFT_121704             194   1e-51    
ref|XP_007780760.1|  hypothetical protein W97_04681                     197   1e-51    
ref|XP_006959845.1|  fatty acid/sphingolipid desaturase                 196   2e-51    
ref|XP_001261681.1|  fatty acid desaturase                              196   2e-51    
ref|XP_001587770.1|  hypothetical protein SS1G_11010                    197   2e-51    
gb|EKG17622.1|  Fatty acid desaturase type 1                            192   2e-51    
ref|XP_001793726.1|  hypothetical protein SNOG_03145                    196   4e-51    
emb|CAK46969.1|  unnamed protein product                                195   4e-51    
ref|XP_006668934.1|  delta 8-(E)-sphingolipid desaturase                194   5e-51    
ref|XP_001397937.2|  fatty acid desaturase                              195   6e-51    
ref|XP_007830277.1|  hypothetical protein PFICI_03505                   195   8e-51    
ref|XP_009656687.1|  fatty acid desaturase                              194   8e-51    
gb|EHK43664.1|  hypothetical protein TRIATDRAFT_150047                  194   1e-50    
gb|ESZ96689.1|  fatty acid desaturase                                   194   1e-50    
ref|XP_006964899.1|  predicted protein                                  194   1e-50    
gb|KDB16890.1|  fatty acid desaturase                                   195   1e-50    
gb|EFX00897.1|  delta-9 acyl-CoA desaturase                             197   1e-50    
ref|XP_002839521.1|  hypothetical protein                               194   1e-50    
ref|XP_009262831.1|  hypothetical protein FPSE_11439                    194   2e-50    
ref|XP_007586292.1|  putative fatty acid desaturase protein             194   2e-50    
dbj|BAO27781.1|  delta6 desaturase-b                                    192   2e-50    
ref|XP_007581109.1|  putative fatty acid desaturase protein             193   3e-50    
ref|XP_004194342.1|  Piso0_004830                                       193   3e-50    
ref|XP_006822674.1|  PREDICTED: fatty acid desaturase 2-like            190   3e-50    
dbj|BAO27782.1|  delta6 desaturase-a                                    191   3e-50    
ref|XP_003845751.1|  similar to fatty acid desaturase                   193   4e-50    
ref|XP_002999971.1|  fatty acid desaturase                              192   5e-50    
sp|Q8NKG9.1|SLD1_LACK1  RecName: Full=Delta(8)-fatty-acid desatur...    192   6e-50    
sp|Q8NKG8.1|SLD1_KLULC  RecName: Full=Delta(8)-fatty-acid desatur...    192   1e-49    
gb|ADM86708.1|  delta-6 desaturase                                      189   1e-49    
ref|XP_003344355.1|  hypothetical protein SMAC_08298                    192   1e-49    
emb|CCC09447.1|  unnamed protein product                                192   1e-49    
gb|KEY72843.1|  hypothetical protein S7711_04424                        191   2e-49    
ref|XP_381893.1|  hypothetical protein FG01717.1                        191   2e-49    
ref|XP_004195443.1|  Piso0_004830                                       191   2e-49    
ref|XP_007723850.1|  hypothetical protein A1O1_04771                    191   2e-49    
emb|CEJ93425.1|  Putative Fatty acid desaturase                         190   3e-49    
ref|XP_002548250.1|  hypothetical protein CTRG_02547                    191   3e-49    
ref|XP_007912716.1|  putative fatty acid desaturase protein             190   3e-49    
ref|XP_008596780.1|  fatty acid desaturase                              191   3e-49    
emb|CDK28943.1|  unnamed protein product                                190   3e-49    
gb|KGQ09810.1|  Fatty acid desaturase 2-like protein                    191   4e-49    
ref|XP_002482564.1|  fatty acid desaturase, putative                    190   4e-49    
gb|KEQ70116.1|  fatty acid/sphingolipid desaturase                      189   4e-49    
gb|EWM20915.1|  delta-6 fatty acid desaturase                           188   5e-49    
dbj|GAM40275.1|  delta 8-sphingolipid desaturase                        189   5e-49    
ref|XP_003049752.1|  predicted protein                                  189   6e-49    
gb|KIH89120.1|  delta8-fatty-acid desaturase                            187   6e-49    
gb|EJT99489.1|  delta 8-sphingoloid desaturase protein                  188   7e-49    
ref|XP_007283444.1|  fatty acid desaturase                              189   8e-49    



>ref|XP_011081681.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Sesamum indicum]
Length=447

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/447 (65%), Positives = 356/447 (80%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K++IT+EELK H+K GDLW+SI GKVYDVS+WV  HPGGE PLL+LAGQD TDAF+AYHP
Sbjct  5     KRYITSEELKAHNKSGDLWISIQGKVYDVSEWVNHHPGGELPLLNLAGQDATDAFVAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A   L +FFNG+Y+ D+ VSEVSKDYR LV EFS+MGLFEKKGH V      ++ MF 
Sbjct  65    GTAWQFLDKFFNGFYLKDYSVSEVSKDYRKLVYEFSKMGLFEKKGHGVFISMCFMAMMFP  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGVV  E VW H+  A L+GFLWIQ+GW+GHDSGHY VM T KL+R  Q+L+GNCL 
Sbjct  125   LSVYGVVCCEGVWLHLLCACLMGFLWIQSGWIGHDSGHYQVMLTPKLNRFVQILSGNCLA  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN +DYDPD+Q +P FA S+K F +SL S+FYE+ M F+S+AR
Sbjct  185   GISIGWWKWNHNAHHIACNSLDYDPDLQHMPFFAVSSKFF-NSLTSYFYERTMYFDSVAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVS QHWTFYPVM  IARIN+F QS   +L K+K+  +R QE+LGL++FW+WYP L+S 
Sbjct  244   FLVSNQHWTFYPVM-CIARINLFAQSIILLLSKRKV-PHRVQELLGLLVFWIWYPLLVSC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFVV S  +TG+Q +QF LNH +SS + GP  G DW EKQ DGTLDI CS W
Sbjct  302   LPNWGERVMFVVASFSVTGIQHVQFCLNHFSSSIYVGPPRGNDWFEKQTDGTLDIKCSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLRK+SP VK+LC+KHG+ YN ASFW ANA+  +++R
Sbjct  362   MDWFHGGLQFQVEHHLFPRLPRCQLRKISPLVKELCKKHGLPYNSASFWEANAMTIRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARD + +  PKNLVWEA+N+ G
Sbjct  422   NAALQARDFT-KPIPKNLVWEAVNTHG  447



>ref|XP_010097058.1| Fatty acid desaturase 3 [Morus notabilis]
 gb|EXB66859.1| Fatty acid desaturase 3 [Morus notabilis]
Length=447

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/447 (64%), Positives = 352/447 (79%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +K+I+ EEL KH KPGDLW+SI GK+Y+VSDW + HPGGE+PLL+LAGQD TDAF+AYHP
Sbjct  5     RKYISQEELGKHKKPGDLWISIQGKIYNVSDWAHTHPGGEHPLLNLAGQDATDAFVAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GYY+ D+ VSE SKDYR LV EFS+MGLF+KKGH+       ++ +F 
Sbjct  65    GKAWQYLDQFFTGYYLRDYSVSEASKDYRKLVHEFSKMGLFDKKGHVTFLTFCLIAMLFA  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F ESVW H+ S  L+GFLWIQ+GW+GHDSGHY VM ++  +R AQ+L GNCL 
Sbjct  125   ISVYGVLFSESVWVHLLSGGLMGFLWIQSGWIGHDSGHYQVMTSRGFNRFAQILTGNCLA  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN +D+DPD+Q +P+F  S+K F  SL S FYE+ M+F+S AR
Sbjct  185   GISIGWWKWNHNAHHIACNSLDFDPDLQHMPVFVVSSKFF-DSLTSCFYERRMNFDSFAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH TFYPVM L ARIN+F QS+  +L K+K+  NR QEILG+++FW+WYP L+S 
Sbjct  244   FLVSYQHLTFYPVMCL-ARINLFAQSFALLLSKRKV-PNRGQEILGIVMFWIWYPLLVSR  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SERIMFVV S  +TG+Q IQF LNH +S  + GP +G DW EKQ  GTLDI CS W
Sbjct  302   LPNWSERIMFVVASFSVTGIQHIQFCLNHFSSRVYVGPPSGNDWFEKQTHGTLDISCSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+ HHLFPR+PRCQLRKVSPFVK+LC+KH + YN ASFW ANA+   ++R
Sbjct  362   MDWFHGGLQFQVAHHLFPRLPRCQLRKVSPFVKELCKKHNLPYNCASFWKANAMTLSTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDLS    P+NLVWEA+N+ G
Sbjct  422   TAALQARDLS-NPVPRNLVWEAVNTHG  447



>ref|XP_009792309.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Nicotiana sylvestris]
Length=447

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/448 (63%), Positives = 353/448 (79%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             ++K+IT EELK H+KPGDLW+SI GKVYDVSDW+  HPGG++PLL+LAGQDVTDAF+AYH
Sbjct  4     SRKYITGEELKNHNKPGDLWISIQGKVYDVSDWIKEHPGGDFPLLNLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             PA A  +L +FFNG+Y+ D+  SEVSKDYR LVSEF+++GLFEKKGH+  Y   +++ +F
Sbjct  64    PATAWQYLDKFFNGFYLKDYSASEVSKDYRRLVSEFTKLGLFEKKGHVCFYTMCSIAMLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              VS+YG++  ESV  H+ S  L+GFLWIQ+GW+GHDSGHY VM T+ L+R AQ+L GNCL
Sbjct  124   AVSVYGILCSESVLVHLMSGGLMGFLWIQSGWIGHDSGHYQVMSTRGLNRFAQVLTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHIA N ++YDPD+Q +P F  S+K F +SL S+FY++ M+F+S  
Sbjct  184   AGISIAWWKWNHNAHHIAVNSLEYDPDLQHMPFFVVSSKFF-NSLTSYFYDRKMTFDSFT  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVS QHWTFYPVM L ARIN+F QS+  +L KK +   R QE+LG++ FW+WYP L+S
Sbjct  243   RFLVSNQHWTFYPVMCL-ARINLFAQSFILLLSKKNV-PYRVQELLGVVAFWIWYPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ERIMFV+ S  +TG+Q +QF LNH +S  +  P  G DW EKQ  G+LDI C  
Sbjct  301   CLPNWGERIMFVLASFTVTGIQHVQFCLNHFSSDIYVAPPKGNDWFEKQTGGSLDISCPS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PRCQLRKVSPFVK LC+KHG+ YN ASF+ ANAL   ++
Sbjct  361   WMDWFHGGLQFQIEHHLFPRLPRCQLRKVSPFVKDLCKKHGLPYNCASFYMANALTISTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+ +  PKNLVWEA+N+ G
Sbjct  421   RTAALQARDLT-KPVPKNLVWEAVNTHG  447



>gb|ABO31111.1| sphingolipid delta-8 desaturase [Nicotiana tabacum]
Length=447

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/448 (63%), Positives = 354/448 (79%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             ++K+IT+EELK H+KPGDLW+SI GKVYDVSDW+  HPGG++PLL+LAGQDVTDAF+AYH
Sbjct  4     SRKYITSEELKNHNKPGDLWISIQGKVYDVSDWIKEHPGGDFPLLNLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             PA A  +L +FFNG+Y+ D+  SEVSKDYR LVSEF+++GLFEKKGH+  Y   +++ +F
Sbjct  64    PATAWQYLDKFFNGFYLKDYSASEVSKDYRRLVSEFTKLGLFEKKGHVCFYTMCSIAMLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              VS+YG++  ESV  H+ S  L+GFLWIQ+GW+GHDSGHY VM T+ L+R AQ+L GNCL
Sbjct  124   AVSVYGIMCSESVLVHLMSGGLMGFLWIQSGWIGHDSGHYQVMSTRGLNRFAQVLTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHIA N ++YDPD+Q +P F  S+K F +SL S+FY++ M+F+S  
Sbjct  184   AGISIAWWKWNHNAHHIAVNSLEYDPDLQHMPFFVVSSKFF-NSLTSYFYDRKMTFDSFT  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVS QHWTFYPVM L ARIN+F QS+  +L KK +   R QE+LG++ FW+WYP L+S
Sbjct  243   RFLVSNQHWTFYPVMCL-ARINLFAQSFILLLSKKNV-PYRVQELLGVVAFWIWYPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ERIMFV+ S  +TG+Q +QF LNH +S  +  P  G DW EKQ  G+LDI C  
Sbjct  301   CLPNWGERIMFVLASFTVTGIQHVQFCLNHFSSDIYVAPPKGNDWFEKQTGGSLDISCPS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWF+GGLQFQIEHHLFPR+PRCQLRKVSPFVK LC+KHG+ YN ASF+ ANAL   ++
Sbjct  361   WMDWFYGGLQFQIEHHLFPRLPRCQLRKVSPFVKDLCKKHGLPYNCASFYMANALTISTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+ +  PKNLVWEA+N+ G
Sbjct  421   RTAALQARDLT-KPVPKNLVWEAVNTHG  447



>emb|CDP08267.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/448 (61%), Positives = 351/448 (78%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +K +IT++ELKKH+KPGDLW+SI GK+YDVSDWV  HPGG +PLL+L+GQD TDAF+A+H
Sbjct  4     SKSYITSDELKKHNKPGDLWISIQGKIYDVSDWVKEHPGGAFPLLNLSGQDATDAFVAFH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A   L +FFNG+Y+ D+ VSEVSKDYR LV EF++MGLFE+KGH V      ++ +F
Sbjct  64    PGTAWKFLDKFFNGFYLKDYSVSEVSKDYRKLVYEFNKMGLFEQKGHGVLLSMCFMAVLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+  E V  H+    L+GFLWIQ+GW+GHDSGHY VM T+ ++R AQ+L+GNCL
Sbjct  124   CLSVYGVLCCERVLVHLICGGLMGFLWIQSGWIGHDSGHYQVMTTRGINRFAQILSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHIACN +++DPD+Q +P FA S KLF +SL S+FYE+ M+F+S+A
Sbjct  184   AGISIAWWKWNHNAHHIACNSLEFDPDLQHMPFFAVSPKLF-NSLTSYFYERKMAFDSVA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVS QHWTFYPVM   ARIN+F QS+  +   K+    R QE+LGL++FW+WYP L+S
Sbjct  243   RFLVSNQHWTFYPVMCF-ARINLFAQSFILLSSSKRSVPRRGQELLGLLVFWIWYPLLVS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVV S  +TG+Q +QF LNH ++S + GP  G DW EKQ  GTLDI C  
Sbjct  302   CLPNWGERLMFVVASFTVTGIQHVQFCLNHFSTSVYVGPPAGHDWFEKQTSGTLDILCPS  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ EHHLFPR+PRCQLRK+SPFVK+LC+KHG+ YN ASFW AN +  K++
Sbjct  362   WMDWFHGGLQFQTEHHLFPRLPRCQLRKISPFVKELCKKHGLPYNAASFWEANVMTCKTL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R+AAL ARD + +  PKNLVWEA+N+ G
Sbjct  422   RNAALQARDFT-KPVPKNLVWEAVNTHG  448



>ref|XP_009631585.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Nicotiana tomentosiformis]
Length=447

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/447 (62%), Positives = 350/447 (78%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +K+IT++ELK H+KPGDLW+SI GKVYDVSDWV  HPGG++PLL+LAGQDVTDAF+AYHP
Sbjct  5     RKYITSDELKNHNKPGDLWISIQGKVYDVSDWVKEHPGGDFPLLNLAGQDVTDAFVAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A A  +L +FFNG+Y+ D+  SE SKDYR LVSEF+++GLFEKKGH+  Y   +++ +F 
Sbjct  65    ATAWQYLDKFFNGFYLKDYSASEASKDYRRLVSEFTKLGLFEKKGHVCFYTMCSIAMLFA  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             VS+YG++  ESV  H+ S  L+G LWIQ+GW+GHDSGHY VM T+ L+R AQ+L GNCL 
Sbjct  125   VSVYGILCCESVLVHLMSGGLMGVLWIQSGWIGHDSGHYQVMSTRGLNRFAQVLTGNCLA  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIA N ++YDPD+Q +P F  S+K F +SL S+FY++ M+F+S  R
Sbjct  185   GISIAWWKWNHNAHHIAVNSLEYDPDLQHMPFFVVSSKFF-NSLTSYFYDRKMTFDSFTR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVS QHWTFYPVM   ARIN+F QS+  +L KK +   R QE+LG++ FW+WYP L+S 
Sbjct  244   FLVSNQHWTFYPVMCF-ARINLFAQSFILLLSKKNV-PYRVQELLGVVAFWIWYPLLVSC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFV+ S  +TG+Q +QF LNH +S  +  P  G DW EKQ  G+LDI C  W
Sbjct  302   LPNWGERIMFVLASFTVTGIQHVQFCLNHFSSDIYVAPPKGNDWFEKQTSGSLDISCPSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQIEHHLFPR+PRCQLRKVSPFVK LC+KHG+ YN ASF+ ANAL   ++R
Sbjct  362   MDWFHGGLQFQIEHHLFPRLPRCQLRKVSPFVKDLCKKHGLPYNCASFYMANALTISTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+ +  PKNLVWEA+N+ G
Sbjct  422   AAALQARDLT-KPVPKNLVWEAVNTHG  447



>ref|XP_002516430.1| fatty acid desaturase, putative [Ricinus communis]
 gb|EEF45771.1| fatty acid desaturase, putative [Ricinus communis]
Length=447

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/448 (61%), Positives = 350/448 (78%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             TKK+IT E+L+KH+ PGDLW+SI GK+Y+V+DW   HPGG  PLL LAGQDVTDAF+AYH
Sbjct  4     TKKYITKEDLEKHNNPGDLWISIQGKIYNVTDWSKDHPGGVSPLLHLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF GY++ D+ VSE SKDYR LV+EFS++GLFEKKGH+      ++  + 
Sbjct  64    PGTAWQYLDKFFTGYHLKDYSVSETSKDYRRLVAEFSKLGLFEKKGHIAFITLVSMVMLL  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+   S W H+ S  L+GF+WIQ+GW+GHDSGHY VM +++ +R AQ+L+GNCL
Sbjct  124   ALSVYGVLCSNSTWVHLISGGLMGFMWIQSGWIGHDSGHYQVMMSRRFNRLAQILSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHN HHIACN +D+DPD+Q +P FA S+K F SS+ S+FYE+ M+F+  A
Sbjct  184   AGISIAWWKWNHNTHHIACNSLDFDPDLQHMPFFAVSSKFF-SSITSYFYERKMNFDCAA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQH TFYPVM   ARIN+F QS   +L K+++ ANR QEILG+++FW+WYPFL+S
Sbjct  243   RFLVSYQHLTFYPVMCF-ARINLFAQSISLLLSKRRV-ANRGQEILGVLVFWIWYPFLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVV S  +TG+Q +QF LNH +SS + GP +  DW E Q  GTL+I CS 
Sbjct  301   CLPNWGERVMFVVASFSVTGIQHVQFCLNHFSSSVYLGPPSANDWFENQTKGTLNITCSS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PRCQLRKVSPFV++LC+KH + Y+ ASFW AN L FK++
Sbjct  361   WMDWFHGGLQFQIEHHLFPRLPRCQLRKVSPFVRELCKKHNLPYDSASFWNANELTFKTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDLS    PKNLVWEA+N+ G
Sbjct  421   RAAALQARDLS-NPIPKNLVWEAVNTHG  447



>ref|XP_007012291.1| Fatty acid/sphingolipid desaturase [Theobroma cacao]
 gb|EOY29910.1| Fatty acid/sphingolipid desaturase [Theobroma cacao]
Length=447

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/448 (62%), Positives = 345/448 (77%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             ++++I+  EL++H KPGDLW+S+ GKVYDV+ W   HPGG  PL +LAGQD TDAF+AYH
Sbjct  4     SRRYISQAELEEHKKPGDLWISLQGKVYDVTQWSQDHPGGALPLQNLAGQDATDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF GYY+ D+ VSEVSKDYR LV EFS+MGLFEKKGH        ++ +F
Sbjct  64    PGSAWQYLDKFFTGYYLKDYAVSEVSKDYRKLVGEFSKMGLFEKKGHGTCISLCFIALLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+   + WAH+ S  L+GFLWIQ+GW+GHDSGHY VM  +K +R AQ+L GNCL
Sbjct  124   FISVYGVLCCSTTWAHLCSGGLMGFLWIQSGWMGHDSGHYQVMCNRKFNRLAQILTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHIACN +D+DPD+Q +P F  S+K F  SL S+FYE+ M+F+S+A
Sbjct  184   AGISIGWWKWNHNAHHIACNSLDFDPDLQHMPFFVVSSKFFH-SLTSYFYERKMNFDSVA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWT+YPVM   ARIN+F QS+  +L K+K+  NR QEILGL++FW WYP L+S
Sbjct  243   RFLVSYQHWTYYPVMCF-ARINLFAQSFALLLSKRKV-PNRGQEILGLLVFWTWYPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVV S  +TG+Q IQF LNH +SS + GP +G DW E Q  GTLDI CS 
Sbjct  301   CLPNWGERVMFVVASFSVTGIQHIQFCLNHFSSSVYVGPPSGNDWFEMQTAGTLDILCSS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PRC LRK+SPFVK+LC+KH + YN ASFW ANA+   ++
Sbjct  361   WMDWFHGGLQFQIEHHLFPRLPRCHLRKISPFVKELCKKHSLPYNSASFWKANAMTIGTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA+N+ G
Sbjct  421   RSAALQARDLT-NPVPKNLVWEAVNTHG  447



>ref|XP_006360999.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Solanum tuberosum]
Length=447

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/448 (61%), Positives = 352/448 (79%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             ++K+IT+EELK H+KPGDLW+SI GKVYDVS+WV  HPGG++PLL+LAGQDVTDAF+A+H
Sbjct  4     SRKYITSEELKNHNKPGDLWISIQGKVYDVSNWVREHPGGDFPLLNLAGQDVTDAFVAFH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             PA A  +L +FF G+Y++D+  SEVSKDYR LVS+F++MGLFEKKGH+  +    ++ +F
Sbjct  64    PATAWQYLDKFFKGFYLNDYSASEVSKDYRRLVSDFTKMGLFEKKGHVCLFTMCLMAMLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YG++  +SV AH+ S  L+G LWIQ+GW+GHDSGHY VM T+  +R AQ+L GNCL
Sbjct  124   SLSVYGILCCQSVLAHLISGGLMGCLWIQSGWIGHDSGHYQVMSTRGFNRFAQVLTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHIACN ++YDPD+Q +P FA S+K F  SL S+FY++ M+F+S  
Sbjct  184   AGISIAWWKWNHNAHHIACNSLEYDPDLQHMPFFAVSSKFF-DSLTSYFYDRKMNFDSFT  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVS+QHWTFYPVM   ARIN+F QS+  +L  K +  +R QE+LG++ FW+WYP L+S
Sbjct  243   RFLVSHQHWTFYPVMCF-ARINLFAQSFILLLSNKNV-PHRVQELLGVVSFWIWYPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ERIMFV+ S  +TG+Q +QF LNH +S  +  P  G DW EKQ +G+LDI C  
Sbjct  301   CLPNWGERIMFVLSSFTVTGIQHVQFCLNHFSSEIYVAPPKGNDWFEKQTNGSLDISCPS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PRCQLRKVSPFVK LC+KHG+ Y+  SFW +N L   ++
Sbjct  361   WMDWFHGGLQFQIEHHLFPRLPRCQLRKVSPFVKDLCKKHGLPYSCVSFWKSNVLTISTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+ +  PKNLVWEA+N+ G
Sbjct  421   RAAALQARDLT-KPVPKNLVWEAVNTHG  447



>ref|XP_002279189.1| PREDICTED: delta(8)-fatty-acid desaturase 1 [Vitis vinifera]
Length=447

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/448 (61%), Positives = 346/448 (77%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             TK++I+ EELK H + GDLW+SI GKVY+VSDW   HPGG  PLLSLAGQD TDAF+AYH
Sbjct  4     TKRYISKEELKTHSRDGDLWISIQGKVYNVSDWAKVHPGGSAPLLSLAGQDATDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P +    L  FF G+++ D+ VSE S+DYR LV EF++MGLFEKKGH V     A++ MF
Sbjct  64    PGVLWSRLDDFFTGFHLEDYAVSEASRDYRRLVYEFTKMGLFEKKGHGVFVTLCAMAVMF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
                +YGV+  ++ W H+ S  L+G  WIQ+GW+GHDSGHY VM  ++L+R  Q+L+GNCL
Sbjct  124   SACIYGVLGSDNTWVHLASGALMGLFWIQSGWIGHDSGHYQVMMNRRLNRFVQVLSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHIACN +D+DPD+Q +P+FA S+KLF SSL S+FYE+ M+F+ +A
Sbjct  184   AGISIAWWKWNHNAHHIACNSLDFDPDLQHMPVFAVSSKLF-SSLTSYFYERKMNFDCVA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM  +AR+N+F QSW  +L K+++   RAQEILGL++FW+WYP L+S
Sbjct  243   RFLVSYQHWTFYPVM-CVARLNLFAQSWSLLLSKRRV-RYRAQEILGLLVFWIWYPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVVLS   TG+Q +QF LNH +SS + GP +G DW EKQ  G+LDI CS 
Sbjct  301   CLPNWWERVMFVVLSFSFTGIQHVQFCLNHFSSSVYVGPPSGNDWFEKQTHGSLDISCSS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PR QLR VSPFV++LC+KH + Y+ ASFW AN L   ++
Sbjct  361   WMDWFHGGLQFQIEHHLFPRLPRNQLRNVSPFVQELCKKHNLPYDCASFWKANVLTLATL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA+N+ G
Sbjct  421   RTAALQARDLA-NPIPKNLVWEAVNTHG  447



>gb|AAZ23035.1| delta-6 desaturase [Echium sabulicola]
Length=448

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/447 (62%), Positives = 352/447 (79%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKHDK GDLW+SI GK+YDVSDW+  HPGG++PLLSLAGQ+VTDAF+A+H 
Sbjct  6     KKYITAEELKKHDKEGDLWISIQGKIYDVSDWLKEHPGGKFPLLSLAGQEVTDAFVAFHS  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                   L++FF GYY+ D+ VSEVSKDYR LV EF++MGLF+KKGH+V      ++ +F 
Sbjct  66    GSTWKLLEKFFTGYYLKDYSVSEVSKDYRKLVFEFNKMGLFDKKGHIVLVTVLFIAMLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F E V  H+ S  L+GF+WIQ+GW+GHD+GHY VM   +L++   ++A NCL+
Sbjct  126   MSVYGVLFCEGVLVHLLSGGLMGFVWIQSGWIGHDAGHYIVMPNPRLNKLMGIVAANCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN +DYDPD+Q +P    S+KLF SSL SHFYEK ++F+SL+R
Sbjct  186   GISIGWWKWNHNAHHIACNSLDYDPDLQYIPFLVVSSKLF-SSLTSHFYEKKLTFDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VS+QHWTFYPVM   AR+NMF+QS   +L K+ +F  R+QE+LGL++FW+WYP L+S 
Sbjct  245   FFVSHQHWTFYPVM-CSARVNMFVQSLIMLLTKRNVFY-RSQELLGLVVFWIWYPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFVV SL +TG+QQ+QFSLNH +SS + G   G DW EKQ  GTLDI C  W
Sbjct  303   LPNWGERIMFVVASLSVTGMQQVQFSLNHFSSSVYVGQPKGNDWFEKQTCGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFP++PRC LRK+SPFV +LC+KH ++YN ASF  AN +  +++R
Sbjct  363   MDWFHGGLQFQVEHHLFPKLPRCHLRKISPFVMELCKKHNLSYNCASFSEANEMTLRTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             D AL ARDL+ +  PKNLVWEALN+ G
Sbjct  423   DTALQARDLT-KPLPKNLVWEALNTHG  448



>gb|AAL23580.1| delta-6-desaturase [Echium gentianoides]
Length=448

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/447 (62%), Positives = 351/447 (79%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKHDK GDLW+SI GKVYDVSDW+  HPGG++PLLSLAGQ+VTDAF+A+H 
Sbjct  6     KKYITAEELKKHDKEGDLWISIQGKVYDVSDWLKDHPGGKFPLLSLAGQEVTDAFVAFHS  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                   L  FF GYY+ D+ VSEVSKDYR LV EF++MGLF+KKGH+V      ++ MF 
Sbjct  66    GSTWKFLDSFFTGYYLKDYSVSEVSKDYRKLVFEFNKMGLFDKKGHIVLVTVLFIAMMFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F E V  H+ +  L+GF+WIQ+GW+GHD+GHY VM   +L++   ++AGNCL+
Sbjct  126   MSVYGVLFCEGVLVHLLAGGLMGFVWIQSGWIGHDAGHYIVMPNPRLNKLMGIVAGNCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN +DYDPD+Q +P    S+KLF SSL SHFYEK ++F+SL+R
Sbjct  186   GISIGWWKWNHNAHHIACNSLDYDPDLQYIPFLVVSSKLF-SSLTSHFYEKKLTFDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VS+QHWTFYPVM   AR+NMF+QS   +L K+ +F  R+QE+LGL++FW+WYP L+S 
Sbjct  245   FFVSHQHWTFYPVM-CSARVNMFVQSLIMLLTKRNVFY-RSQELLGLVVFWIWYPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFVV SL +TG+QQ+QFSLNH ++S + G   G DW EKQ  GTLDI C  W
Sbjct  303   LPNWGERIMFVVASLSVTGMQQVQFSLNHFSASVYVGQPKGNDWFEKQTCGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFP++PRC LRK+SPFV +LC+KH ++YN ASF  AN +  +++R
Sbjct  363   MDWFHGGLQFQVEHHLFPKLPRCHLRKISPFVMELCKKHNLSYNCASFSEANEMTLRTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             D AL ARDL+ +  PKNLVWEALN+ G
Sbjct  423   DTALQARDLT-KPLPKNLVWEALNTHG  448



>gb|AAZ08559.1| delta-6 desaturase [Echium plantagineum]
Length=448

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 352/447 (79%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKHDK GDLW+SI GK+YDVSDW+  HPGG +PLLSLAGQ+VTDAF+A+H 
Sbjct  6     KKYITAEELKKHDKAGDLWISIQGKIYDVSDWLKDHPGGNFPLLSLAGQEVTDAFVAFHS  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                   L++FF GYY+ D+ VSEVSKDYR LV EF++MGLF+KKGH+V      ++ +F 
Sbjct  66    GTTWKLLEKFFTGYYLKDYSVSEVSKDYRKLVFEFNKMGLFDKKGHIVLVTVLFIAMLFG  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F E V  H+ +  L+GF+WIQ+GW+GHD+GHY VM   +L++   ++A NCL+
Sbjct  126   MSVYGVLFCEGVLVHLLAGGLMGFVWIQSGWIGHDAGHYIVMPDARLNKLMGIVAANCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN +DYDPD+Q +P    S+KLF SSL SHFYEK ++F+SL+R
Sbjct  186   GISIGWWKWNHNAHHIACNSLDYDPDLQYIPFLVVSSKLF-SSLTSHFYEKKLTFDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VS+QHWTFYPVM + AR+NMF+QS   +L K+ +F  R+QE+LGL++FW+WYP L+S 
Sbjct  245   FFVSHQHWTFYPVMCM-ARVNMFVQSLIMLLTKRNVFY-RSQELLGLVVFWIWYPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFVV SL +TG+QQ+QFSLNH +SS + G   G DW EKQ  GTLDI C  W
Sbjct  303   LPNWGERVMFVVASLSVTGMQQVQFSLNHFSSSVYVGQPKGNDWFEKQTCGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFP++PRC LRK+SPFV +LC+KH ++YN ASF  AN +  +++R
Sbjct  363   MDWFHGGLQFQVEHHLFPKLPRCHLRKISPFVMELCKKHNLSYNCASFSEANNMTLRTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             D AL ARDL+ +  PKNLVWEALN+ G
Sbjct  423   DTALQARDLT-KPLPKNLVWEALNTHG  448



>gb|AAL23581.1| delta-6-desaturase [Echium pitardii var. pitardii]
Length=448

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/447 (62%), Positives = 350/447 (78%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKHDK GDLW+SI GKVYDVSDW+  HPGG++PLLSLAGQ+VTDAF+A+H 
Sbjct  6     KKYITAEELKKHDKEGDLWISIQGKVYDVSDWLKDHPGGKFPLLSLAGQEVTDAFVAFHS  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                   L  FF GYY+ D+ VSEVSKDYR LV EF++MGLF+KKGH+V      ++ MF 
Sbjct  66    GSTWKLLDSFFTGYYLKDYSVSEVSKDYRKLVFEFNKMGLFDKKGHIVLVTVFFIAMMFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F E V  H+ +  L+GF+WIQ+GW+GHD+GHY VM   KL++   ++A NCL+
Sbjct  126   MSVYGVLFCEGVLVHLLAGGLMGFVWIQSGWIGHDAGHYIVMPNPKLNKLMGIVASNCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN +DYDPD+Q +P    S+KLF SSL SHFYEK ++F+SL+R
Sbjct  186   GISIGWWKWNHNAHHIACNSLDYDPDLQYIPFLVVSSKLF-SSLTSHFYEKKLTFDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VS+QHWTFYPVM   AR+NMF+QS   +L K+ +F  R+QE+LGL++FW+WYP L+S 
Sbjct  245   FFVSHQHWTFYPVM-CSARVNMFVQSLIMLLTKRNVFY-RSQELLGLVVFWIWYPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFVV SL +TG+QQ+QFSLNH A+S + G   G DW EKQ  GTLDI C  W
Sbjct  303   LPNWGERIMFVVASLSVTGLQQVQFSLNHFAASVYVGQPKGIDWFEKQTCGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFP++PRC LRK+SPFV +LC+KH ++YN ASF  AN +  +++R
Sbjct  363   MDWFHGGLQFQVEHHLFPKLPRCHLRKISPFVMELCKKHNLSYNCASFSQANEMTLRTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             D AL ARDL+ +  PKNLVWEALN+ G
Sbjct  423   DTALQARDLT-KPLPKNLVWEALNTHG  448



>ref|XP_004245093.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Solanum lycopersicum]
 ref|XP_010325034.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Solanum lycopersicum]
Length=447

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/448 (60%), Positives = 349/448 (78%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             ++K+I++EELK H+KPGDLW+SI GKVYDVSDWV  HPGG++PLL+LAGQDVTDAF+A+H
Sbjct  4     SRKYISSEELKNHNKPGDLWISIQGKVYDVSDWVKEHPGGDFPLLNLAGQDVTDAFVAFH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             PA A  +L +FF G+Y+ D+ VSEVS DYR LVSEF++MGLFEKKGH+  +    ++ +F
Sbjct  64    PATAWKYLDKFFKGFYLKDYSVSEVSTDYRRLVSEFTKMGLFEKKGHVCLFTMFLMTMLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YG+++   V AH+ S  L+G LWIQ+GW+GHDSGHY VM T+  +R AQ+L GNCL
Sbjct  124   SLSVYGILYCHGVLAHLISGALMGCLWIQSGWIGHDSGHYQVMSTRGFNRFAQVLTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHIACN ++YDPD+Q +P F  S+K F  SL S+FY++ M+F+S  
Sbjct  184   AGISIAWWKWNHNAHHIACNSLEYDPDLQHMPFFVVSSKFF-DSLTSYFYDRKMNFDSFT  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVS+QHWTFYPVM   ARIN+F QS+  +L  K +  +R QE+LG++ FW+WYP L+S
Sbjct  243   RFLVSHQHWTFYPVMCF-ARINLFAQSFILLLSNKNV-PHRVQELLGVVSFWIWYPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ERI+FV+ S  +TG+Q +QF LNH +S  +  P  G DW EKQ +G+LDI C  
Sbjct  301   FLPNWGERIIFVLASFTVTGIQHVQFCLNHFSSEIYVAPPKGNDWFEKQTNGSLDISCPS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PRCQLRKVSPFVK LC+KHG+ Y+  SFW +N L   ++
Sbjct  361   WMDWFHGGLQFQIEHHLFPRLPRCQLRKVSPFVKDLCKKHGLPYSCVSFWKSNVLTISTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+ +  PKNLVWEA+N+ G
Sbjct  421   RAAALQARDLT-KPVPKNLVWEAVNTHG  447



>gb|ADA68870.2| delta-6 desaturase [Echium amoenum]
Length=448

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/447 (62%), Positives = 349/447 (78%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT +ELKKHDK GDLW+SI GKVYDVSDW+  HPGG +PLLSLAGQ+VTDAF+A+H 
Sbjct  6     KKYITADELKKHDKAGDLWISIQGKVYDVSDWLKDHPGGNFPLLSLAGQEVTDAFVAFHS  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                   L  FF GYY+ D+ VSEVSKDYR LV EFS+MGLF+KKGH+V      ++ +F 
Sbjct  66    GSTWKLLDTFFTGYYLKDYSVSEVSKDYRKLVFEFSKMGLFDKKGHIVLVTVLFIAMLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F E V  H+ S  L+GFLWIQ+GW+GHD+GHY VM   +L++   ++A NCL+
Sbjct  126   MSVYGVLFCEGVLVHLLSGGLMGFLWIQSGWIGHDAGHYIVMPNPRLNKLMGIVAANCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN ++YDPD+Q +P    S+KLFR SL SHFYEK ++F+SL+R
Sbjct  186   GISIGWWKWNHNAHHIACNSLEYDPDLQYIPFLVVSSKLFR-SLTSHFYEKKLTFDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VS+QHWTFYPVM   AR+NMF+QS   +L K+ + + R+QE+LGL++FW+WYP L+S 
Sbjct  245   FFVSHQHWTFYPVM-CSARLNMFVQSLIMLLTKRNV-SYRSQELLGLVVFWIWYPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFVV SL +TG+QQ+QFSLNH +SS + G   G DW EKQ  GTLDI C  W
Sbjct  303   LPNWGERIMFVVASLSVTGMQQVQFSLNHFSSSVYVGKPKGNDWFEKQTCGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFP++PRC LRK+SPFV +LC+KH ++YN ASF  AN +  +++R
Sbjct  363   MDWFHGGLQFQVEHHLFPKLPRCHLRKISPFVMELCKKHNLSYNCASFSEANEMTLRTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             D AL ARDL+ +  PKNLVWEALN+ G
Sbjct  423   DTALQARDLT-KPLPKNLVWEALNTHG  448



>gb|ADD10720.1| delta-6-desaturase [Camellia oleifera]
Length=448

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/448 (61%), Positives = 343/448 (77%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             TK+FIT E LK H+KPGDLW+SI GKVYDVSDW   HPGG  PLLSLAGQDVTDAF+AYH
Sbjct  5     TKRFITFESLKAHNKPGDLWISIQGKVYDVSDWAKEHPGGYLPLLSLAGQDVTDAFVAYH  64

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FFNGY++ D+ VSEVSKDYRMLVSEFS MGLFEKKGHL       ++ +F
Sbjct  65    PNTAWQYLDKFFNGYFIEDYSVSEVSKDYRMLVSEFSHMGLFEKKGHLALISFCFMALLF  124

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              VS++GV+   S+W H+    L+G LWIQ+GW GHDSGHY +M +K L+R  Q+L GNCL
Sbjct  125   SVSVWGVLCCSSIWVHLVCGGLMGGLWIQSGWAGHDSGHYQIMPSKNLNRFVQILTGNCL  184

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHI+CN +D+DPD+Q +P F  S+KLF +SL S FYE+ M F+S+ 
Sbjct  185   AGISIAWWKWNHNAHHISCNSLDFDPDLQHMPFFVVSSKLF-NSLTSCFYERKMPFDSVT  243

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             R  VSYQHWTFYPVM   AR+N+F QS+  +  K+K+  NR QEILG+ +FW+WYP L+S
Sbjct  244   RLFVSYQHWTFYPVMCF-ARLNLFAQSFMLLCSKRKV-PNRVQEILGISVFWIWYPLLVS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFV+ S  ++G+Q +QF LNH +S  + GP +G DW  KQ  GTLDI C  
Sbjct  302   CLPNWGERLMFVLASFAVSGIQHVQFCLNHFSSIVYVGPPSGSDWCGKQTRGTLDITCPS  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PR QLRKVSPFV++LC+KH + Y+ ASFW ANAL  +++
Sbjct  362   WMDWFHGGLQFQIEHHLFPRLPRSQLRKVSPFVRELCKKHNLPYDSASFWKANALTVRTL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R+AAL ARD++     KNLVWEA+N+ G
Sbjct  422   RNAALQARDVA-NPVQKNLVWEAVNTHG  448



>gb|AFX86441.1| delta-6-desaturase [Microula sikkimensis]
Length=448

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/447 (61%), Positives = 351/447 (79%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++EL  H+K GDLW+SI GKVYDVSDW+  HPGG +PL++LAGQ+VTDAF+A+HP
Sbjct  6     KKYITSDELSSHNKAGDLWISIQGKVYDVSDWLKDHPGGSFPLMNLAGQEVTDAFVAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A A  +L +FF GYY+ D+ VSEVSKDYR LV +FS+MGLFEKKGH++      ++ +F+
Sbjct  66    ASAWQNLDKFFTGYYLKDYSVSEVSKDYRNLVFQFSKMGLFEKKGHVMFGTMLFIAMLFV  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+ GV+F ESVW H+ S  LVGF+WIQ+GW+GHD+GHY  M + +L++   +L  NCL+
Sbjct  126   MSVCGVLFFESVWVHLLSGCLVGFMWIQSGWIGHDAGHYVAMPSSRLNKLGGILFANCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHI+CN ++YDPD+Q +P    S+K F SSL SHFY+K ++F++L+R
Sbjct  186   GISIGWWKWNHNAHHISCNSLEYDPDLQYIPFLVVSSKFF-SSLTSHFYQKKLTFDTLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVS+QHWTFYPVM   AR+NMF+QS   +LFK+ +F NRA EILGL++F  WYP LLS 
Sbjct  245   FLVSHQHWTFYPVM-CSARLNMFVQSVIMLLFKRNVF-NRALEILGLLVFVTWYPLLLSY  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER MFV+ SL +TG+QQ+QFSLNH +SS + G L G DW E+Q  GTLDI C  W
Sbjct  303   LPNWGERTMFVIASLSVTGMQQVQFSLNHFSSSVYVGQLKGNDWFERQTSGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPRMPRCQ RKVSPFV +LC+KH + YN ASF  AN L  + +R
Sbjct  363   MDWFHGGLQFQVEHHLFPRMPRCQFRKVSPFVMELCKKHNLEYNCASFSKANLLTIRQLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             + AL ARDL+ +  PKNLVWEAL++ G
Sbjct  423   NVALEARDLT-KPVPKNLVWEALHTHG  448



>gb|AAD01410.1| delta 6-desaturase [Borago officinalis]
 gb|ABU51607.1| delta 6-desaturase [Borago officinalis]
Length=448

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/447 (60%), Positives = 349/447 (78%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++ELK HDKPGDLW+SI GK YDVSDWV  HPGG +PL SLAGQ+VTDAF+A+HP
Sbjct  6     KKYITSDELKNHDKPGDLWISIQGKAYDVSDWVKDHPGGSFPLKSLAGQEVTDAFVAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A    +L +FF GYY+ D+ VSEVSKDYR LV EFS+MGL++KKGH++      ++ +F 
Sbjct  66    ASTWKNLDKFFTGYYLKDYSVSEVSKDYRKLVFEFSKMGLYDKKGHIMFATLCFIAMLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F E V  H+ S  L+GFLWIQ+GW+GHD+GHY V+   +L++   + A NCL+
Sbjct  126   MSVYGVLFCEGVLVHLFSGCLMGFLWIQSGWIGHDAGHYMVVSDSRLNKFMGIFAANCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN ++YDPD+Q +P    S+K F  SL SHFYEK ++F+SL+R
Sbjct  186   GISIGWWKWNHNAHHIACNSLEYDPDLQYIPFLVVSSKFF-GSLTSHFYEKRLTFDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQHWTFYP+M   AR+NM++QS   +L K+ + + RAQE+LG ++F +WYP L+S 
Sbjct  245   FFVSYQHWTFYPIM-CAARLNMYVQSLIMLLTKRNV-SYRAQELLGCLVFSIWYPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFV+ SL +TG+QQ+QFSLNH +SS + G   G +W EKQ DGTLDI C PW
Sbjct  303   LPNWGERIMFVIASLSVTGMQQVQFSLNHFSSSVYVGKPKGNNWFEKQTDGTLDISCPPW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQIEHHLFP+MPRC LRK+SP+V +LC+KH + YN+ASF  AN +  +++R
Sbjct  363   MDWFHGGLQFQIEHHLFPKMPRCNLRKISPYVIELCKKHNLPYNYASFSKANEMTLRTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             + AL ARD++ +  PKNLVWEAL++ G
Sbjct  423   NTALQARDIT-KPLPKNLVWEALHTHG  448



>ref|XP_006450852.1| hypothetical protein CICLE_v10010195mg [Citrus clementina]
 gb|ESR64092.1| hypothetical protein CICLE_v10010195mg [Citrus clementina]
Length=447

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/448 (59%), Positives = 343/448 (77%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK I+ ++LK H+KPGDLW+S+ GKVY+V+DW   HPGG+ PLLSLAGQDVTDAF+AYH
Sbjct  4     SKKHISQQDLKGHNKPGDLWISVQGKVYNVTDWTKHHPGGDLPLLSLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF GYY+ D+ VSE SKDYR LV+EFS+MGLFEKKGH   Y    ++ +F
Sbjct  64    PGAAWQYLDKFFTGYYLEDYTVSEASKDYRKLVAEFSKMGLFEKKGHCALYTFVFMAMLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              VS+YGV   +S W H+ S  L+G LWIQ+GW+GHDSGHY VM ++ ++R  Q+L GNCL
Sbjct  124   AVSIYGVFCSDSTWVHLCSGGLMGLLWIQSGWIGHDSGHYQVMSSRGINRIVQVLTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+ NHNAHHIACN +D+DPD+Q +P F  S+K F +S+ S +YE+ + F+S+A
Sbjct  184   AGISIAWWKRNHNAHHIACNSLDFDPDLQHMPFFVVSSKFF-NSITSCYYERKLHFDSVA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM L ARIN+F QS+  +L KK +  NR QEI G+++FW+WYP L+S
Sbjct  243   RFLVSYQHWTFYPVMCL-ARINLFAQSFLLLLSKKNV-PNRVQEIFGILVFWIWYPLLIS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MF+V S  +TG+Q +QF LNH +S+ + GP    DW  KQ  GTL+I CS 
Sbjct  301   CLPNWGERVMFIVASFSVTGIQHVQFCLNHFSSNVYVGPPCSNDWFRKQTQGTLNIKCSS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+EHHLFPR+PRC LRKVSPFV +LC+KH + YN  SFW +NA+  +++
Sbjct  361   WMDWFHGGLQFQVEHHLFPRLPRCNLRKVSPFVVELCKKHNLPYNIVSFWKSNAMTMETL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             + AAL ARDLS    P+NLVWEA+N+ G
Sbjct  421   QAAALQARDLS-RPVPRNLVWEAVNTHG  447



>ref|XP_011023257.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Populus euphratica]
Length=447

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/449 (59%), Positives = 347/449 (77%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK+IT EELK+H+K GDLW+SI GKVY+VSDW + HPGG+  LL+LAGQDVTDAF+AY
Sbjct  3     GDKKYITGEELKQHNKEGDLWISIQGKVYNVSDWAHEHPGGDVALLNLAGQDVTDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GYY+ D +VSE SKDYR L SEF+++GLFEKKGH+  Y  A+++ M
Sbjct  63    HPGTAWQYLDKFFTGYYLKDFKVSETSKDYRRLASEFAKLGLFEKKGHITMYALASIALM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F V LYGV+  +SVWAH+GSA+++GFLWIQ+ ++GHDSGHY VMK++  ++ AQ +AGN 
Sbjct  123   FCVVLYGVLCCQSVWAHLGSALVLGFLWIQSAYIGHDSGHYQVMKSRGYNKFAQFVAGNS  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA  N  F +S+ S FY + + F+ +
Sbjct  183   LTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAV-NSTFFNSIKSCFYGRYLDFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWTFYPVM  +AR+N+++Q++  +LF K+ F +RA  ILG++IFW W+P L+
Sbjct  242   ARFFVSYQHWTFYPVM-CVARVNLYLQTF-LLLFSKRKFPDRALNILGILIFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+MFV+ S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI CS
Sbjct  300   SCLPNWPERVMFVLASFAVTAIQHVQFCLNHFAADVYTGPPKGNDWFEKQTGGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPRMPRCQLR+VSP V+ LC+KH ++Y   SFW AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRMPRCQLRRVSPLVQDLCKKHNLSYRSLSFWEANVWTIRR  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+ AL ARDLS    PKNL+WEA+N+ G
Sbjct  420   LRNVALQARDLS-NPVPKNLLWEAVNTHG  447



>ref|XP_006475919.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Citrus sinensis]
 gb|KDO80117.1| hypothetical protein CISIN_1g013234mg [Citrus sinensis]
Length=447

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/448 (59%), Positives = 343/448 (77%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK I+ ++LK H+KPGDLW+S+ GKVY+V+DW   HPGG+ PLLSLAGQDVTDAF+AYH
Sbjct  4     SKKHISQQDLKGHNKPGDLWISVQGKVYNVTDWTKHHPGGDLPLLSLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF GYY+ D+ VSE SKDYR LV+EFS+MGLFEKKGH   Y    ++ +F
Sbjct  64    PGAAWQYLDKFFTGYYLEDYTVSEASKDYRKLVAEFSKMGLFEKKGHCALYTFVFMAMLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              VS+YGV   +S W H+ S  L+G LWIQ+GW+GHDSGHY VM ++ ++R  Q+L GNCL
Sbjct  124   AVSIYGVFCSDSTWVHLCSGGLMGLLWIQSGWIGHDSGHYQVMSSRGINRIVQVLTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+ NHNAHHIACN +D+DPD+Q +P F  S+K F +S+ S +YE+ + F+S+A
Sbjct  184   AGISIAWWKRNHNAHHIACNSLDFDPDLQHMPFFVVSSKFF-NSITSCYYERKLHFDSVA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM L ARIN+F QS+  +L KK +  NR QEI G+++FW+WYP L+S
Sbjct  243   RFLVSYQHWTFYPVMCL-ARINLFAQSFLLLLSKKNV-PNRVQEIFGILVFWIWYPLLIS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MF+V S  +TG+Q +QF LNH +S+ + GP    DW  KQ  GTL+I CS 
Sbjct  301   CLPNWGERVMFIVASFSVTGIQHVQFCLNHFSSNVYVGPPCSNDWFRKQTQGTLNIKCSS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+EHHLFPR+PRC LRKVSPFV +LC+KH + YN  SFW +NA+  +++
Sbjct  361   WMDWFHGGLQFQVEHHLFPRLPRCNLRKVSPFVVELCKKHNLPYNIVSFWKSNAMTVETL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             + AAL ARDLS    P+NLVWEA+N+ G
Sbjct  421   QAAALQARDLS-RPVPRNLVWEAVNTHG  447



>ref|XP_002302613.1| fatty acid desaturase/cytochrome b5 fusion protein mRNA [Populus 
trichocarpa]
 gb|EEE81886.1| fatty acid desaturase/cytochrome b5 fusion protein mRNA [Populus 
trichocarpa]
Length=447

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/449 (59%), Positives = 346/449 (77%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK+IT EELK+H+K GDLW+SI GKVY+VSDW Y HPGG+  LL+LAGQDVTDAF+AY
Sbjct  3     GDKKYITGEELKQHNKEGDLWISIQGKVYNVSDWAYEHPGGDVALLNLAGQDVTDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GYY+ D +VSE SKDYR L SEF+++GLFEKKGH+  Y  A+++ M
Sbjct  63    HPGTAWQYLDKFFTGYYLKDFKVSETSKDYRRLASEFAKLGLFEKKGHITMYALASIALM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F V LYGV+  +SVWAH+GSA+++GFLWIQ+ ++GHDSGHY VMK++  ++ AQ +AGN 
Sbjct  123   FCVVLYGVLCCQSVWAHLGSALVLGFLWIQSAYIGHDSGHYQVMKSRGYNKFAQFVAGNS  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA  N  F +S+ S FY + + F+ +
Sbjct  183   LTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAV-NSTFFNSIKSCFYGRYLDFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWTFYPVM  +AR+N+++Q++  +LF K+ F +RA  ILG++IFW W+P L+
Sbjct  242   ARFFVSYQHWTFYPVM-CVARVNLYLQTF-LLLFSKRKFPDRALNILGILIFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+MFV+ S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI CS
Sbjct  300   SCLPNWPERVMFVLASFAVTAIQHVQFCLNHFAADVYTGPPKGNDWFEKQTGGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPRMPRCQLR+VSP V+ LC+KH ++Y   SFW AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRMPRCQLRRVSPLVQDLCKKHNLSYRSLSFWEANVWTIRR  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+ A  ARDLS    PKNL+WEA+N+ G
Sbjct  420   LRNVAQQARDLS-NPVPKNLLWEAVNTHG  447



>gb|AAD01240.1| desaturase/cytochrome b5 protein [Ricinus communis]
Length=446

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/448 (60%), Positives = 345/448 (77%), Gaps = 5/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             TKK+IT E+L+KH+ PGDLW+SI GK+Y+V+DW   HPGG  PLL LAGQDVTDAF+AYH
Sbjct  4     TKKYITKEDLEKHNNPGDLWISIQGKIYNVTDWSKDHPGGVSPLLHLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF GY++ D+ VSE SKDYR LV+EFS++G FEKKGH+      ++  + 
Sbjct  64    PGTAWQYLDKFFTGYHLKDYSVSETSKDYRRLVAEFSKLG-FEKKGHIAFITLVSMVMLL  122

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+   S W H+ S  L+GF+WIQ+GW+GHDSGHY VM +++ +R AQ+L+GNCL
Sbjct  123   ALSVYGVLCSNSTWVHLISGGLMGFMWIQSGWIGHDSGHYQVMMSRRFNRLAQILSGNCL  182

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHN HHIACN +D+DPD+Q +P FA S+K F SS+ S+FYE+ M+F+  A
Sbjct  183   AGISIAWWKWNHNTHHIACNSLDFDPDLQHMPFFAVSSKFF-SSITSYFYERKMNFDCAA  241

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQH TFYPVM   ARIN+F QS   +L K+++ ANR QEILG+++FW+WYPFL+S
Sbjct  242   RFLVSYQHLTFYPVMCF-ARINLFAQSISLLLSKRRV-ANRGQEILGVLVFWIWYPFLVS  299

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFV  S  +T +Q +QF LNH +SS + G L   DW E Q  GTLDI CS 
Sbjct  300   CLPNWGERVMFVAASFSVTRIQHVQFCLNHFSSSVYLGLLIANDWFENQTKGTLDITCSS  359

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+EHHLFPR+PR +LRKVSPFV++LC+KH + Y+ ASFW AN L FK++
Sbjct  360   WMDWFHGGLQFQMEHHLFPRLPRVKLRKVSPFVRELCKKHNLPYDSASFWNANELTFKTL  419

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDLS    PKNLVWEA+N+ G
Sbjct  420   RAAALQARDLS-NPIPKNLVWEAVNTHG  446



>ref|XP_007051674.1| Fatty acid/sphingolipid desaturase [Theobroma cacao]
 gb|EOX95831.1| Fatty acid/sphingolipid desaturase [Theobroma cacao]
Length=447

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 345/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELK+H+KPGDLW+SI GKVY+VS W   HPGGE PLL+LAGQDVTDAF+AYHP
Sbjct  5     KKYITAEELKEHNKPGDLWISIQGKVYNVSGWAKEHPGGEIPLLNLAGQDVTDAFIAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L + F GYY+ D +VSEVSKDYR LVSEF++ G+FEKKGH+  +   +++ MFL
Sbjct  65    GTAWKYLDKLFTGYYLKDFKVSEVSKDYRRLVSEFAKTGMFEKKGHVALFSLTSVALMFL  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V LYGV+  ESVWAH+GSA+L+G LW+Q+ +VGHDSGHY VM ++  ++ AQ+++GNCLT
Sbjct  125   VVLYGVLRCESVWAHLGSAMLLGLLWMQSAYVGHDSGHYQVMASRGYNKLAQIVSGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+ A S++ F  S+ S+FY + + F+  AR
Sbjct  185   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVLAVSSRFF-DSMTSYFYGRKLKFDPFAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  +AR+N+++Q++  +LF  +   +RA  I+G++IFW W+P L+S 
Sbjct  244   FLISYQHWTFYPVM-CVARVNLYLQTF-LLLFSNRKVPDRALNIMGILIFWTWFPLLVSC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFV+ S  +T +Q +QF LNH A++ + GP  G DW EKQ  GTLDI CS W
Sbjct  302   LPNWPERIMFVLASFAVTSIQHVQFCLNHFAANVYVGPPNGNDWFEKQTGGTLDISCSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRCQLRKVSP V+ LC+KH + Y   SFW AN    +++R
Sbjct  362   MDWFFGGLQFQLEHHLFPRLPRCQLRKVSPIVRDLCKKHNLPYRSLSFWEANRWTIRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    PKNL+WEA+N+ G
Sbjct  422   TAALQARDLT-NPVPKNLLWEAVNTHG  447



>ref|XP_010092888.1| Fatty acid desaturase 3 [Morus notabilis]
 gb|EXB52706.1| Fatty acid desaturase 3 [Morus notabilis]
Length=450

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/447 (60%), Positives = 344/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KKFIT+EELK H+KPGDLW+SI GKVYDVS+WV  HPGG+ PLL+LAG+DVTDAF+AYHP
Sbjct  8     KKFITSEELKDHNKPGDLWISIQGKVYDVSEWVKDHPGGDAPLLNLAGRDVTDAFIAYHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GYY++D  VSE+SKDYR L SEFS++GLFEKKGH +      ++ M  
Sbjct  68    GTAWKYLDKFFTGYYLNDFNVSEISKDYRRLASEFSKLGLFEKKGHGIMCSLTCVAIMLF  127

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             ++ YGV+  ES W HMG   L+GFLWIQ+ +VGHDSGHY VM + K +R  Q+LAGNCLT
Sbjct  128   IAFYGVLCCESFWVHMGCGFLLGFLWIQSAFVGHDSGHYQVMTSPKYNRLGQVLAGNCLT  187

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S+ LF  S+ S FY + + F+SL+R
Sbjct  188   GISIAWWKWTHNAHHIACNSLDHDPDLQHIPVFAVSSSLFH-SITSCFYGRKLKFDSLSR  246

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH TFYPVM  + RIN+FIQ++  +LF ++   +RA  I+G+++FW W+P L+S 
Sbjct  247   FLVSYQHLTFYPVM-CVGRINLFIQTF-LLLFSRRNVPDRAFNIMGILVFWTWFPLLVSF  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERI+FV++S ++T VQ IQF LNH ++  + G  +G DW +KQ  GTLDI CSPW
Sbjct  305   LPNWQERILFVLISFVVTSVQHIQFCLNHFSADTYLGAPSGNDWFQKQTSGTLDIACSPW  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLRK+SP V+ LC+KH + Y   SFW AN    +++R
Sbjct  365   MDWFHGGLQFQLEHHLFPRLPRCQLRKISPIVRDLCKKHNLPYRSLSFWDANVSTIRTLR  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARDLS    PKNLVWEA+N+ G
Sbjct  425   NAALQARDLS-NPVPKNLVWEAVNTHG  450



>gb|AAC49700.1| delta 6 desaturase [Borago officinalis]
Length=448

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 348/447 (78%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++ELK HDKPGDLW+SI GK YDVSDWV  HPGG +PL SLAGQ+VTDAF+A+HP
Sbjct  6     KKYITSDELKNHDKPGDLWISIQGKAYDVSDWVKDHPGGSFPLKSLAGQEVTDAFVAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A    +L +FF GYY+ D+ VSEVSKDYR LV EFS+MGL++KKGH++      ++ +F 
Sbjct  66    ASTWKNLDKFFTGYYLKDYSVSEVSKDYRKLVFEFSKMGLYDKKGHIMFATLCFIAMLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F E V  H+ S  L+GFLWIQ+GW+GHD+GHY V+   +L++   + A NCL+
Sbjct  126   MSVYGVLFCEGVLVHLFSGCLMGFLWIQSGWIGHDAGHYMVVSDSRLNKFMGIFAANCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN ++YDPD+Q +P    S+K F  SL SHFYEK ++F+SL+R
Sbjct  186   GISIGWWKWNHNAHHIACNSLEYDPDLQYIPFLVVSSKFF-GSLTSHFYEKRLTFDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQHWTFYP+M   AR+NM++QS   +L K+ + + RA E+LG ++F +WYP L+S 
Sbjct  245   FFVSYQHWTFYPIM-CAARLNMYVQSLIMLLTKRNV-SYRAHELLGCLVFSIWYPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFV+ SL +TG+QQ+QFSLNH +SS + G   G +W EKQ DGTLDI C PW
Sbjct  303   LPNWGERIMFVIASLSVTGMQQVQFSLNHFSSSVYVGKPKGNNWFEKQTDGTLDISCPPW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQIEHHLFP+MPRC LRK+SP+V +LC+KH + YN+ASF  AN +  +++R
Sbjct  363   MDWFHGGLQFQIEHHLFPKMPRCNLRKISPYVIELCKKHNLPYNYASFSKANEMTLRTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             + AL ARD++ +  PKNLVWEAL++ G
Sbjct  423   NTALQARDIT-KPLPKNLVWEALHTHG  448



>ref|XP_002308556.1| hypothetical protein POPTR_0006s24460g [Populus trichocarpa]
 gb|EEE92079.1| hypothetical protein POPTR_0006s24460g [Populus trichocarpa]
Length=448

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 345/448 (77%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T+++IT EEL+KH+  GDLW+SI GK+Y+V+ W   HPGG+ PLLSLAGQDVTDAF+AYH
Sbjct  4     TRRYITKEELEKHNTAGDLWISIQGKIYNVTYWANDHPGGQLPLLSLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF G+Y+ D+ VSEVS+D+R L +EFS+ GLFEKKGH+V      +  MF
Sbjct  64    PGTAWKYLDKFFTGFYLKDYTVSEVSEDFRKLAAEFSKSGLFEKKGHVVFVTLCLVVMMF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+  +S    +    L+G +WIQ+GW+GHDSGHY VM ++  +   Q+L+GNCL
Sbjct  124   CLSVYGVLCSDSRSVRLVCGGLMGLMWIQSGWIGHDSGHYQVMSSRGFNCLVQILSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              GV I WW+ NHNAHHIACN +DYDPD+Q +P FA S+K F SS+ S FY++ ++F+S++
Sbjct  184   AGVGIGWWKCNHNAHHIACNSLDYDPDLQHMPFFAVSSKFF-SSITSCFYDRKLNFDSVS  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM L ARIN+F QS+  +L KKK+  NR  E LGL++FW WYP L+S
Sbjct  243   RFLVSYQHWTFYPVMCL-ARINLFAQSFLILLSKKKLSTNRGLEFLGLVVFWTWYPLLVS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LP+  ERI+FVV S  +TG+Q +QF LNH +SS + GP +G +W EKQ +GTL+I CSP
Sbjct  302   CLPSWGERIIFVVASFSVTGIQHVQFCLNHFSSSVYVGPPSGNNWFEKQTEGTLNISCSP  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+EHHLFPR+PRCQLR+VSPF+++LC+KH + YN  SFW ANA+  +++
Sbjct  362   WMDWFHGGLQFQVEHHLFPRLPRCQLRRVSPFIRELCKKHNLPYNIVSFWKANAMTLETL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA+N+ G
Sbjct  422   RTAALQARDLT-NPVPKNLVWEAVNTHG  448



>gb|AAO13090.1| delta-6-desaturase [Camellia sinensis]
Length=448

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/448 (61%), Positives = 341/448 (76%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             TK+FIT E LK H+KPGDLW+SI GKVYDVSDW   HPGG  PLLSLAGQDVTDAF+AYH
Sbjct  5     TKRFITFESLKAHNKPGDLWISIQGKVYDVSDWAKEHPGGYLPLLSLAGQDVTDAFVAYH  64

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FFNGY++ D+ VSEVSKDYRMLVSEFS+MGLFEKKGHL       ++ +F
Sbjct  65    PNTAWQYLDKFFNGYFIEDYSVSEVSKDYRMLVSEFSQMGLFEKKGHLALISFCFMALLF  124

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              VS++GV+   S+W H+    L+G LWIQ+GW GHDSGHY +M +KKL+R  Q+L GNCL
Sbjct  125   SVSVWGVLCCSSIWVHLVCGGLMGGLWIQSGWAGHDSGHYQIMPSKKLNRFVQILTGNCL  184

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHNAHHI+CN +D+DPD+Q +P F  S+KLF +SL S FYE+ M F+S+ 
Sbjct  185   AGISIAWWKWNHNAHHISCNSLDFDPDLQHMPFFVVSSKLF-NSLTSCFYERKMPFDSVT  243

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             R  VSYQHWTFYPVM   AR+N+F  S+  +  K+K+  NR QEILG+ +FW   P L+S
Sbjct  244   RLFVSYQHWTFYPVMCF-ARLNLFAPSFMLLCSKRKV-PNRVQEILGISVFWYLDPLLVS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFV+ S  ++G+Q +QF LNH +S  + GP +G DW  KQ  GTLDI C  
Sbjct  302   CLPNLGERLMFVLASFAVSGIQHVQFCLNHFSSIVYVGPPSGTDWCGKQTRGTLDITCPS  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             W+DWFHGGLQFQIEHHLFPR+PR QLRKVSPFV++LC+KH + Y+ ASFW ANAL  +++
Sbjct  362   WVDWFHGGLQFQIEHHLFPRLPRSQLRKVSPFVRELCKKHNLPYDTASFWKANALTVRTL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R+AAL ARD++     KNLVWEA+N+ G
Sbjct  422   RNAALQARDVA-NPVQKNLVWEAVNTHG  448



>gb|ABP01349.1| D8-sphingolipid desaturase [Jatropha curcas]
 gb|KDP34092.1| hypothetical protein JCGZ_07663 [Jatropha curcas]
Length=447

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/448 (60%), Positives = 349/448 (78%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+I+ EELKKH K GDLW+SI GKVY+V+ W   HPGGE PLL L+GQDVTDAF+AYH
Sbjct  4     SKKYISEEELKKHTKSGDLWISIQGKVYNVTGWTKDHPGGELPLLHLSGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF GYY+ DH VSEVSKDYR L++EF++MGLFEKKGH+       ++ + 
Sbjct  64    PGTAWQYLDKFFTGYYLKDHSVSEVSKDYRKLLAEFTKMGLFEKKGHVTLVTLCVVAMLL  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
               S+YG++  +S W H+ S  L+GFLWIQ+GW+GHDSGHY VM + K++R  Q+L GNCL
Sbjct  124   SFSIYGILCSDSTWVHLLSGGLIGFLWIQSGWIGHDSGHYQVMTSPKINRLVQILTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHN HHIACN +++DPD+Q +P FA S+KL  SSL S+FYE+ M+F+S+ 
Sbjct  184   AGISIAWWKWNHNTHHIACNSLEFDPDLQHMPFFAVSSKL-FSSLKSYFYERKMNFDSVC  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM   AR+N+F QS+  +L K+++  NR QEILG+++FW+WYP L+S
Sbjct  243   RFLVSYQHWTFYPVMCF-ARLNLFAQSFLLLLSKRRV-PNRGQEILGVLVFWIWYPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFV+ S  +TG+Q +QF LNH +S+ + G  +G DW EKQ  GTL+I+CS 
Sbjct  301   CLPNWGERVMFVLASFAVTGIQHVQFCLNHFSSNVYVGLPSGNDWFEKQTKGTLNINCSS  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PRCQLRK+SPFVK+LC+KH + Y+ ASFW AN +  +++
Sbjct  361   WMDWFHGGLQFQIEHHLFPRLPRCQLRKISPFVKELCKKHHLPYDSASFWKANVMTIRTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
               AAL ARDL+    PKNLVWEA+N+ G
Sbjct  421   SAAALQARDLA-NPVPKNLVWEAVNTHG  447



>gb|AHF70965.1| delta8-sphingolipid desaturase [Populus tomentosa]
Length=447

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/449 (59%), Positives = 346/449 (77%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK+IT EELK+H+K GDLW+SI GKVY+VSDW + HPGG+ PLL+LAGQDVTDAF+AY
Sbjct  3     GDKKYITGEELKQHNKEGDLWISIQGKVYNVSDWAHEHPGGDVPLLNLAGQDVTDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GYY+ D +VSE SKDYR L SEF+++GLFEKKGH+  Y  A+++ M
Sbjct  63    HPGTAWQYLDKFFTGYYLKDFKVSETSKDYRRLASEFAKLGLFEKKGHITMYALASIALM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F V LYGV+  +SVWAH+GSA+++GFLWIQ+ ++GHDSGHY VMK++  ++ AQ +AGN 
Sbjct  123   FCVVLYGVLCCQSVWAHLGSALVLGFLWIQSAYIGHDSGHYQVMKSRGYNKFAQFVAGNS  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA  N  F +S+ S FY + + F+ +
Sbjct  183   LTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAV-NSTFFNSIKSCFYGRYLDFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWTFYPVM  +AR+N+++Q++  +LF K+ F +RA  ILG++IFW W+P L+
Sbjct  242   ARFFVSYQHWTFYPVM-CVARVNLYLQTF-LLLFSKRKFPDRALNILGILIFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+MFV+ S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI CS
Sbjct  300   SCLPNWPERVMFVLASFAVTAIQHVQFCLNHFAADVYTGPPKGNDWFEKQTGGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPRMPR QLR+VSP V+ LC+KH ++Y   SFW AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRMPRGQLRRVSPLVQDLCKKHNLSYRSLSFWEANVWTIRR  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+ A  ARDLS    PKN++WEA+N+ G
Sbjct  420   LRNVAQQARDLS-NPVPKNMLWEAVNTHG  447



>ref|XP_010261428.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Nelumbo nucifera]
Length=446

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/447 (60%), Positives = 349/447 (78%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+ I+++ELKKH+K  DLW+SI GKVYDV+DW+  HPGGE  LL+LAGQDVTD F+A+HP
Sbjct  5     KRNISSDELKKHNKAEDLWISIQGKVYDVTDWIKDHPGGETSLLNLAGQDVTDTFVAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L RFF GY + D+QVSEVSKDYR LVSEFS++GLFEKKGH +      ++ +F 
Sbjct  65    GTAWKYLDRFFVGY-LKDYQVSEVSKDYRRLVSEFSKLGLFEKKGHGIFISLCFMAILFA  123

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+ GV+F ++VW H+ S  L+GFLWIQ+GWVGHD+GHY +M +   +R AQ+LAGNCLT
Sbjct  124   ISVCGVLFSKNVWVHLASGGLMGFLWIQSGWVGHDAGHYQIMTSPGFNRFAQVLAGNCLT  183

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S+K F +SL S+FYE+ M+F+S+AR
Sbjct  184   GISIGWWKWIHNAHHIACNSLDFDPDLQHIPLFAVSSKFF-NSLTSYFYERKMTFDSIAR  242

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM   ARIN+F QS+  ++ K+++  NR QE++G+++FWVW+P L+S 
Sbjct  243   FLVSYQHWTFYPVMCF-ARINLFAQSFLLLVSKRRV-PNRGQELVGVLVFWVWFPLLVSC  300

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER+MFVV S  +TG+Q +QF LNH +SS + GP    DW EKQ  GTLDI C  W
Sbjct  301   LPNWAERVMFVVASFSVTGIQHVQFCLNHFSSSVYLGPPRANDWFEKQTKGTLDIACPSW  360

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LRK+SPFV+ LC+KH + Y   SF+ AN +   ++R
Sbjct  361   MDWFHGGLQFQVEHHLFPRLPRCHLRKISPFVRDLCKKHNLPYTSVSFFEANKMTIGTLR  420

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    PKNLVWEA+N+ G
Sbjct  421   TAALQARDLT-NPIPKNLVWEAVNTHG  446



>ref|XP_008377689.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Malus domestica]
Length=449

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/448 (59%), Positives = 347/448 (77%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+I+ E+L  H+KPGDLW+SI GK+Y+VSDW   HPGGE PLLSLAGQDVTDAF+AYH
Sbjct  5     SKKYISQEKLSTHNKPGDLWISIQGKIYNVSDWANHHPGGELPLLSLAGQDVTDAFVAYH  64

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  HL +FF G+++ D+ VSEVSKDYR LV+EF++MGLFE  GH V +Y   ++ +F
Sbjct  65    PGSAWQHLDQFFTGFHLEDYSVSEVSKDYRKLVNEFTKMGLFENSGHSVHFYLFLVAMLF  124

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+  +S W H+GS VL+GFLWIQ+GW+GHDSGHY ++++KK++R AQ+L GNCL
Sbjct  125   TLSIYGVLCSDSGWVHLGSGVLMGFLWIQSGWLGHDSGHYQIIRSKKVNRFAQILTGNCL  184

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+ NHNAHHI+ N +++DPD+Q +P FA ++KLF SSL S++Y++ M+F++  
Sbjct  185   AGISIAWWKRNHNAHHISVNSLEFDPDLQHMPFFAVNSKLF-SSLASYYYDRKMNFDAFT  243

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RF+VSYQHWTFYPVM L ARIN+F QS+  +  K+    NR QEI GL++FW+WYP L+S
Sbjct  244   RFMVSYQHWTFYPVMCL-ARINLFAQSFLLLSSKRLRVKNRIQEIFGLLVFWIWYPLLVS  302

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVV S  +TG+Q +QF LNH +SS + G   G DW E Q +G+L+I C P
Sbjct  303   YLPNWGERVMFVVASFSVTGIQHVQFCLNHFSSSVYVGTPXGNDWCENQTNGSLBIVCHP  362

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PR  LRKV+P VK+LC+KH + Y   SF+ AN L   ++
Sbjct  363   WMDWFHGGLQFQIEHHLFPRLPRGNLRKVAPLVKELCKKHKLLYTSVSFYKANELTVGTL  422

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA++S G
Sbjct  423   RKAALQARDLA-SPVPKNLVWEAVHSVG  449



>gb|AHF70967.1| delta8-sphingolipid desaturase [Populus tomentosa]
Length=448

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 343/448 (77%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T+++IT EEL+KH+  GDLW+SI GK+Y+V+ W   HPGG+ PLLSLAGQDVTDAF+AYH
Sbjct  4     TRRYITKEELEKHNTAGDLWISIQGKIYNVTYWANDHPGGQLPLLSLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF G+Y+ D+ VSEVS+D+R L +EFS+ GLFEKKGH+V      +  MF
Sbjct  64    PGTAWKYLDKFFTGFYLKDYTVSEVSEDFRKLAAEFSKSGLFEKKGHVVFVTLCLIVMMF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+  +S    +    L+G +WIQ+GW+GHDSGHY VM ++  +   Q+L+GNCL
Sbjct  124   GLSVYGVLCSDSRSVRLVCGALMGLMWIQSGWIGHDSGHYQVMSSRGFNCLVQILSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+ I WW+ NHNAHHIACN +DYDPD+Q +P FA S+K F SS+ S FY++ ++F+S +
Sbjct  184   AGIGIGWWKCNHNAHHIACNSLDYDPDLQHMPFFAVSSKFF-SSITSCFYDRKLNFDSAS  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM L ARIN+F QS+  +L KKK+  NR  E LGL++FW WYP L+S
Sbjct  243   RFLVSYQHWTFYPVMCL-ARINLFAQSFLILLSKKKLATNRGLEFLGLVVFWTWYPLLVS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LP+  ERIMFVV S  +TG+Q +QF LNH +SS + GP +G +W EKQ +GTL+I C P
Sbjct  302   CLPSWGERIMFVVASFSVTGIQHVQFCLNHFSSSVYVGPPSGNNWFEKQTEGTLNISCPP  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+EHHLFPR+PRCQLR+VSPF+++LC+KH + YN  SFW ANA+  +++
Sbjct  362   WMDWFHGGLQFQVEHHLFPRLPRCQLRRVSPFIRELCKKHNLPYNMVSFWKANAMTLETL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA+N+ G
Sbjct  422   RTAALQARDLT-NPVPKNLVWEAVNTHG  448



>ref|XP_011019447.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Populus euphratica]
Length=448

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 343/448 (77%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             TK++IT EEL+KH+  GDLW+SI GK+Y+V+ W   HPGG+ PLLSLAGQDVTDAF+AYH
Sbjct  4     TKRYITKEELEKHNTAGDLWISIQGKIYNVTYWANDHPGGQLPLLSLAGQDVTDAFIAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF G Y+ D+ VSEVS+D+R L +EFS+ GLFEKKGH+V      +  MF
Sbjct  64    PGTAWKYLDKFFTGLYLKDYTVSEVSEDFRKLAAEFSKSGLFEKKGHVVFVTLCLIVLMF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
               S+YGV+  +S    +    L+G +WIQ+GW+GHDSGHY VM ++  +   Q+L+GNCL
Sbjct  124   CFSVYGVLCSDSRSVRLVCGGLMGLMWIQSGWIGHDSGHYQVMSSRGFNCLVQILSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              GV I WW+ NHNAHHIACN +DYDPD+Q +P FA S+K F SS+ S FY++ ++F+S++
Sbjct  184   AGVGIGWWKCNHNAHHIACNSLDYDPDLQHMPFFAVSSKFF-SSITSCFYDRKLNFDSVS  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM L ARIN+F QS+  +L K+K+  N+  E LGL++FW WYP L+S
Sbjct  243   RFLVSYQHWTFYPVMCL-ARINLFAQSFLILLSKRKLATNKGLEFLGLVVFWTWYPLLVS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LP+  ERIMFVV S  +TG+Q +QF LNH +SS + GP +G +W EKQ +GTL+I CSP
Sbjct  302   CLPSWGERIMFVVASFSVTGIQHVQFCLNHFSSSVYVGPPSGNNWFEKQTEGTLNISCSP  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+EHHLFPR+PRCQLR+VSPF+++LC+KH + YN  SFW ANA+  +++
Sbjct  362   WMDWFHGGLQFQVEHHLFPRLPRCQLRRVSPFIRELCKKHNLPYNVVSFWKANAMTLETL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA+N+ G
Sbjct  422   RTAALQARDLT-NPVPKNLVWEAVNTHG  448



>gb|ABD60318.1| delta-6 fatty acid desaturase [Nonea caspica]
Length=448

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 345/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++ELK HDKPGDLW+SI GKVYDVS+WV  HPGG +PL+SLAGQ+VTDAF+A+HP
Sbjct  6     KKYITSDELKNHDKPGDLWISIQGKVYDVSNWVKDHPGGTFPLMSLAGQEVTDAFVAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                  +L RFF GYY+ D+ VSEVSKDYR LV EFS+MGL++KKGH+V      ++ +F 
Sbjct  66    PSVWKNLDRFFTGYYLKDYSVSEVSKDYRKLVFEFSKMGLYDKKGHIVFATLCFIATLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F E V  H+ S  L+GFLWIQ+GW+GHD+ HY V+   + ++   +   NC++
Sbjct  126   MSVYGVLFCEGVLVHLFSGCLMGFLWIQSGWIGHDARHYMVVSDSRFNKFVGIFVSNCIS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHH+ACN ++YDPD+Q +P    S+K F +SL SHFY K ++F+SL+R
Sbjct  186   GISIGWWKWNHNAHHLACNSLEYDPDLQYIPFLVVSSKFF-TSLNSHFYGKRLTFDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQHWTFYPVM   AR+NMF+QS   +L K+ + + RAQE+LGL++F +W+P L+S 
Sbjct  245   FFVSYQHWTFYPVM-CSARLNMFVQSLIMLLTKRNV-SYRAQELLGLLVFLIWFPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFVV SL +TG+QQ+QFSLNH +SS + G + G +W EKQ DGTLDI C PW
Sbjct  303   LPNVGERVMFVVASLCVTGMQQVQFSLNHFSSSVYVGKVKGNNWFEKQTDGTLDISCPPW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFP+MPRC  RK+SPFV +LC+KH + YN ASF  AN L   ++R
Sbjct  363   MDWFHGGLQFQVEHHLFPKMPRCHFRKISPFVMELCKKHNLPYNVASFSKANELTLSTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             + AL ARD++ +  PKNLVWEAL + G
Sbjct  423   NTALAARDIT-KPLPKNLVWEALQTHG  448



>ref|XP_011098230.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Sesamum indicum]
Length=447

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/447 (60%), Positives = 344/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+F+T++ELK H+K GDLW+SI GKVYDVS+W   HPGGE PL++L GQD TDAF+AYHP
Sbjct  5     KRFVTSDELKAHNKKGDLWISIQGKVYDVSEWANHHPGGELPLMNLGGQDATDAFVAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
              +    L +FF+G+Y+ D+ VSEVSKDYR LV EFS+MGLFEKKGH V      ++ +F 
Sbjct  65    GVTWQFLDKFFSGFYLKDYSVSEVSKDYRKLVYEFSKMGLFEKKGHGVFITMCVIAILFA  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V++YGV+  E +W H+    L+G LWIQ+GW+GHDSGHY VM T KL+R AQ L+GNCL 
Sbjct  125   VTVYGVLCCEGMWLHLLCGGLMGCLWIQSGWMGHDSGHYQVMMTPKLNRFAQFLSGNCLA  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             GVSI WW+ NHNAHHIACN +DYDPD+Q +P FA S+KLF SS+ S FY++ M F+S AR
Sbjct  185   GVSIGWWKRNHNAHHIACNSLDYDPDLQHMPFFAVSSKLF-SSITSCFYDRKMDFDSAAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVS QH TFYPVM   ARIN+F QS+  +L KK++  ++  E+L L++FW+W+P L+S 
Sbjct  244   FLVSNQHCTFYPVMCF-ARINLFTQSFLLLLSKKRV-PHKGLELLCLLVFWIWFPLLVSR  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFVV S ++TG+Q +QF LNH ++S + GP  G DW E+Q  G+LDI+C  W
Sbjct  302   LPNWGERVMFVVASFVVTGIQHVQFCLNHFSTSVYTGPPKGNDWFERQTSGSLDIECYSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ EHHLFPR+PRCQLR +SPFVK+LC+KH + YN ASFW ANA+  K+++
Sbjct  362   MDWFHGGLQFQTEHHLFPRLPRCQLRTISPFVKELCKKHNLPYNIASFWEANAMTIKTLK  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARD + +  P+NL+WEALN+ G
Sbjct  422   VAALQARDFT-KPVPRNLLWEALNTHG  447



>ref|XP_010526057.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Tarenaya hassleriana]
Length=448

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/449 (61%), Positives = 339/449 (76%), Gaps = 5/449 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDW-VYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             TK++I+  EL KH++ GDLW+SI GKVYDV+ W V  HPGGE PLL+LAGQDVTDAF+AY
Sbjct  4     TKRYISRAELGKHNRVGDLWISIQGKVYDVTRWAVDGHPGGELPLLNLAGQDVTDAFIAY  63

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  HL  FF GYY+ D  VS+VSKDYR L SEFS+MGLFEKKGH V      +S +
Sbjct  64    HPGTAWQHLNMFFTGYYLEDFAVSDVSKDYRRLASEFSKMGLFEKKGHGVFVLLCLISVL  123

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F +S+YGV+  ESVW H+    ++GFLWIQ+GW+GHDSGHY VM  +K++R  Q+L GNC
Sbjct  124   FSLSVYGVLCSESVWVHLLCGGVMGFLWIQSGWIGHDSGHYQVMVNRKMNRFVQILTGNC  183

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             L G+SI WW+ NHN HHIACN +D+DPD+Q +P FA S+KLF  SL S+FYE+ M+F++ 
Sbjct  184   LAGISIAWWKLNHNTHHIACNSLDFDPDLQHMPFFAVSSKLFH-SLRSYFYERKMNFDTA  242

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVSYQH TFYPVM   ARIN+F QS+  +LF  K  + R  E +GL++FWVWYP L+
Sbjct  243   ARFLVSYQHLTFYPVMCF-ARINLFAQSF-LLLFSGKKVSGRGLEFIGLLVFWVWYPLLV  300

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+MFVV S  +TG+Q +QF LNH +S  + GP  G DW E Q  GTLDI CS
Sbjct  301   SCLPNWGERLMFVVASFSVTGIQHVQFCLNHFSSDVYVGPPNGNDWFETQTKGTLDIKCS  360

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWFHGGLQFQIEHHLFPR+PRCQLRKVSPFV++LC+KH + YN ASFW AN +    
Sbjct  361   EWMDWFHGGLQFQIEHHLFPRLPRCQLRKVSPFVQELCKKHNLPYNCASFWKANVMTVDI  420

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             ++ AA+ ARD + +  PKNLVWEA+N+ G
Sbjct  421   LKSAAMQARDWT-KPIPKNLVWEAVNTHG  448



>gb|EPS73310.1| d8-sphingolipid desaturase, partial [Genlisea aurea]
Length=444

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/447 (59%), Positives = 339/447 (76%), Gaps = 3/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +++IT+EELK H K GDLW+SI G+V DVS+W++ HPGGE PLL+LAGQD TDAF+AYHP
Sbjct  1     RRYITSEELKTHSKRGDLWISIQGRVLDVSEWIHTHPGGETPLLNLAGQDATDAFVAYHP  60

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             + A   L  + NG+Y+ D+ VS+ S+DYR LV EF+RM LF++KGH+       ++ +F 
Sbjct  61    SSAWKVLDGYSNGFYLKDYSVSDTSRDYRKLVMEFTRMNLFDRKGHITFVTLCFMAMLFA  120

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
              S+YGV F + +  H+     +GFLWIQ+GW+GHDSGHY +M  +KL+R AQ+L GNCLT
Sbjct  121   ASVYGVFFCQGLLVHLLCGGAMGFLWIQSGWLGHDSGHYQIMANRKLNRFAQILTGNCLT  180

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN ++YDPD+Q +P+FA S+K F +SL SHFYE+ M F+ ++R
Sbjct  181   GISIAWWKWNHNAHHIACNSLEYDPDLQYIPLFAVSSKFF-NSLTSHFYERKMHFDGVSR  239

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVS QHWTFYPVM L ARIN+F QS+  VL  K   +NRA EI GL+IFW WYP ++S 
Sbjct  240   FLVSNQHWTFYPVMCL-ARINLFAQSFLLVLSSKHKVSNRALEIAGLLIFWSWYPLVVSF  298

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER +FV+ S  ++G+Q +QF LNH +S  + G   G DW EKQ  GTL+I CSPW
Sbjct  299   LPNWGERGLFVLASFCVSGIQHVQFCLNHFSSEVYVGAPKGNDWFEKQTSGTLNITCSPW  358

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPRMPRCQ RK+SP VK+LC+KH + YN ASFW AN +  +++R
Sbjct  359   MDWFHGGLQFQVEHHLFPRMPRCQFRKISPLVKELCKKHSLPYNSASFWEANVMTVQTLR  418

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             DAAL ARDLS     +NLVWEA+N+ G
Sbjct  419   DAALQARDLS-NPVVRNLVWEAVNTHG  444



>ref|XP_010669398.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Beta vulgaris 
subsp. vulgaris]
Length=447

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/448 (60%), Positives = 336/448 (75%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+I+ EELK H+K  DLW+SIHGK+Y+V++W   HPGGE PLL+LAGQDVTD FLA H
Sbjct  4     SKKYISEEELKTHNKRNDLWISIHGKIYNVTNWANYHPGGETPLLNLAGQDVTDPFLALH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A   L   F GYY+ D+ VSE SKDYR LVSEF++MGLF+KKGH V    A +  M 
Sbjct  64    PTSAWKFLDNHFTGYYLKDYIVSETSKDYRNLVSEFTKMGLFDKKGHGVFILMAFIVIMI  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+  ++ W H+ S  L+GF WIQ+GW+GHDSGHY V+   K +R  Q + GNC+
Sbjct  124   AMSVYGVLCSDNFWVHLASGGLLGFTWIQSGWIGHDSGHYKVIMNPKFNRFVQFMTGNCI  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+W HNAHHIA N +++DPD+Q +P F  S++ F SSL S FY + ++F+S++
Sbjct  184   AGISIGWWKWIHNAHHIAVNSLEFDPDLQYMPFFVVSSEFF-SSLTSQFYGRKLNFDSIS  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RF VSYQHWTFYPVM  +ARIN++ QS   +LF K+   NRAQEILGL++FW+WYP L+S
Sbjct  243   RFFVSYQHWTFYPVM-CVARINLYTQS-LLLLFSKRKVPNRAQEILGLLVFWIWYPVLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ERI FV++S  +TG+Q +QF LNH +S+ + GP  G DW EKQ  GTLDIDC  
Sbjct  301   CLPNWFERIAFVIVSFSVTGIQHVQFCLNHFSSNVYVGPPRGNDWFEKQTSGTLDIDCPC  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQI HHLFPRMPRCQLRK+SPFVK+LCEKH + YN ASFW AN L F ++
Sbjct  361   WMDWFHGGLQFQIAHHLFPRMPRCQLRKISPFVKELCEKHNLPYNCASFWKANVLTFNTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             +  AL ARDLS    PKNLVWEA+N+ G
Sbjct  421   QTTALQARDLS-NPVPKNLVWEAMNTHG  447



>ref|XP_008220482.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Prunus mume]
Length=448

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 344/448 (77%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+I+ E+L KH++PGDLW+SI GK+YDVSDW   HPGGE PLL+LAGQDVTDAF+AYH
Sbjct  4     SKKYISQEDLSKHNRPGDLWISIQGKIYDVSDWANYHPGGELPLLNLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  HL +FF G Y+  + VSEVSKDYR LV+EF++MGLFE +G  V +    ++ +F
Sbjct  64    PGSAWQHLDQFFTGSYLEGYSVSEVSKDYRKLVNEFTKMGLFENRGLGVHFSLFLVAMLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV++ +S W H+GS  L+GFLWIQ+GW GHDSGHY ++ +K+L+R AQ+L GNCL
Sbjct  124   SLSVYGVLYSDSTWVHLGSGGLMGFLWIQSGWHGHDSGHYQIISSKRLNRFAQILTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+ NHNAHHIACN +++DPD+Q +P FA S+KLF +SL S+FY++ M+F++  
Sbjct  184   AGISIAWWKRNHNAHHIACNSLEFDPDLQHMPFFAVSSKLF-NSLTSYFYDRKMNFDAFT  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             R LVSYQHWTFYPVM L AR+N+F QS+  +  K+    NR QEILGL++FW+WYP L+S
Sbjct  243   RTLVSYQHWTFYPVMCL-ARLNLFAQSFLLLSSKRLRVNNRVQEILGLLVFWIWYPLLVS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVV S  +TG+Q +QF LNH +SS + G   G DW E Q +G+LDI+C  
Sbjct  302   CLPNWGERVMFVVTSFSVTGIQHVQFCLNHFSSSVYVGTPIGNDWCENQTNGSLDIECPS  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PR  LRKV+P VK+LC++H + Y   SF  AN L   ++
Sbjct  362   WMDWFHGGLQFQIEHHLFPRLPRGNLRKVAPLVKELCKEHKLPYKSVSFLKANELTIGTL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA++++G
Sbjct  422   RTAALQARDLA-SPVPKNLVWEAVHTYG  448



>ref|XP_007222102.1| hypothetical protein PRUPE_ppa005677mg [Prunus persica]
 gb|EMJ23301.1| hypothetical protein PRUPE_ppa005677mg [Prunus persica]
Length=448

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 345/448 (77%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+I+ E+L KH+KPGDLW+SI GK+Y+VSDW   HPGGE PLL+LAGQDVTDAF+AYH
Sbjct  4     SKKYISQEDLSKHNKPGDLWISIQGKIYNVSDWANYHPGGELPLLNLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  HL +FF G Y+  + VSEVSKDYR LV+EF++MGLFE +G  V +    ++ +F
Sbjct  64    PGSAWQHLDQFFTGSYLEGYSVSEVSKDYRKLVNEFTKMGLFENRGLGVHFSLFLVAMLF  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV++ +S W H+GS  L+GFLWIQ+GW GHDSGHY ++++++L+R AQ+L GNCL
Sbjct  124   SLSVYGVLYSDSTWVHLGSGGLMGFLWIQSGWHGHDSGHYQIIRSERLNRFAQILTGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+ NHNAHHIACN +++DPD+Q +P FA S+KLF +SL S+FY++ M+F++  
Sbjct  184   AGISIAWWKRNHNAHHIACNSLEFDPDLQHMPFFAVSSKLF-NSLTSYFYDRKMNFDAFT  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             R LVSYQHWTFYPVM L AR+N+F QS+  +  K+    NR QEILGL++FW+WYP L+S
Sbjct  243   RTLVSYQHWTFYPVMCL-ARLNLFAQSFLLLSSKRLRVNNRVQEILGLLVFWIWYPLLVS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVV S  +TG+Q +QF LNH +SS + G   G DW E Q +G+LDI+C  
Sbjct  302   CLPNWGERVMFVVTSFSVTGIQHVQFCLNHFSSSVYVGTPIGNDWCENQTNGSLDIECPS  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PR  LRKV+P VK+LC+KH + Y   SF  AN L   ++
Sbjct  362   WMDWFHGGLQFQIEHHLFPRLPRGNLRKVAPLVKELCKKHKLPYKSVSFLKANELTIGTL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA++++G
Sbjct  422   RTAALQARDLA-SPVPKNLVWEAVHTYG  448



>ref|XP_010047339.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Eucalyptus 
grandis]
 gb|KCW79230.1| hypothetical protein EUGRSUZ_C00655 [Eucalyptus grandis]
Length=450

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/449 (60%), Positives = 341/449 (76%), Gaps = 6/449 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             ++ +T EEL +H+KPGDLW+SI GK+YDVS+WV  HPGG+ PL SLAGQD TDAF+A+HP
Sbjct  6     RRSVTAEELARHNKPGDLWISIQGKIYDVSEWVKDHPGGDLPLRSLAGQDATDAFIAFHP  65

Query  1364  AIAA--HHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             A  A    L RF  G  +  + VSEVS+DYR L  EF+RMGLF++KGH+       ++A+
Sbjct  66    AGGAAWGRLGRFDTGRRLEGYAVSEVSRDYRRLAGEFARMGLFDRKGHITLTSMCFIAAL  125

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F  S+ GV+  ES W H+    ++GFLWIQ+GW+GHDSGHY +M     +R AQ+L GNC
Sbjct  126   FGASVLGVLASESAWVHLLCGAMMGFLWIQSGWMGHDSGHYRIMVGPAQNRFAQVLTGNC  185

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             L G+SI WW+ NHNAHHIACN +D+DPD+Q +P F  S+K F +SL S +Y++ M+F+++
Sbjct  186   LAGISIAWWKRNHNAHHIACNSLDFDPDLQHMPFFVVSSKFF-ASLTSCYYDRKMNFDAV  244

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             +RFLVS+QHWTFYPVM L ARIN+F QS+  +L K K+  NR QEILGL+ FW+WYP L+
Sbjct  245   SRFLVSHQHWTFYPVMCL-ARINLFAQSFALLLSKHKV-PNRGQEILGLLSFWIWYPLLV  302

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ERIMFV+ S  +TG+Q +QF LNH ASS + GP +G DW EKQ  GTLDI CS
Sbjct  303   SCLPNWGERIMFVIASFAVTGIQHVQFCLNHFASSVYVGPPSGNDWFEKQTAGTLDIQCS  362

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQIEHHLFPR+PR QLRKVSPFVK+LC+KH + Y+ ASFW ANA+  ++
Sbjct  363   PWMDWFHGGLQFQIEHHLFPRLPRSQLRKVSPFVKELCKKHNLPYSSASFWEANAMTLRT  422

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARDL+    PKNLVWEA+N+ G
Sbjct  423   LRTAALQARDLA-NPVPKNLVWEAVNTHG  450



>ref|XP_011037262.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Populus euphratica]
Length=447

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/449 (58%), Positives = 342/449 (76%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK IT+EELK+H+K GDLW+SI GKVYDVSDW   HPGG+  L+++AG D TDAF+AY
Sbjct  3     GDKKGITSEELKQHNKAGDLWISIQGKVYDVSDWANEHPGGDVALMNMAGLDATDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L + F GYY++D ++SE SKDYR L SEF+++GLFEKKGH+  Y  A++  M
Sbjct  63    HPGTAWKYLDKLFTGYYLTDFKLSETSKDYRRLASEFAKLGLFEKKGHITMYALASIVLM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F V LYGV+  +SVWAH GSAV++GFLWIQ+ ++GHDSGHY VM T+  ++ AQ LAGN 
Sbjct  123   FGVVLYGVLCCQSVWAHFGSAVVLGFLWIQSAYIGHDSGHYQVMNTRGYNKLAQFLAGNS  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA  N +F +S+ S FY + ++F+ +
Sbjct  183   LTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAV-NSIFFNSIKSCFYGRYLNFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWTFYPVM  +AR+N++IQ++  +LF K+ F +RA  ILG++IFW W+P L+
Sbjct  242   ARFFVSYQHWTFYPVM-CVARVNLYIQTF-LLLFSKRRFPDRALNILGILIFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S +PN  ER+MFV+ S  +T +Q +QF LNH A+  + G   G DW EKQ  GTLDI CS
Sbjct  300   SCIPNWPERVMFVLTSFAVTAIQHVQFCLNHFAADVYTGLPEGNDWFEKQTSGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPRMPRCQLR+VSP V+ LC+KH ++Y   SFW AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRMPRCQLRRVSPLVQDLCKKHNLSYRSLSFWEANVWTIRK  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+ AL ARDL+    PKN++WEA+N+ G
Sbjct  420   LRNVALQARDLA-NPVPKNMLWEAVNTHG  447



>ref|XP_010917106.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Elaeis guineensis]
Length=447

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 346/447 (77%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+ I+++EL+KH+   DLW+SI GKVYDV+ W+  HPGG+ PL +LAGQDVTDAF+AYHP
Sbjct  6     KRSISSDELRKHNVATDLWISIQGKVYDVTSWLKDHPGGDLPLRNLAGQDVTDAFVAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL RF  G+ +SD++VS+VSKDYR LV E S+MGLFEKKGH+       ++ +F 
Sbjct  66    GTAWKHLDRFLIGH-LSDYEVSDVSKDYRRLVGEISKMGLFEKKGHISGVTLVLIAVLFS  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
              ++YGV+F      H+    ++GFLWIQ+GW+GHDSGHY ++K  KL+R  Q++ GNCLT
Sbjct  125   AAVYGVLFSSCALTHVVCGGMMGFLWIQSGWMGHDSGHYRIVKNAKLNRFVQIVTGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +++DPD+Q +P+FA S++ F SSL S+FYE+ MSF++++R
Sbjct  185   GISIAWWKRNHNAHHIACNSLEFDPDLQHMPLFAVSSRFF-SSLTSYFYERKMSFDAVSR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM   ARIN+F QS   +L  KK+  NR QEILG+++FWVWYP L+S 
Sbjct  244   FLVSYQHWTFYPVMCF-ARINLFAQSILLLLSNKKV-PNRWQEILGVMVFWVWYPLLVSC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFVV S ++TG+Q +QF LNH +SS + GP TG DW EKQ  GTL+I CSPW
Sbjct  302   LPNWGERLMFVVASFVVTGIQHVQFCLNHFSSSVYVGPPTGNDWFEKQTMGTLNISCSPW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ EHHLFPR+PRC LRKV+PFV++LC+KH + Y+ ASFW AN +  +++R
Sbjct  362   MDWFHGGLQFQAEHHLFPRLPRCHLRKVAPFVRELCKKHKLPYSIASFWEANVMTVRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL A+DLS    PKNLVWEA+N+ G
Sbjct  422   TAALQAQDLS-NPVPKNLVWEAVNTHG  447



>ref|XP_010559105.1| PREDICTED: delta(8)-fatty-acid desaturase 2 [Tarenaya hassleriana]
Length=450

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/447 (57%), Positives = 341/447 (76%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELKKH++PGDLW+SI GKVYDV+DWV  HPGG+ P+ +LAGQDVTDAF+AYHP
Sbjct  8     KKYITSEELKKHNQPGDLWISIQGKVYDVTDWVRSHPGGDAPIRNLAGQDVTDAFIAYHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL + F GY++ D  VS++S+DYR + +EFS++GLFE KGH+  Y    ++ MFL
Sbjct  68    GTAWAHLDKLFTGYHLRDFHVSDISRDYRRMAAEFSKLGLFEDKGHVTLYTLTCVAVMFL  127

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGV+   SVWAH+ SA+L+GFLWIQ+ +VGHDSGHY+VM+++  ++ AQLL+GNCLT
Sbjct  128   AVIYGVLACTSVWAHLVSAILLGFLWIQSAYVGHDSGHYNVMRSRGYNKLAQLLSGNCLT  187

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S K F +S+ S FY + +SF+ LAR
Sbjct  188   GISIAWWKWTHNAHHIACNSLDHDPDLQHIPVFAVSTKFF-ASMTSRFYGRKLSFDPLAR  246

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  +AR+N+F+Q++  +LF K+   +RA  I G+++FW W+P L+S 
Sbjct  247   FLISYQHWTFYPVM-CVARVNLFVQTF-LLLFSKRHVPDRAMNIAGILVFWAWFPLLVSC  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER MFV+ S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  W
Sbjct  305   LPNWPERFMFVLTSFAVTALQHVQFCLNHFAADVYTGPPNGNDWFEKQTGGTLDIACRSW  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR+VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  365   MDWFFGGLQFQLEHHLFPRLPRCHLRRVSPVVRELCKKHNLPYRSLSWWEANVWTIRTLR  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARD +     KNLVWEA+N+ G
Sbjct  425   TAAIQARD-AANPVGKNLVWEAVNTHG  450



>ref|XP_008805633.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Phoenix dactylifera]
Length=449

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 346/447 (77%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +++IT+EEL+ H+ PGDLW+SI GKVYDV+ WV  HPGG+ PLL+LAGQDVTDAF+AYHP
Sbjct  8     RRYITSEELRGHNTPGDLWISIQGKVYDVTGWVKDHPGGDIPLLNLAGQDVTDAFVAYHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                   L RFF GY ++D++VS VSKDYR LV+EF+R+GLFEKKGH V     +++  FL
Sbjct  68    GTTWALLDRFFVGY-LADYRVSAVSKDYRRLVAEFARLGLFEKKGHGVLCSLISMAFFFL  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             VS+ GV+   S + H+ S +L+G LWIQ+G++GHDSGHY++M +  L+R  Q+L+GNCL 
Sbjct  127   VSVSGVLLSTSTFVHLISGLLMGLLWIQSGFLGHDSGHYNIMTSPGLNRLIQILSGNCLA  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +D+DPDVQ +P+FA S+K F +SL S+FYE+ ++F S+AR
Sbjct  187   GISIGWWKRNHNAHHIACNSLDFDPDVQHMPLFAVSSKFF-TSLTSYFYERKLAFTSVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM  +AR+N+F QS   +L KKK+   R QE +G IIFW+WYP L+S+
Sbjct  246   FLVSYQHWTFYPVMC-VARVNLFAQSALLLLSKKKV-PGRWQETVGCIIFWIWYPLLVSA  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER +FV  +  +TG+Q +QF LNH ++S + GP  G DW EKQ  GTLDI C PW
Sbjct  304   LPNWTERAIFVAANFAVTGIQHVQFCLNHFSASVYVGPPRGNDWFEKQTMGTLDILCPPW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLR++SP+VK+LC+KH + Y  ASFW AN     ++R
Sbjct  364   MDWFHGGLQFQVEHHLFPRLPRCQLRRISPYVKELCKKHALPYTAASFWDANLRTLGTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    PKNLVWEA+N+ G
Sbjct  424   TAALQARDLT-NPVPKNLVWEAVNTHG  449



>ref|XP_002320834.1| hypothetical protein POPTR_0014s08750g [Populus trichocarpa]
 gb|ABK95618.1| unknown [Populus trichocarpa]
 gb|EEE99149.1| hypothetical protein POPTR_0014s08750g [Populus trichocarpa]
Length=447

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/449 (57%), Positives = 342/449 (76%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK IT+EELK+H+K GDLW+SI GKVYDVSDW   HPGG+  L+++AG D TDAF+AY
Sbjct  3     GDKKGITSEELKQHNKAGDLWISIQGKVYDVSDWANEHPGGDVALMNMAGLDATDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L + F GYY++D ++SE SKDYR L SEF+++GLFEKKGH+  Y   ++  M
Sbjct  63    HPGTAWKYLDKLFTGYYLTDFKLSETSKDYRRLASEFAKLGLFEKKGHITMYALTSIVLM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F V LYGV+  +SVWAH GSAV++GFLWIQ+ ++GHDSGHY VM T+  ++ AQ +AGN 
Sbjct  123   FCVVLYGVLCCQSVWAHFGSAVVLGFLWIQSAYIGHDSGHYQVMNTRGSNKLAQFVAGNS  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA  N +F +S+ S FY + ++F+ +
Sbjct  183   LTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAV-NSIFFNSIKSCFYGRYLNFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWTFYPVM  +AR+N++IQ++  +LF K+ F +RA  ILG++IFW W+P L+
Sbjct  242   ARFFVSYQHWTFYPVM-CVARVNLYIQTF-LLLFSKRRFPDRALNILGILIFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S +PN  ER+MFV+ S  +T +Q +QF LNH A+  ++G   G DW EKQ  GTLDI CS
Sbjct  300   SCIPNWPERVMFVLTSFAVTAIQHVQFCLNHFAADVYSGLPEGNDWFEKQTSGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPRMPRCQLR+VSP V+ LC+KH ++Y   SFW AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRMPRCQLRRVSPLVQDLCKKHNLSYRSLSFWEANVWTIRK  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+ AL ARDL+    PKN++WEA+N+ G
Sbjct  420   LRNVALQARDLA-NPVPKNMLWEAVNTHG  447



>gb|ACB47482.1| delta6-fatty acid desaturase [Oenothera biennis]
Length=447

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 341/448 (76%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             ++K+I+ +EL  H+K  DLW+SI GKVY+V+DW   HPGG  PLL+LAGQDVTDAF+AYH
Sbjct  4     SRKYISVQELSDHNKLEDLWISIQGKVYNVTDWKNHHPGGAVPLLNLAGQDVTDAFVAYH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A +HL RFF GY++ D+ VSE SKDYR LVSEF+++G F+KKGH+       ++ + 
Sbjct  64    PGTAWNHLDRFFTGYHLRDYTVSEASKDYRKLVSEFTKLGFFDKKGHVTCITLLLIAMLL  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
             L+S+ GV+F +SV  H+ SA ++GFLWIQ+GW+GHDSGHY +M     +R  Q+L GNC+
Sbjct  124   LLSVAGVLFSDSVAVHVASAAMIGFLWIQSGWMGHDSGHYQIMSGPAANRFTQVLTGNCI  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+WNHN HHIACN +D+DPD+Q +P FA SNKLF  S+ S+FY++ M+F+S A
Sbjct  184   AGISIAWWKWNHNCHHIACNSLDFDPDLQHMPFFAVSNKLF-GSITSYFYDRKMNFDSFA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQH T+YPVM   ARIN++ QS+  +LF  +   NR QEILGL +FW+WYP L+S
Sbjct  243   RFLVSYQHLTYYPVMCF-ARINLYAQSF-CLLFSNRKVPNRGQEILGLAVFWIWYPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LP+ SER+MFV +S  +TG+Q +QF+LNH ++  + GP T  DW EKQ  G+LDI C P
Sbjct  301   CLPSWSERVMFVAVSFSVTGIQHVQFTLNHFSTDVYVGPPTSNDWFEKQTMGSLDILCPP  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PRC LRKV+PFV++LC+KH + YN  SF  ANAL   ++
Sbjct  361   WMDWFHGGLQFQIEHHLFPRLPRCNLRKVAPFVQELCKKHNLPYNCVSFLKANALTIDTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDLS    P+NLVWEA+N+ G
Sbjct  421   RVAALQARDLS-RPVPRNLVWEAVNTHG  447



>ref|XP_007157636.1| hypothetical protein PHAVU_002G086300g [Phaseolus vulgaris]
 gb|ESW29630.1| hypothetical protein PHAVU_002G086300g [Phaseolus vulgaris]
Length=447

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/449 (59%), Positives = 348/449 (78%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK++T+EELK H+K GDLW+SI GKVY+VSDWV  HPGG+ P+L+LAGQDVTDAF+AY
Sbjct  3     GEKKYMTSEELKGHNKVGDLWISIQGKVYNVSDWVKEHPGGDVPILNLAGQDVTDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  HL RFF GY++SD +VSEVS+DYR L SEFS+MGLF+ KGH+ SY   A++AM
Sbjct  63    HPGTAWSHLDRFFTGYHLSDFKVSEVSRDYRKLASEFSKMGLFDTKGHITSYTLVAVAAM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             FL+ LYGV+   SVWAH+GS +L+G LW+Q+ +VGHDSGHY VM  K  ++ AQ+L+GNC
Sbjct  123   FLIVLYGVLGCTSVWAHLGSGMLLGLLWMQSAYVGHDSGHYVVMTNKGYNKVAQVLSGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S++ F +SL SHFY + + F+  
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDHDPDLQHMPVFAVSSRFF-NSLTSHFYGRKLEFDYF  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFL+ YQH+TFYPVM  +AR+N+++Q+   +LF K+   +RA  ++G+++FW+W+P L+
Sbjct  242   ARFLICYQHFTFYPVM-SVARVNLYLQT-ILLLFSKRKVQDRALNLMGILVFWIWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+MFV+ S  +  +Q IQF LNH A++ + G  +G DW EKQ  GTLDI CS
Sbjct  300   SCLPNWPERVMFVLSSFAVCSIQHIQFCLNHFAANVYVGLPSGNDWFEKQTSGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF GGLQFQ+EHHLFPR+PRCQLRK+SP V  LC+KH + Y   SFW AN    ++
Sbjct  360   SWMDWFFGGLQFQLEHHLFPRLPRCQLRKISPLVSDLCKKHNLPYRSLSFWEANQWTIRT  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARDLS   APKNL+WEA+N+ G
Sbjct  420   LRTAALQARDLS-NSAPKNLLWEAVNTHG  447



>ref|XP_002511936.1| fatty acid desaturase, putative [Ricinus communis]
 gb|EEF50605.1| fatty acid desaturase, putative [Ricinus communis]
Length=447

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/447 (58%), Positives = 347/447 (78%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELKKH   GDLW+SI GKVYDV++W+  HPGG+ PLL+LAGQDVTDAF+AYHP
Sbjct  5     KKYITSEELKKHSSSGDLWISIQGKVYDVTEWMKEHPGGDTPLLNLAGQDVTDAFIAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL + F GYY+ D +VSEVSKDYR L SEF+++GLF++KGH+  Y  A++  +F 
Sbjct  65    GTAWAHLDKLFTGYYLEDFKVSEVSKDYRKLYSEFAKLGLFDQKGHVAMYSLASVGFLFC  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   S WAHMG+AVL+G LWIQ+ +VGHDSGHY VM+++  ++ AQLLAGNCLT
Sbjct  125   FVLYGVLCFSSFWAHMGAAVLLGVLWIQSAYVGHDSGHYQVMRSRGFNKLAQLLAGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S +LF +S+ S FYE+ ++F+ LAR
Sbjct  185   GISIAWWKWTHNAHHIACNSLDFDPDLQHIPVFAVSTRLF-NSIRSCFYERNLNFDPLAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM  +AR+N+++Q+   +   +K+  +RA  I+G+++FW+W+P L+SS
Sbjct  244   FLVSYQHWTFYPVM-CVARVNLYLQTLLLLFSTRKV-PDRAVNIMGILVFWIWFPLLVSS  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER++FV+ S  +T +Q +QF LNH ++  + GP  G DW EKQ  GTLDI CS W
Sbjct  302   LPDWPERVIFVLTSFAVTSLQHVQFCLNHFSADVYLGPPNGNDWFEKQAGGTLDISCSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDW +GGLQFQ+EHHLFPR+PRCQLR+VSP V+ LC+KH + Y   SFW AN    +++R
Sbjct  362   MDWVYGGLQFQLEHHLFPRLPRCQLRRVSPLVRDLCKKHNLPYRSLSFWEANVSTIRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARD++    PKNL+WEA+N+ G
Sbjct  422   NAALQARDMA-NPVPKNLLWEAVNTHG  447



>ref|XP_006444926.1| hypothetical protein CICLE_v10020141mg [Citrus clementina]
 ref|XP_006491206.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Citrus sinensis]
 gb|ESR58166.1| hypothetical protein CICLE_v10020141mg [Citrus clementina]
 gb|KDO86343.1| hypothetical protein CISIN_1g013209mg [Citrus sinensis]
Length=447

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/447 (58%), Positives = 342/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EEL+ H+K  DLW+SI GKVYDV++W  +HPGG+ PLL+LAGQDVTDAF+AYHP
Sbjct  5     KKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L + F GYYV D +VSE+SKDYR L  EF++ G+FEKK H+ S     ++ MF+
Sbjct  65    GTAWQYLDKLFTGYYVQDFEVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFV  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V +YGV+  ESVWAH+GS +L+GFLWIQ+ +VGHDSGHY VM + K ++ AQL++GNCLT
Sbjct  125   VVVYGVLCCESVWAHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S +LF +S+ S FY + + F+ +AR
Sbjct  185   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSTRLF-NSITSVFYGRKLDFDPVAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM  +AR+N+++Q+   +  K+K+  +RA  I+G ++FW W+P L+S 
Sbjct  244   FLVSYQHWTFYPVM-CVARVNLYLQTLLLLFSKRKV-PDRALNIMGTLVFWTWFPLLVSY  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFV+ S  +T +Q IQF LNH A++ + GP  G DW EKQ  GTLDI CS W
Sbjct  302   LPNWPERVMFVMASFTVTAIQHIQFCLNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLRK+SP V+ LC+KH + Y   SF+ AN    +++R
Sbjct  362   MDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    PKNL+WEALN+ G
Sbjct  422   GAALQARDLT-NPVPKNLLWEALNTHG  447



>ref|XP_004291044.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 339/448 (76%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
               K+I++E+L KH+KPGDLW+SI GKVY+VSDW   HPGGE PLL+LAGQDVTDAF+AYH
Sbjct  6     NNKYISSEDLAKHNKPGDLWISIQGKVYNVSDWAQSHPGGELPLLNLAGQDVTDAFVAYH  65

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  HL +FFNGYY+  + VSEVSKDYR LV+EFS+MGLFE +G  V +   +++ +F
Sbjct  66    PGSAWKHLDQFFNGYYLQHYTVSEVSKDYRKLVTEFSKMGLFENRGVGVYFQLFSVAMLF  125

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +S+YGV+  +  W H+ S  L+G  WIQ+GW+GHDSGHY ++  KK++R AQ+L GNCL
Sbjct  126   SLSVYGVLCSDKTWVHLVSGGLMGLGWIQSGWLGHDSGHYQIISNKKINRFAQILTGNCL  185

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+ NHNAHHIACN +++DPD+Q +P FA S+KLF+ SL S +Y++ M+F+   
Sbjct  186   AGISIAWWKRNHNAHHIACNSLEFDPDLQHMPFFAVSSKLFK-SLRSCYYDRKMNFDKFT  244

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM   ARIN+F QS+  +  K+    NR QEILGL++FW+W+P L+S
Sbjct  245   RFLVSYQHWTFYPVMCF-ARINLFAQSFMLLGCKRLRVPNRGQEILGLLVFWIWFPLLVS  303

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER++FVV S  +TGVQ +QF LNH +SS + G   G DW EKQ +G+LDI C  
Sbjct  304   CLPNWGERVLFVVASFSITGVQHVQFCLNHFSSSVYVGTPVGNDWCEKQTNGSLDIVCPS  363

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PR  LRK++P VK+LC+KH + Y   SF  AN L   ++
Sbjct  364   WMDWFHGGLQFQIEHHLFPRLPRGYLRKIAPLVKELCKKHNLPYTSVSFTEANTLTIGTL  423

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEA++++G
Sbjct  424   RAAALQARDLT-SPVPKNLVWEAVHTYG  450



>ref|XP_002279227.1| PREDICTED: delta(8)-fatty-acid desaturase [Vitis vinifera]
Length=447

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/449 (57%), Positives = 341/449 (76%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G +K+I+ EELK+HDKPGDLW+SI GKVY+V+DW   HPGG+ PLL+LAGQDVTDAF+AY
Sbjct  3     GERKYISAEELKQHDKPGDLWISIQGKVYNVTDWAKVHPGGDIPLLNLAGQDVTDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GYY+ D +VSEVSKD+R L +EFS++GLFEKKGH + Y  + +  +
Sbjct  63    HPGTAWQYLDKFFTGYYLKDFKVSEVSKDFRKLANEFSKLGLFEKKGHGILYTCSIIGFL  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F+V +YGV+ ++S W H+G A L+GFLWIQ+ ++GHDSGHY +M +   ++ AQ+L GNC
Sbjct  123   FMVCIYGVLCVDSFWVHLGCAALLGFLWIQSSYLGHDSGHYQIMSSPGFNKLAQMLIGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             +TG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S+ LF  S+ S FY + + F+S+
Sbjct  183   ITGISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSSSLF-DSINSVFYGRILKFDSV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWT+YPVM  +ARIN+F+Q+   +   + I  +RA  I+G+ +FW WYP L+
Sbjct  242   ARFFVSYQHWTYYPVM-CVARINLFLQTLLLLFSGRNI-PDRALNIMGICVFWTWYPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+MFV++S+ +T +Q IQF+LNH +++ + GP  G DW EKQ  GT+DI CS
Sbjct  300   SCLPNWGERVMFVIVSMAVTSIQHIQFTLNHFSANVYVGPPCGNDWFEKQTSGTIDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWFHGGLQFQ+EHHLFPR+PRC LR +SP VK LC+KH + Y   SFW AN    ++
Sbjct  360   AWMDWFHGGLQFQLEHHLFPRLPRCHLRSISPVVKDLCKKHNLPYRSLSFWEANVSTIRT  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARDL+    PKNLVWEA N  G
Sbjct  420   LRTAALQARDLT-NPVPKNLVWEAANIHG  447



>ref|XP_004498883.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Cicer arietinum]
Length=452

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/445 (59%), Positives = 338/445 (76%), Gaps = 4/445 (1%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI  1359
             +I+ +EL+KH+K GD W+SIHGK+YDVS W   HPGGE PLL+LAGQDVTDAFLA HP  
Sbjct  12    YISLQELQKHNKRGDAWISIHGKIYDVSKWSNHHPGGELPLLNLAGQDVTDAFLALHPPT  71

Query  1358  AAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
             A  HL RFF G Y+SD+ VS+VS+DY+ L SE ++MGLFE KGH V    + +  MF VS
Sbjct  72    AYTHLNRFFTGSYLSDYSVSDVSRDYQKLFSELTKMGLFETKGHGVLLLLSLIVVMFCVS  131

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
             +YGV+F +S W  +    L+GFLWIQ+GW+GHDSGHY +M     +R  Q+L+GN L G+
Sbjct  132   VYGVLFSQSAWVRVLCGGLMGFLWIQSGWLGHDSGHYQIMVNPNWNRFIQILSGNVLAGI  191

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
             SI WW+WNHNAHHIA N +D+DPD+Q LP F  S+K F +SL S FY + M+F+S ARFL
Sbjct  192   SIEWWKWNHNAHHIAVNSLDFDPDLQHLPFFVVSSKFF-TSLTSCFYGRKMNFDSFARFL  250

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLP  639
             VSYQHW++YPVM   AR+N+F QS+  +L  +K+  NR  E+LGL++FWVWYP L+S LP
Sbjct  251   VSYQHWSYYPVMCF-ARLNLFAQSFFLLLSNRKV-PNRKMELLGLLMFWVWYPLLVSCLP  308

Query  638   NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
             N  ER++FV+ S  +TG+Q +QF+LNH +SS + GP T  DW EKQ +GTLD++CS WMD
Sbjct  309   NWGERVLFVIASFSVTGIQHVQFTLNHFSSSVYVGPPTAHDWFEKQANGTLDVNCSSWMD  368

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQFQIEHHLFPR+PRC LRK++P VK LC+KH + YN  SFW AN L  +++R+A
Sbjct  369   WFHGGLQFQIEHHLFPRLPRCNLRKIAPLVKDLCKKHNLPYNCVSFWKANVLTIQTLRNA  428

Query  278   ALMARDLSPEKAPKNLVWEALNSFG  204
             AL ARDL+ +  P+NLVWEA+N+ G
Sbjct  429   ALQARDLT-KPVPRNLVWEAVNTHG  452



>ref|XP_010251589.1| PREDICTED: delta(8)-fatty-acid desaturase [Nelumbo nucifera]
Length=446

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/449 (58%), Positives = 342/449 (76%), Gaps = 5/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G +++I+++EL+KH+K GDLW+SI GKVYDV+DWV  HPGG+ PLL+ AGQDVTDAF+AY
Sbjct  3     GERRYISSDELRKHNKAGDLWISIQGKVYDVTDWVKNHPGGDTPLLNFAGQDVTDAFVAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A   L RFF GY + D+ VSEVSKDYR LVS+F++MGLFEKKGH V +    ++ +
Sbjct  63    HPGTAWKLLDRFFIGY-LEDYHVSEVSKDYRKLVSDFTKMGLFEKKGHGVFFSLCFVAMI  121

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F  S+ GV+   +VW H+    ++GF W+Q+GW+GHDS HY  M + +L+R AQ+L GNC
Sbjct  122   FASSVCGVLLSNNVWVHLACGGVMGFFWVQSGWLGHDSAHYQTMLSPRLNRFAQVLIGNC  181

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG S+ WW+W HN HHIACN +D+DPD+Q +P+FA S+K F +SL S+FY + MSF+S+
Sbjct  182   LTGFSMGWWKWIHNGHHIACNSLDFDPDLQHIPLFAVSSKFF-NSLTSYFYGRKMSFDSV  240

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVSYQHWTFYPVM  IARIN+F Q++  +L K+++   R QEI+G++IFW W+P L+
Sbjct  241   ARFLVSYQHWTFYPVMC-IARINLFAQAFLFLLSKRRV-PRRGQEIVGILIFWTWFPLLV  298

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+MF++ SL +TG+Q +QF L+H +S+ + GP +G DW EKQ  GTLDI+C 
Sbjct  299   SCLPNWGERVMFILASLAVTGIQHVQFCLSHFSSAVYLGPPSGNDWFEKQTKGTLDIECP  358

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWFHGGL+FQIEHHLFPR+PRC  RKVSP VK LC+KH + Y   +FW AN     +
Sbjct  359   SWMDWFHGGLEFQIEHHLFPRLPRCHFRKVSPLVKDLCKKHNLPYTSLTFWEANRRTIGT  418

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARDL+    PKNL+WEA+N+ G
Sbjct  419   LRTAALQARDLT-NPVPKNLIWEAVNTHG  446



>gb|AHF70966.1| delta8-sphingolipid desaturase [Populus tomentosa]
Length=447

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/449 (57%), Positives = 339/449 (76%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK IT+EELK+H+K GDLW+SI GKVYDVS+W   HPGG+  L+++AG D TDAF+AY
Sbjct  3     GDKKGITSEELKQHNKAGDLWISIQGKVYDVSEWANEHPGGDVALMNMAGLDATDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L + F GYY++D ++SE SKDYR L SEF+++GLFEKKGH+  Y   ++  M
Sbjct  63    HPGTAWKYLDKLFTGYYLTDFKLSETSKDYRRLASEFAKLGLFEKKGHITMYALTSIVLM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F   LYGV+  +SVWAH GSAV++GFLWIQ+ ++GHDSGHY VM T+  ++ AQ LAGN 
Sbjct  123   FCAVLYGVLCCQSVWAHFGSAVVLGFLWIQSAYIGHDSGHYQVMNTRGYNKLAQFLAGNS  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA  N +F +S+ S FY + ++F+ +
Sbjct  183   LTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAV-NSIFFNSIKSCFYGRYLNFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWTFYPVM  +AR+N++IQ++  +LF K+ F +RA  ILG++IFW W+P L+
Sbjct  242   ARFFVSYQHWTFYPVM-CVARVNLYIQTF-LLLFSKRRFPDRALNILGILIFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S +PN  ER+MFV+ S  +T +Q +QF LNH A+  + G   G DW EKQ  GTLDI CS
Sbjct  300   SCIPNWPERVMFVLTSFAVTAIQHVQFCLNHFAADVYTGLPEGNDWFEKQTSGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPRMPR QLR+VSP V+ LC+KH ++Y   SFW AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRMPRSQLRRVSPLVQDLCKKHNLSYRSLSFWEANVWTIRK  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+ AL ARDL+    PKN++WEA+N+ G
Sbjct  420   LRNVALQARDLA-NPVPKNMLWEAVNTHG  447



>gb|EYU20353.1| hypothetical protein MIMGU_mgv1a027096mg [Erythranthe guttata]
Length=447

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 337/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELK H+K GDLW+SI GKVYDVS+WV  HPGG+ PLL LAGQD TDAF+A+H 
Sbjct  5     KKYITSEELKTHNKKGDLWISIQGKVYDVSEWVKHHPGGDLPLLHLAGQDATDAFVAFHR  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A   L+++ NG ++ D+ VS+VSKDYR L  EFS+MGLFEKKGH +     ++  M  
Sbjct  65    GAAWQFLEKYSNGLHLKDYSVSDVSKDYRKLAYEFSKMGLFEKKGHGLFISICSIVVMLA  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
              +LYGV+  +  W H     L+GFLWIQ+GW+GHDSGHY VM T KL+R AQ+L+GNCL 
Sbjct  125   ATLYGVLCHDGAWLHFLCGCLMGFLWIQSGWIGHDSGHYQVMLTPKLNRFAQILSGNCLA  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +D+DPD+Q +P FA S+K F +SL+S++Y++ + F+S  R
Sbjct  185   GISIAWWKRNHNAHHIACNSLDHDPDLQHMPFFAVSSKFF-NSLVSYYYDRTLKFDSFTR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LV  QHWTFYPVM L ARIN+F QS   +L  KKI   R  EI+G+ +FW+WYP L+S 
Sbjct  244   MLVKNQHWTFYPVMCL-ARINLFAQSIILLLSNKKI-PYRYSEIIGVTVFWIWYPLLVSC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SER++FV+ S  +TGVQ +QF LNH +S  + GP  G DW EKQ  G+LDI+CS W
Sbjct  302   LPNWSERVLFVLASFAVTGVQHVQFCLNHFSSPVYVGPPKGNDWFEKQTMGSLDIECSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQIEHHLFPR+PR QLR ++PFVK LC+KHG+ YN ASF  AN +  K++R
Sbjct  362   MDWFHGGLQFQIEHHLFPRLPRNQLRTIAPFVKDLCKKHGLPYNCASFLEANFMTIKTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             DAA+ ARDL+   APKNLVWEA+N+ G
Sbjct  422   DAAMQARDLT-NPAPKNLVWEAVNTHG  447



>ref|NP_182144.1| Fatty acid/sphingolipid desaturase [Arabidopsis thaliana]
 sp|Q3EBF7.1|SLD2_ARATH RecName: Full=Delta(8)-fatty-acid desaturase 2; AltName: Full=Delta(8)-sphingolipid 
desaturase 2; AltName: Full=Sphingoid 
long-chain base desaturase 2; Short=Sphingoid LCB desaturase 
2 [Arabidopsis thaliana]
 pir||A84900 hypothetical protein At2g46210 [imported] - Arabidopsis thaliana
 gb|AAC62885.1| putative fatty acid desaturase/cytochrome b5 fusion protein [Arabidopsis 
thaliana]
 gb|AEC10657.1| Fatty acid/sphingolipid desaturase [Arabidopsis thaliana]
Length=449

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/447 (57%), Positives = 335/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+++T+E+LKKH+KPGDLW+SI GKVYDVSDWV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRYVTSEDLKKHNKPGDLWISIQGKVYDVSDWVKSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL++  NGY+V DH VS+VS+DYR L +EFS+ GLF+KKGH+  Y    +  M  
Sbjct  67    GTAWHHLEKLHNGYHVRDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVGVMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   S+WAH+ SAVL+G LWIQ+ +VGHDSGHY V  TK  ++  QLL+GNCLT
Sbjct  127   AVLYGVLACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYTVTSTKPCNKLIQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +PIFA S K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHIACNSLDHDPDLQHIPIFAVSTKFF-NSMTSRFYGRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  + RIN+FIQ++  +LF K+   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWTFYPVM-CVGRINLFIQTF-LLLFSKRHVPDRALNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER +FV +S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERFIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSF  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP VK+LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHNLPYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AA+ ARD +     KNL+WEA+N+ G
Sbjct  424   NAAIQARD-ATNPVLKNLLWEAVNTHG  449



>gb|ABU98945.1| delta-8 lipid desaturase [Stylosanthes hamata]
Length=455

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/447 (59%), Positives = 341/447 (76%), Gaps = 7/447 (2%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
              +I+ EEL+KH+ P DLW+SIHGKVY+V++W+  HPGG  PLL+LAGQDVTDAFLA+HP 
Sbjct  15    NYISLEELRKHNTPQDLWISIHGKVYNVTNWLQHHPGGSLPLLNLAGQDVTDAFLAFHPK  74

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEK-KGHLVSYYAAALSAMFL  1185
              A++ L  FF G Y+ +H VSEVS+DYR L+S F+RMGLFE+ +G + S +      MF 
Sbjct  75    HASNLLHPFFTGIYLQNHTVSEVSRDYRNLLSTFTRMGLFERNRGVVASLFFIFF--MFC  132

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             VS+YGV+F ++    +GS  L+GFLWIQ+GW+GHDSGHY ++ +KKL+R  Q+L+GN L 
Sbjct  133   VSVYGVLFGQTALVRVGSGGLMGFLWIQSGWIGHDSGHYMIVGSKKLNRVLQILSGNVLA  192

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN +D+DPD+Q LP F  S++ F +S+ S FYE+ M F+S +R
Sbjct  193   GISIGWWKWNHNAHHIACNSLDFDPDLQHLPFFVVSSRFF-NSIFSCFYERLMKFDSFSR  251

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM   AR+N+F QS+  +LF  +   +R  EILGLI FW+WYP L+S 
Sbjct  252   FLVSYQHWTFYPVMCF-ARLNLFAQSF-ILLFSNRKVPDRGTEILGLIAFWIWYPLLVSC  309

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERI+FV+ S  +TG+Q IQF LNH ++  + GP T  DW EKQ +GTLD+  S W
Sbjct  310   LPNWGERILFVLASFSVTGIQHIQFCLNHFSAKVYVGPPTATDWCEKQCNGTLDVSSSSW  369

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LR++SPFVK+LC+KH + YN  SFW AN L  +++R
Sbjct  370   MDWFHGGLQFQVEHHLFPRLPRCHLRRISPFVKELCKKHNLPYNCVSFWKANVLTIRTLR  429

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARD+S    PKNLVWEA+N+ G
Sbjct  430   NAALQARDVS-SPVPKNLVWEAVNTHG  455



>gb|AAM94345.1| delta-6-desaturase [Argania spinosa]
Length=448

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/447 (58%), Positives = 339/447 (76%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++ELK HDKPGDLW+SI GK YDVSDWV  HPGG +PL SLAGQ+VTDAF+A+HP
Sbjct  6     KKYITSDELKNHDKPGDLWISILGKAYDVSDWVTDHPGGSFPLKSLAGQEVTDAFVAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A    +L +FF GYY+ D+ VSEVSKDY  LV EFS+MGL++K GH++      ++ +F 
Sbjct  66    ASTWKNLDKFFTGYYLKDYSVSEVSKDYSKLVFEFSKMGLYDKAGHIMFATLCFIAMLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+  E V  H+ S  L+GFLWIQ+GW+GHD GHY V+   +L++   + A NCL+
Sbjct  126   MSVYGVLRCEGVLVHLFSGCLMGFLWIQSGWIGHDPGHYMVVSDSRLNKFMGIFAANCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI W +WNHNAHHIACN ++YDPD+Q +P    S+K F  SL SHFYEK ++ +SL+R
Sbjct  186   GISIGWSKWNHNAHHIACNSLEYDPDLQYIPFLVVSSKFF-GSLTSHFYEKRLTIDSLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQHWTFY +M   AR+NM++QS   +L K+ + + RA E+LG ++F +WYP L+S 
Sbjct  245   FFVSYQHWTFYTIM-CAARLNMYVQSLIMLLTKRNV-SYRAHELLGCLVFSIWYPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERIMFV+ SL +TG+QQ+QFSLNH +SS + G   G +W E Q DGTLDI C PW
Sbjct  303   LPNWGERIMFVIASLSVTGMQQVQFSLNHFSSSVYVGKPNGNNWFETQTDGTLDISCPPW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQIEHHLFP+MPRC LR +SP+V +LC+KH + YN+ASF  AN +  +++R
Sbjct  363   MDWFHGGLQFQIEHHLFPKMPRCNLRTISPYVIELCKKHNLPYNYASFSKANEMTLRTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             + AL ARD++ +  PKNLVWEAL++ G
Sbjct  423   NTALQARDIT-KPLPKNLVWEALHTHG  448



>ref|XP_010053767.1| PREDICTED: delta(8)-fatty-acid desaturase 2 [Eucalyptus grandis]
Length=447

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/447 (58%), Positives = 328/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EEL+KH  PGDLW+SI GKVYDV++W  RHPGGE PL +LAGQDVTDAFLAYHP
Sbjct  5     KKYITAEELRKHSTPGDLWISIRGKVYDVTEWAERHPGGEIPLRTLAGQDVTDAFLAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL+  + GY V D   SEVSKDYR L +E +R+G+FEKKGH+      A++ M  
Sbjct  65    VSAWQHLEGLYTGYRVRDFAPSEVSKDYRRLHAELARLGMFEKKGHIAVCALTAIALMLS  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGVV  E V  H   AVL+G LWIQ  ++GHDSGHY VM T   ++  QLLAGNCLT
Sbjct  125   LCVYGVVACEGVAVHFLCAVLLGLLWIQGAYMGHDSGHYQVMTTTGCNQITQLLAGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q +P+FA S++ F +SL S FY + + F+S+AR
Sbjct  185   GISIAWWKWTHNAHHLACNSLDHDPDLQHIPVFAVSSRFF-NSLTSIFYGRKLQFDSVAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQHWTFYPVM  + RIN+FIQ++  +LF K+   +RA  ILG+++FW W+P L+S 
Sbjct  244   LLVSYQHWTFYPVM-CVGRINLFIQTF-LLLFSKRKVPDRALNILGILVFWTWFPLLVSF  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP  SER MFVV SL +T +Q IQF LNH +++ + GP  G DW EKQ  GT+DI C  W
Sbjct  302   LPTWSERAMFVVTSLSVTAIQHIQFCLNHFSANVYMGPPNGSDWFEKQTGGTIDISCPTW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLR +SP  + LC+KH + Y   SFW AN    +++R
Sbjct  362   MDWFHGGLQFQLEHHLFPRLPRCQLRGISPLARDLCKKHNLPYRSLSFWDANISTLRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDLS    PKNLVWEA+N+ G
Sbjct  422   TAALQARDLS-SPVPKNLVWEAVNTHG  447



>ref|XP_004138473.1| PREDICTED: delta(8)-fatty-acid desaturase-like isoform 1 [Cucumis 
sativus]
 ref|XP_004138474.1| PREDICTED: delta(8)-fatty-acid desaturase-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159774.1| PREDICTED: delta(8)-fatty-acid desaturase-like isoform 1 [Cucumis 
sativus]
 ref|XP_004159775.1| PREDICTED: delta(8)-fatty-acid desaturase-like isoform 2 [Cucumis 
sativus]
 gb|KGN45699.1| hypothetical protein Csa_6G006850 [Cucumis sativus]
Length=447

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 337/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EEL KH+KPGDLW+SI GKVY+V++W   HPGG+ P ++LAG DVTDAF+AYHP
Sbjct  5     KKYITSEELLKHNKPGDLWISIQGKVYNVTEWAKEHPGGDTPFINLAGHDVTDAFIAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L R F G+++ D QVSE+SKDYR L SEFS+ GLFEKKGH+  Y   +++ M  
Sbjct  65    GTAWAYLDRLFTGFHLKDFQVSEISKDYRKLASEFSKQGLFEKKGHVTMYSLISVAVMMF  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGV+  ESV  H+G A+++G LWIQ+ +VGHDSGH +VM ++  ++ AQ+L+GNCLT
Sbjct  125   LVVYGVLKSESVLVHLGCAMILGMLWIQSAYVGHDSGHSNVMSSRGFNKLAQILSGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHI+CN +D+DPD+Q +P+FA S   FR +L SHFY + + F+SLAR
Sbjct  185   GISIAWWKWTHNAHHISCNSLDHDPDLQHIPVFAVSTSFFR-TLTSHFYGRKLEFDSLAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+TFYPVM  +AR+N+F+Q+   +LF  +   +RA  I+G+++FW W+P L+S 
Sbjct  244   FFVSYQHFTFYPVM-CVARVNLFVQTL-LLLFSTRKVPDRALNIMGILVFWTWFPLLVSY  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFV+ S  +  +Q IQF LNH +++ + G  TG DW EKQ  GTLDI CS W
Sbjct  302   LPNWPERVMFVLASFAVCSLQHIQFCLNHFSANVYVGKPTGNDWFEKQASGTLDISCSTW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPRMPRCQLRK+SP V +LC+KH + Y   SFW AN    +++R
Sbjct  362   MDWFFGGLQFQLEHHLFPRMPRCQLRKISPIVVELCKKHNLPYRSLSFWDANVRTIRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    PKNL+WEA+N+ G
Sbjct  422   TAALQARDLT-NPVPKNLLWEAVNTHG  447



>ref|XP_010506617.1| PREDICTED: delta(8)-fatty-acid desaturase 2 [Camelina sativa]
Length=449

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/447 (57%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+++TTE+LKKH++PGDLW+SI GKVYDVS+WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRYVTTEDLKKHNQPGDLWISIQGKVYDVSNWVKTHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL++  NGY+V D  VSEVS+DYR L ++FS+ GLF+KKGH+  Y    +  M  
Sbjct  67    GTAWHHLEKLHNGYHVKDFHVSEVSRDYRRLAADFSKRGLFDKKGHVTLYTLTCVGVMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGVV   SVWAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNCLT
Sbjct  127   AVLYGVVACTSVWAHLISAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKLIQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q +PIFA S K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHMACNSLDHDPDLQHIPIFAVSTKFF-NSMTSRFYGRELTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  + RIN+FIQ++  +LF K+   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWTFYPVM-CVGRINLFIQTF-LLLFSKRHVPDRAMNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER +FV +S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERFIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP VK+LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHDLPYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AA+ ARD++     KNL+WEA+N+ G
Sbjct  424   NAAIQARDVT-NPVLKNLLWEAVNTHG  449



>ref|XP_010915755.1| PREDICTED: delta(8)-fatty-acid desaturase 2 [Elaeis guineensis]
Length=450

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/447 (60%), Positives = 344/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +++IT+ EL+ H+ PGDLW+SI GKVYDV+ WV  HPGG+ PLL+LAGQDVTDAF+AYHP
Sbjct  8     RRYITSAELRGHNTPGDLWISIQGKVYDVTRWVKDHPGGDIPLLNLAGQDVTDAFVAYHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A     L RFF GY ++D++VS VSKDYR LV+EF+R+GLF+KKGH V +    +S +FL
Sbjct  68    ATTWTLLDRFFIGY-LADYRVSAVSKDYRRLVAEFARLGLFDKKGHGVLFSLIFMSFIFL  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             VS+ GV+       H+ S +L+G LWIQ+G++GHDSGHY+VM +   +R  Q+L+GNCLT
Sbjct  127   VSVSGVLLSTDASVHLISGLLMGLLWIQSGFLGHDSGHYNVMISPGFNRLMQILSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +D+DPDVQ +P+FA S+K F +SL S+FYE+ ++FNS+AR
Sbjct  187   GISIGWWKRNHNAHHIACNSLDFDPDVQHIPLFAVSSKFF-NSLTSYFYERKLAFNSVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM  +AR+N+F QS   +L KKK    R QEI+G  IFW+WYP LLS+
Sbjct  246   FLVSYQHWTFYPVMC-VARVNLFAQSALLLLSKKKKVPGRWQEIVGCTIFWIWYPLLLSA  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER MFV  +  +TG+Q +QF LNH ++S + G   G DW EKQ  GTLDI CSPW
Sbjct  305   LPNWTERAMFVAANFAVTGIQHVQFCLNHFSASVYVGQPRGNDWFEKQTMGTLDILCSPW  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LR++SP+V++LC KH + Y  ASFW AN     ++R
Sbjct  365   MDWFHGGLQFQVEHHLFPRLPRCHLRRISPYVEELCRKHRLPYTAASFWDANLRTIATLR  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+ +  PKNLVWEA+N+ G
Sbjct  425   TAALQARDLT-KPVPKNLVWEAVNTHG  450



>ref|XP_008458161.1| PREDICTED: delta(8)-fatty-acid desaturase [Cucumis melo]
Length=447

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/447 (57%), Positives = 338/447 (76%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EEL KH+KPGDLW+SI GKVY+V++W   HPGG+ P L+LAG DVTDAF+AYHP
Sbjct  5     KKYITSEELLKHNKPGDLWISIQGKVYNVTEWAKVHPGGDTPFLNLAGHDVTDAFIAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L R F G+++ D QVSE+SKDYR L SEFS+ GLFEKKGH++ Y   +++ M  
Sbjct  65    GTAWAYLDRLFTGFHLKDFQVSEISKDYRKLASEFSKQGLFEKKGHVIMYSLISVAVMMF  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGV+  ESV  H+G A+++G LWIQ+ +VGHDSGH +VM ++  ++ AQ+L+GNCLT
Sbjct  125   LVVYGVLKSESVLVHLGCAMILGMLWIQSAYVGHDSGHSNVMSSRGFNKLAQILSGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHI+CN +D+DPD+Q +P+FA S   FR +L SHFY + + F+SLAR
Sbjct  185   GISIAWWKWTHNAHHISCNSLDHDPDLQHIPVFAVSATFFR-TLTSHFYGRKLKFDSLAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+TFYPVM  +AR+N+F+Q+   +LF  +   +RA  I+G+++FW W+P L+S 
Sbjct  244   FFVSYQHFTFYPVM-CVARVNLFVQT-LLLLFSTRKVPDRALNIMGILVFWTWFPLLVSY  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFV+ S  +  +Q IQF LNH +++ + G  TG DW EKQ  GTLDI CS W
Sbjct  302   LPNWPERVMFVLASFAVCSLQHIQFCLNHFSANVYVGKPTGNDWFEKQTSGTLDISCSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPRMPRCQLRK+SP V +LC+KH + Y   SFW AN    +++R
Sbjct  362   MDWFFGGLQFQLEHHLFPRMPRCQLRKISPIVVELCKKHNLPYRSLSFWDANVRTIRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    PKNL+WEA+N+ G
Sbjct  422   TAALQARDLT-NPVPKNLLWEAVNTHG  447



>ref|XP_003517965.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Glycine max]
Length=450

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/447 (58%), Positives = 346/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELK H+K GDLW+SI GKVY+VSDWV  HPGG+ P+ +LAGQDVTDAF+AYHP
Sbjct  8     KKYITSEELKGHNKEGDLWISIQGKVYNVSDWVKEHPGGDVPISNLAGQDVTDAFIAYHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL++FF GY++SD +VSEVSKDYR L SEFS++GLF+ KGH+ S   A+++ MFL
Sbjct  68    GTAWSHLEKFFTGYHLSDFKVSEVSKDYRKLASEFSKLGLFDTKGHVTSCTLASVAVMFL  127

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + LYGV+   SVWAH+GS +L+G LW+Q+ +VGHDSGHY VM T   ++ AQ+L+GNCLT
Sbjct  128   IVLYGVLRCTSVWAHLGSGMLLGLLWMQSAYVGHDSGHYVVMTTNGFNKVAQILSGNCLT  187

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S++ F +S+ SHFY + + F+ +AR
Sbjct  188   GISIAWWKWTHNAHHIACNSLDHDPDLQHMPVFAVSSRFF-NSITSHFYGRKLEFDFIAR  246

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+ YQH+TFYPVM  +AR+N+++Q+   +LF ++   +RA  I+G+++FW W+P L+S 
Sbjct  247   FLICYQHFTFYPVM-CVARVNLYLQT-ILLLFSRRKVQDRALNIMGILVFWTWFPLLVSC  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFV+ S  +  +Q IQF LNH A++ + GP +G DW EKQ  GTLDI C+  
Sbjct  305   LPNWPERVMFVLASFAVCSIQHIQFCLNHFAANVYVGPPSGNDWFEKQTSGTLDISCASS  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRCQLRK+SP V  LC+KH + Y   SFW AN    +++R
Sbjct  365   MDWFFGGLQFQLEHHLFPRLPRCQLRKISPLVSDLCKKHNLPYRSLSFWEANQWTIRTLR  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+   APKNL+WEA+N+ G
Sbjct  425   TAALQARDLT-NPAPKNLLWEAVNTHG  450



>ref|XP_006294209.1| hypothetical protein CARUB_v10023205mg [Capsella rubella]
 gb|EOA27107.1| hypothetical protein CARUB_v10023205mg [Capsella rubella]
Length=449

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/447 (57%), Positives = 335/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+++T+E+LKKHD+PGDLW+SI GKVYDVSDWV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRYVTSEDLKKHDQPGDLWISIQGKVYDVSDWVKSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL++  NGY+V D  VS+VS+DYR L +EFS+ GLF+KKGH+  Y    +  M  
Sbjct  67    GTAWHHLEKLHNGYHVRDFHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVGVMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SVWAH+ SAVL+G LWIQ+ +VGHDSGHY V  TK  ++  QLL+GNCLT
Sbjct  127   AVLYGVLACTSVWAHLISAVLLGLLWIQSAYVGHDSGHYTVTSTKPCNKLIQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q +PIFA S K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHMACNSLDHDPDLQHIPIFAVSTKFF-NSMTSRFYGRTLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  + RIN+FIQ++  +LF K+   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWTFYPVM-CVGRINLFIQTF-LLLFSKRHVPDRALNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER +FV +S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERFIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP VK+LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHNLPYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AA+ ARD++     KNL+WEA+N+ G
Sbjct  424   NAAIQARDVT-NPVLKNLLWEAVNTHG  449



>ref|XP_009415167.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Musa acuminata 
subsp. malaccensis]
Length=450

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 337/448 (75%), Gaps = 5/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              K++IT EEL+KH+   DLW+ I GKVYDV+ WV  HPGG+ PLLSLAGQD T+AF+AYH
Sbjct  8     AKRYITAEELRKHNTASDLWICIQGKVYDVTSWVEDHPGGDLPLLSLAGQDATNAFVAYH  67

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             PA A  HL RFF G+ ++D++VS  S DYR LV+EFS+ GLF++KG +      ++  + 
Sbjct  68    PASAWAHLGRFFVGH-LADYRVSAASSDYRRLVAEFSKSGLFDQKGLVAPLTICSILVLL  126

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
             + ++ GV+  E    H     ++GFLWIQ GW+GHDSGHY ++   +L+R AQ++AGNCL
Sbjct  127   VAAVSGVLLSEGALVHALCGGMMGFLWIQTGWMGHDSGHYRIVGHPRLNRLAQIVAGNCL  186

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              GVSI WW+ NHNAHHIACN +D+DPD+Q +P FA S+KLF +S+ S+FYE+ M+F+++A
Sbjct  187   AGVSIAWWKRNHNAHHIACNSLDFDPDLQHMPFFAVSSKLF-ASMKSYFYERKMNFDAVA  245

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM   ARIN+F QS   +L  KK+  NR QEILG+ +FW+WYP L+S
Sbjct  246   RFLVSYQHWTFYPVMCF-ARINLFAQSILLLLSAKKV-PNRWQEILGVAVFWIWYPLLVS  303

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVV S  +TG+Q +QF LNH +SS + GP  G DW EKQ  GTLDI CSP
Sbjct  304   CLPNWGERVMFVVASFAVTGIQHVQFCLNHFSSSVYVGPPQGTDWFEKQTMGTLDISCSP  363

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+ HHLFPR+PRC LRKVSPFV++LC+KH + YN ASFW ANA+  +++
Sbjct  364   WMDWFHGGLQFQVAHHLFPRLPRCHLRKVSPFVRELCKKHKLPYNIASFWEANAMTIRTL  423

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARD      PKNLVWEA+N+ G
Sbjct  424   RAAALRARDFE-NPVPKNLVWEAVNTHG  450



>ref|XP_003588984.1| Delta-6-desaturase [Medicago truncatula]
 gb|AES59235.1| fatty acid/sphingolipid desaturase [Medicago truncatula]
Length=453

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/445 (58%), Positives = 336/445 (76%), Gaps = 4/445 (1%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI  1359
             +I+ +EL+KH+  GD W+SI GK+YDVS W   HPGGE PLL+LAGQDVTDAFLA+HP  
Sbjct  13    YISLQELQKHNTRGDAWISIDGKIYDVSKWANHHPGGELPLLNLAGQDVTDAFLAFHPPS  72

Query  1358  AAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
             A  HLQ F  G Y+ D+ VS+VS+DYR L SE +++GLFE+KGH V    + +S MF VS
Sbjct  73    AYKHLQNFATGSYLRDYVVSDVSRDYRALFSELTKLGLFEEKGHGVLLLLSIISVMFFVS  132

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
             +YGV+F +S   H+ S  L+G LWIQ+GW+GHDSGHY VM  +K ++  Q+L+GN L G+
Sbjct  133   VYGVLFCDSAVVHVLSGGLMGLLWIQSGWIGHDSGHYQVMVNRKWNQFMQILSGNVLAGI  192

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
             SI WW+WNHNAHH+ACN +D+DPD+Q LP F  S+K F +SL S FY + M+F+S ARFL
Sbjct  193   SIEWWKWNHNAHHLACNSLDFDPDLQHLPFFVVSSKFF-TSLTSCFYGRKMNFDSFARFL  251

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLP  639
             VSYQHW++YPVM   AR+N+F QS+  +LF  +   NR  E+LGL +FW+WYP L+S LP
Sbjct  252   VSYQHWSYYPVMCF-ARLNLFAQSF-FLLFSNRKVPNRKMELLGLALFWIWYPLLVSCLP  309

Query  638   NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
             N  ER++FV+ S  +TG+Q +QF+LNH ++S + GP T  DW EKQ  GTLD+ CS WMD
Sbjct  310   NWGERVLFVLASFCVTGIQHVQFTLNHFSASVYVGPPTAHDWFEKQAHGTLDVKCSSWMD  369

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQFQIEHHLFPR+PRC LRK+SP VK LC+KH + YN  SFW AN L  +++R+A
Sbjct  370   WFHGGLQFQIEHHLFPRLPRCNLRKISPLVKDLCKKHNLPYNCVSFWKANVLTIQTLRNA  429

Query  278   ALMARDLSPEKAPKNLVWEALNSFG  204
             AL ARDL+ +  P+NLVWEA+N+ G
Sbjct  430   ALQARDLT-KPVPRNLVWEAVNTHG  453



>ref|XP_010518286.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Camelina sativa]
Length=449

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/447 (57%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+++TTE+LKKH++PGDLW+SI GKVYDVS+WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRYVTTEDLKKHNQPGDLWISIQGKVYDVSNWVKTHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL++  NGY+V D  VS+VS+DYR L ++FS+ GLF+KKGH+  Y    +  M  
Sbjct  67    GTAWHHLEKLHNGYHVKDFHVSDVSRDYRRLAADFSKRGLFDKKGHVTLYTLTCVGVMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGVV   SVWAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNCLT
Sbjct  127   AVLYGVVVCTSVWAHLVSAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKLIQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q +PIFA S K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHMACNSLDHDPDLQHIPIFAVSTKFF-NSMTSRFYGRELTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  + RIN+FIQ++  +LF K+   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWTFYPVM-CVGRINLFIQTF-LLLFSKRHVPDRAMNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER +FV +S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERFIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP VK+LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHDLPYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AA+ ARD++     KNL+WEA+N+ G
Sbjct  424   NAAIQARDVT-NPVLKNLLWEAVNTHG  449



>gb|KHN01208.1| Fatty acid desaturase 2 [Glycine soja]
Length=450

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/447 (58%), Positives = 345/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELK H+K GDLW+SI GKVY+VSDWV  HPGG+ P+L+LAGQDVTDAF+AYHP
Sbjct  8     KKYITSEELKGHNKEGDLWISIQGKVYNVSDWVKEHPGGDVPILNLAGQDVTDAFIAYHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL +FF GY++SD +VSEVSKDYR L SEFS++GLF+ KGH+ S   A+++ MFL
Sbjct  68    GTAWSHLDKFFTGYHLSDFKVSEVSKDYRKLASEFSKLGLFDTKGHVTSCTLASVAVMFL  127

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + LYGV+   SVWAH+GS +L+G LW+Q+ +VGHDSGHY VM T   ++ AQ+L+GNCLT
Sbjct  128   IVLYGVLRCTSVWAHLGSGMLLGLLWMQSAYVGHDSGHYVVMTTNGFNKVAQILSGNCLT  187

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S++ F +S+ SHFY + + F+ +AR
Sbjct  188   GISIAWWKWTHNAHHIACNSLDHDPDLQHMPVFAVSSRFF-NSITSHFYGRKLEFDFIAR  246

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+ YQH+TFYPVM  +AR+N+++Q+   +LF ++   +RA  I+G+++FW W+P L+S 
Sbjct  247   FLICYQHFTFYPVM-CVARVNLYLQT-ILLLFSRRKVQDRALNIMGILVFWTWFPLLVSC  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFV+ S  +  +Q IQF LNH A++ + GP +G DW EKQ  GTLDI C+  
Sbjct  305   LPNWPERVMFVLASFAVCSIQHIQFCLNHFAANVYVGPPSGNDWFEKQTSGTLDISCASS  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRCQLR +SP V  LC+KH + Y   SFW AN    +++R
Sbjct  365   MDWFFGGLQFQLEHHLFPRLPRCQLRNISPLVSDLCKKHNLPYRSLSFWEANQWTIRTLR  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+   APKNL+WEA+N+ G
Sbjct  425   TAALQARDLT-NPAPKNLLWEAVNTHG  450



>gb|ACZ51243.1| sphingolipid delta-8 desaturase [Arachis hypogaea]
Length=448

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/449 (58%), Positives = 338/449 (75%), Gaps = 7/449 (2%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +  +I+ EEL KH+KP DLW+SIHGKVY+V++W+  HPGG  PLL+LAGQDVTDAFLA+H
Sbjct  6     STNYISREELSKHNKPQDLWISIHGKVYNVTNWLQYHPGGASPLLNLAGQDVTDAFLAFH  65

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFE-KKGHLVSYYAAALSAM  1191
             P  A + LQ FF G Y+++H VSE S+DYR L+S F+RMGLF+  +G L S     +  M
Sbjct  66    PNHAFNRLQPFFTGSYLANHNVSEASRDYRNLLSTFTRMGLFDHNRGVLTSL--VFIFIM  123

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F + +Y V+F ++    +GS  L+GFLWIQ+GW+GHDSGHY ++ +KKL+R  Q+L+GN 
Sbjct  124   FCLCVYAVLFAQTGLVRVGSGALMGFLWIQSGWIGHDSGHYKIVSSKKLNRVLQILSGNV  183

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             L G+SI WW+WNHNAHHIA N +D+DPD+Q LP F  S++ F +SL S FYE+ M F+S 
Sbjct  184   LAGISIGWWKWNHNAHHIAVNSLDFDPDLQHLPFFVVSSRFF-NSLFSCFYERIMKFDSF  242

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             +R LVSYQHWTFYPVM   AR+N+F QS+  +   +K+  +R  EILGLI FW+WYP L+
Sbjct  243   SRLLVSYQHWTFYPVMCF-ARLNLFAQSFMLLSSNRKV-PDRGTEILGLIAFWIWYPCLV  300

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ERI+FV+ S  +TG+Q +QF LNH ++  + GP T  DW EKQ +GTLD+ CS
Sbjct  301   SCLPNWGERILFVLASFSVTGIQHVQFCLNHFSAKVYVGPPTATDWCEKQCNGTLDVSCS  360

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWFHGGLQFQ+EHHLFPR+PRC LRK+SPFVK LC+KH + YN  SFW ANAL  ++
Sbjct  361   SWMDWFHGGLQFQVEHHLFPRLPRCHLRKISPFVKDLCKKHNLPYNCVSFWKANALTIRT  420

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +RDAAL ARD+S    PKNLVWEA+N+ G
Sbjct  421   LRDAALQARDVS-NPVPKNLVWEAVNTHG  448



>ref|XP_008232958.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Prunus mume]
Length=447

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/449 (57%), Positives = 335/449 (75%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G +K+IT EELK+H+KPGDLW+SI GKVY+VSDW   HPGG+  L +LAGQDVTDAF+AY
Sbjct  3     GERKYITCEELKEHNKPGDLWISIQGKVYNVSDWAKDHPGGDTILFNLAGQDVTDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L + F G+Y+ D +VSEVSKDYR + SEFSR+GLFEKKGH   Y    ++ +
Sbjct  63    HPGTAWQYLDKLFTGFYLKDFKVSEVSKDYRRMASEFSRLGLFEKKGHGAMYSILIITTL  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H+   +++G LWI+  ++GHD+GHY +M ++K +  AQ+LAGNC
Sbjct  123   LHLVVYGVLKSESVLVHLVCGMMLGALWIEGAYIGHDAGHYQIMSSRKCNDIAQILAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F +S+ S FY + + F+ +
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSTKFF-NSITSIFYGRELKFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFL+SYQH+T+YPVM ++ R+N+FIQ++  +LF +    NRA  I+G+++FW W+P L+
Sbjct  242   ARFLISYQHFTYYPVM-VVGRVNLFIQTF-LLLFSRGNVPNRALNIMGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LP  +ER+MFVV S  +T +Q IQF+LNH +   + GP T  DW EKQ  GTLDI CS
Sbjct  300   SCLPTWNERVMFVVASFTVTALQHIQFTLNHFSGDTYLGPPTSNDWFEKQAAGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF GGLQFQ+EHHLFPR+PRCQLR +SP VK+LC+KH + Y   SFW AN    ++
Sbjct  360   TWMDWFFGGLQFQLEHHLFPRLPRCQLRTISPTVKELCKKHNLPYRSLSFWEANKSTIRT  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARDLS    PKNLVWEALN+ G
Sbjct  420   LRTAALQARDLS-NPVPKNLVWEALNTHG  447



>ref|XP_010544777.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Tarenaya hassleriana]
Length=450

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 333/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+E+LKKH++PGDLW+SI GKVYDV+DWV  HPGG+ P+ +LAGQDVTDAF+AYHP
Sbjct  8     KKYITSEDLKKHNQPGDLWISIQGKVYDVTDWVKSHPGGDAPIRNLAGQDVTDAFIAYHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL + F GY++ D  VS++S+DYR + +EF+++GLFE KGH+       +  MF+
Sbjct  68    GTAWAHLDKLFTGYHLRDFHVSDISRDYRRMATEFTKLGLFENKGHVTVCTLTGVFLMFI  127

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SVWAH  SAV++G LWIQ+ +VGHDSGHY+VM ++  ++ AQLL+GNCLT
Sbjct  128   AVLYGVLACSSVWAHFLSAVVLGLLWIQSAYVGHDSGHYNVMTSRGYNKLAQLLSGNCLT  187

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S K F SS+ S FY + + F+ LAR
Sbjct  188   GISIAWWKWTHNAHHIACNSLDHDPDLQHIPVFAVSTKFF-SSMTSKFYGRKLDFDPLAR  246

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM  + R+N+FIQ++  +LF K+    RA  I G+++FW W+P L+S 
Sbjct  247   FLVSYQHWTFYPVM-CVGRVNLFIQTF-LLLFSKRHVPERALNIAGILVFWTWFPLLVSC  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER MFV+ S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  W
Sbjct  305   LPNWPERFMFVLTSFTVTALQHVQFCLNHFAADVYTGPPNGNDWFEKQTGGTLDISCRSW  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR+VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  365   MDWFFGGLQFQLEHHLFPRLPRCHLRRVSPVVRELCKKHNLPYRSLSWWEANVWTIRTLR  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARD +     KNLVWEA+N+ G
Sbjct  425   TAAIQARD-AANPVGKNLVWEAVNTHG  450



>emb|CAA11857.1| delta-8 sphingolipid desaturase [Brassica napus]
Length=449

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+FIT+++LKKH++PGDLW+SI GKVYDVS WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRFITSDDLKKHNQPGDLWISIQGKVYDVSHWVKSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL+   NGY+V DH VS+VS+DYR L +EFS+ GLF+KKGH+  Y    ++AM  
Sbjct  67    GTAWRHLENLHNGYHVKDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVAAMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGVV   S+WAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNC+T
Sbjct  127   AVVYGVVACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKLVQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHI+CN +D+DPD+Q +P+ A SNK F+ S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHISCNSLDHDPDLQHIPVLAVSNKFFK-SMTSRFYGRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHW+FYP+M  + RIN+FIQ+   +LF ++   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWSFYPIM-CVGRINLFIQT-LLLLFSRRYVPDRALNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERI+FV LS+ +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERIIFVFLSMAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRGVSPVVQELCKKHNLPYRSLSWWEANVWTLRTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARD++     +NL+WEALN+ G
Sbjct  424   KAAVQARDVT-NPVLENLLWEALNTHG  449



>ref|XP_010925808.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Elaeis guineensis]
Length=449

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/447 (59%), Positives = 348/447 (78%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +++IT++EL+ H+ P DLW+SI GKVYDV+ WV  HPGG+ PLL+LAGQDVTDAF+A+HP
Sbjct  8     RRYITSKELRGHNNPTDLWISIQGKVYDVTGWVKDHPGGDIPLLNLAGQDVTDAFVAFHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A     L RFF GY ++D++VS VSKDYR LV+EF+R+GLF+KKGH V Y    +  +FL
Sbjct  68    ATTWALLDRFFVGY-LADYRVSAVSKDYRRLVAEFARLGLFDKKGHGVLYSLIFMFILFL  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             VS+ GVVF  + + H+ S +L+G LWIQ+G++GHDSGHY+VM T  ++R  Q+L+GNCLT
Sbjct  127   VSVSGVVFSTNTFVHLMSGLLMGLLWIQSGFLGHDSGHYNVMTTPGINRLMQILSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +++DPDVQ +P+FA S+K F +SL S+FYE+ ++FNS AR
Sbjct  187   GISIGWWKRNHNAHHIACNSLEFDPDVQHIPLFAVSSKFF-NSLTSYFYERKLAFNSFAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM  +AR+N+F QS   +L  KK+   R QE +G ++FW+WYP L+S+
Sbjct  246   FLVSYQHWTFYPVMC-VARVNLFAQSAILLLSNKKV-PGRWQETVGCVVFWIWYPLLVST  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER+MFV  +  +TG+Q +QF LNH ++S + GP    DW EKQ  GTLDI C PW
Sbjct  304   LPNWTERVMFVAANFAVTGIQHVQFCLNHFSASVYVGPPRANDWFEKQTMGTLDILCHPW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LR++SP+VK+LC+KHG+ Y  ASFW AN     ++R
Sbjct  364   MDWFHGGLQFQVEHHLFPRLPRCHLRRISPYVKELCKKHGLPYTAASFWDANVKTIGTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+ +  P+NLVWEA+N+ G
Sbjct  424   TAALQARDLA-KPVPRNLVWEAVNTHG  449



>ref|XP_008802041.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Phoenix dactylifera]
 ref|XP_008802042.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Phoenix dactylifera]
Length=447

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 347/447 (78%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+ I+++EL+KH    DLW+SI GKVYDV+ W+  HPGG+ PL +LAGQDVTDAF+AYHP
Sbjct  6     KRHISSDELRKHVVATDLWISIQGKVYDVTGWLKDHPGGDLPLRNLAGQDVTDAFVAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL RF  G+ +SD+QV++VSKDYR L++EFS+MGLFE KGH+       ++ +F 
Sbjct  66    GSAWKHLDRFLIGH-LSDYQVTDVSKDYRRLLAEFSKMGLFENKGHISGVSLVLIAILFS  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
              ++YGV+F      H+    ++GFLWIQ+GW+GHDSGHY +++  KL+R  Q+L GNCLT
Sbjct  125   AAVYGVLFSSCALVHLVCGGMMGFLWIQSGWMGHDSGHYRIVENAKLNRFTQILTGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +++DPD+Q +P+FA S++LF SSL S +Y++ M+F++ AR
Sbjct  185   GISIAWWKRNHNAHHIACNCLEFDPDLQHMPLFAVSSRLF-SSLTSFYYDRKMNFDAAAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQHWTFYPVM   ARIN+F QS   +L KKK+  N+ QEILGL++FWVWYP L+S 
Sbjct  244   FFVSYQHWTFYPVMCF-ARINLFAQSIVLLLSKKKV-PNKWQEILGLMVFWVWYPLLVSC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFVV S ++TG+Q IQF LNH +SS F GP TG DW EKQ  GTLDI CSPW
Sbjct  302   LPNWGERLMFVVASFVVTGIQHIQFCLNHFSSSVFVGPPTGNDWFEKQTMGTLDISCSPW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LRKV+PFV++LC+KH + Y+ ASFW AN +  +++R
Sbjct  362   MDWFHGGLQFQVEHHLFPRLPRCHLRKVAPFVRELCKKHKLPYSSASFWEANVMTVRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL A+DL+ +  PKNLVWEA+N+ G
Sbjct  422   AAALQAQDLA-KPVPKNLVWEAVNTHG  447



>gb|AFX61788.1| fatty acid desaturase 2a [Musa AB Group]
Length=450

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/448 (58%), Positives = 336/448 (75%), Gaps = 5/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              K++IT EEL+KH+   DLW+ I GKVYDV+ WV  HPGG+ PLLSLAGQD T+AF+AYH
Sbjct  8     AKRYITAEELRKHNTASDLWICIQGKVYDVTSWVEDHPGGDLPLLSLAGQDATNAFVAYH  67

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             PA A  HL RFF G+ ++D++VS  S DYR LV+EFS+ GLF++KG +      ++  + 
Sbjct  68    PASAWAHLGRFFVGH-LADYRVSAASSDYRRLVAEFSKSGLFDQKGLVAPLTICSILVLL  126

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
             + ++ GV+  E    H     ++G LWIQ GW+GHDSGHY ++   +L+R AQ++AGNCL
Sbjct  127   VAAVSGVLLSEGALVHALCGGMMGVLWIQTGWIGHDSGHYRIVGHPRLNRLAQIVAGNCL  186

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              GVSI WW+ NHNAHHIACN +D+DPD+Q +P FA S+KLF +S+ S+FYE+ M+F+++A
Sbjct  187   AGVSIAWWKRNHNAHHIACNSLDFDPDLQHMPFFAVSSKLF-ASMKSYFYERKMNFDAVA  245

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHWTFYPVM   ARIN+F QS   +L  KK+  NR QEILG+ +FW+WYP L+S
Sbjct  246   RFLVSYQHWTFYPVMCF-ARINLFAQSILLLLSAKKV-PNRWQEILGVAVFWIWYPLLVS  303

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFVV S  +TG+Q +QF LNH +SS + GP  G DW EKQ  GTLDI CSP
Sbjct  304   CLPNWGERVMFVVASFAVTGIQHVQFCLNHFSSSVYVGPPQGNDWFEKQTMGTLDISCSP  363

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+ HHLFPR+PRC LRKVSPFV++LC+KH + Y+ ASFW ANA+  +++
Sbjct  364   WMDWFHGGLQFQLAHHLFPRLPRCHLRKVSPFVRELCKKHKLPYSIASFWEANAMTIRTL  423

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARD      PKNLVWEA+N+ G
Sbjct  424   RAAALRARDFE-NPVPKNLVWEAVNTHG  450



>ref|XP_002880224.1| hypothetical protein ARALYDRAFT_483768 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56483.1| hypothetical protein ARALYDRAFT_483768 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/447 (57%), Positives = 334/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+++T+E+LKKH+KPGDLW+SI GKV DVSDWV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRYVTSEDLKKHNKPGDLWISIQGKVCDVSDWVKSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL++  NGY+V D  VS+VS+D+R L +EFS+ GLF+KKGH+  Y    +  M  
Sbjct  67    GTAWHHLEKLHNGYHVRDFHVSDVSRDFRRLAAEFSKRGLFDKKGHVTLYTLTCVGVMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SVWAH+ SAVL+G LWIQ+ +VGHDSGHY V  TK  ++  QLL+GNCLT
Sbjct  127   AVLYGVLACTSVWAHLISAVLLGLLWIQSAYVGHDSGHYTVTSTKPCNKLIQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q +PIFA S K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHMACNSLDHDPDLQHIPIFAVSTKFF-NSMTSRFYGRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  + RIN+FIQ++  +LF K+   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWTFYPVM-CVGRINLFIQTF-LLLFSKRHVPDRALNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SER +FV +S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWSERFIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP VK+LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHNLPYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AA+ ARD +     KNL+WEA+N+ G
Sbjct  424   NAAIQARD-ATNPVLKNLLWEAVNTHG  449



>ref|XP_006397805.1| hypothetical protein EUTSA_v10001443mg [Eutrema salsugineum]
 gb|ESQ39258.1| hypothetical protein EUTSA_v10001443mg [Eutrema salsugineum]
Length=449

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 335/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K++I++E+LK H+K GDLW+SI GKVYDVSDWV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRYISSEDLKTHNKSGDLWISIQGKVYDVSDWVRSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL++  NGY+V D  VS+VS+DYR L +EFS+ GLF+KK H+  Y    ++ MF 
Sbjct  67    GTAWHHLEKLHNGYHVRDFHVSDVSRDYRRLAAEFSKRGLFDKKEHVTLYTLTCVAVMFA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGV+   SVWAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNC+T
Sbjct  127   AVVYGVLACTSVWAHLVSAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKIVQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +PIFA S K F+ S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHIACNSLDHDPDLQHIPIFAVSTKFFK-SMTSRFYGRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  + RIN+F+Q++  +LF K+   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWTFYPVM-CVGRINLFVQTF-LLLFSKRHVPDRALNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERI+FV  S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWPERIIFVFTSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR+VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRRVSPVVQELCKKHNLPYRSLSWWEANVWTIRTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AA+ ARD +     KNL+WEA+N+ G
Sbjct  424   NAAVQARD-ATNPVLKNLLWEAVNTHG  449



>ref|XP_009142680.1| PREDICTED: delta(8)-fatty-acid desaturase 2 [Brassica rapa]
Length=449

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+FIT+++LKKH++PGDLW+SI GKVYDVS WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRFITSDDLKKHNQPGDLWISIQGKVYDVSHWVKSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL+   NGY+V DH VS+VS+DYR L +EFS+ GLF+KKGH+  Y    ++AM  
Sbjct  67    GTAWRHLENLHNGYHVKDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVAAMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGVV   S+WAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNC+T
Sbjct  127   AVVYGVVACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKLVQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHI+CN +D+DPD+Q +P+ A S+K F+ S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHISCNSLDHDPDLQHIPVLAVSSKFFK-SMTSRFYGRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHW+FYP+M  + RIN+FIQ+   +LF ++   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWSFYPIM-CVGRINLFIQT-LLLLFSRRHVPDRALNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERI+FV LS+ +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERIIFVFLSMAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRGVSPVVQELCKKHNLPYRSLSWWEANVWTLRTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARD++     +NL+WEALN+ G
Sbjct  424   KAAVQARDVT-NPVLENLLWEALNTHG  449



>ref|XP_008795083.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Phoenix dactylifera]
Length=449

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 344/447 (77%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +++IT+EEL+ H+   DLW+SI GKVYDV+ WV  HPGG+ PLL+LAGQDVTDAF+AYHP
Sbjct  8     RRYITSEELRGHNTKADLWISIQGKVYDVTGWVKDHPGGDIPLLNLAGQDVTDAFVAYHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                   L RFF GY ++D++VS VS+DYR LV+EF+R+GLF+KKGH V +    +  +F+
Sbjct  68    GTTWALLDRFFVGY-LADYRVSPVSRDYRRLVAEFARLGLFDKKGHGVLFSLIFMVVLFV  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             VS+ GV+F  S + H+    L+G LWIQ+G++GHDSGHY+VM T  L+R  Q+L+GNCLT
Sbjct  127   VSVSGVLFSTSTFVHLIGGSLMGVLWIQSGFLGHDSGHYNVMSTPGLNRLMQILSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +D+DPD+Q +P FA S+K F +SL S+FYE+ ++FNSLAR
Sbjct  187   GISIGWWKRNHNAHHIACNSLDFDPDLQHIPFFAVSSKFF-TSLTSYFYERKLAFNSLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM  +AR+N+F QS   +L  KK+   R QE  G I+FW+WYP L+S+
Sbjct  246   FLVSYQHWTFYPVMC-VARVNLFAQSAILLLSNKKV-PGRWQETAGCIVFWIWYPLLVST  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER++FVV S  +TG+Q +QF LNH ++S + GP  G DW EKQ  GTLDI CSPW
Sbjct  304   LPNWTERVVFVVASFAVTGIQHVQFCLNHFSASVYVGPPRGNDWFEKQTMGTLDILCSPW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LR++SP+VK+LC+KHG+ Y  ASFW AN     ++R
Sbjct  364   MDWFHGGLQFQVEHHLFPRLPRCHLRRISPYVKELCKKHGLPYTAASFWDANVRTIATLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL A DL+    P+NLVWEA+N+ G
Sbjct  424   TAALEAGDLA-NPVPRNLVWEAVNTHG  449



>gb|ADA60228.1| delta-8 sphingolipid desaturase [Ribes nigrum]
Length=448

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/447 (57%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELK+H+KP DLW+SIHGKVY+V+ W   HPGG+ PLL+L GQDVTDAF+AYHP
Sbjct  6     KKYITVEELKEHNKPEDLWISIHGKVYNVTYWKKEHPGGDIPLLNLGGQDVTDAFIAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF G+Y+ DH  S+VSKDYR LV EF++MGLF+KKGH V Y    ++ +F 
Sbjct  66    GTAWQYLDKFFTGHYLKDHNFSDVSKDYRKLVFEFNKMGLFDKKGHGVVYVFCLVAFLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V LYGV+  ES+  HM    L+GFLW+Q+ +VGHDSGHY  M T   +  AQ+L GNCLT
Sbjct  126   VVLYGVLCCESILVHMLCGGLLGFLWMQSAYVGHDSGHYQTMSTPFYNNFAQILTGNCLT  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIA N +DYDPD+Q +P+FA S++LF +++ S+FY + + F++ AR
Sbjct  186   GISIAWWKWTHNAHHIAVNSLDYDPDLQHIPVFAVSSQLF-NNITSYFYGRKLEFDAFAR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F+VSYQHWTFYPV +++AR+N+++Q++  +LF K+   NRA  I+G+++FW W+P L+  
Sbjct  245   FMVSYQHWTFYPV-VIVARVNLYVQTF-LLLFSKRKVPNRAMNIMGILVFWTWFPLLVLC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+ +ER+MFV+ S  +T +Q IQF LNH ++  + G  TG DW EKQ  GT+DI CS W
Sbjct  303   LPSWTERVMFVLASFTVTSIQHIQFCLNHFSADVYMGLPTGNDWFEKQTKGTIDISCSSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLR VSPF  +LC+KH + Y   SF  AN    K++R
Sbjct  363   MDWFHGGLQFQLEHHLFPRLPRCQLRTVSPFAIELCKKHNLPYRSLSFLEANVATIKTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDLS    PKNL+WEA+N+ G
Sbjct  423   TAALQARDLS-NPVPKNLLWEAVNTHG  448



>ref|NP_001288997.1| delta8-sphingolipid desaturase [Brassica rapa]
 gb|AEW24952.1| delta8-sphingolipid desaturase [Brassica rapa]
Length=449

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT E+L KH+KPGDLW++I GKVYDVSDW+  HPGGE  +++LAGQDVTDAF+A+HP
Sbjct  7     KKYITKEDLSKHNKPGDLWIAIQGKVYDVSDWIKSHPGGEALIVNLAGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL  FF GY++ D QVSE+S+DYR L +EF ++GLFEKKGH+  Y    ++A+F 
Sbjct  67    GTAWHHLNSFFTGYHIGDSQVSEISRDYRRLAAEFRKLGLFEKKGHVTLYTLTFVAALFA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV AH  +A ++G LW+Q+ ++GHDSGHY +MK K  ++ AQLL+GNC+T
Sbjct  127   AVLYGVLACTSVVAHQIAAAILGLLWMQSAYIGHDSGHYVIMKNKSYNKFAQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH++CN +DYDPDVQ +P+FA S+K F SS+ S FY++ ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHLSCNSLDYDPDVQHIPVFAVSSKFF-SSMTSRFYDRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF K+ F +RA  + G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSKREFPDRALNLAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER  FV+ S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C+ +
Sbjct  304   LPTWPERFFFVLTSFTVTALQHIQFTLNHFAADVYMGPPTGNDWFEKQTAGTLDISCTSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKVSP V++LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCKKHNLQYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   KAAYQARD-AANPVVKNLVWEALNTHG  449



>emb|CDY43938.1| BnaC04g21720D [Brassica napus]
Length=449

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 335/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT E+L KH+KPGDLW++I GKVYDVSDW+  HPGGE  +++LAGQDVTDAF+A+HP
Sbjct  7     KKYITKEDLSKHNKPGDLWIAIQGKVYDVSDWIKSHPGGEALIVNLAGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F GY++ D QVSE+S+DYR L +EF ++GLFEKKGH+  Y    ++A+F 
Sbjct  67    GTAWHHLNSLFTGYHIGDSQVSEISRDYRRLAAEFRKLGLFEKKGHVTLYTLTFVAALFA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV AH  +A ++G LW+Q+ ++GHDSGHY +MK K  ++ AQLL+GNC+T
Sbjct  127   AVLYGVLACTSVVAHQIAAAILGLLWMQSAYIGHDSGHYVIMKNKSYNKFAQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH++CN +DYDPDVQ +P+FA S+K F SS+ S FY++ ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHLSCNSLDYDPDVQHIPVFAVSSKFF-SSMTSRFYDRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF K+ F +RA  + G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSKREFPDRALNLAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER  FV+ S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C+ +
Sbjct  304   LPTWPERFFFVLTSFTVTALQHIQFTLNHFAADVYMGPPTGNDWFEKQTAGTLDISCTSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKVSP V++LCEKH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCEKHNLQYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   KAAYQARD-AANPVVKNLVWEALNTHG  449



>ref|XP_009404910.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 337/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K++I++EEL+ H+ P DLW+SI GKVYD + WV  HPGGE PL +LAGQDVTDAF+AYHP
Sbjct  11    KRYISSEELRLHNTPSDLWISIQGKVYDATHWVKDHPGGELPLFNLAGQDVTDAFVAYHP  70

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A   L R     Y+SD++VS+VSKDYR L+++ S+ GLF+KKGH+       +  MF 
Sbjct  71    GTAWSLLDRLPLVGYLSDYRVSDVSKDYRRLITDISKKGLFDKKGHITFIVLCHMCLMFA  130

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGVV   SVW H+G AV++GFLW+Q+G++GHDSGHY ++    ++R  Q++ GNCL 
Sbjct  131   AVVYGVVCSPSVWVHLGCAVVLGFLWMQSGFLGHDSGHYRILSGPLVNRIMQVVTGNCLA  190

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +++DPDVQ +P+ A S++LFR  L S+FYE+ MSF+ +AR
Sbjct  191   GISIEWWKRNHNAHHIACNSLEFDPDVQHIPVLAVSSELFR-GLTSYFYERKMSFDGVAR  249

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQHWTFYPVM  +AR+N+F QS   +L  K++   R+ E++GL +FWVW+P L+S 
Sbjct  250   LLVSYQHWTFYPVM-CVARLNLFAQSVLLLLSNKRV-QGRSMELVGLGVFWVWFPLLVSY  307

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER+MFVV S  +TG+Q +QF LNH +SS + GP  G DW EKQ  GTLDI C PW
Sbjct  308   LPSWGERVMFVVASFAVTGIQHVQFCLNHFSSSVYVGPPRGNDWFEKQTMGTLDITCEPW  367

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLR+++P V++LC+KHG+ Y++ SFW AN    +++R
Sbjct  368   MDWFHGGLQFQVEHHLFPRLPRCQLRRIAPLVRELCKKHGLPYDNFSFWEANVRTIRTLR  427

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    PKNLVWEA+N+ G
Sbjct  428   TAALQARDLA-NPVPKNLVWEAVNTHG  453



>gb|AHF50176.1| fatty acid d6 desaturase, partial [Lemna gibba]
Length=443

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/447 (57%), Positives = 339/447 (76%), Gaps = 6/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +K I++EEL+ H+ P DLW+SI GKVYDV+DW   HPGG+ PLLSLAGQDVTDAF+AYHP
Sbjct  3     EKQISSEELRLHNSPTDLWISIQGKVYDVTDWAKSHPGGDVPLLSLAGQDVTDAFIAYHP  62

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL RFF G  +SD++VSEVS+D+R L +EFS+ GLFEKKGHL  Y  A+++A+F+
Sbjct  63    GSAWGHLDRFFIGR-LSDYRVSEVSRDFRRLAAEFSKSGLFEKKGHLTLYTLASIAALFV  121

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
              ++ GV+  +S   H+ + VL+G LW Q+GWVGHDSGHY  M T +L+R  Q+L GNCL 
Sbjct  122   AAVCGVLASDSAAVHLLAGVLIGLLWTQSGWVGHDSGHYRAMPTARLNRLVQILTGNCLA  181

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             GVS+ WW+W HN HHIACN +++DP++QL+P+FA S KLF S L S+F+E  M+F+++ R
Sbjct  182   GVSMAWWKWTHNGHHIACNSLEFDPNIQLMPVFAVSPKLFES-LRSYFFETEMNFDAITR  240

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQHWTFYPVM L ARI++F+Q++  +L  +K   +R QE+LG++ FW+WYP L+S 
Sbjct  241   SLVSYQHWTFYPVMCL-ARIDLFVQTF--ILLARKKVPHRKQEVLGVVFFWIWYPLLVSC  297

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MF+  +  + G+Q IQF L+H +SS + G   G DW EKQ  GTL+I CSP 
Sbjct  298   LPNWGERMMFMAANFSVIGIQHIQFCLSHFSSSVYVGRPAGNDWFEKQTVGTLNITCSPS  357

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQIEHHLFPR+PRC LRK+SP VK+LC+KH ++Y+ ASFW AN     ++R
Sbjct  358   MDWFYGGLQFQIEHHLFPRLPRCNLRKISPLVKELCKKHKLSYSAASFWEANVRTIATLR  417

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARDL  +  PKNLVWEA+ + G
Sbjct  418   AAAMQARDLG-KPLPKNLVWEAVKTHG  443



>gb|AFK34809.1| unknown [Medicago truncatula]
Length=453

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/445 (58%), Positives = 334/445 (75%), Gaps = 4/445 (1%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI  1359
             +I+ +EL+KH+  GD W+SI GK+YDVS W   HPGGE PLL+LAGQDVTDAFLA+HP  
Sbjct  13    YISLQELQKHNTRGDAWISIDGKIYDVSKWANHHPGGELPLLNLAGQDVTDAFLAFHPPS  72

Query  1358  AAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
             A  HLQ F  G Y+ D+ VS+VS+DYR L SE +++GLFE+KGH V    + +S MF VS
Sbjct  73    AYKHLQNFATGSYLRDYVVSDVSRDYRALFSELTKLGLFEEKGHGVLLLLSIISVMFFVS  132

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
             +YGV+F +S   H+ S  L+G LWIQ+GW+GHDSGHY VM  +K ++  Q+L+GN L G+
Sbjct  133   VYGVLFCDSAVVHVLSGGLMGLLWIQSGWIGHDSGHYQVMVNRKWNQFMQILSGNVLAGI  192

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
             SI WW+WNHNAHH+ACN +D+DPD+Q LP F  S+K F +SL S FY + M+F+S ARFL
Sbjct  193   SIEWWKWNHNAHHLACNSLDFDPDLQHLPFFVVSSKFF-TSLTSCFYGRKMNFDSFARFL  251

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLP  639
             VSYQHW++YP M   AR+N+F QS+  +LF  +   NR  E+LGL +FW+WYP L+S LP
Sbjct  252   VSYQHWSYYPAMCF-ARLNLFAQSF-FLLFSNRKVPNRKMELLGLALFWIWYPLLVSCLP  309

Query  638   NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
             N  ER++FV+ S  +TG+Q +QF+LNH ++S + GP T  DW EKQ  GTLD+ CS WMD
Sbjct  310   NWGERVLFVLASFCVTGIQHVQFTLNHFSASVYVGPPTAHDWFEKQAHGTLDVKCSSWMD  369

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQFQIEHHLFPR+PR  LRK+SP VK LC+KH + YN  SFW AN L  +++R+A
Sbjct  370   WFHGGLQFQIEHHLFPRLPRRNLRKISPLVKDLCKKHNLPYNCVSFWKANVLTIQTLRNA  429

Query  278   ALMARDLSPEKAPKNLVWEALNSFG  204
             AL ARDL+ +  P+NLVWEA+N+ G
Sbjct  430   ALQARDLT-KPVPRNLVWEAVNTHG  453



>gb|AIP90101.1| omega-3 fatty acid desaturase endoplasmic reticulum isozyme 3 
[Musa AB Group]
Length=450

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/449 (58%), Positives = 339/449 (76%), Gaps = 5/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G K++IT EEL+KH+   DLW+SI G VYDV++WV  HPGG+ PLLSLAGQD TDAF+AY
Sbjct  7     GEKRYITVEELRKHNAATDLWISIQGGVYDVTNWVEDHPGGDLPLLSLAGQDATDAFVAY  66

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HPA A  HL RFF GY +  + V++VS+DYR LV+EFS+ GLF++KG +       +  +
Sbjct  67    HPASAWAHLGRFFVGY-LDGYCVTDVSRDYRRLVAEFSKSGLFDEKGRVALLTMCLMLFL  125

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
              + ++ GV+  ES   H     + GFLWIQ+GW+GHDSGHY +++  +L+R AQ+++GNC
Sbjct  126   LVTAVSGVLLSESALVHALCGGMTGFLWIQSGWIGHDSGHYRIVRNPRLNRVAQIISGNC  185

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+ NHNAHHIACN +D+DPD+Q +P+FA S+K F +S+ S+F+E+ M+F+++
Sbjct  186   LTGLSIGWWKRNHNAHHIACNSLDFDPDLQHMPLFAVSSKFF-ASMTSYFFERKMNFDAV  244

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFL+SYQHWTFYPVM   ARIN+  QS   +L KK +  NR QEI G+ +F +WYP L+
Sbjct  245   ARFLISYQHWTFYPVMCF-ARINLLAQSILLLLSKKNV-PNRWQEITGVAVFLIWYPLLV  302

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+ FVV SL +TG+Q +QF LNH +SS + GP  G DW EKQ  GTLDI CS
Sbjct  303   SCLPNWGERVTFVVASLAVTGIQHVQFCLNHFSSSVYVGPPQGNDWCEKQTMGTLDISCS  362

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQ+EHHLFPR+PRC LRKVSPFV++LC+KH + YN ASFW ANA+  ++
Sbjct  363   PWMDWFHGGLQFQVEHHLFPRLPRCHLRKVSPFVRELCKKHKLPYNIASFWEANAMTVRT  422

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARD +    PKNLVWE +N+ G
Sbjct  423   LRAAALQARDFA-NPVPKNLVWETVNTHG  450



>gb|ADA60229.1| delta-8 sphingolipid desaturase [Ribes nigrum]
Length=448

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/447 (57%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK++T EELK+H+KP DLW+SI GKVY+V+ W  +HPGG+ PLL+L GQDVTDAF+AYHP
Sbjct  6     KKYMTVEELKEHNKPEDLWISIQGKVYNVTVWKKQHPGGDIPLLNLGGQDVTDAFIAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L RFF GYY+ D +VS+VSKDYR L  EF++MGLFE KGH V Y    ++ +F 
Sbjct  66    GTAWQYLDRFFTGYYLKDFKVSDVSKDYRKLAYEFNKMGLFENKGHGVLYAFCLVAFLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V +YGV+  ESV+ HM    L+GFLW+Q+ +VGHDSGHY  M T   +  AQ+L GNCLT
Sbjct  126   VVVYGVLCSESVFVHMCCGGLLGFLWMQSAYVGHDSGHYQTMSTPFYNNFAQILTGNCLT  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIA N +DYDPD+Q +P+FA S +LF  ++ S+FY + + F++ AR
Sbjct  186   GISIAWWKWTHNAHHIAVNSLDYDPDLQHIPVFAVSPQLF-DNITSYFYGRKLEFDAFAR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F+VSYQHWTFYPV +++AR+N+++Q++  +LF K+  + RA  I+G+++FW W+P L+ +
Sbjct  245   FMVSYQHWTFYPV-VIVARVNLYVQTF-LLLFSKRKISYRAMNIMGILVFWTWFPLLVFT  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+ +ER+MFV+ S  +T +Q IQF LNH ++  + G  TG DW EKQ  GT+DI CSPW
Sbjct  303   LPSWTERVMFVLASFTVTSIQHIQFCLNHFSADVYMGLPTGNDWFEKQTKGTIDISCSPW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLRKVSPFVK LC+KH + Y   SF  AN    K++R
Sbjct  363   MDWFHGGLQFQLEHHLFPRLPRCQLRKVSPFVKDLCKKHNLPYRSLSFLDANVATIKTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDLS      NL+WEA+N+ G
Sbjct  423   TAALQARDLS-NPVKNNLLWEAVNTHG  448



>gb|AEW24951.1| delta8-sphingolipid desaturase [Brassica rapa]
Length=449

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/447 (56%), Positives = 335/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+FIT+++LKKH++PGDLW+SI GKVYDVS WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRFITSDDLKKHNQPGDLWISIQGKVYDVSHWVKSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL+   NGY+V DH VS+VS+DYR L +EFS+ GLF+KKGH+  Y    ++ M  
Sbjct  67    GTAWRHLENLHNGYHVKDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVALMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGVV   S+WAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNC+T
Sbjct  127   AVVYGVVACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKLVQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHI+CN +D+DPD+Q +P+ A S+K F+ S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHISCNSLDHDPDLQHIPVLAVSSKFFK-SMTSRFYGRRLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHW+FYP+M  + RIN+FIQ+   +LF ++   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWSFYPIM-CVGRINLFIQT-LLLLFSRRHVPDRALNIAGILVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERI+FV LS+ +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERIIFVFLSMAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRGVSPVVQELCKKHNLPYRSLSWWEANVWTLRTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARD++     +NL+WEALN+ G
Sbjct  424   KAAVQARDVT-NPVLENLLWEALNTHG  449



>ref|XP_004306719.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Fragaria vesca 
subsp. vesca]
Length=449

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/448 (56%), Positives = 333/448 (74%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              +K+ITTEEL+ H+KP DLW+SI GK Y+V+DWV  HPGG  PL++LAGQDVTDAF+AYH
Sbjct  6     NRKYITTEELRLHNKPDDLWISIQGKAYNVTDWVKDHPGGAEPLMNLAGQDVTDAFIAYH  65

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L + F GYYV D +VS+VS+DYR L SEF +MGLFEKKGH+  Y  A+++ M 
Sbjct  66    PGTAWAYLDKLFTGYYVRDFKVSDVSRDYRKLYSEFLKMGLFEKKGHVQLYNMASVAVML  125

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              + +YGVV  ES   HMG   L+G LWI A ++GHDSGHY VMK++  +   Q+LAGNC+
Sbjct  126   GMVVYGVVRSESSLVHMGCGFLLGLLWIVAAYMGHDSGHYVVMKSEFWNSVTQILAGNCV  185

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F  SL S FY + ++F+ +A
Sbjct  186   TGISIAWWKWTHNAHHIACNSLDYDPDLQHVPVFAVSTKFFH-SLTSVFYGRELTFDGVA  244

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFL+ YQH+T+YPVM+   RIN+FIQ++  +LF K+   NR + I G+++FW W+P L+S
Sbjct  245   RFLIGYQHFTYYPVMIF-GRINLFIQTF-LLLFSKRPVPNRLKNIFGILVFWTWFPLLVS  302

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER+MFV+++  +T +Q +QF+LNH +   + GP  G DW EKQ  GT+DI CS 
Sbjct  303   CLPNWGERVMFVLIAFAVTALQHVQFTLNHFSGDTYVGPPKGNDWFEKQTAGTIDISCSS  362

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             +MDW  GGLQFQ+EHHLFPR+PRCQLRKVSP +++LC+KH + Y   SFW AN    +++
Sbjct  363   YMDWLFGGLQFQLEHHLFPRLPRCQLRKVSPIIQELCKKHSLPYRSLSFWEANVSTIRTL  422

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDL+    PKNLVWEALN+ G
Sbjct  423   RTAALQARDLT-NPVPKNLVWEALNTHG  449



>ref|XP_010508055.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Camelina sativa]
Length=449

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/447 (57%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+++TTE+LKKH++PGDLW+SI GKVYDVS WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRYVTTEDLKKHNQPGDLWISIQGKVYDVSKWVKTHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL++  NGY+V D  VS+VS+DYR L ++FS+ GLF+KKGH+  Y    +  M  
Sbjct  67    GTAWHHLEKLHNGYHVKDFHVSDVSRDYRRLAADFSKRGLFDKKGHVTLYTLTCVGVMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGVV   SVWAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNCLT
Sbjct  127   AVLYGVVVCTSVWAHLVSAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKLVQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q +PIFA S+K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHMACNSLDHDPDLQHIPIFAVSSKFF-NSMTSRFYGRELTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWTFYPVM  + RIN+FIQ++  +LF K+   +RA  I G+++FW W+P L+S 
Sbjct  246   FLISYQHWTFYPVM-CVGRINLFIQTF-LLLFSKRHVPDRAMNIAGIMVFWTWFPLLVSF  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER +FV +S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERFVFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP VK+LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHDLPYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AA+ ARD++     KNL+WEA+N+ G
Sbjct  424   NAAIQARDVT-NPVLKNLLWEAVNTHG  449



>ref|XP_003520073.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Glycine max]
Length=451

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/447 (57%), Positives = 343/447 (77%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELK H+K GDLW+SI GKVY+VSDWV  HPGG+ P+ +LAGQDVTDAF+AYHP
Sbjct  9     KKYITSEELKGHNKEGDLWISIQGKVYNVSDWVKEHPGGDVPISNLAGQDVTDAFIAYHP  68

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL +FF GY++SD +VSEVSKDYR L SEFS++GLF+ KGH+ S   A+++ MFL
Sbjct  69    GTAWSHLDKFFTGYHLSDFKVSEVSKDYRKLASEFSKLGLFDTKGHVTSCTLASVAVMFL  128

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGV+   SVWAH+GS +L+G LW+Q+ +VGHDSGHY VM +   ++ AQ+L+GNCLT
Sbjct  129   IVMYGVLRCTSVWAHLGSGMLLGLLWMQSAYVGHDSGHYVVMTSNGFNKVAQILSGNCLT  188

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S++ F +S+ SHFY + + F+ +AR
Sbjct  189   GISIAWWKWTHNAHHIACNSLDHDPDLQHMPVFAVSSRFF-NSITSHFYGRKLEFDFIAR  247

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+ YQH+TFYPVM  +AR+N+++Q+   +LF ++   +RA  I+G+++FW W+P L+S 
Sbjct  248   FLICYQHFTFYPVM-CVARVNLYLQT-ILLLFSRRKVQDRALNIMGILVFWTWFPLLVSF  305

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+MFV+ S  +  +Q IQF LNH A++ + G  +G DW EKQ  GTLDI CS  
Sbjct  306   LPNWPERVMFVLASFAVCSIQHIQFCLNHFAANVYVGLPSGNDWFEKQTSGTLDISCSSS  365

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRCQLR +SP V  LC+KH + Y   SFW AN    +++R
Sbjct  366   MDWFFGGLQFQLEHHLFPRLPRCQLRNISPLVSDLCKKHNLPYRSLSFWEANQWTIRTLR  425

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+   APKNL+WEA+N+ G
Sbjct  426   TAALQARDLT-NPAPKNLLWEAVNTHG  451



>ref|XP_007219777.1| hypothetical protein PRUPE_ppa024455mg [Prunus persica]
 gb|EMJ20976.1| hypothetical protein PRUPE_ppa024455mg [Prunus persica]
Length=447

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 334/449 (74%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G +K+IT EELK+H+KPGDLW+SI GKVY+VSDW   HPGG+  L +LAGQ+VTDAF+AY
Sbjct  3     GERKYITCEELKEHNKPGDLWISIQGKVYNVSDWAKEHPGGDTILFNLAGQEVTDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP+ A  +L + F GYY+ D +VSEVSKDYR + SEFSR+GLFEKKGH   Y    ++ +
Sbjct  63    HPSTAWQYLNKLFTGYYLKDFKVSEVSKDYRRMASEFSRLGLFEKKGHGAMYSILIITTL  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H+   +++G LWI+  ++GHD+GHY +M ++K +  AQ+LAGNC
Sbjct  123   LHLVVYGVLKSESVLVHLVCGMMLGALWIEGAYIGHDAGHYQIMSSRKCNDIAQILAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F +S+ S FY + + F+ +
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSTKFF-NSITSIFYGRELKFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFL+SYQH+T+YPVM ++ R+N+FIQ++  +LF +    +RA  I+G+++FW W+P L+
Sbjct  242   ARFLISYQHFTYYPVM-VVGRVNLFIQTF-LLLFSRGNVPHRALNIMGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LP  SER+MFV+ S  +T +Q IQF+LNH +   + GP T  DW EKQ  GTLDI CS
Sbjct  300   SCLPTWSERVMFVLASFTVTALQHIQFTLNHFSGDTYLGPPTSSDWFEKQAAGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
               MDWF GGLQFQ+EHHLFPR+PRCQLR ++P VK LC+KH + Y   SFW AN    ++
Sbjct  360   TRMDWFFGGLQFQLEHHLFPRLPRCQLRTIAPTVKDLCKKHNLPYRSLSFWEANMSTIRT  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARDLS    PKNLVWEALN+ G
Sbjct  420   LRTAALQARDLS-NPVPKNLVWEALNTHG  447



>gb|KFK37417.1| hypothetical protein AALP_AA4G254400 [Arabis alpina]
Length=449

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K++IT +ELKKH+KPGDLW+SI GKVYDVS WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRYITNKELKKHNKPGDLWISIQGKVYDVSKWVKSHPGGESAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A +HL+   NGY+VSD  +SEVS+DYR L +EFS+ GLFEKKGH+  Y    +  + +
Sbjct  67    GTAWNHLKNLHNGYHVSDFHMSEVSRDYRRLAAEFSKRGLFEKKGHVTLYTLTCVLVLLI  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
                YGV+   SV+AH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNC+T
Sbjct  127   AVWYGVLVCTSVFAHLISAVLLGLLWIQSAYVGHDSGHYNVASTKPCNKIIQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHI+CN +D+DPD+Q +PIFA S K F+ S+ S FY++ ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHISCNSLDHDPDLQHIPIFAVSTKFFK-SMTSRFYDRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHW+FYPVM  + RIN+FIQ++  +L  K+   +RA  I+G+++FW W+P L+S 
Sbjct  246   FLISYQHWSFYPVM-CVGRINLFIQTF-LLLISKRHVPDRALNIVGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER++FV +S  +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  304   LPNWQERMIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRLVSPVVQELCKKHDLPYRSLSWWEANVWTIRTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AA+ ARD++     KNL+WEA+N+ G
Sbjct  424   NAAIQARDVT-NPVFKNLIWEAVNTHG  449



>gb|AAZ23034.1| delta-6 desaturase-related protein [Echium pitardii var. pitardii]
Length=448

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/445 (58%), Positives = 335/445 (75%), Gaps = 6/445 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+ITT+ELKKHDKP DLW+SI GK+YDVS+W+  HPGG YPL SLAGQDVTDAF+A+HP
Sbjct  6     KKYITTDELKKHDKPDDLWISIQGKIYDVSNWLKDHPGGHYPLTSLAGQDVTDAFVAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A A  +L  FFNGYY+ D+ VS+VSKDYR LVSEFS+MGLF+K GH V    + ++  F 
Sbjct  66    ASAWQNLDEFFNGYYLKDYYVSDVSKDYRKLVSEFSKMGLFKKNGHTVFVTLSLIAMSFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+F + V  H     LVG LW Q G +GHD+GHY +M + +L++   +LA NCL+
Sbjct  126   MSVYGVLFCQGVLVHWLCGCLVGILWTQCGLLGHDAGHYTMMPSSRLNKFVFILAANCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             GVSI WW WNHNAHH+ACN ++YDPDVQ +P    S+KL  +SL SHF+EK + F+SL++
Sbjct  186   GVSIGWWTWNHNAHHVACNSLEYDPDVQYIPFIVVSSKLL-TSLTSHFHEKRLKFDSLSK  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VS+QHWTFYPVM   AR+ + +QS+  +L K+ + ++R+QE+ GLI+FW+WYPFL+  
Sbjct  245   FFVSHQHWTFYPVM-CSARLYLIVQSFIMLLTKRNV-SHRSQELFGLIVFWIWYPFLVYC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SERIMFV+ S  MTG+QQ+QFSL+H++SS + G   G DW EKQ  GTLDI C  W
Sbjct  303   LPNWSERIMFVLPSFFMTGIQQLQFSLSHVSSSVYVGKPKGNDWFEKQTSGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GG QFQIEHHLFPR+PRC  R +SP V +LC+KH + YN ASF+  N ++ K+++
Sbjct  363   MDWFYGGTQFQIEHHLFPRLPRCHFRTISPLVMELCKKHNLNYNCASFFKGNKMVIKTLK  422

Query  284   DAALMARDLSPEKAPKNLVWEALNS  210
              AAL ARDL+    PKNL    +N+
Sbjct  423   KAALEARDLA---KPKNLECVGVNT  444



>ref|XP_003550268.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Glycine max]
Length=448

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/446 (58%), Positives = 336/446 (75%), Gaps = 5/446 (1%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA-  1362
             +I+T+EL+KH+   D W+SIHGK+YDVS W++RHPGG  PLL+LAG D TDAFLA+HP  
Sbjct  7     YISTDELRKHNTRHDAWISIHGKIYDVSSWLHRHPGGPLPLLTLAGTDATDAFLAFHPPN  66

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
              A+  L  F   + +SDH VS  S DYR L S+ S + LF +KGH  S   + +  +F +
Sbjct  67    TASLLLPAFSTSHRLSDHTVSAASSDYRKLFSDLSALNLFNRKGHTTSILLSLILTLFPL  126

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             S+ GV+F +S + H+ SA L+GFLWIQ+GW+GHDSGHY+VM +++L+RA Q+L+GN L G
Sbjct  127   SVCGVLFSDSTFVHVLSAALIGFLWIQSGWIGHDSGHYNVMLSRRLNRAIQILSGNILAG  186

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             +SI WW+WNHNAHHIACN +DYDPD+Q LP F  S++ F +SL S FY++ ++F+S ARF
Sbjct  187   ISIGWWKWNHNAHHIACNSLDYDPDLQHLPFFVVSSRFF-NSLTSRFYDRKLNFDSFARF  245

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
             LVSYQHWTFYPVM   AR+N+F QS+  +L K+K+  NR  E+LGL+ FWVWYP L+S L
Sbjct  246   LVSYQHWTFYPVMCF-ARVNLFAQSFFLLLSKRKV-ENRGSELLGLLAFWVWYPLLVSFL  303

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ER++FV +S  +TG+Q +QF LNH +S  + GP +G DW EKQ  GTL +DCSPWM
Sbjct  304   PNWWERLLFVFVSFSVTGIQHVQFCLNHFSSEVYLGPPSGGDWFEKQTKGTLGVDCSPWM  363

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQ+EHHLFPR+PRC LRK++P VK LC+KH + YN  SFW AN L  +++R+
Sbjct  364   DWFHGGLQFQVEHHLFPRLPRCHLRKIAPLVKDLCKKHNLPYNCVSFWKANVLTIQTLRN  423

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AAL ARD S    PKNLVWEA+N+ G
Sbjct  424   AALQARDGS-NPVPKNLVWEAVNTHG  448



>gb|ADC34631.1| delta-8 sphingolipid desaturase [Primula nivalis]
Length=453

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/448 (56%), Positives = 326/448 (73%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T  +IT+ +LK H+KPGDLW+SIHG+VYDVS W   HPGG  PLL+LAG DVTDAFLAYH
Sbjct  10    TSSYITSSDLKTHNKPGDLWISIHGQVYDVSSWAALHPGGTAPLLALAGNDVTDAFLAYH  69

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P   +H L        +  + VS  S DYR L+  F ++GLF+ K H       A+ A+F
Sbjct  70    PPSISHLLPPLSTNLLLEKYSVSPTSSDYRNLLDNFHKLGLFKSKSHTTMATFVAMVALF  129

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +SL+G+ + ++VW H+ S  ++G  WIQ+GW+GHDSGHY +M T+K +R AQ+L+GNCL
Sbjct  130   FISLFGIFYSDNVWVHLASGGVMGVAWIQSGWLGHDSGHYQIMSTRKWNRFAQVLSGNCL  189

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW WNHNAHH+ACN +DYDPD+Q +P F  S+K F +SL S FY + + F+S+ 
Sbjct  190   AGISIAWWNWNHNAHHLACNSLDYDPDLQHMPFFVVSSKFF-NSLTSRFYGRKLRFDSVC  248

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQHW+FYPVM L ARIN+F QS+  +LF  +   +R QEI G+ +FWVWYP L+S
Sbjct  249   RFLVSYQHWSFYPVMCL-ARINLFAQSF-MLLFSSRKVPDRVQEIFGIGVFWVWYPLLVS  306

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ERI+FVV S  +TG+Q +QF LNH ++  + GP  G DW EKQ  GTL+I C  
Sbjct  307   CLPNWGERIIFVVASFSVTGIQHVQFCLNHFSAEVYVGPPKGNDWFEKQTAGTLNISCPS  366

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQIEHHLFPR+PR QLRK+SPFV+ +C+KH ++YN ASF  AN L  +++
Sbjct  367   WMDWFHGGLQFQIEHHLFPRLPRSQLRKISPFVRDMCKKHNLSYNIASFTMANVLTLRTL  426

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R+AA+ ARDLS    PKNLVWEA+N+ G
Sbjct  427   RNAAIQARDLS-NPVPKNLVWEAVNTHG  453



>ref|XP_004511216.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Cicer arietinum]
Length=449

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/447 (58%), Positives = 339/447 (76%), Gaps = 3/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KKFIT+EELKKHDK GDLW+SI GKVY+VSDW   HPGGE PLL+LAGQDVTDAF+AYHP
Sbjct  6     KKFITSEELKKHDKKGDLWISIQGKVYNVSDWAKEHPGGEIPLLNLAGQDVTDAFIAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GYY+SD +VSEVSKDYR LVSEF ++GLFEKK H+  +   +++ MF 
Sbjct  66    GTAWKYLDKFFTGYYLSDFKVSEVSKDYRRLVSEFVKLGLFEKKEHVTLFTLTSVAIMFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGVV   SV AH+GS +L+G LW+Q+ +VGHDSGHY+VM ++  ++ AQ++ GNCLT
Sbjct  126   IVVYGVVGCSSVLAHLGSGMLLGLLWMQSTYVGHDSGHYEVMSSRSYNKLAQIICGNCLT  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S++LF  S+ S+FY++ ++F+ L+R
Sbjct  186   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSSRLF-GSIKSYFYDRQLTFDPLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQH TFYPV L  AR+N+++Q++  +   K+   +R   I+G+++FW W+P LLS 
Sbjct  245   FLISYQHITFYPV-LCFARLNLYLQTFLLLFSPKRNVPDRLYNIMGILVFWTWFPLLLSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SER+MFV+   ++  +Q +QF LNH A++ + GP  G DW EKQ  GTLDI CS W
Sbjct  304   LPNWSERLMFVLACFVVCSIQHLQFCLNHFAANVYVGPPKGNDWFEKQTSGTLDISCSTW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PR QLRKVSP V  LC+KH + Y   SF  AN    K++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRAQLRKVSPLVIDLCKKHNLPYRSLSFVEANLWTLKTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARD+    A +NL+WEA N+ G
Sbjct  424   TAALQARDMVDPSA-QNLLWEAFNTHG  449



>gb|AAN03619.1|AF406816_1 sphingolipid long chain base delta 8 desaturase [Aquilegia vulgaris]
Length=446

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 335/447 (75%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             ++ IT+EELKKH+K GD+W+SI GK+YDVS+W+  HPGGE PLL+LAGQDVTDAF+A+HP
Sbjct  5     RREITSEELKKHNKHGDIWISIQGKIYDVSEWIKDHPGGEAPLLNLAGQDVTDAFVAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GY + D+ +SEVSKDYR LV+EFS+ GL++KKGH + +    ++ +  
Sbjct  65    GSAWKYLDKFFIGY-LKDYTISEVSKDYRKLVAEFSKAGLYDKKGHHILFSLTFVTILMA  123

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+ GV+  +  WAH+ SA ++G LW+Q G+VGHDSGHY++M T KL+R  Q+  GNC+T
Sbjct  124   ISVMGVLCSDKTWAHLASAAVLGLLWMQIGFVGHDSGHYNIMLTPKLNRFMQIFTGNCIT  183

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIA N +DYDPD+Q +P  A S+ +F SSL S FY + M+F+ +AR
Sbjct  184   GISIGWWKWNHNAHHIAVNSLDYDPDLQHIPFLAVSSDIF-SSLTSKFYGRKMTFDPIAR  242

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+S+QHWTFYPVM  IARIN+F QS+  +L  K+   +RA E+LGL++FW WY  LL+ 
Sbjct  243   FLISFQHWTFYPVMA-IARINLFAQSF-ILLLSKRPVTDRALELLGLMVFWCWYSLLLAC  300

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER M+V +S  ++G Q IQF LNH ++  + GP    DW EKQ  G  DI CS W
Sbjct  301   LPNWGERAMYVAMSFAVSGYQHIQFCLNHFSAHTYVGPPPCNDWFEKQTKGPFDISCSTW  360

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LRK+SPFVK+LC KH + Y   SF+ AN +   ++R
Sbjct  361   MDWFHGGLQFQVEHHLFPRLPRCHLRKISPFVKELCRKHNLPYISVSFFEANKMTIATLR  420

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARDL+    PKNLVWEA+N+ G
Sbjct  421   NAALQARDLT-NPIPKNLVWEAVNTHG  446



>gb|ADC80921.1| delta-8 sphingolipid desaturase [Vernicia fordii]
Length=447

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 342/449 (76%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G +K++T+EELK+H++ GDLW+SI GKVY+VSDWV  HPGG+ PLL+LAGQDVTDAF+AY
Sbjct  3     GERKYMTSEELKQHNRHGDLWISIQGKVYNVSDWVKEHPGGDIPLLNLAGQDVTDAFMAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L + F GYY+ D +VS+VS+D+R L  EF+++GLF+ KGH+  Y  A++  +
Sbjct  63    HPGTAWKYLDKLFTGYYLDDFKVSDVSRDFRKLNLEFAKLGLFDMKGHVALYSLASVVFL  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F + +YGV++ +S WAHMGSAV +G LWI + +VGHDSGHY VM +   ++ AQLL+GNC
Sbjct  123   FYIVVYGVLYCQSFWAHMGSAVSLGILWIISAYVGHDSGHYQVMLSPAFNKLAQLLSGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHH+ACN +DYDPD+Q +P FA S+ LF +S+ S FY + M+F+ L
Sbjct  183   LTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPFFAVSSNLF-NSIRSCFYGRNMNFDPL  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWTFYPVM  +AR+N+++Q+   +   +K+  +RA  I+G+++FW W+P L+
Sbjct  242   ARFFVSYQHWTFYPVM-CVARVNLYLQTLLLLFSNRKV-PDRALNIMGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LP+  ER++FV+ S  +T +Q IQF LNH +++ + GP  G DW EKQ  GTLDI CS
Sbjct  300   SCLPDWPERVIFVLTSFAVTSLQHIQFCLNHFSANVYLGPPNGNDWFEKQTSGTLDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDW +GGLQFQ+EHHLFPR+PRCQLRKVSP V+ LC+KH + Y   SFW AN    ++
Sbjct  360   SWMDWAYGGLQFQLEHHLFPRLPRCQLRKVSPLVRDLCKKHNLPYRSLSFWEANVWTIRT  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARD++    PKNLVWEA+++ G
Sbjct  420   LRIAALQARDMT-NPVPKNLVWEAVHTHG  447



>gb|AAP23035.1| sphingolipid delta-8 desaturase [Primula vialii]
Length=452

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/446 (57%), Positives = 324/446 (73%), Gaps = 4/446 (1%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
              +IT+ +LK H+K G+LW+SIHG+VYDVS W   HPGG  PL++LAG DVTDAFLAYHP 
Sbjct  11    SYITSSDLKGHNKAGNLWISIHGEVYDVSSWAGLHPGGSAPLMALAGHDVTDAFLAYHPP  70

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
               A  L        + +H VS  S DYR L+  F ++GLF+ K H       A+ A+F +
Sbjct  71    STARLLPPLSTNLLLQNHSVSPTSSDYRKLLHNFHKIGLFQTKSHTTCVTFVAMVALFFL  130

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             SLYGV   +S W H+ S  ++G  WIQ+GW+GHDSGHY +M ++K +R AQ+L+GNCL G
Sbjct  131   SLYGVFCSDSAWVHLASGGVMGVAWIQSGWLGHDSGHYQIMSSRKTNRFAQVLSGNCLAG  190

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             +SI WW+WNHNAHH+ACN +DYDPD+Q +P F  S+K F  SL S FY++ + F+S++RF
Sbjct  191   ISIAWWKWNHNAHHLACNSLDYDPDLQHMPFFVVSSKFF-GSLTSRFYDRKLRFDSVSRF  249

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
             LVSYQHW+FYPVM L ARIN+F QS+  +LF  +   +R QEI G+ +FWVWYP L+S L
Sbjct  250   LVSYQHWSFYPVMCL-ARINLFAQSF-MLLFSSRKVPDRFQEIFGIGVFWVWYPLLVSCL  307

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ERIMFVV S  +TG+Q +QF LNH ++  + GP  G DW EKQ  GTL+I C  WM
Sbjct  308   PNWGERIMFVVASFRVTGIQHVQFCLNHFSAEVYLGPPEGNDWFEKQTAGTLNISCPSWM  367

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQIEHHLFPR+PR QLRKVSPFV+ LC+KH +AYN ASF  AN L  K++R+
Sbjct  368   DWFHGGLQFQIEHHLFPRLPRSQLRKVSPFVRDLCKKHNLAYNIASFTMANVLTLKTLRN  427

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AA+ ARDLS    PKNLVWEA+N+ G
Sbjct  428   AAIQARDLS-NPTPKNLVWEAVNTHG  452



>ref|XP_011093077.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Sesamum indicum]
Length=449

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 334/447 (75%), Gaps = 3/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++ELKKH+KP DLW+S+ GKVY+V++W   HPGG  PLL LAGQDVTDAF+A+HP
Sbjct  6     KKYITSDELKKHNKPDDLWLSVQGKVYNVTEWAKIHPGGATPLLHLAGQDVTDAFIAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL RFF GY++ D QVS+VSKDYR LV++F++ G+F+KKGH V Y    ++ +F 
Sbjct  66    GSAWKHLDRFFTGYHLEDFQVSDVSKDYRKLVTQFTKSGMFQKKGHGVIYSMCFIALLFY  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV++ +S W HM SA ++G  W+Q  ++GHDSGHY++M     ++ AQ++ GNCLT
Sbjct  126   ACLYGVLYCKSFWIHMLSAAILGIAWMQVTYLGHDSGHYEIMMNPGFNKLAQIVTGNCLT  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q LP FA S++LF+ SL+S FY + ++F+S+AR
Sbjct  186   GISIAWWKWTHNAHHVACNSLDHDPDLQHLPFFAVSSRLFQ-SLMSQFYGRKLTFDSMAR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH TFYPVM  +AR+N+++Q+   +   K+   +RA  I G+++FW W+P LLS 
Sbjct  245   FLVSYQHLTFYPVM-CVARVNLYVQTLLLLFSPKRRVPDRALNIFGVVVFWTWFPLLLSH  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ERI+FV+ S  +T +Q IQF LNH A++ + G   G DW EKQ  GT+DI CSP 
Sbjct  304   LPNWNERILFVLASFCVTSIQHIQFCLNHFAANVYVGAPKGNDWFEKQTSGTIDISCSPQ  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR +SP V+ LC+KH + Y   SF  AN L F++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRNISPLVQDLCKKHNLPYRSLSFLDANKLTFRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARD S    PKNL+WEA+N+ G
Sbjct  424   TAAMEARDFS-SPVPKNLLWEAVNTHG  449



>ref|XP_011093109.1| PREDICTED: delta(8)-fatty-acid desaturase [Sesamum indicum]
Length=448

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 332/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +K+IT++ELKKH+K  DLW+SI GKVY+V+DW   HPGG+ PLL+LAGQDVTDAF+A+HP
Sbjct  6     EKYITSDELKKHNKSDDLWISIQGKVYNVTDWAKVHPGGDIPLLNLAGQDVTDAFIAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL RFF GYY+ D QVSEVSKDYR L +EF++ G+FEKKGH V Y    +S +  
Sbjct  66    GSAWKHLDRFFTGYYLEDFQVSEVSKDYRRLAAEFAKSGMFEKKGHGVIYSLCFVSVLLF  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
                YGV+F +S   HM S  L+GF W+Q  ++GHDSGHY +M T+  ++ AQ+L GNCLT
Sbjct  126   ACFYGVLFSDSFSIHMLSGALLGFSWMQVAYMGHDSGHYQIMMTRGCNKLAQILTGNCLT  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q LP  A S  LF+ SL S FY + ++F+S AR
Sbjct  186   GISIAWWKWTHNAHHVACNSLDHDPDLQHLPFLAVSASLFQ-SLTSVFYGRKLTFDSFAR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH TFYPVM  +AR+N+++Q++  +LF K+   +RA  ILG+++FW W+P L+S 
Sbjct  245   FFVSYQHLTFYPVM-CVARVNLYVQTF-LLLFSKRKVPDRALNILGILVFWTWFPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER++FV++S  +T +Q +QF LNH A++ + G   G DW EKQ  GT+DI CS W
Sbjct  303   LPNWNERVLFVLVSFCVTSIQHVQFCLNHFAANVYIGAPKGNDWFEKQTSGTIDIACSAW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRK+SP V++LC+KH + Y   SF+ AN    K++R
Sbjct  363   MDWFFGGLQFQLEHHLFPRLPRCHLRKISPLVQELCKKHNLPYRSLSFFEANIWTLKTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDLS     KNL+WEA+N+ G
Sbjct  423   TAALEARDLS-SPVSKNLLWEAVNTHG  448



>gb|AFX61783.1| fatty acid desaturase 2 [Musa AB Group]
Length=453

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 334/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+ I++EEL+ H+ P DLW+SI GKVYD + WV  HPGGE PL +LAGQDVTDAF+AYHP
Sbjct  11    KRSISSEELRLHNTPSDLWISIQGKVYDATHWVKDHPGGELPLFNLAGQDVTDAFVAYHP  70

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A   L R     Y+SD++VS+VSKDYR L+++ S+ GLF+KKGH+       +  MF 
Sbjct  71    GTAWSLLDRLPLVGYLSDYRVSDVSKDYRRLITDISKKGLFDKKGHITFIVLCHMCLMFA  130

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGVV   SVW H+G AV++GFLW+Q+G++GHDSGHY ++  + ++R  Q++ GNCL 
Sbjct  131   AVVYGVVCSPSVWVHLGCAVVLGFLWMQSGFLGHDSGHYRILSGRLVNRIMQVVTGNCLA  190

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +D+DPD+Q +P+FA S++LFR  L S FYE+ MSF+ + R
Sbjct  191   GISIEWWKRNHNAHHIACNSLDFDPDLQHIPVFAVSSELFR-GLTSCFYERKMSFDGVTR  249

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQHWTFYPVM  +AR+N+F QS   +L  K++   R+ E++GL +FWVW+P L+S 
Sbjct  250   SLVSYQHWTFYPVM-CVARLNLFAQSVLLLLSNKRV-QGRSLELVGLGVFWVWFPLLVSY  307

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER+MFVV+S  +TG+Q +QF LNH +SS + G   G DW EKQ  GTLDI C PW
Sbjct  308   LPSWGERVMFVVVSFAVTGIQHVQFCLNHFSSSVYVGQPRGNDWFEKQTMGTLDITCEPW  367

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+ RCQLR+++P V++LC+KHG+ Y+  SFW AN    +++R
Sbjct  368   MDWFHGGLQFQVEHHLFPRLSRCQLRRIAPLVRELCKKHGLPYDSFSFWEANVRTIRTLR  427

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    PKNLVWEA+N+ G
Sbjct  428   TAALQARDLA-NPVPKNLVWEAVNTHG  453



>ref|XP_007153598.1| hypothetical protein PHAVU_003G049200g [Phaseolus vulgaris]
 gb|ESW25592.1| hypothetical protein PHAVU_003G049200g [Phaseolus vulgaris]
Length=446

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/448 (58%), Positives = 331/448 (74%), Gaps = 6/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              KK+IT+EELK+HDKPGDLW+SI GKVY+VSDW   HPGGE PLL+LAGQDVTDAF+AYH
Sbjct  5     NKKYITSEELKRHDKPGDLWISIQGKVYNVSDWAKDHPGGEVPLLNLAGQDVTDAFIAYH  64

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  HL  FF GY+V D +VSEVSKDYR LVSEF +MGLFEKK H+  +  A++S MF
Sbjct  65    PGSAWKHLDPFFTGYHVRDFKVSEVSKDYRKLVSEFVKMGLFEKKEHVTLFTLASVSVMF  124

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              V +YGVV   SVWAH GSA+L+G LW+Q+ +VGHDSGHY+VM     ++ AQ+L GNC+
Sbjct  125   AVVVYGVVGCTSVWAHFGSALLLGLLWMQSTYVGHDSGHYEVMSGPGYNKLAQILCGNCM  184

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHHI+CN +D+DPD+Q +P+FA S + F  S+ S FY + + F+ L+
Sbjct  185   TGISIAWWKWTHNAHHISCNSLDHDPDLQHIPVFAVSTRFF-DSIRSSFYGRKLEFDWLS  243

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFL+SYQH TFYPV L  AR+N+++Q+   +  ++K+  +RA  I+G+++FW W+P L+S
Sbjct  244   RFLISYQHLTFYPV-LCFARVNLYLQTLLLLFSRRKV-PDRAMNIMGILVFWTWFPLLIS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN  ER MFV+ S     +Q +QF LNH A+  + GP  G DW +KQ  GTLDI CS 
Sbjct  302   CLPNWGERFMFVLASFAACSIQHLQFCLNHFAADVYEGPPNGNDWFQKQASGTLDISCSS  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWF GGLQFQ+EHHLFPR+PR QLRKVSP V  LC+KH + Y   +F  AN    K++
Sbjct  362   WMDWFFGGLQFQLEHHLFPRLPRAQLRKVSPLVIDLCKKHNLPYRSLTFIEANLRTLKTL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL AR  S   +P+NL+WEA N+ G
Sbjct  422   RTAALQARTHS---SPQNLLWEAFNTHG  446



>ref|XP_009392458.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Musa acuminata 
subsp. malaccensis]
Length=450

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/449 (58%), Positives = 342/449 (76%), Gaps = 5/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G K++IT EEL+KH+   DLW+SI G VYDV+DW+  HPGG+ PLLSLAGQD TDAF+AY
Sbjct  7     GEKRYITVEELRKHNAATDLWISIQGGVYDVTDWIKDHPGGDLPLLSLAGQDATDAFVAY  66

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HPA A  HL RFF GY +  + V++VS+DYR LV+EFS+ GLF++KG +       +  +
Sbjct  67    HPASAWAHLGRFFVGY-LDGYCVTDVSRDYRRLVAEFSKSGLFDEKGRVALLTICFMLFL  125

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
              + ++ GV+  ES   H     + GFLWIQ+GW+GHDSGHY +++  +L+R AQ+++GNC
Sbjct  126   LVTAVSGVLLSESALVHALCGGMTGFLWIQSGWIGHDSGHYRIVRNPRLNRVAQIISGNC  185

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+ NHNAHHIACN +D+DPD+Q +P+FA S+K F +S+ S+FYE+ M+F+++
Sbjct  186   LTGLSIGWWKRNHNAHHIACNSLDFDPDLQHMPLFAVSSKFF-ASMTSYFYERKMNFDAV  244

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFL+SYQHWTFYPVM   ARIN+  QS   +L KK +  NR QEI G+ +FW+WYP L+
Sbjct  245   ARFLISYQHWTFYPVMCF-ARINLLAQSILLLLSKKNV-PNRWQEITGVAVFWIWYPLLV  302

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ERI FVV SL +TG+Q +QF LNH +SS + GP  G DW EKQ  GTLD+ CS
Sbjct  303   SCLPNWGERITFVVASLAVTGIQHVQFCLNHFSSSVYVGPPQGNDWFEKQTMGTLDVSCS  362

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQ+EHHLFPR+PRC LRKVSPFV++LC+KH + YN ASFW ANA+  ++
Sbjct  363   PWMDWFHGGLQFQVEHHLFPRLPRCHLRKVSPFVRELCKKHKLPYNIASFWEANAMTVRT  422

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL A+DL+    PKNLVWEA+N+ G
Sbjct  423   LRAAALQAQDLA-NPVPKNLVWEAVNTHG  450



>gb|ADA60230.1| delta-6 desaturase [Ribes nigrum]
Length=448

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/447 (56%), Positives = 330/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +K++T EELK H+KP DLW+SI GKVY+V+DW   HPGG+  LL+L GQDVTDAF+AYHP
Sbjct  6     RKYMTVEELKVHNKPEDLWISIQGKVYNVTDWKKEHPGGDSSLLNLGGQDVTDAFIAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L RFF GYY+ D  VS+VSKDYR L SEF++MGLF KKGH V Y     + +F 
Sbjct  66    GTAWQYLDRFFTGYYLKDFNVSDVSKDYRKLASEFTKMGLFAKKGHGVFYSFCLGAFLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V +YGV++ +S++ H+    ++GFLW+Q+G+ GHDSGHY  M T   +  AQ+L GNCL+
Sbjct  126   VCVYGVLYSQSLFVHLCCGGILGFLWMQSGYAGHDSGHYQTMSTPFYTNLAQILTGNCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+S+ WW+W HNAHH+A N +D+DPD+Q +P F  S KLF + + S FY + + F++ AR
Sbjct  186   GISMAWWKWTHNAHHVAVNSIDHDPDLQYMPFFVLSPKLF-NGITSRFYGRKLEFDAFAR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F+VSYQHWTFYPVM+  AR  MF+ ++  +L KKK+  NR   I G+I+FW+W+P L+S 
Sbjct  245   FMVSYQHWTFYPVMIF-ARFYMFVPTFFMLLSKKKV-PNRPLNIAGIIVFWIWFPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER+MFV++S  +T +Q + F LNH ++  + G  TG DW EKQ  GTLDI C  W
Sbjct  303   LPNWTERMMFVLVSFTVTSIQHVTFCLNHYSADNYMGHPTGNDWFEKQTSGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQIEHHLFPR+PRCQLRKVSPFVK+LC+KH + Y   SF+ AN  + K++R
Sbjct  363   MDWFHGGLQFQIEHHLFPRLPRCQLRKVSPFVKELCKKHNLPYRSLSFFEANVAIIKTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDLS     KNL+WEA+N++G
Sbjct  423   TAALQARDLS-NPISKNLLWEAVNTYG  448



>gb|ADA60232.1| delta-6 desaturase [Ribes nigrum]
Length=448

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 327/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK++T EELK HDKP DLW+SI GKVY+V+DW   HPGG+  LL+L GQDVTDAF+AYHP
Sbjct  6     KKYMTVEELKVHDKPEDLWISIQGKVYNVTDWKKEHPGGDSSLLNLGGQDVTDAFIAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L RFF GYY+ D  VS+VSKDYR L SEF++MGLF KKGH V Y     + +F 
Sbjct  66    GTAWQYLDRFFTGYYLKDFNVSDVSKDYRKLASEFTKMGLFAKKGHGVFYSFCLGAFLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V + GV++ +S++ H+    ++GFLW+Q+G+ GHDSGHY  M T   +  AQ+L GNCL+
Sbjct  126   VCVCGVLYSQSLFVHLCCGGILGFLWMQSGYAGHDSGHYQTMSTPFYTNLAQILTGNCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+S+ WW+W HNAHHIA N +D+DPD+Q +P F  S KLF +S+ S FY + + F++ AR
Sbjct  186   GISMAWWKWTHNAHHIAVNSIDHDPDLQYMPFFVLSPKLF-NSITSRFYGRKLEFDAFAR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F+VSYQHWTFYPVM+  AR  MF+ ++  +LF KK   NR   I G+I+FW+W+P L+S 
Sbjct  245   FMVSYQHWTFYPVMIF-ARFYMFVPTF-FMLFSKKKVPNRPLNIAGIIVFWIWFPLLVSC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER+MFV++S  +T +Q + F LNH ++  + G  TG DW EKQ  GTLDI C  W
Sbjct  303   LPNWTERMMFVLVSFTVTSIQHVTFCLNHYSADNYMGHPTGNDWFEKQTSGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPRMPRCQLRKVSPFVK+LC+KH + Y   SF+ AN    K++R
Sbjct  363   MDWFHGGLQFQLEHHLFPRMPRCQLRKVSPFVKELCKKHNLPYRSLSFFEANVATIKTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDLS     KNL+WEA+N+ G
Sbjct  423   TAALQARDLS-NPITKNLLWEAVNTHG  448



>ref|XP_003544536.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Glycine max]
Length=448

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/447 (58%), Positives = 331/447 (74%), Gaps = 5/447 (1%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
              +I+++EL+KH+   D W+SIHGKVYDVS W++RHPGG  PLLSLAG D TDAFLA HP 
Sbjct  6     SYISSDELRKHNTRHDAWISIHGKVYDVSSWLHRHPGGPLPLLSLAGTDATDAFLALHPP  65

Query  1361  IAAHHL-QRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
              +A  L   F   + +SDH VS  S DYR L S+ S + LF +KGH  S   + +  +F 
Sbjct  66    NSASLLLPAFATPHLLSDHSVSPASSDYRKLFSDLSSLNLFNRKGHTTSILLSLILVLFP  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +SL GV+  +S   H+ S  LVGFLWIQ+GW+GHDSGHY+VM   +L+RA Q+L+GN L+
Sbjct  126   LSLCGVLLSDSTCVHVLSGALVGFLWIQSGWIGHDSGHYNVMLNPRLNRAIQILSGNVLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+WNHNAHHIACN +D+DPD+Q LP F  S+  F +SL S FYE+ M+F+S +R
Sbjct  186   GISIGWWKWNHNAHHIACNSLDFDPDLQHLPFFVVSSSFF-NSLTSRFYERKMNFDSFSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHWTFYPVM   ARIN+F QS+  +L K+K+  NR  E+LGL+ FWVWYP L+S 
Sbjct  245   FLVSYQHWTFYPVMCF-ARINLFAQSFFLLLSKRKV-ENRWSELLGLLAFWVWYPLLVSF  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER++FV +S  +TG+Q +QF LNH +S  + GP +G DW EKQ  GTL +DCSPW
Sbjct  303   LPNWWERVLFVFVSFSVTGIQHVQFCLNHFSSEVYLGPPSGGDWFEKQTKGTLGVDCSPW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LRK++P VK LC+KH + YN  SFW AN L  +++R
Sbjct  363   MDWFHGGLQFQVEHHLFPRLPRCHLRKIAPLVKDLCKKHNLPYNCVSFWKANVLTIQTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARD S +  PKNLVWEA+N+ G
Sbjct  423   NAALQARDGS-KPVPKNLVWEAVNTHG  448



>ref|XP_010413381.1| PREDICTED: delta(8)-fatty-acid desaturase 1 [Camelina sativa]
Length=449

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/447 (55%), Positives = 332/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKH+K GDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITNEELKKHNKSGDLWIAIQGKVYNVSDWIKSHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F GY++ D +VS+VS+DYR + +EF ++GLF+ KGH+  Y  + ++AMF+
Sbjct  67    GTAWHHLDNLFTGYHIKDFEVSQVSRDYRRMAAEFRKLGLFDNKGHVTLYTLSFIAAMFV  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  +A L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   GVLYGVLACSSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +SL S FY++ ++F+ +AR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-TSLTSRFYDRKLTFDPVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF ++   +RA    G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSRREVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GT+DI C  +
Sbjct  304   LPSWPERFFFVFTSFAVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPRMPRC LRKVSP V++LC+KH + Y   S++ AN L   +++
Sbjct  364   MDWFYGGLQFQLEHHLFPRMPRCHLRKVSPVVQELCKKHNLPYRSLSWFDANVLTISTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   KAAYQARD-AANPVVKNLVWEALNTHG  449



>ref|XP_009138767.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Brassica rapa]
 emb|CDX89123.1| BnaA04g00630D [Brassica napus]
Length=449

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/447 (56%), Positives = 336/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT E+L KH+ PGDLW++I GKVYDVSDW+  HPGGE  +++LAGQDVTDAF+A+HP
Sbjct  7     KKYITKEDLSKHNTPGDLWIAIQGKVYDVSDWIKSHPGGEALIVNLAGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F GY++ D QVSE+S+DYR L +EF ++GLFEKKGH+  Y  A ++A+F 
Sbjct  67    GTAWHHLNSLFTGYHIGDSQVSEISRDYRRLAAEFRKLGLFEKKGHVTLYTLAFVAALFA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV AH  +A ++G LW+Q+ ++GHDSGHY +MK K  ++ AQLL+GNC+T
Sbjct  127   AVLYGVLACTSVVAHQIAAAILGLLWMQSAYIGHDSGHYVIMKNKSYNKFAQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH++CN +DYDPDVQ +P+FA S+K F +S+ S FY++ ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHLSCNSLDYDPDVQHIPVFAVSSKFF-NSMTSRFYDRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF K+ F +RA  + G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSKREFPDRALNLAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER  FV+ S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C+ +
Sbjct  304   LPSWPERFFFVLTSFTVTALQHIQFTLNHFAADVYMGPPTGNDWFEKQTAGTLDISCTSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKVSP V++LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCKKHNLQYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   KAAYQARD-AANPVVKNLVWEALNTHG  449



>ref|XP_010469097.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like isoform X2 [Camelina 
sativa]
Length=449

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 331/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELK H+K GDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITNEELKNHNKSGDLWIAIQGKVYNVSDWIKSHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F GY++ D +VS+VS+DYR + +EF ++GLF+ KGH+  Y  + ++AMF+
Sbjct  67    GTAWHHLDNLFTGYHIKDFEVSQVSRDYRRMAAEFRKLGLFDNKGHVTLYTLSFIAAMFV  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  +A L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   GVLYGVLACSSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +SL S FY++ ++F+ +AR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-TSLTSRFYDRKLTFDPVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF ++   +RA    G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSRREVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GT+DI C  +
Sbjct  304   LPSWPERFFFVFTSFAVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPRMPRC LRKVSP V++LC+KH + Y   S++ AN L   +++
Sbjct  364   MDWFYGGLQFQLEHHLFPRMPRCHLRKVSPVVQELCKKHNLPYRSLSWFDANVLTISTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   KAAYQARD-AANPVVKNLVWEALNTHG  449



>gb|ADA60231.1| delta-6 desaturase [Ribes nigrum]
Length=448

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/447 (56%), Positives = 330/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELK+H+K  DLW+SI GKVY+V+ W   HPGG+  LL+L GQDVTDAF+AYHP
Sbjct  6     KKYITVEELKEHNKSEDLWISIQGKVYNVTLWKKEHPGGDSSLLNLGGQDVTDAFIAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             + A  +L +FF GYY+ D  VS+VSKDYR L  EF++MGLFEKKGH V Y     + +F 
Sbjct  66    STAWQYLDKFFTGYYLKDFIVSDVSKDYRKLAYEFTKMGLFEKKGHGVLYSFCLGAFLFA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V +YG+++ ESV+ H+    ++G LWIQ+G+ GHDSGHY  M +   +  AQ+  GNCL+
Sbjct  126   VCVYGLLYSESVFVHLCCGGILGLLWIQSGYAGHDSGHYQTMSSPFYTNLAQIFTGNCLS  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+S+ WW+W HNAHHIA N +D+DPD+Q +P F  S KLF +S+ S FY + + F++ AR
Sbjct  186   GISMAWWKWTHNAHHIAVNSIDHDPDLQYMPFFVLSPKLF-NSITSRFYGRKLEFDAFAR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F+VSYQHWTFYPVM+  AR  MF+ ++  +L K+K+  NRA  I+G+I+FW+W+P L+S 
Sbjct  245   FVVSYQHWTFYPVMIF-ARFYMFVPTFFMLLSKRKV-PNRALNIVGIIVFWIWFPLLISG  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER+MFV++S  +T +Q I F LNH ++  + G  TG DW EKQ  GTLDI C  W
Sbjct  303   LPNWTERMMFVLVSFTVTSIQHITFCLNHYSADNYMGHPTGNDWFEKQTSGTLDISCPSW  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRCQLRKVSPFVK+LC+KH + Y   SF+ AN    K++R
Sbjct  363   MDWFHGGLQFQLEHHLFPRLPRCQLRKVSPFVKELCKKHNLPYRSLSFFEANVATIKALR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDLS     KNL+WEA+N++G
Sbjct  423   TAALQARDLS-NPISKNLLWEAVNTYG  448



>ref|XP_008344403.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Malus domestica]
Length=447

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/447 (56%), Positives = 329/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+I+ EELKKH+KPGDLW+SI GKVY+VSDW   HPGG+  L +L G DVTDAF+AYHP
Sbjct  5     KKYISVEELKKHNKPGDLWISIQGKVYNVSDWTKDHPGGDTILYNLGGLDVTDAFIAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L++F  G Y+ D +VSEVSKDYR + +EFS+ GLFEKKGH        +S MF 
Sbjct  65    RTAWQYLKKFSTGIYLKDFEVSEVSKDYRRMATEFSKAGLFEKKGHGALCSITIISIMFC  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+YGV+  +SV  H+ S +L+G LWI+  +VGHD GHY VM ++  +  AQ++AGNCLT
Sbjct  125   LSVYGVLKSDSVLVHLMSGMLLGMLWIEGAYVGHDCGHYQVMPSQLCNNIAQIVAGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F +S+ S FY + ++F+ LAR
Sbjct  185   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSTKFF-NSITSIFYGRVLTFDPLAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM ++ R+N+FIQ++  +L  ++   NR   I+G+++FW W+P L+S 
Sbjct  244   FLVSYQHFTYYPVM-MVGRVNLFIQTF-LLLCSRRDVPNRGLNIMGILVFWTWFPLLVSC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SER+MFV+ +  +T +Q IQF+LNH +   + G   G DW EKQ  GT+DI CS  
Sbjct  302   LPNWSERVMFVLAAFAVTSLQHIQFTLNHFSGDTYLGAPNGNDWFEKQAAGTVDISCSTK  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPRMPR QLRK++P VK+LC+KH + Y   SFW AN    +++R
Sbjct  362   MDWFFGGLQFQLEHHLFPRMPRGQLRKIAPTVKELCKKHNLPYRSLSFWEANKATLRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARDLS    PKNLVWEALN+ G
Sbjct  422   TAAXQARDLS-NPVPKNLVWEALNTHG  447



>ref|XP_010669699.1| PREDICTED: delta(8)-fatty-acid desaturase [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/448 (54%), Positives = 329/448 (73%), Gaps = 3/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             TKK+IT+EELK H+KP DLW+SI GK+YDV++W   HPGG+ PLL+LAG DVTDAF+AYH
Sbjct  6     TKKYITSEELKVHNKPEDLWISIQGKIYDVTNWSKEHPGGDIPLLALAGNDVTDAFIAYH  65

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P    H L +FFNGYY+ D+QVSE+SKDYR L ++ S+MGLFEKKGH V Y   ++  MF
Sbjct  66    PGTTWHLLDKFFNGYYLKDYQVSEMSKDYRRLHNDLSKMGLFEKKGHGVIYIFISIFIMF  125

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              + + GV++ +S+  H+    L+G  WIQ+ ++GHDSGHY +M T   ++ AQ+L GNCL
Sbjct  126   TLCVLGVLYSDSMLVHLCCGALLGMAWIQSAYLGHDSGHYQIMATPGYNKVAQILTGNCL  185

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+S+ WW+W HNAHHI CN +D DPD+Q +P+FA S K F  ++ S FY + M F+ +A
Sbjct  186   TGISMAWWKWTHNAHHILCNSLDNDPDLQHIPVFAVSTKFFH-NMTSVFYGRKMDFDPVA  244

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFLVSYQH T+YPVM ++ARIN+++Q++  +L   +   NR   I+G+++FW WYP L+S
Sbjct  245   RFLVSYQHMTYYPVM-VVARINLYVQTFLLLLNPNRKIINRGLNIMGIMVFWTWYPLLVS  303

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LP   ERI+FV+ S ++T  Q IQF+LNH ++  + G   G DWVEKQ  G++DI+ + 
Sbjct  304   CLPTWEERILFVLSSFVVTAFQHIQFTLNHFSADVYVGQPKGNDWVEKQTFGSIDINVAS  363

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             +MDW  GGLQFQ+EHHLFPR+PRC LRKVSP VK LC+KH + Y   +FW AN    K++
Sbjct  364   YMDWLFGGLQFQLEHHLFPRLPRCNLRKVSPVVKDLCKKHNMPYRSLTFWEANISTLKTL  423

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             RDAAL ARDL+    PKNL+WEA+N+ G
Sbjct  424   RDAALQARDLT-NPVPKNLLWEAVNTHG  450



>ref|XP_010469096.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like isoform X1 [Camelina 
sativa]
Length=449

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 330/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELK H+K GDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITNEELKNHNKSGDLWIAIQGKVYNVSDWIKSHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A H+L   F GY++ D +VS+VS+DYR + +EF ++GLF+ KGH+  Y  + ++AMF+
Sbjct  67    GTAWHNLDNLFTGYHIKDFEVSQVSRDYRRMAAEFRKLGLFDNKGHVTLYTLSFIAAMFV  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  SA L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   GVLYGVLSCTSVFAHQISAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +SL S FY++ ++F+ +AR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-TSLTSRFYDRKLTFDPVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF ++   +RA    G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSRREVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GT+DI C  +
Sbjct  304   LPTWPERFFFVFTSFAVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPRMPRC LRKVSP V++LC+KH + Y   S++ AN L   +++
Sbjct  364   MDWFYGGLQFQLEHHLFPRMPRCHLRKVSPVVQELCKKHNLPYRSLSWFDANVLTISTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   KAAYQARD-AANPVVKNLVWEALNTHG  449



>gb|AAM64895.1| delta-8 sphingolipid desaturase [Arabidopsis thaliana]
Length=449

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 331/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT E+LKKH+K GDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITNEDLKKHNKSGDLWIAIQGKVYNVSDWIKTHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F GY++ D QVSEVS+DYR + +EF ++GLFE KGH+  Y  A ++AMFL
Sbjct  67    GTAWHHLDHLFTGYHIRDFQVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTLAFVAAMFL  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  +A L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   RVLYGVLACTSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F SSL S FY++ ++F+ +AR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-SSLTSRFYDRKLTFDPVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF K+   +RA    G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSKREVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER  FV     +T +Q IQF+LNH A+  + GP TG DW EKQ  GT+DI C  +
Sbjct  304   LPNWPERFFFVFTGFTVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKVSP V++LC+KH + Y   S++ AN L   +++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCKKHNLPYRSMSWFEANVLTINTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD++     KNLVWEALN+ G
Sbjct  424   TAAYQARDVA-NPVVKNLVWEALNTHG  449



>ref|XP_009338790.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Pyrus x bretschneideri]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/449 (54%), Positives = 332/449 (74%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK+IT E+LK H+KP DLW+SI GKVY+++DW   HPGG+  L +++GQDVTD F+AY
Sbjct  3     GEKKYITVEQLKLHNKPSDLWISIQGKVYNITDWAKDHPGGDAILFNMSGQDVTDGFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GYY+ D ++SEVSKDYR L SEF+++GLFE KGH   Y   ++  M
Sbjct  63    HPPSAWKYLGKFFTGYYLKDFEISEVSKDYRKLASEFNQLGLFENKGHGALYSVISILVM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H G   L+G LW+Q  ++GHDSGHY VM +++ ++ AQ LAGNC
Sbjct  123   LYLVVYGVLKSESVLVHFGCGCLLGVLWVQGAYMGHDSGHYQVMSSRRYNKLAQFLAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S+K F+ S+ S FY + ++F+++
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHMPVFAVSSKFFQ-SITSTFYGRELTFDAV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVS+QH+T+YP+M ++ R+N+FIQ++  +LF K+   +RA  I+G+++FW W+P L+
Sbjct  242   ARFLVSHQHFTYYPIM-IVGRVNLFIQTF-LLLFSKRSIPDRALNIMGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN SER MFV+ S  +T +Q IQF+LNH     + GP TG DW EKQ  GT+DI CS
Sbjct  300   SCLPNWSERFMFVLASFTVTALQHIQFTLNHFTGDTYLGPPTGNDWFEKQTAGTVDILCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPR+PR QLRK+SP VK+LC+KH + Y   SF  AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRLPRSQLRKISPTVKELCKKHNLPYKSLSFLDANVTTIRM  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+AA  A D++    PKNL WEA+N+ G
Sbjct  420   LRNAAQQAWDMA-LPVPKNLAWEAVNTHG  447



>ref|XP_003628379.1| Delta-8 sphingolipid desaturase [Medicago truncatula]
 gb|AET02855.1| fatty acid/sphingolipid desaturase [Medicago truncatula]
Length=449

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 337/447 (75%), Gaps = 3/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELKKHDK GDLW+SI GKVY+VSDW  +HPGGE  LL+LAGQDVTDAF+AYHP
Sbjct  6     KKYITSEELKKHDKEGDLWISIQGKVYNVSDWAKKHPGGEVVLLNLAGQDVTDAFIAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL +FF GYY+ D +VSEVSKDYR LVSEF +MGLFEKK H+  +   +++ M  
Sbjct  66    GSAWKHLDQFFTGYYLEDFKVSEVSKDYRRLVSEFVKMGLFEKKEHVALFTLTSVAIMLA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGVV   SVWAH+GS +L+G LW+Q+ ++GHDSGHY+VM ++  ++ AQ+L GNC+T
Sbjct  126   IVVYGVVGCTSVWAHLGSGMLLGLLWMQSTYIGHDSGHYEVMSSRSYNKLAQILCGNCMT  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S++ F  S+ S+FY++ + F++L+R
Sbjct  186   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSSRFF-GSIKSYFYDRQLKFDALSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQH TFYPV L  AR+N+++Q++  +    +   +R   I+G+ +FW W+P LLS+
Sbjct  245   FLISYQHITFYPV-LCFARLNLYLQTFLLLFSPSRNVPDRLYNIMGIGVFWTWFPLLLSA  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER+MFV+   ++  +Q +QF LNH A++ + GP +G DW +KQ  GTLDI CS W
Sbjct  304   LPSWPERLMFVLACFVVCSIQHLQFCLNHFAANVYLGPPSGNDWFQKQTAGTLDITCSTW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PR QLRKVSP V  LC+KH + Y   SF  AN    K++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRAQLRKVSPLVIDLCKKHNLPYRSLSFVEANLWTLKTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARD +   AP+NL+WEA N+ G
Sbjct  424   TAALQARDFT-NSAPQNLLWEAFNTHG  449



>ref|XP_010512510.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Camelina sativa]
Length=450

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 329/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELK H+K GDLW++I GKVY+VSDW+  HPGGE  +L+L GQDVTDAF+A+HP
Sbjct  8     KKYITNEELKNHNKSGDLWIAIQGKVYNVSDWIKSHPGGETVILNLVGQDVTDAFIAFHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A H+L   F GY++ D +VS+VS+DYR + +EF ++GLF+ KGH+  Y  + ++AMF+
Sbjct  68    GTAWHNLDNLFTGYHIKDFEVSQVSRDYRRMAAEFRKLGLFDNKGHVTLYTLSFIAAMFV  127

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  SA L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  128   GVLYGVLACTSVFAHQISAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  187

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +SL S FY++ ++F+ +AR
Sbjct  188   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-TSLTSRFYDRKLTFDPVAR  246

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF ++   +RA    G+++FW W+P L+S 
Sbjct  247   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSRREVPDRALNFAGILVFWTWFPLLVSC  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER  FV  S  +T +Q IQF+LNH A+  + GP  G DW EKQ  GT+DI C  +
Sbjct  305   LPTWPERFFFVFTSFAVTALQHIQFTLNHFAADVYVGPPKGSDWFEKQAAGTIDISCRSY  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPRMPRC LRKVSP V++LC+KH + Y   S++ AN L   +++
Sbjct  365   MDWFYGGLQFQLEHHLFPRMPRCHLRKVSPVVQELCKKHNLPYRSLSWFDANVLTISTLK  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  425   KAAYQARD-AANPVVKNLVWEALNTHG  450



>ref|NP_191717.1| Fatty acid/sphingolipid desaturase [Arabidopsis thaliana]
 sp|Q9ZRP7.1|SLD1_ARATH RecName: Full=Delta(8)-fatty-acid desaturase 1; AltName: Full=Delta(8)-sphingolipid 
desaturase 1; AltName: Full=Sphingoid 
long-chain base desaturase 1; Short=Sphingoid LCB desaturase 
1 [Arabidopsis thaliana]
 gb|AAL16189.1|AF428420_1 AT3g61580/F2A19_180 [Arabidopsis thaliana]
 emb|CAA11858.1| delta-8 sphingolipid desaturase [Arabidopsis thaliana]
 emb|CAB71088.1| delta-8 sphingolipid desaturase [Arabidopsis thaliana]
 gb|AAN17419.1| delta-8 sphingolipid desaturase [Arabidopsis thaliana]
 gb|AAO30042.1| delta-8 sphingolipid desaturase [Arabidopsis thaliana]
 gb|AEE80226.1| Fatty acid/sphingolipid desaturase [Arabidopsis thaliana]
Length=449

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 332/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT E+LKKH+K GDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITNEDLKKHNKSGDLWIAIQGKVYNVSDWIKTHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F GY++ D QVSEVS+DYR + +EF ++GLFE KGH+  Y  A ++AMFL
Sbjct  67    GTAWHHLDHLFTGYHIRDFQVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTLAFVAAMFL  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  +A L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   GVLYGVLACTSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F SSL S FY++ ++F+ +AR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-SSLTSRFYDRKLTFDPVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF K+   +RA    G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSKREVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GT+DI C  +
Sbjct  304   LPNWPERFFFVFTSFTVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKVSP V++LC+KH + Y   S++ AN L   +++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCKKHNLPYRSMSWFEANVLTINTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD++     KNLVWEALN+ G
Sbjct  424   TAAYQARDVA-NPVVKNLVWEALNTHG  449



>ref|XP_006847040.1| hypothetical protein AMTR_s00017p00184030 [Amborella trichopoda]
 gb|ERN08621.1| hypothetical protein AMTR_s00017p00184030 [Amborella trichopoda]
Length=470

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/448 (55%), Positives = 335/448 (75%), Gaps = 6/448 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K++ ++EEL+ H+ P DLW+SI GKVY+V+DW+  HPGG+ PLL+LAGQDVTD F+AYHP
Sbjct  28    KRYFSSEELQSHNTPNDLWISIQGKVYNVTDWLEFHPGGDLPLLNLAGQDVTDVFVAYHP  87

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAA-ALSAMF  1188
               A   L +FF GY + D+Q S+VSKDYR L S+  +MG+F++KG L  Y  A +++ M 
Sbjct  88    GSAWKFLDKFFVGY-LRDYQASDVSKDYRKLASDLKKMGVFDQKGALFLYLCALSMALML  146

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +  YGV+  +  W H+G   ++G +W Q+GWVGHDSGHY V+   KL+R  Q+L GNCL
Sbjct  147   AICFYGVLGSDKFWVHIGCGCIMGMIWTQSGWVGHDSGHYQVLSNGKLNRFLQVLTGNCL  206

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+ NHNAHHIACN +++DPD+Q +P+FA S++ F SSL SHFY + M F+ ++
Sbjct  207   TGLSIAWWKNNHNAHHIACNSLEFDPDLQHMPLFAVSSRFF-SSLNSHFYNRKMVFDRIS  265

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             R+LVSYQHWTFYPVM   ARIN+  QS   ++ +KK+   R QE+LG+++FW+W+P+L+ 
Sbjct  266   RYLVSYQHWTFYPVMCF-ARINLLAQSIFFLITQKKV-PKRNQELLGVLVFWLWFPYLVV  323

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN SERI+F++ S  +TG+Q +QF LNH ++S + G   G DW E Q  G+LDI CSP
Sbjct  324   CLPNWSERILFIICSFSVTGIQHVQFCLNHFSASVYVGRPKGNDWFEAQTKGSLDISCSP  383

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+EHHLFPR+PR QLRKV+P V+ LC+KHG+ Y   +FW AN++   ++
Sbjct  384   WMDWFHGGLQFQVEHHLFPRLPRWQLRKVAPLVRALCKKHGLPYVSVTFWEANSMTIGTL  443

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL ARDLS   APKNL+WEA+N+ G
Sbjct  444   RAAALQARDLS-NPAPKNLLWEAVNANG  470



>ref|XP_002876622.1| delta-8 sphingolipid desaturase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52881.1| delta-8 sphingolipid desaturase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 331/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EEL+KH+K GDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITNEELRKHNKSGDLWIAIQGKVYNVSDWIKTHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F GY++ D QVSEVS+DYR + +EF ++GLFE KGH+  Y  A ++AMF+
Sbjct  67    GTAWHHLDNLFTGYHIRDFQVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTLAFVAAMFV  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  +A L+G LWIQ+ ++GHDSGHY VM  K  +R AQLL+GNCLT
Sbjct  127   GVLYGVLACTSVFAHQIAAALLGLLWIQSAYIGHDSGHYVVMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +SL S FY++ ++F+ +AR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-NSLTSRFYDRKLTFDPVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQH+T+YPVM    RIN+FIQ++  +LF K+   +RA    G+++FW W+P L+S 
Sbjct  246   FLISYQHFTYYPVMCF-GRINLFIQTF-ILLFSKRKVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GT+DI C  +
Sbjct  304   LPNWPERFFFVFTSFTVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKVSP V++LC+KH + Y   S++ AN L   +++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCKKHNLPYRSMSWFEANVLTINTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   TAAYQARD-AANPVVKNLVWEALNTHG  449



>gb|AAP23033.1| sphingolipid delta-8 desaturase [Primula farinosa]
Length=452

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 320/445 (72%), Gaps = 4/445 (1%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI  1359
             +IT+ +LK H+K GDLW+SIHG+VYDVS W   HPGG  PL++LAG DVTDAFLAYHP  
Sbjct  12    YITSSDLKAHNKAGDLWISIHGQVYDVSSWAALHPGGTAPLMALAGHDVTDAFLAYHPPS  71

Query  1358  AAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
              A  L        +  + VS  S DYR L+  F ++ LF+ K H   +   A+  +F +S
Sbjct  72    TARLLPPLSANLLLEHYSVSPTSSDYRKLLHNFHKLDLFQTKSHTTCFTFVAMVVLFFLS  131

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
             L GV   +S W H+ S  ++G  WIQ+GW+GHDSGHY +M ++K +R AQ+L+GNCL G+
Sbjct  132   LLGVFCSDSTWVHLASGGVMGVAWIQSGWLGHDSGHYQIMSSRKTNRFAQVLSGNCLAGI  191

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
             SI WW+WNHNAHH+ACN +DYDPD+Q +P F  S+K F +SL S FY++ ++F+ ++RFL
Sbjct  192   SIAWWKWNHNAHHLACNSLDYDPDLQHMPFFVVSSKFF-NSLTSRFYDRKLNFDGVSRFL  250

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLP  639
             VSYQHW+FYPVM L ARIN+F QS+  +LF  +   +R QEI G+ +FWVWYP L+S LP
Sbjct  251   VSYQHWSFYPVMCL-ARINLFAQSF-MLLFSSRKVPDRVQEIFGIGVFWVWYPLLVSCLP  308

Query  638   NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
             N  ERIMFVV S  +TG+Q +QF LNH ++  + GP  G DW EKQ  GTL+I C  WMD
Sbjct  309   NWGERIMFVVASFSVTGIQHVQFCLNHFSAEVYLGPPEGNDWFEKQTAGTLNISCHSWMD  368

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQFQIEHHLFPR+PR QLRKVSPFV+ LC+KH + YN  SF  AN L  K++R+A
Sbjct  369   WFHGGLQFQIEHHLFPRLPRSQLRKVSPFVRDLCKKHNLPYNVTSFTMANVLTLKTLRNA  428

Query  278   ALMARDLSPEKAPKNLVWEALNSFG  204
             A+ ARDLS    PKNLVWEA+N+ G
Sbjct  429   AIQARDLS-NPTPKNLVWEAVNTHG  452



>ref|XP_009116822.1| PREDICTED: delta(8)-fatty-acid desaturase 1 [Brassica rapa]
Length=447

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/447 (54%), Positives = 329/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT ++L+ H+KPGDLW+SI GKVYDVSDW+  HPGG+  +L+L GQDVTDAF A+HP
Sbjct  5     KKYITHDDLRNHNKPGDLWISIQGKVYDVSDWINSHPGGDTIILNLVGQDVTDAFTAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A H L   F GY++ D+Q+SEVS+DYR + +EF ++GLFE KGH   Y  + ++AMF 
Sbjct  65    GTAWHRLDSLFTGYHIGDYQISEVSRDYRRMATEFRKLGLFESKGHNTLYTLSFIAAMFA  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+  +S+ AH  +A L+G LWIQ+ ++GHDSGHY +M  +K +R AQL++GNCLT
Sbjct  125   GVLYGVLACDSIVAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNQKYNRIAQLISGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ +AR
Sbjct  185   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-NSMTSRFYDRKLTFDHVAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQH+T+YPVM    R+N+F+Q++  +LF ++   +R     G+++FW W+P L+  
Sbjct  244   FLISYQHFTYYPVMCF-GRVNLFVQTF-LLLFSRREVEDRVLNFAGILVFWTWFPLLVYC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER +FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C P+
Sbjct  302   LPTWPERFLFVFTSFTVTALQHIQFTLNHFAADVYMGPPTGHDWFEKQAAGTLDITCVPY  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN L  ++++
Sbjct  362   MDWFYGGLQFQLEHHLFPRLPRCNLRKVAPVVQELCKKHKLPYRSMSWWEANKLTVRTLK  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD       KNLVWEALN+ G
Sbjct  422   KAAYRARD-KANPVVKNLVWEALNTHG  447



>ref|XP_009338791.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Pyrus x bretschneideri]
Length=449

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/447 (55%), Positives = 328/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+I+ EELKKH KP DLW+SI GKVY+VSDW   HPGG+  L +L GQDVTDAF+AYHP
Sbjct  7     KKYISAEELKKHKKPRDLWISIQGKVYNVSDWAKDHPGGDTILYNLGGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L++F  G Y+ D +VSEVSKDYR + +EFS+ GLFEKKGH        ++ M  
Sbjct  67    GTAWQYLKKFSTGIYLKDFEVSEVSKDYRRMATEFSKAGLFEKKGHGALCSIVIIAIMLN  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGV+  +SV  H+   VL+G LWI+  ++GHDSGHY VM ++  +  AQ++AGNC T
Sbjct  127   LVVYGVLKSDSVLVHLICGVLLGMLWIEGAYIGHDSGHYQVMSSRFYNNIAQIVAGNCFT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSAKFF-NSITSIFYGRVLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQH+T+YPVM ++ R+N+FIQ++  +LF ++   NR   I+G+++FW W+P L+S 
Sbjct  246   LLVSYQHFTYYPVM-MVGRVNLFIQTF-LLLFSRRNVPNRGLNIIGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SER+MFV+ +  +T +Q IQF+LNH +   + G     DW EKQ  GT+DI CS W
Sbjct  304   LPNWSERVMFVLAAFAVTSLQHIQFTLNHFSGDTYLGAPNANDWFEKQAAGTIDISCSTW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPRMPR QLRK++P VK+LC+KH + Y   SFW AN    +++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRMPRGQLRKIAPTVKELCKKHNLPYRSLSFWEANVSTIRTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARDLS  + PKNLVWEALN+ G
Sbjct  424   NAALQARDLS-NQVPKNLVWEALNTHG  449



>ref|XP_008344317.1| PREDICTED: LOW QUALITY PROTEIN: delta(8)-fatty-acid desaturase-like 
[Malus domestica]
Length=447

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 330/449 (73%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK+IT E+LK H+KP DLW+SI GKVY+++DW   HPGG+  L +++GQDVTD F+AY
Sbjct  3     GEKKYITVEQLKLHNKPSDLWISIQGKVYNITDWAKDHPGGDAILFNMSGQDVTDGFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GY++ D ++SEVSKDYR L SEF+++GLFE KGH+  Y   ++  M
Sbjct  63    HPPSAWKYLGKFFTGYHLKDFEISEVSKDYRKLASEFNQLGLFENKGHVALYSVISILVM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H G   L+G LW+Q  ++GHDSGHY VM +++ ++ AQ LAGNC
Sbjct  123   LYLVVYGVLKSESVLVHFGCGCLLGVLWVQGAYIGHDSGHYQVMSSRRYNKMAQFLAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F  S+ S FY + ++F+++
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHMPVFAVSTKFFH-SITSTFYGRELTFDAV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVS+QH+T+YP+M ++ R+N+FIQ++  +LF K+   +RA  I+G+++FW W+P L+
Sbjct  242   ARFLVSHQHFTYYPIM-IVGRVNLFIQTF-LLLFSKRSIPDRALNIMGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER MFV+ S  +T +Q IQF+LNH     + GP TG DW EKQ  GT+DI CS
Sbjct  300   SCLPNWXERFMFVLASFAVTALQHIQFTLNHFTGDTYLGPPTGNDWFEKQTAGTVDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPR+PR QLRK+SP VK+LC+KH + Y   SF  AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRLPRSQLRKISPTVKELCKKHNLPYKSLSFLDANVATIRL  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+AA  A D++    PKNL WEA+N+ G
Sbjct  420   LRNAAQQAWDMA-LPVPKNLAWEAVNTHG  447



>ref|XP_008384543.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Malus domestica]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/449 (54%), Positives = 331/449 (74%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK+IT E+LK H+KP DLW+SI GKVY+++DW   HPGG+  L +++GQDVTD F+AY
Sbjct  3     GEKKYITVEQLKLHNKPSDLWISIQGKVYNITDWAKDHPGGDAILFNMSGQDVTDGFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GYY+ D ++SEVSKDYR L SEF+++GLFE KGH   Y   ++ AM
Sbjct  63    HPPSAWKYLGKFFTGYYLKDFEISEVSKDYRKLASEFNQLGLFENKGHGALYSVISILAM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H G   L+G LW+Q  ++GHDSGHY VM +++ ++ AQ LAGNC
Sbjct  123   LYLVVYGVLKSESVLVHFGCGCLLGVLWVQGAYMGHDSGHYQVMSSRRYNKLAQFLAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F+ S+ S FY + ++F+++
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHMPVFAVSTKFFQ-SITSTFYGRELTFDAV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVS+QH+T+YP+M ++ R+N+FIQ++  +LF K+   +RA  I+G+++FW W+P L+
Sbjct  242   ARFLVSHQHFTYYPIM-IVGRVNLFIQTF-LLLFSKRSIPDRALNIMGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN SER MFV+ S  +T +Q IQF+LNH     + GP TG DW EKQ  GT+DI CS
Sbjct  300   SCLPNWSERFMFVLASFTVTALQHIQFTLNHFTGDTYLGPPTGNDWFEKQTAGTVDILCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMD F+GGLQFQ+EHHLFPR+PR QLRK+SP VK+LC+KH + Y   SF  AN    + 
Sbjct  360   SWMDGFYGGLQFQLEHHLFPRLPRSQLRKISPTVKELCKKHNLPYKSLSFLDANVTTIRM  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+AA  A D++    PKNL WEA+N+ G
Sbjct  420   LRNAAQQAWDMT-LPVPKNLAWEAVNTHG  447



>emb|CDY11363.1| BnaA09g39290D [Brassica napus]
Length=447

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/447 (54%), Positives = 328/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT ++L+ H+KPGDLW+SI GKVYDVSDW+  HPGG+  +L+L GQDVTDAF A+HP
Sbjct  5     KKYITHDDLRNHNKPGDLWISIQGKVYDVSDWIKSHPGGDTIILNLVGQDVTDAFTAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A H L   F GY++ D+Q+SEVS+DYR + +EF ++GLFE KGH   Y  + ++AMF 
Sbjct  65    GTAWHRLDGLFTGYHIRDYQISEVSRDYRRMATEFRKLGLFESKGHNTLYTLSFIAAMFA  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+  +S+ AH  +A L+G LWIQ+ ++GHDSGHY +M  +K +R AQL++GNCLT
Sbjct  125   GVLYGVLACDSIVAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNQKYNRIAQLISGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ +AR
Sbjct  185   GISIAWWKWTHNAHHFACNSLDYDPDLQHIPVFAVSTKFF-NSMTSRFYDRKLTFDHVAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL++YQH+T+YPVM    RIN+F+Q++  +LF ++   +R     G+++FW W+P L+  
Sbjct  244   FLITYQHFTYYPVMCF-GRINLFVQTF-LLLFSRREVEDRVLNFAGILVFWTWFPLLVYC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER +FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C P+
Sbjct  302   LPTWPERFLFVFTSFTVTALQHIQFTLNHFAADVYMGPPTGHDWFEKQAAGTLDITCVPY  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN L  ++++
Sbjct  362   MDWFYGGLQFQLEHHLFPRLPRCNLRKVAPVVQELCKKHKLPYRSMSWWEANKLTVRTLK  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD       KNLVWEALN+ G
Sbjct  422   KAAYQARD-KANPVVKNLVWEALNTHG  447



>emb|CDX71730.1| BnaC08g31440D [Brassica napus]
Length=450

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/447 (54%), Positives = 328/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT ++L+ H+KPGDLW++I GKVYDVSDWV  HPGG+  +L+L GQDVTDAF A+HP
Sbjct  8     KKYITHDDLRSHNKPGDLWIAIQGKVYDVSDWVKSHPGGDTIILNLVGQDVTDAFTAFHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A H L   F GY++ D+++SEVS+DYR + +EF ++GLFE KGH   Y  + ++AMF 
Sbjct  68    GTAWHRLDGLFTGYHIGDYRISEVSRDYRRMATEFRKLGLFESKGHNTLYTLSFIAAMFA  127

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+  +S+ AH  +A L+G LWIQ+ ++GHDSGHY +M  KK +R AQL+AGNCLT
Sbjct  128   GVLYGVLACDSIVAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKKYNRIAQLVAGNCLT  187

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ +AR
Sbjct  188   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-NSMTSRFYDRKLTFDPVAR  246

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQH+T+YPVM    RIN+F+Q++  +LF ++   +R     G+++FW W+P L+  
Sbjct  247   LLVSYQHFTYYPVMCF-GRINLFVQTF-LLLFSRREVEDRVLNFAGILVFWTWFPLLVYC  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER +FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C P+
Sbjct  305   LPTWPERFLFVFTSFTVTALQHIQFTLNHFAADVYMGPPTGHDWFEKQAAGTLDITCVPY  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN L  ++++
Sbjct  365   MDWFYGGLQFQLEHHLFPRLPRCNLRKVAPVVQELCKKHKLPYRSMSWWEANKLTVRTLK  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD       KNLVWEALN+ G
Sbjct  425   KAAYQARD-KANPVVKNLVWEALNTHG  450



>sp|Q9FR82.1|SLD1_BOROF RecName: Full=Delta(8)-fatty-acid desaturase; AltName: Full=Delta(8)-sphingolipid 
desaturase [Borago officinalis]
 gb|AAG43277.1|AF133728_1 delta 8-sphingolipid desaturase [Borago officinalis]
Length=446

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 333/449 (74%), Gaps = 5/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             GTKK+I+  EL+KH++ GD+W+SI GKVY+V+DW+ +HPGG+ P+++LAGQD TDAF+AY
Sbjct  3     GTKKYISVGELEKHNQLGDVWISIQGKVYNVTDWIKKHPGGDVPIMNLAGQDATDAFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L+  F GY++ D+ VSE+SKDYR L SEFS+ GLFEKKGH V Y  + ++ +
Sbjct  63    HPGTAWKNLENLFTGYHLEDYLVSEISKDYRKLASEFSKAGLFEKKGHTVIYCLSFIALL  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
                 +YGV+   S+W HM S  ++G  +IQA ++GHDSGHY +M +K  ++ AQ+L GNC
Sbjct  123   LCGCVYGVLCSNSLWVHMLSGAMLGMCFIQAAYLGHDSGHYTMMSSKGYNKFAQVLNGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q LP+FA  +  F+ SL S FY + ++F+ L
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHLPVFAVPSSFFK-SLTSRFYGRELTFDGL  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             +RFLVSYQH+T Y VM+   RIN+++Q++  +LF  +   +RA  I+G++++W W+P+L+
Sbjct  242   SRFLVSYQHFTIYLVMIF-GRINLYVQTF-LLLFSTRKVPDRALNIIGILVYWTWFPYLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN +ER++FV+    +T +Q IQF+LNH A+  + GP TG +W EKQ  GT+DI CS
Sbjct  300   SCLPNWNERVLFVLTCFSVTALQHIQFTLNHFAADVYVGPPTGTNWFEKQAAGTIDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF GGLQFQ+EHHLFPRMPRCQLR +SP V+  C+KH + Y   SF+ AN    K+
Sbjct  360   SWMDWFFGGLQFQLEHHLFPRMPRCQLRNISPIVQDYCKKHNLPYRSLSFFDANVATIKT  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL ARDL+    P+NL+WEA N+ G
Sbjct  420   LRTAALQARDLT--VVPQNLLWEAFNTHG  446



>ref|XP_008382455.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Malus domestica]
Length=449

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 327/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+I+ EELKKH KPGDLW+SI GKVY+VSDW   HPGG+  L +L GQDVTDAF+AYHP
Sbjct  7     KKYISAEELKKHKKPGDLWISIQGKVYNVSDWAKDHPGGDTILYNLGGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L++F  G Y+ D +VSEVSKDYR + +EFS+ GLFEKKGH        ++ M  
Sbjct  67    GTAWQYLKKFSTGIYLKDFEVSEVSKDYRRMATEFSKAGLFEKKGHGALCSIVIIAIMLN  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGV+  +SV  H+   +L+G LWI+  ++GHDSGHY VM ++  +  AQ++AGNC T
Sbjct  127   LVVYGVLKSDSVLVHLICGMLLGMLWIEGAYIGHDSGHYQVMSSRFYNNIAQIVAGNCFT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSAKFF-NSITSIFYGRVLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQH+T+YPVM ++ R+N+FIQ++  +LF ++   NR   I+G+++FW W+P L+S 
Sbjct  246   LLVSYQHFTYYPVM-MVGRVNLFIQTF-LLLFSRRNVPNRGLNIIGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SER+MFV+ +  +T +Q IQF+LNH +   + G     DW EKQ  GT+DI CS W
Sbjct  304   LPNWSERVMFVLAAFAVTSLQHIQFTLNHFSGDTYLGAPNANDWFEKQAAGTIDISCSTW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPRMPR QLRK++P VK+LC+KH   Y   SFW AN    +++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRMPRGQLRKIAPTVKELCKKHNXPYRSLSFWEANXSTIRTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARD S  + PKNLVWEALN+ G
Sbjct  424   NAALQARDXS-NQVPKNLVWEALNTHG  449



>gb|AEW24954.1| delta8-sphingolipid desaturase [Brassica rapa]
Length=447

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 240/447 (54%), Positives = 328/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT ++L+ H+KPGDLW+SI GKVYDVSDW+  HPGG+  +L+L GQDVTDAF A+HP
Sbjct  5     KKYITHDDLRNHNKPGDLWISIQGKVYDVSDWINSHPGGDTIILNLVGQDVTDAFTAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A H L   F GY++ D+Q+SEVS+DYR + +EF ++GLFE KGH   Y  + ++AMF 
Sbjct  65    GTAWHRLDSLFTGYHIGDYQISEVSRDYRRMATEFRKLGLFESKGHNTLYTLSFIAAMFA  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+  +S+ A   +A L+G LWIQ+ ++GHDSGHY +M  +K +R AQL++GNCLT
Sbjct  125   GVLYGVLACDSIVARQIAAALLGLLWIQSAYIGHDSGHYVIMSNQKYNRIAQLISGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ +AR
Sbjct  185   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-NSMTSRFYDRKLTFDHVAR  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQH+T+YPVM    RIN+F+Q++  +LF ++   +R     G+++FW W+P L+  
Sbjct  244   FLISYQHFTYYPVMCF-GRINLFVQTF-LLLFSRREVEDRVLNFAGILVFWTWFPLLVYC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER +FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C P+
Sbjct  302   LPTWPERFLFVFTSFTVTALQHIQFTLNHFAADVYMGPPTGHDWFEKQAAGTLDITCVPY  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN L  ++++
Sbjct  362   MDWFYGGLQFQLEHHLFPRLPRCNLRKVAPVVQELCKKHKLPYRSMSWWEANKLTVRTLK  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD       KNLVWEALN+ G
Sbjct  422   KAAYRARD-KANPVVKNLVWEALNTHG  447



>ref|XP_009350120.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Pyrus x bretschneideri]
Length=447

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 331/449 (74%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK+IT E+LK H+KP DLW+SI GKVY+++DW   HPGG+  L +++GQDVTD F+AY
Sbjct  3     GEKKYITVEQLKLHNKPSDLWISIQGKVYNITDWAKDHPGGDAILFNMSGQDVTDGFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GYY+ D ++SEVSKDYR L SEF+++GLFE KGH   Y   ++  M
Sbjct  63    HPPSAWKYLGKFFTGYYLKDFEISEVSKDYRKLASEFNQLGLFENKGHGALYSVISILVM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H G   L+G LW+Q  ++GHDSGHY VM +++ ++ AQ LAGNC
Sbjct  123   LYLVVYGVLKSESVLVHFGCGCLLGVLWVQGAYMGHDSGHYQVMSSRRYNKLAQFLAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S+K F+ S+ S FY + ++F+++
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHMPVFAVSSKFFQ-SITSTFYGRELTFDAV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVS+QH+T+YP+M ++ R+N+FIQ++  +LF K+   +RA  I+G+++FW W+P L+
Sbjct  242   ARFLVSHQHFTYYPIM-IVGRVNLFIQTF-LLLFSKRSIPDRALNIMGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN SER MFV+ S  +T +Q IQF+LNH     + GP TG DW EKQ  GT+DI CS
Sbjct  300   SCLPNWSERFMFVLASFTVTALQHIQFTLNHFTGDTYLGPPTGNDWFEKQTAGTVDILCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
               MDWF+GGLQFQ+EHHLFPR+PR QLRK+SP VK+LC+KH + Y   SF  AN    + 
Sbjct  360   SRMDWFYGGLQFQLEHHLFPRLPRSQLRKISPTVKELCKKHNLPYKSLSFLDANVTTIRM  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+AA  A D++    PKNL WEA+N+ G
Sbjct  420   LRNAAQQAWDMA-LPVPKNLAWEAVNTHG  447



>ref|XP_009350121.1| PREDICTED: delta(8)-fatty-acid desaturase 1-like [Pyrus x bretschneideri]
Length=449

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 327/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+I+ EELKKH KP DLW+SI GKVY+VSDW   HPGG+  L +L GQDVTDAF+AYHP
Sbjct  7     KKYISAEELKKHKKPRDLWISIQGKVYNVSDWAKDHPGGDTILYNLGGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L++F  G Y+ D +VSEVSKDYR + +EFS+ GLFEKKGH        ++ M  
Sbjct  67    GTAWQYLKKFSTGIYLKDFEVSEVSKDYRRMATEFSKAGLFEKKGHGALCSIVIIAIMLN  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGV+  +SV  H+   +L+G LWI+  ++GHDSGHY VM ++  +  AQ++AGNC T
Sbjct  127   LVVYGVLKSDSVLVHLICGMLLGMLWIEGAYIGHDSGHYQVMSSRFYNNIAQIVAGNCFT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F +S+ S FY + ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSAKFF-NSITSIFYGRVLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQH+T+YPVM ++ R+N+FIQ++  +LF ++   NR   I+G+++FW W+P L+S 
Sbjct  246   LLVSYQHFTYYPVM-MVGRVNLFIQTF-LLLFSRRNVPNRGLNIIGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN SER+MFV+ +  +T +Q IQF+LNH +   + G     DW EKQ  GT+DI CS W
Sbjct  304   LPNWSERVMFVLAAFAVTSLQHIQFTLNHFSGDTYLGAPNANDWFEKQAAGTIDISCSTW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPRMPR QLRK++P VK+LC+KH   Y   SFW AN    +++R
Sbjct  364   MDWFFGGLQFQLEHHLFPRMPRGQLRKIAPTVKELCKKHNFPYRSLSFWEANVSTIRTLR  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARDLS  + PKNLVWEALN+ G
Sbjct  424   NAALQARDLS-NQVPKNLVWEALNTHG  449



>gb|EYU32187.1| hypothetical protein MIMGU_mgv1a006322mg [Erythranthe guttata]
Length=448

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 241/447 (54%), Positives = 325/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++ELKKH  P DLW+SI GKVYDV++W   HPGG+  LL+LAGQDVTDAF+A+HP
Sbjct  6     KKYITSDELKKHTDPDDLWISIQGKVYDVTEWKKIHPGGDILLLNLAGQDVTDAFIAFHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L  +F GYY+ D QVSEVSKDYR L ++F++ GLFEKKGH           M +
Sbjct  66    GTAWKYLDNYFTGYYLEDFQVSEVSKDYRKLATQFAKSGLFEKKGHGTVISLCCCFLMLM  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
                YGV+  +S   H+ S  L+GF WIQ  ++GHDSGHY +MKT+  ++  Q+L GNCLT
Sbjct  126   ACFYGVLCTDSFLIHIISGGLLGFTWIQVAYLGHDSGHYQIMKTRGFNKLTQILTGNCLT  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q LP+FA S  LF  S+ SHFY + ++F+ L+R
Sbjct  186   GISIAWWKWTHNAHHIACNSLDYDPDLQHLPVFAVSTTLF-DSIRSHFYGRELTFDYLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F V YQH T+YPVM  +AR N+++Q++  +LF K+   +RA  ILG+++FW W+P L+  
Sbjct  245   FFVCYQHLTYYPVM-CVARFNLYLQTF-LLLFSKRKIPDRALNILGILVFWTWFPLLVMC  302

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER++FV+ S  +  +Q +QF+LNH A++ + G   G DW EKQ  GT+DI CSP 
Sbjct  303   LPNWTERVLFVLASFCVCAIQHVQFTLNHFAANVYVGSPKGNDWFEKQTSGTIDIACSPS  362

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRCQLR +SP V++LC+KH + Y   SF+ AN +  +++R
Sbjct  363   MDWFFGGLQFQLEHHLFPRLPRCQLRNISPMVQELCKKHNLPYRSLSFFEANKVTLQTLR  422

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARDL+    PKNL+WEA+N+ G
Sbjct  423   SAAMEARDLA-NPVPKNLLWEAVNTHG  448



>ref|XP_003532059.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Glycine max]
 gb|KHN06848.1| Fatty acid desaturase 3 [Glycine soja]
Length=448

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/448 (57%), Positives = 341/448 (76%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              KK+IT+EELK+H+KPGDLW+SI GKVY+VSDW   HPGGE PLL+LAGQDVTDAF+AYH
Sbjct  5     NKKYITSEELKEHNKPGDLWISIQGKVYNVSDWAKDHPGGEVPLLNLAGQDVTDAFVAYH  64

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L  FF GY++ D +VSEVSKDYR LVSEF +MGLFEKK H+  Y  ++++ MF
Sbjct  65    PGSAWKYLDPFFTGYHLRDFKVSEVSKDYRKLVSEFVKMGLFEKKEHVTLYTLSSVAVMF  124

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              + +YGV+   SVWAH+G+A+L+G LW+Q+ +VGHDSGHY+VM +   ++ AQ+L GNC+
Sbjct  125   SIVVYGVIGCSSVWAHLGAALLLGLLWMQSTYVGHDSGHYEVMSSPGYNKLAQILCGNCM  184

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHHI+CN +DYDPD+Q +P+FA S + F +S+ S FY + + F+SL+
Sbjct  185   TGISIAWWKWTHNAHHISCNSLDYDPDLQHIPVFAVSTRFF-NSIKSCFYGRKLVFDSLS  243

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFL+SYQH+TFYPV L  AR+N+++Q+   +  ++K+  +RA  I+G+++FWVW+P L+S
Sbjct  244   RFLISYQHFTFYPV-LCFARVNLYLQTLLLLFSRRKV-PDRAFNIMGILVFWVWFPLLIS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
             SLPN  ER+MFV+ S  +  +Q +QF LNH ++  + GP  G DW EKQ  GTLDI CS 
Sbjct  302   SLPNWGERVMFVLASFAVCSIQHLQFCLNHFSADVYEGPPNGNDWFEKQTGGTLDISCSS  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWF GGLQFQ+EHHLFPR+PR QLRK+SP V  LC+KH + Y   +F  AN    K++
Sbjct  362   WMDWFFGGLQFQLEHHLFPRLPRAQLRKISPLVIDLCKKHNLPYRSLTFVEANLWTLKTL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL AR+LS   + +NL+WEA N+ G
Sbjct  422   RTAALQARNLS-NPSSQNLLWEAFNTHG  448



>gb|ABA55805.1| delta-8 sphingolipid desaturase [Crepis alpina]
Length=469

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 240/447 (54%), Positives = 329/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EEL+KH+KP DLW+SI GKVY+V++W   HPGG+ PLL+LAGQDVTDAF+A+HP
Sbjct  27    KKYITSEELEKHNKPTDLWISIQGKVYNVTEWSKIHPGGDIPLLNLAGQDVTDAFIAFHP  86

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHLQ  F GY++ D+QVS++SKDYR L SEFS+ G+F+KKGH V Y    +S +  
Sbjct  87    GSAWHHLQSLFTGYHLQDYQVSDISKDYRKLASEFSKAGMFDKKGHGVIYSLCFVSILLS  146

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGV+   SV  HM +  L+G  W+Q  ++GHD+GHY +M T+  ++ A +  GNC+T
Sbjct  147   LCVYGVLCSASVTVHMFAGALLGLAWMQIAYLGHDAGHYQMMATRGWNKFAGIFIGNCIT  206

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q LP+ A S+KLF  S+ S FY + ++F+S+AR
Sbjct  207   GISIAWWKWTHNAHHIACNSLDYDPDLQHLPMLAVSSKLFE-SITSVFYGRRLTFDSVAR  265

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F +SYQH+T+YP+M  + R+N+++Q+   +  K++I  +R   I+G +IFW W+P L+S 
Sbjct  266   FFISYQHYTYYPIM-CVTRVNLYLQTILLLCSKRRI-PDRTLNIIGTLIFWTWFPLLVSC  323

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+ FV++S  +TG+Q +QF+LNH A+  + GP  G DW EKQ  GT+DI CS +
Sbjct  324   LPNWPERVAFVLVSFCVTGIQHVQFTLNHFAADVYVGPPRGNDWFEKQTAGTIDISCSSY  383

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR +SP V  LC+KH + Y   SF+ AN    K++R
Sbjct  384   MDWFFGGLQFQLEHHLFPRLPRCHLRSISPIVMDLCKKHNLPYTSLSFFDANVTTLKTLR  443

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+    P+NLVWEA N+ G
Sbjct  444   TAALQARDLA-NGPPQNLVWEAFNTHG  469



>gb|KHN17384.1| Fatty acid desaturase 2 [Glycine soja]
Length=448

 Score =   530 bits (1365),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 252/448 (56%), Positives = 341/448 (76%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              KK+I++EELK+H+K GDLW+SI GKVY+VSDW   HPGGE PLL+LAGQDVTDAF+AYH
Sbjct  5     NKKYISSEELKEHNKSGDLWISIQGKVYNVSDWAKDHPGGEVPLLNLAGQDVTDAFIAYH  64

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L  FF GY++ D +VSEVSKDYR LVSEF+++GLFEKK H+  Y  ++++ MF
Sbjct  65    PGSAWKYLDPFFTGYHLRDFKVSEVSKDYRKLVSEFAKVGLFEKKEHVTLYTLSSVAVMF  124

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              + +YGV+   SVWAH+G+A+L+G LW+Q+ +VGHDSGHY+VM +   ++ AQ+L GNC+
Sbjct  125   SIVVYGVIGCNSVWAHLGAALLLGLLWMQSTYVGHDSGHYEVMSSPGYNKLAQILCGNCM  184

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHHI+CN +DYDPD+Q +P+FA S + F +S+ S FY + + F+SL+
Sbjct  185   TGISIAWWKWTHNAHHISCNSLDYDPDLQHIPVFAVSTRFF-NSIKSCFYGRKLVFDSLS  243

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             RFL+SYQHWTFYPV L  AR+N+++Q+   +  ++K+  +RA  I+G+++FW+W+P L+S
Sbjct  244   RFLISYQHWTFYPV-LCFARVNLYLQTLLLLFSRRKV-PDRAFNIMGILVFWIWFPLLIS  301

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
             SLPN  ER+MFV+ S  +  +Q +QF LNH A+  + GP  G DW EKQ  GTLDI CS 
Sbjct  302   SLPNWGERVMFVLASFAVCSIQHLQFCLNHFAADVYEGPPNGNDWFEKQTGGTLDISCST  361

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWF GGLQFQ+EHHLFPR+PR QLRK+SP V  LC+KH + Y   +F  AN    K++
Sbjct  362   WMDWFFGGLQFQLEHHLFPRLPRAQLRKISPLVIDLCKKHNLPYRSLTFVEANLWTLKTL  421

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AAL AR+LS   + +NL+WEA N+ G
Sbjct  422   RTAALQARNLS-NPSSQNLLWEAFNTHG  448



>ref|XP_007161019.1| hypothetical protein PHAVU_001G036200g [Phaseolus vulgaris]
 gb|ESW33013.1| hypothetical protein PHAVU_001G036200g [Phaseolus vulgaris]
Length=447

 Score =   530 bits (1365),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 253/445 (57%), Positives = 329/445 (74%), Gaps = 4/445 (1%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI  1359
             +I++ +L+ H+KP D W+SIHGK+YDVS W++RHPGG  PLL++AG D TDAFLA+HP  
Sbjct  7     YISSSDLRTHNKPHDAWISIHGKIYDVSSWLHRHPGGTLPLLTVAGTDATDAFLAFHPPS  66

Query  1358  AAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
             AA  L  F  G  +SD+ VS  S DYR L+S+ S + LFE+KGH      + +  +  + 
Sbjct  67    AAALLPTFATGVLLSDYAVSPASSDYRQLLSKLSDLKLFERKGHTTLILLSIILTLLPLC  126

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
             + GVVF +S   H+ SA L+G LWIQ+GW+GHDSGHY+VM  ++ +R AQ+L+GN L G+
Sbjct  127   VCGVVFSDSTCVHLLSAALIGILWIQSGWIGHDSGHYNVMLNRRFNRVAQILSGNVLAGI  186

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
             SI WW+WNHNAHHIACN +D+DPD+Q LP F  S++ F +SL S FY++ + F+SLARFL
Sbjct  187   SIAWWKWNHNAHHIACNSLDFDPDLQHLPFFVVSSRFF-NSLTSRFYDRKLIFDSLARFL  245

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLP  639
             VSYQHWT+YPVM   ARIN+F QS+  +LF K+   +R  E+LGL+ FWVWYP L+S LP
Sbjct  246   VSYQHWTYYPVMCF-ARINLFAQSF-FLLFSKRKVEHRGVELLGLLAFWVWYPLLVSFLP  303

Query  638   NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
             N  ERI+FVV S  +TG+Q +QF LNH +S  + GP +G DW EKQ +GTLD+ CS WMD
Sbjct  304   NWWERILFVVTSFSVTGIQHVQFCLNHFSSKVYLGPPSGDDWFEKQTNGTLDVSCSAWMD  363

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQFQ+EHHLFPR+PRC LRK++P VK LC+KH + YN  SFW AN L  +++R A
Sbjct  364   WFHGGLQFQVEHHLFPRLPRCHLRKIAPLVKDLCKKHNLPYNCVSFWKANVLTIQTLRKA  423

Query  278   ALMARDLSPEKAPKNLVWEALNSFG  204
             AL ARD S    PKNLVWEA+N+ G
Sbjct  424   ALQARDGS-GPVPKNLVWEAVNTHG  447



>gb|ADK91077.1| delta-8 sphingolipid desaturase [Helianthus annuus]
Length=466

 Score =   531 bits (1367),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 241/447 (54%), Positives = 335/447 (75%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++ELKKH+KP DLW+SI GKVY+V++W   HPGGE PL++LAGQDVTDAF+A+HP
Sbjct  24    KKYITSDELKKHNKPNDLWISIQGKVYNVTEWAKIHPGGEIPLMNLAGQDVTDAFIAFHP  83

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL + F GY++ D+QVS VSKDYR L SEF++ G+FEKKGH V Y    +S +  
Sbjct  84    GSAWEHLSKLFTGYHLKDYQVSAVSKDYRKLASEFAKAGMFEKKGHGVIYSLCFVSLLLS  143

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGV+F  S W HM +  L+G  WIQ  ++GHD+GHY +M T+  ++ A +  GNC+T
Sbjct  144   GCVYGVLFSSSFWVHMLAGALLGLAWIQIAYLGHDAGHYQMMSTRGWNKFAGIFIGNCIT  203

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q LP+ A S++LF +SL S FY + ++F+ LAR
Sbjct  204   GISIAWWKWTHNAHHIACNSLDYDPDLQHLPMLAVSSRLF-NSLTSVFYGRQLTFDRLAR  262

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+++YP+M  +AR+N+++Q+   +L K+K+  ++   I G ++FW W+P L+S 
Sbjct  263   FFVSYQHYSYYPIM-CVARVNLYLQTLLLLLSKRKV-PDKGLNIFGTLVFWTWFPLLVSC  320

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+ FV++S  +TG+Q +QF+LNH A++ + GP TG DW EKQ +GT+DI CS +
Sbjct  321   LPNWPERVAFVLVSFCVTGIQHVQFTLNHFAANVYVGPPTGNDWFEKQTNGTIDIACSSY  380

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR ++P V++LC+KH + Y   SF+ AN +  K++R
Sbjct  381   MDWFFGGLQFQLEHHLFPRLPRCHLRSIAPIVRELCKKHNLPYTSVSFFDANIMTLKTLR  440

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+   AP+NL+WEA N+ G
Sbjct  441   TAALQARDLT-NPAPQNLLWEAFNTHG  466



>ref|XP_006291124.1| hypothetical protein CARUB_v10017244mg [Capsella rubella]
 gb|EOA24022.1| hypothetical protein CARUB_v10017244mg [Capsella rubella]
Length=449

 Score =   530 bits (1365),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 247/447 (55%), Positives = 332/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+E+LKKH+KPGDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITSEDLKKHNKPGDLWIAIQGKVYNVSDWIKSHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F G+++ D +VSEVS+DYR + +EF ++GLF+ KGH+  Y  A ++AMF 
Sbjct  67    GTAWHHLDHLFTGFHIRDFEVSEVSRDYRRMAAEFRKLGLFDNKGHVTLYTLAFIAAMFA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  +A L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   GVLYGVLACNSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +SL S FY++ ++F+ +AR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-TSLTSRFYDRKLTFDPVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF ++   +RA    G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSRRDVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GT+DI C  +
Sbjct  304   LPSWPERFFFVFTSFTVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKVSP V++LC+KH + Y   S++ AN L   +++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCKKHNLPYRSLSWFDANVLTINTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   KAAYQARD-AANPVVKNLVWEALNTHG  449



>ref|XP_008232960.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Prunus mume]
 ref|XP_008232961.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Prunus mume]
Length=447

 Score =   530 bits (1364),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 331/449 (74%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G +K+IT E+LK H +PGDLW+SI GKVY+VSDW   HPGGE  L ++AGQDVTD F+AY
Sbjct  3     GERKYITVEQLKLHKQPGDLWISIKGKVYNVSDWAKDHPGGEAVLFNMAGQDVTDGFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HPA A  +L +FF GYY+ D Q+SEVSKDYR L SEF+++GLFE KGH   Y   +L  M
Sbjct  63    HPASAWQYLGKFFTGYYLKDFQISEVSKDYRKLASEFNQLGLFENKGHGALYSVISLVVM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H+G  +L+G LW+QA ++GHDSGHY VM ++  ++ AQ +AGNC
Sbjct  123   LSLVVYGVLKSESVLVHLGCGLLLGVLWVQAAYMGHDSGHYQVMSSRTYNKMAQFVAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F  S+ S FY + ++F+ +
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHMPVFAVSTKFFH-SITSVFYGRELTFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVS+QH+T+YP+M ++ R+N+FIQ++  +LF K+   +R   ILG+++FW+W+P L+
Sbjct  242   ARFLVSHQHFTYYPIM-IVGRVNLFIQTF-LLLFSKRSIPDRGLNILGILVFWIWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN SER+MFV+ S  +T +Q IQF+LNH     + GP TG DW EKQ  GT+DI CS
Sbjct  300   SCLPNWSERVMFVLASFAVTALQHIQFTLNHFTGDTYLGPPTGNDWFEKQTAGTVDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPR+PR QLRK+SP VK LC+KH + Y   SFW AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRLPRSQLRKISPTVKDLCKKHNLPYKSLSFWDANVTTIRL  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AA  A D+     PKNL WEA+N+ G
Sbjct  420   LRSAARKAWDMD-LPIPKNLAWEAVNTHG  447



>ref|XP_007218002.1| hypothetical protein PRUPE_ppa005694mg [Prunus persica]
 gb|EMJ19201.1| hypothetical protein PRUPE_ppa005694mg [Prunus persica]
Length=447

 Score =   528 bits (1361),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 330/449 (73%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G +K+IT E+LK H +PGDLW+SI GKVY+VSDW   HPGGE  L ++AGQDVTD F+AY
Sbjct  3     GERKYITVEQLKLHKQPGDLWISIKGKVYNVSDWAKDHPGGEAVLFNMAGQDVTDGFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HPA A  +L +FF GYY+ D Q+SEVSKDYR L SEF+++GLFE KGH   Y   +L  M
Sbjct  63    HPASAWQYLGKFFTGYYLKDFQISEVSKDYRKLASEFNQLGLFENKGHGALYSVISLVVM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H+G  +L+G LW+QA ++GHDSGHY VM ++  ++ AQ +AGNC
Sbjct  123   LSLVVYGVLKSESVLVHLGCGLLLGVLWVQAAYMGHDSGHYQVMSSRTYNKMAQFVAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F  S+ S FY + ++F+ +
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHMPVFAVSTKFFH-SITSVFYGRELTFDPV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVS+QH+T+YP+M ++ R+N+FIQ++  +LF K+   +R   ILG+++FW W+P L+
Sbjct  242   ARFLVSHQHFTYYPIM-IVGRVNLFIQTF-LLLFSKRSIPDRGLNILGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN SER+MFV+ S  +T +Q IQF+LNH     + GP TG DW EKQ  GT+DI CS
Sbjct  300   SCLPNWSERVMFVLASFAVTALQHIQFTLNHFTGDTYLGPPTGNDWFEKQTAGTVDISCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWF+GGLQFQ+EHHLFPR+PR QLRK+SP VK LC+KH + Y   SFW AN    + 
Sbjct  360   SWMDWFYGGLQFQLEHHLFPRLPRSQLRKISPTVKDLCKKHNLPYKSLSFWDANVTTIRL  419

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AA  A D+     PKNL WEA+N+ G
Sbjct  420   LRSAAQKAWDMDIP-IPKNLAWEAVNTHG  447



>ref|XP_006402468.1| hypothetical protein EUTSA_v10005967mg [Eutrema salsugineum]
 gb|ESQ43921.1| hypothetical protein EUTSA_v10005967mg [Eutrema salsugineum]
Length=449

 Score =   528 bits (1359),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 247/447 (55%), Positives = 330/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT E+L+KH+K GDLW++I GKVYDVSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITNEDLRKHNKSGDLWIAIQGKVYDVSDWIKSHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A +HL   F GY++ D +VSEVS+DYR + +EF ++GLFE KGH+  Y  A ++AMF 
Sbjct  67    GTAWNHLGNLFTGYHIRDFEVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTLAFVAAMFA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  +A L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   GVLYGVLACTSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-NSITSRFYDRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+F+Q++  +LF K+   +RA    G+++FW W+P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFVQTF-LLLFSKRHVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C  +
Sbjct  304   LPSWPERFFFVFTSFTVTALQHIQFTLNHFAADVYVGPPTGNDWFEKQAAGTLDISCRSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVAPVVQELCKKHNLPYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  424   KAAFQARD-AANPVVKNLVWEALNTHG  449



>gb|AAP23034.1| fatty acid delta-6 desaturase [Primula farinosa]
Length=453

 Score =   528 bits (1359),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 314/445 (71%), Gaps = 4/445 (1%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI  1359
             +IT+ +LK H+K GDLW+SIHG+VYDVS W   HPGG  PL++LAG DVTDAFLAYHP  
Sbjct  13    YITSSDLKSHNKAGDLWISIHGQVYDVSSWAALHPGGTAPLMALAGHDVTDAFLAYHPPS  72

Query  1358  AAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
              A  L        + +H VS  S DYR L+  F + GLF  +GH        + AMFL+S
Sbjct  73    TARLLPPLSTNLLLQNHSVSPTSSDYRKLLDNFHKHGLFRARGHTAYATFVFMIAMFLMS  132

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
             + GV+  +S W H+ S   +GF WIQ GW+GHDSGHY +M  +K +  AQ+L+ NCL G+
Sbjct  133   VTGVLCSDSAWVHLASGGAMGFAWIQCGWIGHDSGHYRIMSDRKWNWFAQILSTNCLQGI  192

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
             SI WW+WNHNAHHIACN +DYDPD+Q +P+   S K F +SL S FY+K ++F+ ++RFL
Sbjct  193   SIGWWKWNHNAHHIACNSLDYDPDLQYIPLLVVSPKFF-NSLTSRFYDKKLNFDGVSRFL  251

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLP  639
             V YQHWTFYPVM  +AR+NM  QS+ T LF  +   +RAQE+ GL +FWVW+P LLS LP
Sbjct  252   VCYQHWTFYPVM-CVARLNMLAQSFIT-LFSSREVCHRAQEVFGLAVFWVWFPLLLSCLP  309

Query  638   NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
             N  ERIMF++ S  +TG+Q +QFSLNH +S  + GP  G DW +KQ  GTL+I C  WMD
Sbjct  310   NWGERIMFLLASYSVTGIQHVQFSLNHFSSDVYVGPPVGNDWFKKQTAGTLNISCPAWMD  369

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQFQ+EHHLFPRMPR Q RK+SPFV+ LC+KH + YN ASF  AN    K++R+ 
Sbjct  370   WFHGGLQFQVEHHLFPRMPRGQFRKISPFVRDLCKKHNLPYNIASFTKANVFTLKTLRNT  429

Query  278   ALMARDLSPEKAPKNLVWEALNSFG  204
             A+ ARDLS    PKN+VWEAL + G
Sbjct  430   AIEARDLS-NPLPKNMVWEALKTLG  453



>ref|XP_006358651.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Solanum tuberosum]
Length=439

 Score =   527 bits (1357),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 236/448 (53%), Positives = 331/448 (74%), Gaps = 12/448 (3%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+IT EELKKH+K  D+W+S+ GKVY+V+DW+ +HPGG+ P+L+LAGQ+ TDAF+A+H
Sbjct  4     SKKYITAEELKKHNKREDVWISVQGKVYNVTDWIKQHPGGDIPILNLAGQEATDAFIAFH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  HL  FF GYY+ D++VSEVS+DYR L  +F++ GLFEKKGH V Y    +  + 
Sbjct  64    PGTAWKHLDNFFTGYYLQDYEVSEVSRDYRKLCVDFAKAGLFEKKGHGVMYSFCFIGLLL  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              ++ YGV+F  S   HM S  L+G  W+Q  ++GHDSGHY +M TK  ++  Q+++GNCL
Sbjct  124   FLTFYGVLFSNSFLIHMLSGALLGLTWMQISYLGHDSGHYLIMTTKGFNKMVQIMSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHH+ACN +DYDPD+Q LP+FA S+ LF+ SL S FY + ++F+SLA
Sbjct  184   TGISIAWWKWTHNAHHVACNSLDYDPDLQHLPVFAVSSSLFK-SLNSTFYGRELTFDSLA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             +F VSYQH+TFYP+ + ++R+N+F+Q+   +LF K+   +R   ILG+++FW W+P L+ 
Sbjct  243   KFFVSYQHFTFYPI-ICVSRVNLFVQTL-LLLFSKRKVPDRFFNILGIMVFWTWFPLLVL  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
             SLPN +ER++FV+ S  +TG+Q +QF LNH A+  + G   G DW EKQ  GT+DIDCSP
Sbjct  301   SLPNWTERVLFVLTSFAVTGIQHVQFCLNHFAADVYVGQPKGNDWFEKQTAGTIDIDCSP  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
              MDWF GGLQFQ+EHHLFPR+PRCQLRK+SP V++LC+KH ++Y   SF+ AN    +++
Sbjct  361   QMDWFFGGLQFQLEHHLFPRLPRCQLRKISPIVQELCKKHNLSYRSLSFFEANRWTIRTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AA+ AR          ++WEA+N+ G
Sbjct  421   RTAAMQAR---------GMLWEAVNTHG  439



>ref|XP_009104319.1| PREDICTED: delta(8)-fatty-acid desaturase 1 [Brassica rapa]
Length=449

 Score =   527 bits (1358),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 246/448 (55%), Positives = 327/448 (73%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              KK+IT E+LK H+KPGDLW++I GK Y+VSDW+  HPGG+  +L+L GQDVTDAF+A+H
Sbjct  6     VKKYITNEDLKNHNKPGDLWIAIQGKAYNVSDWIKSHPGGDAVILNLIGQDVTDAFIAFH  65

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A HHL   F GY+VSD QVSEVS+DYR + +EF ++GLFE KGH+  Y  + ++AMF
Sbjct  66    PGTAWHHLDNLFTGYHVSDFQVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTLSFVAAMF  125

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
                LYGV+   S+ AH  +A ++G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCL
Sbjct  126   AAVLYGVLACTSLLAHQIAAAILGLLWIQSAYIGHDSGHYVIMTNKSYNRFAQLLSGNCL  185

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ LA
Sbjct  186   TGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSAKFF-NSMTSRFYDRKLAFDPLA  244

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             R L+SYQH+T+YPVM    RIN+F+Q+   +LF K+   +RA    G+++FW W+P L+S
Sbjct  245   RLLISYQHFTYYPVMCF-GRINLFVQT-LLLLFSKREVPDRALNFAGILVFWTWFPLLVS  302

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LP   ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI CS 
Sbjct  303   CLPTWPERFFFVFTSFSVTALQHIQFTLNHFAADVYVGPPTGGDWFEKQAAGTLDISCSS  362

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             +MDWF GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN    +++
Sbjct  363   YMDWFFGGLQFQLEHHLFPRLPRCHLRKVAPVVQELCKKHNLPYRSLSWWEANVWTIRTL  422

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             + AA  ARD +     KNLVWEALN+ G
Sbjct  423   KKAAYQARD-AANPVVKNLVWEALNTHG  449



>ref|XP_009759732.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Nicotiana sylvestris]
Length=439

 Score =   527 bits (1357),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 330/447 (74%), Gaps = 12/447 (3%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKH+K  DLW+SI GKVY+ ++W+  HPGG+ P+L+LAGQ+ TDAF+A+HP
Sbjct  5     KKYITAEELKKHNKADDLWISIQGKVYNATNWIKEHPGGDIPILNLAGQEATDAFIAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GYY+ D++VSEVSKDYR L SEF++ GLFEKKGH V Y    ++ +  
Sbjct  65    GTAWKYLDKFFTGYYLEDYEVSEVSKDYRKLCSEFAKAGLFEKKGHGVIYSLCFVAFLLF  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +++YGV++  S W  M    L+G  W+Q  ++GHDSGHY +M ++  ++  Q+LAGNC+T
Sbjct  125   LTVYGVLYSNSFWIRMLCGGLLGLAWMQVSYLGHDSGHYLIMTSRGFNKLVQILAGNCIT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW W HNAHH+ACN +DYDPD+Q LP+FA S  LF+ SL S FY + ++F+SLA+
Sbjct  185   GISIAWWNWTHNAHHVACNSLDYDPDLQHLPVFAVSTSLFK-SLNSTFYGRELTFDSLAK  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+TFYP++  ++R+N+FIQ+   +LF ++   NR   ILG+++FW W+P L+S+
Sbjct  244   FFVSYQHFTFYPIV-CVSRVNLFIQT-LLLLFSRRKVTNRLMNILGIMVFWTWFPLLVST  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER++FV++S  +TG+Q +QF LNH A+  + G   G DW EKQ  GT+DI CSP 
Sbjct  302   LPNWTERVLFVLISFAVTGIQHVQFCLNHFAADVYVGQPKGNDWFEKQTAGTIDIACSPQ  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRCQLRK+SP V++LC+KH + Y   SF+ AN    +++R
Sbjct  362   MDWFFGGLQFQLEHHLFPRLPRCQLRKISPIVQELCKKHNLPYRSLSFFEANRWTIRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ AR         +L+WEA+N+ G
Sbjct  422   VAAMQAR---------SLLWEAVNTHG  439



>gb|AAQ10732.1| delta-8-sphingolipid desaturase [Anemone leveillei]
Length=446

 Score =   527 bits (1357),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 250/447 (56%), Positives = 324/447 (72%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             ++ I+++EL +H   GDLW+SI GKVYDVS+WV  HPGG+ PL++LAGQDVTDAF+A+HP
Sbjct  5     RREISSQELAQHTNKGDLWISIQGKVYDVSEWVKDHPGGDAPLMNLAGQDVTDAFVAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +F  GY +SD+ VS+VSKDYR L SEFS+ GLFEKKGH +     ++  MF+
Sbjct  65    GSAWKYLDKFHIGY-LSDYVVSDVSKDYRKLASEFSKAGLFEKKGHGIFMSLLSVGIMFV  123

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             V L GV+   + W H   A L+G LW+Q G+VGHDSGHY+VM T KL+R  Q+  GNC+T
Sbjct  124   VILSGVLLSGNTWVHAACAGLLGILWMQIGFVGHDSGHYNVMLTPKLNRFVQIFTGNCVT  183

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WWRW H AHHIA N +DYDPD+Q +P  A S  +  SSL S FY + M+F++ AR
Sbjct  184   GISIGWWRWTHTAHHIAVNSLDYDPDLQHVPFLAVSKDIL-SSLTSKFYGRKMTFDAAAR  242

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQHW+FYPVM  +ARIN+F QS+  +L   +   +R  E+LGL++FW WY  L+S 
Sbjct  243   FLVSYQHWSFYPVMA-VARINLFTQSF-LLLLSSRPMQDRYLELLGLMVFWGWYSLLVSC  300

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER MFV +S  ++G+Q +QF LNH ++  + GP    DW EKQ  G++DI CS W
Sbjct  301   LPNWGERAMFVAVSFAVSGIQHVQFCLNHFSAHTYVGPPRANDWFEKQTKGSIDISCSTW  360

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LRK+SPFVK+LC KH + Y   SF+ AN +   ++R
Sbjct  361   MDWFHGGLQFQVEHHLFPRLPRCHLRKISPFVKELCRKHNLPYVSVSFFEANKMTIATLR  420

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARDL+    PKNLVWEA N+ G
Sbjct  421   NAALQARDLT-NPIPKNLVWEAFNTHG  446



>gb|AAP23036.1| fatty acid delta-6 desaturase [Primula vialii]
Length=453

 Score =   527 bits (1358),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 315/445 (71%), Gaps = 4/445 (1%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI  1359
             +IT+ +LK H+K GDLW+SIHG+VYDVS W   HPGG  PL++LAG DVTDAFLAYHP  
Sbjct  13    YITSSDLKGHNKAGDLWISIHGEVYDVSSWAGLHPGGSAPLMALAGHDVTDAFLAYHPPS  72

Query  1358  AAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
              A  L        + +H VS  S DYR L+  F ++G+F  +GH        +  MFL S
Sbjct  73    TARLLPPLSTNLLLQNHSVSPTSSDYRKLLHNFHKIGMFRARGHTAYATFVIMIVMFLTS  132

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
             + GV+  +S W H+ S   +GF WIQ GW+GHDSGHY +M  +K +  AQ+L+ NCL G+
Sbjct  133   VTGVLCSDSAWVHLASGAAMGFAWIQCGWIGHDSGHYRIMSDRKWNWFAQVLSTNCLQGI  192

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
             SI WW+WNHNAHHIACN +DYDPD+Q +P+   S K F +SL S FY+K ++F+ ++RFL
Sbjct  193   SIGWWKWNHNAHHIACNSLDYDPDLQYIPLLVVSPKFF-NSLTSRFYDKKLNFDGVSRFL  251

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLP  639
             V YQHWTFYPVM  +AR+NM  QS+ T LF  +   +RAQEI GL +FWVW+P LLS LP
Sbjct  252   VCYQHWTFYPVM-CVARLNMIAQSFIT-LFSSREVGHRAQEIFGLAVFWVWFPLLLSCLP  309

Query  638   NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
             N SERIMF++ S  +TG+Q +QFSLNH +S  + GP    DW +KQ  GTL+I C  WMD
Sbjct  310   NWSERIMFLLASYSVTGIQHVQFSLNHFSSDVYVGPPVANDWFKKQTAGTLNISCPAWMD  369

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQFQ+EHHLFPRMPR Q RK+SPFV+ LC+KH + YN ASF  AN L  K++R+ 
Sbjct  370   WFHGGLQFQVEHHLFPRMPRGQFRKISPFVRDLCKKHNLPYNIASFTKANVLTLKTLRNT  429

Query  278   ALMARDLSPEKAPKNLVWEALNSFG  204
             A+ ARDLS    PKN+VWEA+++ G
Sbjct  430   AIEARDLS-NPTPKNMVWEAVHTHG  453



>ref|XP_009790286.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Nicotiana sylvestris]
Length=439

 Score =   526 bits (1356),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 328/447 (73%), Gaps = 12/447 (3%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKH+K  DLW+SI GKVY+V+DWV  HPGG+ P+ SLAGQ+ TDAF+A+HP
Sbjct  5     KKYITAEELKKHNKQDDLWISIQGKVYNVTDWVKEHPGGDIPIRSLAGQEATDAFIAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GYY+ D+QVSEVSKDYR L SEF++ G+FEKKGH V Y    ++ +  
Sbjct  65    GTAWKYLDKFFTGYYLQDYQVSEVSKDYRKLCSEFAKAGMFEKKGHGVIYSLCFVTLLLT  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S  GV+   + W HM S  L+G  W+Q  ++GHDSGHY +M T+  ++ AQ+L GNCLT
Sbjct  125   MSFSGVLLSNNFWIHMFSGALLGLSWMQISYLGHDSGHYLIMTTRGFNKLAQILTGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q LP+FA S+  F+ SL S+FY + ++F+S A+
Sbjct  185   GISIAWWKWTHNAHHVACNSLDHDPDLQHLPVFAVSSTFFK-SLNSYFYGRELTFDSAAK  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+T+YP+M  +AR+N+F+Q+   +LF K+   +R   ILG+++FW W+P L+S+
Sbjct  244   FFVSYQHFTYYPIM-CVARVNLFVQT-LLLLFSKRKVPDRGLNILGILVFWTWFPLLVST  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER++FV++S  +T +Q IQF+LNH A+  + G   G DW EKQ  GT+DI CS W
Sbjct  302   LPNWTERVLFVLISFCVTSLQHIQFTLNHFAADVYVGQPEGNDWFEKQTSGTIDIACSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LRKVSP V+ LC+KH + Y   SF+ AN    ++++
Sbjct  362   MDWFYGGLQFQLEHHLFPRLPRCHLRKVSPIVQDLCKKHKLPYRSLSFYEANVWTIRTLK  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ AR          L+WEA+N+ G
Sbjct  422   TAAMQAR---------GLLWEAVNTHG  439



>emb|CBI20658.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   528 bits (1359),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 255/471 (54%), Positives = 326/471 (69%), Gaps = 45/471 (10%)
 Frame = -1

Query  1631  IRSILASLGLFYLSMnamenndknnnNGTKKFITTEELKKHDKPGDLWVSIHGKVYDVSD  1452
             I+ ++ +L   +LS+  +     +    TK++I+ EELK H + GDLW+SI GKVY+VSD
Sbjct  3     IKKLILNLTTLFLSIKCIVPRSLSEMAETKRYISKEELKTHSRDGDLWISIQGKVYNVSD  62

Query  1451  WVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRML  1272
             W   HPGG  PLLSLAGQD TDAF+AYHP +                        DYR L
Sbjct  63    WAKVHPGGSAPLLSLAGQDATDAFVAYHPGVL-----------------------DYRRL  99

Query  1271  VSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGW  1092
             V EF++MGLFEKKGH V     A++ MF   +YGV+  ++ W H+ S  L+G  WIQ+GW
Sbjct  100   VYEFTKMGLFEKKGHGVFVTLCAMAVMFSACIYGVLGSDNTWVHLASGALMGLFWIQSGW  159

Query  1091  VGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLP  912
             +GHDSGHY VM  ++L+R  Q+L+GNCL G+SI WW+WNHNAHHIACN +D+DPD+Q +P
Sbjct  160   IGHDSGHYQVMMNRRLNRFVQVLSGNCLAGISIAWWKWNHNAHHIACNSLDFDPDLQHMP  219

Query  911   IFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVL  732
             +FA S+KLF SSL S+FYE+ M+F+ +ARFLVSYQHWTFYPVM  +AR+N+F QSW  +L
Sbjct  220   VFAVSSKLF-SSLTSYFYERKMNFDCVARFLVSYQHWTFYPVM-CVARLNLFAQSWSLLL  277

Query  731   FKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLA  552
              K+++   RAQEILGL++                  +MFVVLS   TG+Q +QF LNH +
Sbjct  278   SKRRV-RYRAQEILGLLV------------------VMFVVLSFSFTGIQHVQFCLNHFS  318

Query  551   SSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPF  372
             SS + GP +G DW EKQ  G+LDI CS WMDWFHGGLQFQIEHHLFPR+PR QLR VSPF
Sbjct  319   SSVYVGPPSGNDWFEKQTHGSLDISCSSWMDWFHGGLQFQIEHHLFPRLPRNQLRNVSPF  378

Query  371   VKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDLSPEKAPKNLVWEA  219
             V++LC+KH + Y+ ASFW AN L   ++R AAL ARDL+    PKNLVWEA
Sbjct  379   VQELCKKHNLPYDCASFWKANVLTLATLRTAALQARDLA-NPIPKNLVWEA  428



>emb|CDY53911.1| BnaA07g38190D [Brassica napus]
Length=449

 Score =   526 bits (1355),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 245/448 (55%), Positives = 326/448 (73%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              KK+IT E+LK H+KPGDLW++I GK Y+VSDW+  HPGG+  +L+L GQDVTDAF+A+H
Sbjct  6     VKKYITNEDLKNHNKPGDLWIAIQGKAYNVSDWIKSHPGGDAVILNLVGQDVTDAFIAFH  65

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A HHL   F GY+VSD Q SEVS+DYR + +EF ++GLFE KGH+  Y  + ++AMF
Sbjct  66    PGTAWHHLDNLFTGYHVSDFQASEVSRDYRRMAAEFRKLGLFENKGHVTLYTLSFVAAMF  125

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
                LYGV+   S+ AH  +A ++G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCL
Sbjct  126   AAVLYGVLACTSLLAHQIAAAILGLLWIQSAYIGHDSGHYVIMTNKSYNRFAQLLSGNCL  185

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ LA
Sbjct  186   TGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSAKFF-NSMTSRFYDRKLAFDPLA  244

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             R L+SYQH+T+YPVM    RIN+F+Q+   +LF K+   +RA    G+++FW W+P L+S
Sbjct  245   RLLISYQHFTYYPVMCF-GRINLFVQT-LLLLFSKREVPDRALNFAGILVFWTWFPLLVS  302

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LP   ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI CS 
Sbjct  303   CLPTWPERFFFVFTSFSVTALQHIQFTLNHFAADVYVGPPTGGDWFEKQAAGTLDISCSS  362

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             +MDWF GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN    +++
Sbjct  363   YMDWFFGGLQFQLEHHLFPRLPRCHLRKVAPVVQELCKKHNLPYRSLSWWEANVWTIRTL  422

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             + AA  ARD +     KNLVWEALN+ G
Sbjct  423   KKAAYQARD-AANPVVKNLVWEALNTHG  449



>gb|ADC34632.1| delta-8 sphingolipid desaturase [Primula auricula]
Length=452

 Score =   526 bits (1354),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 239/447 (53%), Positives = 323/447 (72%), Gaps = 12/447 (3%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K ++T E+L+KH+K GDLW+SI GK+YDV+DW+  HPGG+ PLL+ +GQD TDAF+A+HP
Sbjct  18    KGYVTEEDLRKHNKKGDLWISIQGKIYDVTDWIKDHPGGDSPLLNFSGQDATDAFIAFHP  77

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL + F G Y+ D + SEVSKDYR + SE S+MGLFEKK H V Y  A ++ +F 
Sbjct  78    GTAWQHLDKLFTGLYLKDFEPSEVSKDYRKIASEISKMGLFEKKEHTVIYCLAFITLLFT  137

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
              S+  V    S+W+H+    L+GF W+Q  ++GHDSGHY +M  KK ++ AQ+L+GNCLT
Sbjct  138   ASMGCVFLSNSLWSHIFGGGLLGFAWVQMSYLGHDSGHYVMMSNKKFNKIAQILSGNCLT  197

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+S+ WW+W HNAHHIACN +DYDPD+Q LP+FA S  LFR ++ S FY + ++F+ + +
Sbjct  198   GISMAWWKWTHNAHHIACNSLDYDPDLQHLPVFAVSTTLFR-NITSVFYGRELTFDFIPK  256

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
               VSYQH++FYPVM  + RIN+FIQ++  +LF ++   +RA  ILG+++FW W+P L+S 
Sbjct  257   LFVSYQHFSFYPVM-AVGRINLFIQTF-LLLFSRRKVPDRALNILGILLFWTWFPLLVSC  314

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER +FV+ S  +T +Q IQF LNH +   + GP TG DWVEKQ  GT+DI CS W
Sbjct  315   LPNWTERFLFVLASFTVTSIQHIQFCLNHFSGDTYVGPPTGTDWVEKQTRGTIDISCSTW  374

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWFHGGLQFQ+EHHLFPR+PRC LRKVSP VK LC+KH + Y   SF+ AN    K++R
Sbjct  375   MDWFHGGLQFQLEHHLFPRLPRCNLRKVSPVVKDLCKKHNLPYRSLSFFEANVATLKTLR  434

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             DAA+ A         + L+WEA+N+ G
Sbjct  435   DAAMQA---------QGLLWEAVNTHG  452



>gb|KFK35341.1| hypothetical protein AALP_AA5G272100 [Arabis alpina]
Length=450

 Score =   526 bits (1354),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 243/447 (54%), Positives = 329/447 (74%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT  +L KH+KPGDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  8     KKYITNSDLSKHNKPGDLWIAIQGKVYNVSDWIKSHPGGDTVILNLVGQDVTDAFIAFHP  67

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A H+L+  F GY++ D +VS+VS+DYR + +EF ++GLFEKKGH+  Y  A +++MF 
Sbjct  68    GTAWHNLEPLFTGYHLRDFEVSDVSRDYRKMAAEFRKLGLFEKKGHVTLYTLAFIASMFA  127

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   S+  H  +A L+G LWIQ+ ++GHDSGHY +M  +  +R AQL++GNCLT
Sbjct  128   GVLYGVLACTSIIVHQIAAALLGLLWIQSAYIGHDSGHYVIMANESYNRIAQLISGNCLT  187

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ +AR
Sbjct  188   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-NSMTSRFYDRKLTFDPVAR  246

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQHWT+YPVM    RIN+FIQ++  +LF  +   +RA    G+++FW W+P L+S 
Sbjct  247   FLISYQHWTYYPVMCF-GRINLFIQTF-LLLFSTREVPDRALNFAGILVFWTWFPLLVSC  304

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI C  +
Sbjct  305   LPTWPERFFFVFTSFTVTALQHIQFTLNHFAADVYMGPPTGNDWFEKQAAGTLDITCVSY  364

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LRKVSP VK+LC+KH + Y   S+W AN L  ++++
Sbjct  365   MDWFYGGLQFQLEHHLFPRLPRCHLRKVSPVVKELCKKHNLPYRSLSWWDANVLTIETLK  424

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVWEALN+ G
Sbjct  425   KAAYHARD-AANPVVKNLVWEALNTHG  450



>ref|XP_009599904.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Nicotiana tomentosiformis]
Length=439

 Score =   525 bits (1352),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 235/447 (53%), Positives = 330/447 (74%), Gaps = 12/447 (3%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EEL+KH+K  DLW+SI GKVY+ ++W+  HPGG+ P+L+LAGQ+ TDAF+A+HP
Sbjct  5     KKYITAEELRKHNKAEDLWISIQGKVYNATNWIKEHPGGDIPILNLAGQEATDAFIAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GYY+ D++VSEVSKDYR L SEF++ GLFEKKGH V Y    ++ +  
Sbjct  65    GTAWKYLDKFFTGYYLEDYKVSEVSKDYRKLCSEFAKAGLFEKKGHGVIYSLCFVAFLLF  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +++YGV++  S W  M    L+G  W+Q  ++GHDSGHY +M T+  ++  Q+LAGNC+T
Sbjct  125   LTVYGVLYSNSFWIRMLCGGLLGLAWMQVSYLGHDSGHYLIMTTRGFNKLVQILAGNCIT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW W HNAHH+ACN +DYDPD+Q LP+FA S+ LF+ SL S FY + ++F+SL++
Sbjct  185   GISIAWWNWTHNAHHVACNSLDYDPDLQHLPVFAVSSSLFK-SLNSTFYGRELTFDSLSK  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+TFYP++  ++R+N+FIQ+   +LF ++   NR   ILG+++FW W+P L+S+
Sbjct  244   FFVSYQHFTFYPIV-CVSRVNLFIQT-LLLLFSRRKVTNRLMNILGIMVFWTWFPLLVST  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER++FV++S  +TG+Q +QF LNH A+  + G   G DW EKQ  GT+DI CSP 
Sbjct  302   LPNWTERVLFVLISFAVTGIQHVQFCLNHFAADVYVGQPKGNDWFEKQTAGTIDIACSPR  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRCQLRK+SP V+ LC+KH + Y   SF+ AN    +++R
Sbjct  362   MDWFFGGLQFQLEHHLFPRLPRCQLRKISPIVQDLCKKHNLPYRSLSFYEANRWTIRTLR  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ AR         +L+WEA+N+ G
Sbjct  422   VAAMQAR---------SLLWEAVNTHG  439



>ref|XP_004248068.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Solanum lycopersicum]
Length=439

 Score =   525 bits (1352),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 236/448 (53%), Positives = 330/448 (74%), Gaps = 12/448 (3%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+IT EELKKH+K  DLW+S+ GK+Y+V+DW+ +HPGG+ P+L+LAGQ+ TDAF+A+H
Sbjct  4     SKKYITAEELKKHNKRDDLWISVQGKIYNVTDWIKQHPGGDIPILNLAGQEATDAFIAFH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  HL  FF GYY+ D++VSEVSKDYR L  +F++ GLFEKKGH V Y    +  + 
Sbjct  64    PGTAWKHLDNFFTGYYLQDYEVSEVSKDYRKLCVDFAKAGLFEKKGHGVMYSFCFIGFLL  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              ++ YGV+F  S   HM S  L+G  W+Q  ++GHDSGHY +M  K  ++  Q+++GNCL
Sbjct  124   FLTFYGVLFSNSFLIHMLSGGLLGLTWMQISYLGHDSGHYLIMTNKGFNKMVQIMSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHH+ACN +DYDPD+Q LP+FA S+ LF+ SL S FY + ++F+SLA
Sbjct  184   TGISIAWWKWTHNAHHVACNSLDYDPDLQHLPVFAVSSSLFK-SLNSTFYGRELTFDSLA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             +F VSYQH+TFYP+ + ++R+N+F+Q+   +LF K+   +R   ILG+++FW W+P L+ 
Sbjct  243   KFFVSYQHFTFYPI-ICVSRVNLFVQTL-LLLFSKRKVPDRFLNILGIMVFWTWFPLLVL  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
             SLPN +ER++FV+ S  +TG+Q +QF LNH A+  + G   G DW EKQ  GT+DIDCSP
Sbjct  301   SLPNWTERVLFVLTSFAVTGIQHVQFCLNHFAADVYVGQPKGNDWFEKQTAGTIDIDCSP  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
              MDWF GGLQFQ+EHHLFPR+PRCQLRK+SP V++LC+KH ++Y   SF+ AN    +++
Sbjct  361   QMDWFFGGLQFQLEHHLFPRLPRCQLRKISPIVQELCKKHNLSYRSLSFFEANRWTIRTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             + AA+ AR          L+WEA+N+ G
Sbjct  421   KTAAMQAR---------GLLWEAVNTHG  439



>sp|Q43469.1|SLD1_HELAN RecName: Full=Delta(8)-fatty-acid desaturase; AltName: Full=Delta(8)-sphingolipid 
desaturase [Helianthus annuus]
 emb|CAA60621.1| delta-8 sphingolipid desaturase [Helianthus annuus]
Length=458

 Score =   525 bits (1353),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 328/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT++ELKKH+ P DLW+SI GKVY+V++W   HPGG+ PL++LAGQDVTDAF+A+HP
Sbjct  16    KKYITSKELKKHNNPNDLWISILGKVYNVTEWAKEHPGGDAPLINLAGQDVTDAFIAFHP  75

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL + F GY++ D+QVS++S+DYR L SEF++ G+FEKKGH V Y    +S +  
Sbjct  76    GTAWKHLDKLFTGYHLKDYQVSDISRDYRKLASEFAKAGMFEKKGHGVIYSLCFVSLLLS  135

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGV++  S W HM S  ++G  W+Q  ++GHD+GHY +M T+  ++ A +  GNC+T
Sbjct  136   ACVYGVLYSGSFWIHMLSGAILGLAWMQIAYLGHDAGHYQMMATRGWNKFAGIFIGNCIT  195

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q LP+ A S+KLF +S+ S FY + ++F+ LAR
Sbjct  196   GISIAWWKWTHNAHHIACNSLDYDPDLQHLPMLAVSSKLF-NSITSVFYGRQLTFDPLAR  254

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+ +YP+M  +AR+N+++Q+   ++ K+KI  +R   ILG +IFW W+P L+S 
Sbjct  255   FFVSYQHYLYYPIM-CVARVNLYLQTILLLISKRKI-PDRGLNILGTLIFWTWFPLLVSR  312

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER+ FV++S  +TG+Q IQF+LNH +   + GP  G +W EKQ  GT+DI CS W
Sbjct  313   LPNWPERVAFVLVSFCVTGIQHIQFTLNHFSGDVYVGPPKGDNWFEKQTRGTIDIACSSW  372

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR +SP  ++LC+K+ + Y   SF+ AN    K++R
Sbjct  373   MDWFFGGLQFQLEHHLFPRLPRCHLRSISPICRELCKKYNLPYVSLSFYDANVTTLKTLR  432

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL ARDL+   AP+NL WEA N+ G
Sbjct  433   TAALQARDLT-NPAPQNLAWEAFNTHG  458



>ref|XP_009611900.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Nicotiana tomentosiformis]
Length=439

 Score =   524 bits (1350),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 327/447 (73%), Gaps = 12/447 (3%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKH+K  DLW+SI GKVY+V+DWV  HPGG+ P+ SLAGQ+ TDAF+A+HP
Sbjct  5     KKYITAEELKKHNKQDDLWISIQGKVYNVTDWVKEHPGGDIPIRSLAGQEATDAFIAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GYY+ D+QVSEVSKDYR L SEF++ G+FEKKGH V Y    ++ +  
Sbjct  65    GTAWKYLDKFFTGYYLQDYQVSEVSKDYRKLCSEFAKAGMFEKKGHGVIYSLCFVTLLLT  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S  GV+   + W HM S  L+G  W+Q  ++GHDSGHY +M T+  ++ AQ+L GNCLT
Sbjct  125   LSFSGVLLSNNFWVHMFSGALLGLSWMQISYLGHDSGHYLIMTTRGFNKLAQILTGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q LP+FA S+  F+ SL S+FY + ++F+S A+
Sbjct  185   GISIAWWKWTHNAHHVACNSLDHDPDLQHLPVFAVSSTFFK-SLNSYFYGRELTFDSAAK  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
               VSYQH+T+YP+M  +AR+N+F+Q+   +LF K+   +R   ILGL++FW W+P L+S+
Sbjct  244   VFVSYQHFTYYPIM-CVARMNLFVQT-LLLLFSKRKVQDRFLNILGLLVFWTWFPLLVST  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER++FV++S  +T +Q IQF+LNH A+  + G   G DW EKQ  GT+DI CS W
Sbjct  302   LPNWTERVLFVLISFCVTSLQHIQFTLNHFAADVYVGQPEGNDWFEKQTSGTIDIACSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LRKVSP V+ LC+KH + Y   SF+ AN    ++++
Sbjct  362   MDWFYGGLQFQLEHHLFPRLPRCHLRKVSPIVQDLCKKHNLPYRSLSFYEANVWTIRTLK  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ AR          L+WEA+N+ G
Sbjct  422   TAAMQAR---------GLLWEAVNTHG  439



>gb|AEW24953.1| delta8-sphingolipid desaturase [Brassica rapa]
Length=449

 Score =   524 bits (1350),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 244/448 (54%), Positives = 326/448 (73%), Gaps = 4/448 (1%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
              KK+IT E+LK H+KPGDLW++I GK Y+VSDW+  HPGG+  +L+L GQDVTDAF+A+H
Sbjct  6     VKKYITNEDLKNHNKPGDLWIAIQGKAYNVSDWIKSHPGGDAVILNLIGQDVTDAFIAFH  65

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A HHL   F GY+VSD QVSEVS+DYR + +EF ++GLFE KGH+  Y  + ++AMF
Sbjct  66    PGTAWHHLDNLFTGYHVSDFQVSEVSRDYRRMAAEFHKLGLFENKGHVTLYTLSFVAAMF  125

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
                LYGV+   S+ AH  +A ++G LWIQ+ ++GHDSGHY +M  +  +R AQLL+GNCL
Sbjct  126   AAVLYGVLACTSILAHQLAAAILGLLWIQSAYIGHDSGHYVIMTNESCNRFAQLLSGNCL  185

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ LA
Sbjct  186   TGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSAKFF-NSMTSRFYDRKLAFDPLA  244

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             R L+SYQH+T+YPVM    RIN+F+Q+   +LF K+   +R     G+++FW W+P L+S
Sbjct  245   RLLISYQHFTYYPVMCF-GRINLFVQT-LLLLFSKREVPDRPLNFAGILVFWTWFPLLVS  302

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LP   ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI CS 
Sbjct  303   CLPTWPERFFFVFTSFSVTALQHIQFTLNHFAADVYVGPPTGGDWFEKQAAGTLDISCSS  362

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             +MDWF GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN    +++
Sbjct  363   YMDWFFGGLQFQLEHHLFPRLPRCHLRKVAPVVQELCKKHNLPYRSLSWWEANVWTIRTL  422

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             + AA  ARD +     KNLVWEALN+ G
Sbjct  423   KKAAYQARD-AANPVVKNLVWEALNTHG  449



>ref|XP_009624554.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Nicotiana tomentosiformis]
Length=439

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 234/448 (52%), Positives = 330/448 (74%), Gaps = 12/448 (3%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+IT EELKKH+   DLW+SI GKVY+ ++W+  HPGG+ P+L+LAGQ+ TDAF+A+H
Sbjct  4     SKKYITAEELKKHNNSEDLWISIQGKVYNATNWIKEHPGGDIPILNLAGQEATDAFIAFH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF GYY+ D++VSEVS+DYR L SEF++ GLFEKKGH V Y    ++ + 
Sbjct  64    PGTAWKYLDKFFTGYYLEDYEVSEVSRDYRKLCSEFAKAGLFEKKGHGVIYSLCFVAFLL  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +++YGV++  S W  M    L+G  W+Q  ++GHDSGHY +M T+  ++  Q+LAGNC+
Sbjct  124   FLTVYGVLYSNSFWIRMLCGGLLGLAWMQVSYLGHDSGHYLIMTTRGFNKLVQILAGNCI  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW W HNAHH+ACN +DYDPD+Q LP+FA S+ LF+ SL S FY + ++F+SLA
Sbjct  184   TGISIAWWNWTHNAHHVACNSLDYDPDLQHLPVFAVSSSLFK-SLNSTFYGRELTFDSLA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             +F VSYQH+TFYP++  ++R+N+FIQ+   +LF ++   +R   ILG+++FW W+P L+S
Sbjct  243   KFFVSYQHFTFYPIV-CVSRVNLFIQT-LLLLFSRRKVTDRLMNILGIMVFWTWFPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
              LPN +ER++FV++S ++TG+Q +QF LNH A+  + G   G DW EKQ  GT+DI CS 
Sbjct  301   ILPNWTERVLFVLISFVVTGIQHVQFCLNHFAADVYVGQPKGNDWFEKQTAGTIDIACSR  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
              MDWF GGLQFQ+EHHLFPR+PRCQLRK+SP V++LC+KH + Y   SF+ AN    +++
Sbjct  361   QMDWFFGGLQFQLEHHLFPRLPRCQLRKISPIVQELCKKHNLPYRSLSFFEANRWTIRTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AA+ AR         NL+WEA+N+ G
Sbjct  421   RVAAMQAR---------NLLWEAVNTHG  439



>ref|XP_004240093.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Solanum lycopersicum]
Length=439

 Score =   522 bits (1344),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 237/447 (53%), Positives = 328/447 (73%), Gaps = 12/447 (3%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EELKKHDKP DLW+SI GK Y+V+DWV  HPGG+ P+ SLAGQ+ TDAF+A+HP
Sbjct  5     KKYITAEELKKHDKPDDLWISIQGKCYNVTDWVKEHPGGDIPIRSLAGQEATDAFIAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GY++ D++V++VSKDYR L SEFS+ G+F+KKGH V Y    ++ +  
Sbjct  65    GSAWKYLDKFFTGYHLKDYEVTDVSKDYRKLCSEFSKAGMFDKKGHGVIYSFCFVALLMS  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S  GV+  ++   HM SA L+G  W+Q  ++GHDSGHY +M  +  ++ AQ+L GNCLT
Sbjct  125   LSFCGVLLSKNFLVHMVSAALLGLAWMQISYLGHDSGHYMIMTNRGFNKLAQILTGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q LP+FA S K F+ SL S FY + ++F+SLA+
Sbjct  185   GISIAWWKWTHNAHHVACNSLDHDPDLQHLPVFAVSTKFFK-SLRSSFYGRELTFDSLAK  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+T+YP+M  +AR+N+F+Q++  +LF  +   +RA  ILG+++FW W+P L+S+
Sbjct  244   FFVSYQHFTYYPIM-CVARVNLFVQTF-LLLFSTRKVPDRALNILGILVFWTWFPLLIST  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER +FV+LS  +T +Q IQF+LNH A+  + G   G DW EKQ  GT+DI CS W
Sbjct  302   LPNWTERFLFVLLSFCVTSLQHIQFTLNHFAADVYVGQPEGNDWFEKQTSGTIDIACSSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LRKVSP V+ LC+KH + Y   SF+ AN    ++++
Sbjct  362   MDWFYGGLQFQLEHHLFPRLPRCHLRKVSPIVQDLCKKHKLPYRSLSFYEANVWTLRTLK  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ AR          L+WEA+N+ G
Sbjct  422   TAAIQAR---------GLLWEAVNTHG  439



>ref|XP_006660549.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Oryza brachyantha]
Length=465

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 246/449 (55%), Positives = 320/449 (71%), Gaps = 5/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G  + I+++EL+KH K GDLW+SI G VYDV+ WV  HPGG+ PLL+LAGQD TDAF AY
Sbjct  22    GEVRAISSDELRKHAKAGDLWISISGDVYDVTAWVAHHPGGDIPLLTLAGQDATDAFAAY  81

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP      L+RF  G  + D+ VS  S D+R L+++ S  GLFE+ G       A ++ +
Sbjct  82    HPPSVRPLLRRFLVGR-LEDYAVSPASADFRRLLAQLSSAGLFERVGPTPKVQVAGMAVL  140

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               V+ Y V+   S WAH+ +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNC
Sbjct  141   LCVAFYCVLACASAWAHLLAGGLIGFIWIQSGWMGHDSGHHRITGHATLDRLLQVLSGNC  200

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+ NHN HHI+CN +D+DPD+Q +P+FA S+KLF   L S+FYE+ + F+++
Sbjct  201   LTGLSIAWWKCNHNTHHISCNSLDHDPDLQHMPLFAVSSKLF--GLWSYFYERTLVFDAV  258

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ++FL+SYQHWTFYPVM   ARIN+ +QS    LF K+    R  EI G+  FW+WYP L+
Sbjct  259   SKFLISYQHWTFYPVMGF-ARINLLVQS-AVFLFSKRKVPQRPLEIAGVAAFWLWYPMLV  316

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+ FV  S ++TG+Q +QF LNH +S  + GP  G DW EKQ  GTLDI CS
Sbjct  317   SCLPNWWERVAFVAASFVITGIQHVQFCLNHFSSEVYVGPPKGNDWFEKQTAGTLDILCS  376

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQIEHHLFPR+PRC LRKV+PFV+ LC+KHG+ Y  ASFW AN L +K+
Sbjct  377   PWMDWFHGGLQFQIEHHLFPRLPRCHLRKVAPFVRDLCKKHGLPYAAASFWEANVLTWKT  436

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL AR  +   APKNLVWEA+N+ G
Sbjct  437   LRAAALQARKATSGAAPKNLVWEAVNTHG  465



>ref|XP_006602301.1| PREDICTED: delta(8)-fatty-acid desaturase-like, partial [Glycine 
max]
Length=437

 Score =   522 bits (1344),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 249/441 (56%), Positives = 335/441 (76%), Gaps = 4/441 (1%)
 Frame = -1

Query  1526  EELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIAAHH  1347
             EELK+H+K GDLW+SI GKVY+VSDW   HPGGE PLL+LAGQDVTDAF+AYHP  A  +
Sbjct  1     EELKEHNKSGDLWISIQGKVYNVSDWAKDHPGGEVPLLNLAGQDVTDAFIAYHPGSAWKY  60

Query  1346  LQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGV  1167
             L  FF GY++ D +VSEVSKDYR LVSEF+++GLFEKK H+  Y  ++++ MF + +YGV
Sbjct  61    LDPFFTGYHLRDFKVSEVSKDYRKLVSEFAKVGLFEKKEHVTLYTLSSVAVMFSIVVYGV  120

Query  1166  VFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWW  987
             +   SVWAH+G+A+L+G LW+Q+ +VGHDSGHY+VM +   ++ AQ+L GNC+TG+SI W
Sbjct  121   IGCNSVWAHLGAALLLGLLWMQSTYVGHDSGHYEVMSSPGYNKLAQILCGNCMTGISIAW  180

Query  986   WRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQ  807
             W+W HNAHHI+CN +DYDPD+Q +P+FA S + F +S+ S FY + + F+SL+RFL+SYQ
Sbjct  181   WKWTHNAHHISCNSLDYDPDLQHIPVFAVSTRFF-NSIKSCFYGRKLVFDSLSRFLISYQ  239

Query  806   HWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSE  627
             HWTFYPV L  AR+N+++Q+   +  ++K+  +RA  I+G+++FW+W+P L+SSLPN  E
Sbjct  240   HWTFYPV-LCFARVNLYLQTLLLLFSRRKV-PDRAFNIMGILVFWIWFPLLISSLPNWGE  297

Query  626   RIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHG  447
             R+MFV+ S  +  +Q +QF LNH A+  + GP  G DW EKQ  GTLDI CS WMDWF G
Sbjct  298   RVMFVLASFAVCSIQHLQFCLNHFAADVYEGPPNGNDWFEKQTGGTLDISCSTWMDWFFG  357

Query  446   GLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMA  267
             GLQFQ+EHHLFPR+PR QLRK+SP V  LC+KH + Y   +F  AN    K++R AAL A
Sbjct  358   GLQFQLEHHLFPRLPRAQLRKISPLVIDLCKKHNLPYRSLTFVEANLWTLKTLRTAALQA  417

Query  266   RDLSPEKAPKNLVWEALNSFG  204
             R+LS   + +NL+WEA N+ G
Sbjct  418   RNLS-NPSSQNLLWEAFNTHG  437



>ref|XP_010326991.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Solanum lycopersicum]
Length=439

 Score =   521 bits (1342),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 235/448 (52%), Positives = 328/448 (73%), Gaps = 12/448 (3%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+IT EELKKH+K  D+W+S+ GKVY+V+DW+ +HPGG+ P+L+LAGQ+ TDAF+A+H
Sbjct  4     SKKYITAEELKKHNKREDVWISVQGKVYNVTDWIKQHPGGDIPILNLAGQEATDAFIAFH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  HL  FF GYY+ D++VSEVSKDYR L  +F++ GLFEKKGH V Y    +  + 
Sbjct  64    PGTAWKHLDNFFTGYYLQDYEVSEVSKDYRKLCVDFAKAGLFEKKGHGVMYSFCFIGFLL  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              ++ YGV+F  S   HM S  L+G  W+Q  ++GHDSGHY +M TK  ++  Q+++GNCL
Sbjct  124   CLTFYGVLFSNSFLIHMLSGALLGLTWMQISYLGHDSGHYVIMTTKGFNKMIQIMSGNCL  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW+W HNAHH+ACN +DYDPD+Q LP+FA S+ LF+ SL S FY + ++F+SLA
Sbjct  184   TGISIAWWKWTHNAHHVACNSLDYDPDLQHLPVFAVSSSLFK-SLNSTFYGRELTFDSLA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             +F VSYQH+TFYP+ + ++R+N+FIQ+   +LF K+   +R   ILG+++FW W+P L+ 
Sbjct  243   KFFVSYQHFTFYPI-ICVSRVNLFIQTL-LLLFSKRKVPDRFLNILGIMVFWTWFPLLVL  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
             SLPN +ER++FV+ S  +TG+Q +QF LNH A+  + G   G DW EKQ  GT+DI CSP
Sbjct  301   SLPNWTERVLFVLTSFAVTGIQHVQFCLNHFAADVYVGQPKGNDWFEKQTAGTIDIACSP  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
              MDWF GGLQFQ+EHHLFPR+PRC LR +SP V++LC+KH ++Y   SF+ AN    +++
Sbjct  361   QMDWFFGGLQFQLEHHLFPRLPRCHLRNISPIVQELCKKHNLSYRSLSFFEANRWTIRTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AA+ AR          L+W+A+N+ G
Sbjct  421   RTAAMQAR---------GLIWDAVNTHG  439



>ref|XP_009788557.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Nicotiana sylvestris]
Length=439

 Score =   518 bits (1335),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 234/448 (52%), Positives = 333/448 (74%), Gaps = 12/448 (3%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +KK+IT EELKKH+K  DLW+SI GKVY+ ++W+  HPGG+ P+L+LAGQ+ TDAF+A+H
Sbjct  4     SKKYITAEELKKHNKADDLWISIQGKVYNATNWIKEHPGGDIPILNLAGQEATDAFIAFH  63

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             P  A  +L +FF GYY+ D++VSEVS+DYR L SEF++ GLFEKKGH V Y    ++ + 
Sbjct  64    PGTAWKYLNKFFTGYYLEDYEVSEVSRDYRKLCSEFAKAGLFEKKGHGVIYSLCFVAFLL  123

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              +++YGV++  S W  M    L+G  W+Q  ++GHDSGHY +M T+  ++  Q+LAGNC+
Sbjct  124   FLTVYGVLYSNSFWIRMLCGGLLGLAWMQVSYLGHDSGHYLIMTTRGFNKLVQILAGNCI  183

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
             TG+SI WW W HNAHH+ACN +DYDPD+Q LP+FA S+ LF+ SL S FY + ++F+ +A
Sbjct  184   TGISIAWWNWTHNAHHVACNSLDYDPDLQHLPVFAVSSSLFK-SLNSTFYGRELTFDPMA  242

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLS  648
             +F VSYQH+TFYP+ + ++R+N+F+Q+   +  K+K+  NR   ILG+++FW W+P L+S
Sbjct  243   KFFVSYQHFTFYPI-VCVSRVNLFLQTLLLLFSKRKV-TNRLMNILGIMVFWTWFPLLVS  300

Query  647   SLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
             +LPN +ER++FV++S ++TG+Q +QF LNH A+  + G   G DW EKQ  GT+DI CSP
Sbjct  301   TLPNWTERVLFVLISFVVTGIQHVQFCLNHFAADVYVGQPKGNDWFEKQTAGTIDIACSP  360

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
              MDWF GGLQFQ+EHHLFPR+PRCQLRK+SP V++LC+KH ++Y   SF+ AN    +++
Sbjct  361   QMDWFFGGLQFQLEHHLFPRLPRCQLRKISPIVQELCKKHNLSYRSLSFFEANRWTIRTL  420

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG  204
             R AA+ AR         NL+WEA+N+ G
Sbjct  421   RVAAMQAR---------NLLWEAVNTHG  439



>ref|XP_006345577.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Solanum tuberosum]
Length=439

 Score =   517 bits (1332),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 235/447 (53%), Positives = 327/447 (73%), Gaps = 12/447 (3%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELKKHDK  DLW+SI GK Y+V+DWV  HPGG+ P+ SLAGQ+ TDAF+A+HP
Sbjct  5     KKYITSEELKKHDKQDDLWISIQGKCYNVTDWVKDHPGGDIPIRSLAGQEATDAFIAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +FF GY++ D++V+EVSKDYR L SEFS+ G+FEKKGH V Y    ++ +  
Sbjct  65    GTAWKYLDKFFTGYHLRDYEVTEVSKDYRKLCSEFSKAGMFEKKGHGVIYSFCFVTLLMS  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             +S+ GV+  ++   HM SA L+G  W+Q  ++GHDSGHY +M  +  ++ AQ+L GNCLT
Sbjct  125   LSICGVLLSKNFLVHMLSAALLGLAWMQISYLGHDSGHYVMMTNRGFNKLAQILTGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q LP+FA S K F+ SL S FY + ++F+S+A+
Sbjct  185   GISIAWWKWTHNAHHVACNSLDHDPDLQHLPVFAVSTKFFK-SLNSSFYGRELTFDSVAK  243

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F VSYQH+T+YP+M  +AR+N+F+Q++  +LF  +   +RA  ILG+++FW W+P L+S+
Sbjct  244   FFVSYQHFTYYPIM-CVARVNLFVQTF-LLLFSTRKVPDRALNILGILVFWTWFPLLVST  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN +ER +FV+LS  +T +Q IQF+LNH A+  + G   G DW EKQ  GT+DI C  W
Sbjct  302   LPNWTERFLFVLLSFCVTSLQHIQFTLNHFAADVYVGQPEGNDWFEKQTSGTIDIACDSW  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF+GGLQFQ+EHHLFPR+PRC LR VSP V+ LC+KH + Y   SF+ AN    ++++
Sbjct  362   MDWFYGGLQFQLEHHLFPRLPRCHLRTVSPIVQDLCKKHKLPYRSLSFYEANVWTLRTLK  421

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ AR          L+WEA+N+ G
Sbjct  422   TAAMQAR---------GLLWEAVNTHG  439



>ref|XP_004306721.1| PREDICTED: delta(8)-fatty-acid desaturase-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004306722.1| PREDICTED: delta(8)-fatty-acid desaturase-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=451

 Score =   517 bits (1332),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 238/447 (53%), Positives = 320/447 (72%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +K+IT EELK H+KPGDLW+SI GK+Y+VSDWV  HPGG   L  L GQDVTD F+AYHP
Sbjct  9     RKYITVEELKLHNKPGDLWISIQGKIYNVSDWVNDHPGGATILYDLGGQDVTDGFMAYHP  68

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             +     L ++FNGY++ D ++SE SKDYR L +E ++MGLFE KGH   Y    +  +  
Sbjct  69    STVWKRLGKYFNGYHLKDFEISEASKDYRKLHAEITQMGLFENKGHGALYNITTIVVLLY  128

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGV+  +SV  H   AV++G LWI   ++GHD+GHY VM ++K ++  Q+LAGNCLT
Sbjct  129   LVVYGVLKSDSVLVHFVCAVMLGVLWIMGAYMGHDAGHYQVMASRKWNQIIQVLAGNCLT  188

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HN HHIACN +DYDPD+Q +P+FA S K F  SL S FY + M F+ +AR
Sbjct  189   GISIAWWKWTHNQHHIACNSLDYDPDLQHMPVFAVSTKFFH-SLTSVFYGRKMDFDHVAR  247

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVS+QH T+YP+M ++ R+N+FIQ++  +L  K+   NR   I+G++ FW W+P L+  
Sbjct  248   FLVSHQHLTYYPIM-IVGRVNLFIQTF-LLLSSKRSIPNRTLNIIGILFFWTWFPLLVMC  305

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+ +ER+MFV++S  +T +Q IQF+LNH +   + GP TG DW EKQ  GT+DI CS +
Sbjct  306   LPSWTERVMFVLVSFTVTALQHIQFTLNHFSGDTYLGPPTGNDWFEKQAAGTIDISCSKY  365

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRCQLR VSP VK+LC+KH + +   SFW AN    + +R
Sbjct  366   MDWFFGGLQFQLEHHLFPRLPRCQLRTVSPTVKELCKKHNLPHRSLSFWDANVTTIRVLR  425

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AAL A D++    PKNL WEA+N+ G
Sbjct  426   KAALQAWDMT-LPVPKNLAWEAINTHG  451



>gb|EMT29164.1| Fatty acid desaturase 2-like protein [Aegilops tauschii]
Length=469

 Score =   517 bits (1331),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 238/446 (53%), Positives = 325/446 (73%), Gaps = 4/446 (1%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             + I+T+EL+ H    DLW+SI G VYDV+ W+  HPGGE PL++LAGQD TDAF+AYHP 
Sbjct  28    RMISTKELQAHAAADDLWISISGDVYDVTPWLRHHPGGEVPLITLAGQDATDAFMAYHPP  87

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
                  L+RFF G  +SD+ V   S D+R L+++ S  GLFE+ GH   +   A+S +F +
Sbjct  88    SVRPLLRRFFVGR-LSDYTVPPASADFRRLLAQLSSAGLFERVGHTPKFLLVAMSVLFCI  146

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             +LY V+   S  AHM +  L+GF+WIQ+GW+GHDSGH+ + +   L+R  Q+++GNCLTG
Sbjct  147   ALYCVLACSSTGAHMFAGGLIGFIWIQSGWIGHDSGHHQITRHPALNRLLQVVSGNCLTG  206

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             + I WW++NHN HHI+CN +D+DPD+Q LP+FA S KLF ++L S  YE+ ++F+++++F
Sbjct  207   LGIAWWKFNHNTHHISCNSLDHDPDLQHLPLFAVSTKLF-NNLWSVCYERTLAFDAISKF  265

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
              VSYQHWTFYPVM   ARIN+ +QS   ++ +KK+   R  EI G+  FWVWYP L+S L
Sbjct  266   FVSYQHWTFYPVMGF-ARINLLVQSIVFLITQKKV-RQRWLEIAGVAAFWVWYPLLVSCL  323

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ER+ FV+ S ++TG+Q +QF LNH +S+ + GP  G DW E+Q  GTLDI CSPWM
Sbjct  324   PNWWERVAFVLASFVITGIQHVQFCLNHFSSAVYVGPPKGNDWFERQTAGTLDIKCSPWM  383

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQ+EHHLFPR+PRC  R V+P V+ LC+KHG++Y  A+FW AN + +K++R 
Sbjct  384   DWFHGGLQFQVEHHLFPRLPRCHYRMVAPIVRDLCKKHGLSYGAATFWEANVMTWKTLRA  443

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AAL AR+ +   APKNLVWEALN+ G
Sbjct  444   AALQAREATTGAAPKNLVWEALNTHG  469



>dbj|BAK00580.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   517 bits (1331),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 324/446 (73%), Gaps = 4/446 (1%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             + I+T+EL+ H    DLW+SI G VYDV+ W+  HPGGE PL++LAGQD TDAF+AYHP 
Sbjct  28    RMISTKELQAHAAADDLWISISGDVYDVTPWLRYHPGGEVPLITLAGQDATDAFMAYHPP  87

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
                  L+RFF G  +SD+ V   S D+R L+++ S  GLFE+ GH   +   A+S +F V
Sbjct  88    SVRPLLRRFFVGR-LSDYTVPPASADFRRLLAQLSSAGLFERVGHTPKFLLVAMSVLFCV  146

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             +LY V+   S  AHM +  L+GF+WIQ+GW+GHDSGH+ +     L+R  Q+++GNCLTG
Sbjct  147   ALYCVLACSSTGAHMFAGGLIGFIWIQSGWIGHDSGHHQITSHPALNRLLQVVSGNCLTG  206

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             + I WW++NHN HHI+CN +D+DPD+Q LP+FA S KLF ++L S  YE+ ++F+++++F
Sbjct  207   LGIAWWKFNHNTHHISCNSLDHDPDLQHLPLFAVSTKLF-NNLWSVCYERTLAFDAISKF  265

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
              VSYQHWTFYPVM   ARIN+ +QS   ++ +KK+   R  EI G+  FWVWYP L+S L
Sbjct  266   FVSYQHWTFYPVMGF-ARINLLVQSIVFLITQKKV-RQRWLEIAGVAAFWVWYPLLVSCL  323

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ER+ FV+ S ++TG+Q +QF LNH +S+ + GP  G DW E+Q  GTLDI CSPWM
Sbjct  324   PNWWERVAFVLASFVITGIQHVQFCLNHFSSAVYVGPPKGNDWFERQTAGTLDIKCSPWM  383

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQ+EHHLFPR+PRC  R V+P V+ LC+KHG++Y  A+FW AN + +K++R 
Sbjct  384   DWFHGGLQFQVEHHLFPRLPRCHYRMVAPIVRDLCKKHGLSYGAATFWEANVMTWKTLRA  443

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AAL ARD +   APKNLVWEALN+ G
Sbjct  444   AALQARDATTGSAPKNLVWEALNTHG  469



>emb|CDY52010.1| BnaC06g42900D [Brassica napus]
Length=449

 Score =   516 bits (1329),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 245/447 (55%), Positives = 327/447 (73%), Gaps = 4/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT E+LK H+K GDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITNEDLKSHNKHGDLWIAIQGKVYNVSDWIKSHPGGDAVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL+  F GY+V D QVSEVS+DYR + +EF ++GLFE KGH+  Y  A ++AMF 
Sbjct  67    GTAWHHLENLFTGYHVRDFQVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTFAFVAAMFA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   S+ AH  +A ++G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   AVLYGVLACTSILAHQIAAAILGLLWIQSAYIGHDSGHYVIMTNKSFNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F +S+ S FY++ ++F+ LAR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-TSMTSRFYDRKLTFDPLAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              L+SYQH+++YPVM    RIN+FIQ+   +LF K+   +RA    G+++FW W+P L+S 
Sbjct  246   LLISYQHFSYYPVMCF-GRINLFIQT-LLLLFSKREVPDRALNFAGILVFWTWFPLLVSC  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP   ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GTLDI CS +
Sbjct  304   LPTWPERFFFVFTSFSVTALQHIQFTLNHFAADVYMGPPTGGDWFEKQAAGTLDISCSSY  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LRKV+P V++LC+KH + Y   S+W AN    ++++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRCHLRKVAPVVQELCKKHNLPYRSLSWWEANVWTIRTLK  423

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD +     KNLVW+ALN+ G
Sbjct  424   KAAYQARD-AANPVVKNLVWQALNTHG  449



>gb|AAD00895.1| fatty acid desaturase/cytochrome b5 fusion protein [Arabidopsis 
thaliana]
Length=446

 Score =   516 bits (1328),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 249/447 (56%), Positives = 328/447 (73%), Gaps = 7/447 (2%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT E+LKKH+K GDLW++I GKVY+VSDW+  HPGG+  +L+L GQDVTDAF+A+HP
Sbjct  7     KKYITDEDLKKHNKSGDLWIAIQGKVYNVSDWIKTHPGGDTVILNLVGQDVTDAFIAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A HHL   F GY++ D QVSEVS+DYR + +EF ++GLFE KGH+  Y  A ++AMFL
Sbjct  67    GTAWHHLDHLFTGYHIRDFQVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTLAFVAAMFL  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               LYGV+   SV+AH  +A L+G LWIQ+ ++GHDSGHY +M  K  +R AQLL+GNCLT
Sbjct  127   GVLYGVLACTSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +DYDPD+Q +P+FA S K F SSL S FY++ ++F+ +AR
Sbjct  187   GISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFF-SSLTSRFYDRKLTFDPVAR  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVSYQH+T+YPVM    RIN+FIQ++  +LF K+   +RA    G+++FW   P L+S 
Sbjct  246   FLVSYQHFTYYPVMCF-GRINLFIQTF-LLLFSKREVPDRALNFAGILVFWT--PLLVSC  301

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER  FV  S  +T +Q IQF+LNH A+  + GP TG DW EKQ  GT+DI C  +
Sbjct  302   LPNWPERFFFVFTSFTVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSY  361

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MD+F GGLQFQ+EHHLFPR+PRC  RKV P V++LC+KH + Y   S++ AN L   +++
Sbjct  362   MDFF-GGLQFQLEHHLFPRLPRCHFRKVFPVVQELCKKHXLPYRSMSWFEANVLTINTLK  420

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA  ARD++     KNLVWEALN+ G
Sbjct  421   TAAYQARDVA-NPVVKNLVWEALNTHG  446



>gb|AAD10250.1| S276 [Triticum aestivum]
Length=469

 Score =   516 bits (1329),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 237/446 (53%), Positives = 325/446 (73%), Gaps = 4/446 (1%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             + I+T+EL+ H    DLW+SI G VYDV+ W+  HPGGE PL++LAGQD TDAF+AYHP 
Sbjct  28    RMISTKELQAHAAADDLWISISGDVYDVTPWLRHHPGGEVPLITLAGQDATDAFMAYHPP  87

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
                  L+RFF G  ++D+ V   S D+R L+++ S  GLFE+ GH   +   A+S +F +
Sbjct  88    SVRPLLRRFFVGR-LTDYTVPPASADFRRLLAQLSSAGLFERVGHTPKFLLVAMSVLFCI  146

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             +LY V+   S  AHM +  L+GF+WIQ+GW+GHDSGH+ + +   L+R  Q+++GNCLTG
Sbjct  147   ALYCVLACSSTGAHMFAGGLIGFIWIQSGWIGHDSGHHQITRHPALNRLLQVVSGNCLTG  206

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             + I WW++NHN HHI+CN +D+DPD+Q LP+FA S KLF ++L S  YE+ ++F+++++F
Sbjct  207   LGIAWWKFNHNTHHISCNSLDHDPDLQHLPLFAVSTKLF-NNLWSVCYERTLAFDAISKF  265

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
              VSYQHWTFYPVM   ARIN+ +QS   ++ +KK+   R  EI G+  FWVWYP L+S L
Sbjct  266   FVSYQHWTFYPVMGF-ARINLLVQSIVFLITQKKV-RQRWLEIAGVAAFWVWYPLLVSCL  323

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ER+ FV+ S ++TG+Q +QF LNH +S+ + GP  G DW E+Q  GTLDI CSPWM
Sbjct  324   PNWWERVAFVLASFVITGIQHVQFCLNHFSSAVYVGPPKGNDWFERQTAGTLDIKCSPWM  383

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQ+EHHLFPR+PRC  R V+P V+ LC+KHG++Y  A+FW AN + +K++R 
Sbjct  384   DWFHGGLQFQVEHHLFPRLPRCHYRMVAPIVRDLCKKHGLSYGAATFWEANVMTWKTLRA  443

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AAL AR+ +   APKNLVWEALN+ G
Sbjct  444   AALQAREATTGAAPKNLVWEALNTHG  469



>ref|XP_003578001.2| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Brachypodium 
distachyon]
Length=470

 Score =   516 bits (1329),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 243/449 (54%), Positives = 324/449 (72%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G  + I+T+EL+ H    DLW+SI G VYDV+ W+  HPGG+ PLL+LAGQD TDAF+AY
Sbjct  26    GDVRMISTKELRAHTAADDLWISISGDVYDVTPWLRHHPGGDVPLLTLAGQDATDAFVAY  85

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A   L+RFF G  +SD+ VS  S DYR L+++ S  GLFE+ G         +S +
Sbjct  86    HPPSARPLLRRFFVGR-LSDYTVSPASADYRRLLAQLSSAGLFERVGPTPKLLLVVMSVL  144

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F ++LY V+   S +AH+ S  L+GF+WIQ+GW+GHDSGH+ +     L+R  Q+++GNC
Sbjct  145   FCIALYCVLACSSTFAHLFSGGLIGFIWIQSGWIGHDSGHHQLTTHPALNRLLQIISGNC  204

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+ I WW++NHN HHI+CN +D+DPD+Q LP+FA S KLF ++L S  YE+ ++F+++
Sbjct  205   LTGLGIAWWKFNHNTHHISCNSLDHDPDLQHLPLFAVSTKLF-NNLWSVCYERTLAFDAI  263

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ++F VSYQHWTFYPVM   ARIN+ +QS   ++ +KK+   R  EI G+  FWVWYP L+
Sbjct  264   SKFFVSYQHWTFYPVMGF-ARINLLVQSAVFLVSQKKV-RQRWLEIAGVAAFWVWYPLLV  321

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+ FVV S ++TG+Q +QF LNH +S+ + GP  G DW E+Q  GTLDI CS
Sbjct  322   SCLPNWWERVAFVVASFVITGIQHVQFCLNHFSSAVYVGPPKGNDWFERQTAGTLDIKCS  381

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQ+EHHLFPR+PRC  R V+PFV+ LC+KHG+ Y  A+FW AN L +K+
Sbjct  382   PWMDWFHGGLQFQVEHHLFPRLPRCHYRMVAPFVRDLCKKHGLPYAAATFWEANVLTWKT  441

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL AR  +   APKNLVWEALN+ G
Sbjct  442   LRAAALQARVATTGAAPKNLVWEALNTHG  470



>gb|AFK42352.1| unknown [Medicago truncatula]
Length=445

 Score =   514 bits (1323),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 239/427 (56%), Positives = 322/427 (75%), Gaps = 2/427 (0%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT+EELKKHDK GDLW+SI GKVY+VSDW  +HPGGE  LL+LAGQDVTDAF+AYHP
Sbjct  6     KKYITSEELKKHDKEGDLWISIQGKVYNVSDWAKKHPGGEVVLLNLAGQDVTDAFIAYHP  65

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL +FF GYY+ D +VSE SKDYR LVSEF +MGLFEKK H+  +   +++ M  
Sbjct  66    GSAWKHLDQFFTGYYLEDFKVSEASKDYRRLVSEFVKMGLFEKKEHVALFTLTSVAIMLA  125

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGVV   SVWAH+GS +L+G LW+Q+ ++GHDSGHY+VM ++  ++ AQ+L GNC+T
Sbjct  126   IVVYGVVGCTSVWAHLGSGMLLGLLWMQSTYIGHDSGHYEVMSSRSYNKLAQILCGNCMT  185

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S++ F  S+ S+FY++ + F++L+R
Sbjct  186   GISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSSRFF-GSIKSYFYDRQLKFDTLSR  244

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FL+SYQH TFYPV L  AR+N+++Q++  +    +   +R   I+G+ +FW W+P LLS+
Sbjct  245   FLISYQHITFYPV-LCFARLNLYLQTFLLLFSPSRNVPDRLYNIMGIGVFWTWFPLLLSA  303

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP+  ER+MFV+   ++  +Q +QF LNH A++ + GP +G DW +KQ  GTLDI CS W
Sbjct  304   LPSWPERLMFVLACFVVCSIQHLQFCLNHFAANVYLGPPSGNDWFQKQTAGTLDITCSTW  363

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PR QLRKVSP V  LC+KH + Y   SF  AN    K+++
Sbjct  364   MDWFFGGLQFQLEHHLFPRLPRAQLRKVSPLVIDLCKKHNLPYRSLSFVEANLWTLKTLK  423

Query  284   DAALMAR  264
              AAL A+
Sbjct  424   TAALQAK  430



>ref|NP_001130866.1| uncharacterized protein LOC100191970 [Zea mays]
 gb|ACF79235.1| unknown [Zea mays]
 gb|ACG36537.1| desaturase/cytochrome b5 protein [Zea mays]
 gb|ACN35893.1| unknown [Zea mays]
 tpg|DAA61085.1| TPA: desaturase/cytochrome b5 protein [Zea mays]
Length=462

 Score =   514 bits (1324),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 320/449 (71%), Gaps = 4/449 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G  + I+++EL+ H    DLW+SI G VYDV+ W+  HPGG+ PLL+LAGQD TDAF AY
Sbjct  18    GDVRMISSKELRAHASADDLWISISGDVYDVTPWLPHHPGGDLPLLTLAGQDATDAFAAY  77

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A   L+RFF G  +SD+ VS  S DYR L+++ S  GLFE+ G         ++ +
Sbjct  78    HPPSARPLLRRFFVGR-LSDYAVSPASADYRRLLAQLSSAGLFERVGPTPKVQLVLMAVL  136

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F  +LY V+   S WAH+ +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNC
Sbjct  137   FYAALYLVLACASAWAHLLAGGLIGFVWIQSGWMGHDSGHHRITGHPVLDRVVQVLSGNC  196

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+ NHN HHIACN +D+DPD+Q +P+FA S KLF  ++ S+FY++ ++F++ 
Sbjct  197   LTGLSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSPKLF-GNIWSYFYQRTLAFDAA  255

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ++F +SYQHWTFYPVM  IARIN+  QS   VL +K++   R  EI G+  FW WYP L+
Sbjct  256   SKFFISYQHWTFYPVMC-IARINLLAQSALFVLTEKRV-PQRLLEIAGVATFWAWYPLLV  313

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             +SLPN  ER+ FV+ S  + G+Q +QF LNH +S  + GP  G DW EKQ  GTLDI CS
Sbjct  314   ASLPNWWERVAFVLFSFTICGIQHVQFCLNHFSSDVYVGPPKGNDWFEKQTAGTLDILCS  373

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQIEHHLFPR+PRC LRKV+P V+ LC+KHG+ Y+ A+FW AN L +K+
Sbjct  374   PWMDWFHGGLQFQIEHHLFPRLPRCHLRKVAPAVRDLCKKHGLTYSAATFWGANVLTWKT  433

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R AAL AR  +   APKNLVWEA+N+ G
Sbjct  434   LRAAALQARTATSGGAPKNLVWEAVNTHG  462



>ref|XP_004956618.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Setaria italica]
Length=462

 Score =   513 bits (1321),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 319/446 (72%), Gaps = 4/446 (1%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             + I+++EL+ H  P DLW+SI G VYDV+ W+  HPGG+ PL++LAGQD TDAF AYHP 
Sbjct  21    RMISSKELRAHASPDDLWISISGDVYDVTPWLPHHPGGDLPLITLAGQDATDAFAAYHPP  80

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
              A   L+RFF G  +SD+ VS  S DYR L+++ S  GLFE+ G         ++ +F  
Sbjct  81    SARPLLRRFFVGR-LSDYTVSPASADYRRLLAQLSSAGLFERVGPTPKVQLLLMATLFCA  139

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             +LY V+   S  AH+ +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNCLTG
Sbjct  140   ALYLVLACASACAHLLAGGLIGFIWIQSGWMGHDSGHHRITGHPLLDRVVQVLSGNCLTG  199

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             +SI WW+ NHN HHIACN +D+DPD+Q +P+FA S KLF  ++ S+FY + ++F++ ++F
Sbjct  200   LSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSPKLF-GNIWSYFYRRTLAFDAASKF  258

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
              +SYQHWTFYPVM  +ARIN+  QS   VL +K++   R  EI G+  FW WYP L+S L
Sbjct  259   FISYQHWTFYPVMC-VARINLLTQSALFVLTEKRV-PQRLLEIAGVAAFWAWYPLLVSCL  316

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ER+ FV+ S  + G+Q +QF LNH +S  + GP  G DW EKQ  GTLDI CSPWM
Sbjct  317   PNWWERVAFVLSSFTICGIQHVQFCLNHFSSEVYVGPPKGNDWFEKQTAGTLDILCSPWM  376

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQIEHHLFPR+PRC LRKV+P+V+ LC+KHG+ Y+ ASFW AN L +K++R 
Sbjct  377   DWFHGGLQFQIEHHLFPRLPRCHLRKVAPYVRDLCKKHGLTYSAASFWDANVLTWKTLRA  436

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AAL AR+ +   APKNLVWEALN+ G
Sbjct  437   AALQARNATSGAAPKNLVWEALNTHG  462



>gb|EPS70430.1| delta-8 sphingolipid desaturase, partial [Genlisea aurea]
Length=435

 Score =   511 bits (1317),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 237/447 (53%), Positives = 323/447 (72%), Gaps = 12/447 (3%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT +ELKKH + GDLWVSIHGKVYDV+DW+  HPGGE PLL+L GQDVTD F+A+HP
Sbjct  1     KKYITCDELKKHSRAGDLWVSIHGKVYDVTDWLQHHPGGEIPLLNLGGQDVTDPFIAFHP  60

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A +HL+ FF GY++ D +VSEVS DYR L SEF++ GLFEKKGH V Y    ++ M  
Sbjct  61    KSAWNHLESFFTGYHLEDFRVSEVSMDYRKLASEFTKSGLFEKKGHGVIYSICFIALMLS  120

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
                YGV+  ES+  H+ SA L+G  W+Q  ++GHDSGHY +M  +  ++  QL  GNCLT
Sbjct  121   ACFYGVLATESLTVHVLSAGLLGLSWMQVAYLGHDSGHYQIMTGRGSNKFIQLFTGNCLT  180

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHH+ACN +D+DPD+Q LP+ A S+KLF+ S+ S+FY + ++F+++AR
Sbjct  181   GISIAWWKWTHNAHHMACNSLDHDPDLQHLPLLAVSSKLFQ-SITSYFYGRKLAFDAIAR  239

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F +SYQH TFYP+   +AR+N+++Q+   +LF  +   +R   ILG+++FW W+P L+S 
Sbjct  240   FFISYQHITFYPIT-CVARVNLYLQT-VLLLFSGRKVPDRGLNILGILVFWTWFPLLVSF  297

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LP  SER++FV++S  +T +Q +QF LNH A++ + G   G DW EKQ +GT+DI CS W
Sbjct  298   LPTWSERVLFVMVSFCVTSIQHVQFCLNHFAANVYVGAPKGDDWFEKQTNGTIDISCSWW  357

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP V++LC+KH + Y   SF+ AN    K++R
Sbjct  358   MDWFFGGLQFQLEHHLFPRLPRCWLRSVSPSVQELCKKHNLQYRSLSFFEANVATLKTLR  417

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ AR         N +WEA+N+ G
Sbjct  418   AAAMEAR---------NFLWEAVNTHG  435



>ref|XP_002460077.1| hypothetical protein SORBIDRAFT_02g022420 [Sorghum bicolor]
 gb|EER96598.1| hypothetical protein SORBIDRAFT_02g022420 [Sorghum bicolor]
Length=464

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 321/446 (72%), Gaps = 4/446 (1%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             + I+++EL+ H    DLW+SI G VYDV+ W+  HPGG+ PL++LAGQD TDAF AYHP 
Sbjct  23    RMISSKELRAHASADDLWISISGDVYDVTPWLPHHPGGDLPLITLAGQDATDAFAAYHPP  82

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
              A   L+RFF G  +SD+ VS  S DYR L+++ S  GLFE+ G       A ++ +F  
Sbjct  83    SARPLLRRFFVGR-LSDYTVSPASADYRRLLAQLSSAGLFERVGPTPKVQLALMAVLFYA  141

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             +LY V+   +  AH+ +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNCLTG
Sbjct  142   ALYLVLACATASAHLLAGGLIGFVWIQSGWMGHDSGHHRITGHPLLDRVVQVLSGNCLTG  201

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             +SI WW+ NHN HHIACN +D+DPD+Q +P+FA S KLF  ++ S+FY++ ++F++ ++F
Sbjct  202   LSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSPKLF-GNIWSYFYQRTLAFDAASKF  260

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
             L+SYQHWTFYPVM  +ARIN+  QS   VL +K++   R+ EI G+  FW WYP L++SL
Sbjct  261   LISYQHWTFYPVMC-VARINLLAQSALFVLTEKRV-PQRSLEIAGVAAFWAWYPLLVASL  318

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ER+ FV+LS  + G+Q +QF LNH +S  + GP  G DW EKQ  GTLDI C PWM
Sbjct  319   PNWWERVAFVLLSFTICGIQHVQFCLNHFSSDVYVGPPKGNDWFEKQTAGTLDILCPPWM  378

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQIEHHLFPR+PRC LRKV+P V+ LC+KHG+ Y+ ASFW AN L +K++R 
Sbjct  379   DWFHGGLQFQIEHHLFPRLPRCHLRKVAPAVRDLCKKHGLTYSAASFWGANVLTWKTLRA  438

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AAL AR  +   APKNLVWEALN+ G
Sbjct  439   AALQARSATSGAAPKNLVWEALNTHG  464



>ref|NP_001062915.1| Os09g0338500 [Oryza sativa Japonica Group]
 dbj|BAD28708.1| putative delta-6-desaturase [Oryza sativa Japonica Group]
 dbj|BAF24829.1| Os09g0338500 [Oryza sativa Japonica Group]
 dbj|BAG86727.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84386.1| hypothetical protein OsI_30947 [Oryza sativa Indica Group]
Length=466

 Score =   512 bits (1318),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 246/446 (55%), Positives = 316/446 (71%), Gaps = 5/446 (1%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             + I++EEL+ H    DLW+SI G VYDV+ WV  HPGG+ PLL+LAGQD TDAF AYHP 
Sbjct  26    RMISSEELRAHASRDDLWISISGDVYDVTAWVPHHPGGDIPLLTLAGQDATDAFAAYHPP  85

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
              A   L RF  G  + D+ VS  S D+R L+++ S  GLFE+ G       A +  +   
Sbjct  86    SARPLLGRFLVGR-LEDYTVSPASADFRRLLAQLSSAGLFERVGPTPKVQVAGMLLLLCA  144

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             +LY V+   S WAH+ +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNCLTG
Sbjct  145   ALYCVLACASAWAHLLAGGLIGFIWIQSGWMGHDSGHHRITGHAALDRLLQVLSGNCLTG  204

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             +SI WW+ NHN HHIACN +D+DPD+Q +P+FA S+KLF   L S+FY++ + F++ ++F
Sbjct  205   LSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSSKLF--GLWSYFYQRTLVFDAASKF  262

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
             L+SYQHWTFYPVM   ARIN+ IQS   +L  +K+   R  EI G+  FWVWYP ++S L
Sbjct  263   LISYQHWTFYPVMCF-ARINLLIQSAVFLLSSRKV-PQRGLEIAGVAAFWVWYPMVVSCL  320

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ER+ FVV S ++TG+Q +QF LNH +S  + GP  G DW EKQ  GTLDI CSPWM
Sbjct  321   PNWWERVAFVVASFVITGIQHVQFCLNHFSSEVYVGPPKGNDWFEKQTAGTLDIQCSPWM  380

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQIEHHLFPR+PRC LRKVSPFV+ LC+KHG+ Y  ASFW AN L +K++R 
Sbjct  381   DWFHGGLQFQIEHHLFPRLPRCHLRKVSPFVRDLCKKHGLPYAAASFWQANVLTWKTLRA  440

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AAL AR  +   APKNLVWEA+N+ G
Sbjct  441   AALQARKATSGAAPKNLVWEAVNTHG  466



>gb|EMS63061.1| Fatty acid desaturase 3 [Triticum urartu]
Length=441

 Score =   509 bits (1311),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 320/442 (72%), Gaps = 4/442 (1%)
 Frame = -1

Query  1529  TEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIAAH  1350
             T+E + H    DLW+SI G VYDV+ W+  HPGGE PL++LAGQD TDAF+AYHP     
Sbjct  4     TKERRAHAAADDLWISISGDVYDVTPWLRHHPGGEVPLITLAGQDATDAFMAYHPPSVRP  63

Query  1349  HLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYG  1170
              L+RFF G  +SD+ V   S D+R L+++ S  GLFE+ GH   +   A+S +F ++LY 
Sbjct  64    LLRRFFVGR-LSDYTVPPPSADFRRLLAQLSSAGLFERVGHTPKFLLVAMSVLFCIALYC  122

Query  1169  VVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIW  990
             V+   S  AHM +  L+GF+WIQ+GW+GHDSGH+ + K   L+R  Q+++GNCLTG+ I 
Sbjct  123   VLACSSTGAHMFAGGLIGFIWIQSGWIGHDSGHHQITKHPALNRLLQVVSGNCLTGLGIA  182

Query  989   WWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSY  810
             WW++NHN HHI+CN +D+DPD+Q LP+FA S KLF ++L S  YE+ ++F+++++F VSY
Sbjct  183   WWKFNHNTHHISCNSLDHDPDLQHLPLFAVSTKLF-NNLWSVCYERTLAFDAISKFFVSY  241

Query  809   QHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHS  630
             QHWTFYPVM   ARIN+ +QS   ++ +KK+   R  EI G+  FWVWYP L+S LPN  
Sbjct  242   QHWTFYPVMGF-ARINLLVQSIVFLITQKKV-RQRWLEIAGVAAFWVWYPLLVSCLPNWW  299

Query  629   ERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFH  450
             ER+ FV+ S ++TG+Q +QF LNH +S+ + GP  G DW E+Q  GTLDI CSPWMDWFH
Sbjct  300   ERVAFVLASFVITGIQHVQFCLNHFSSAVYVGPPKGNDWFERQTAGTLDIKCSPWMDWFH  359

Query  449   GGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALM  270
             GGLQFQ+EHHLFPR+PRC  R V+P V+ LC+KHG++Y  A+FW AN + +K++R AAL 
Sbjct  360   GGLQFQVEHHLFPRLPRCHYRMVAPIVRDLCKKHGLSYGAATFWEANVMTWKTLRAAALQ  419

Query  269   ARDLSPEKAPKNLVWEALNSFG  204
             AR+ +    PKNLVWEALN+ G
Sbjct  420   AREATTGAVPKNLVWEALNTHG  441



>ref|NP_001145881.1| desaturase/cytochrome b5 protein isoform 1 [Zea mays]
 gb|ACF78928.1| unknown [Zea mays]
 gb|ACF85769.1| unknown [Zea mays]
 gb|ACL52782.1| unknown [Zea mays]
 gb|ACN25580.1| unknown [Zea mays]
 tpg|DAA39918.1| TPA: desaturase/cytochrome b5 protein isoform 1 [Zea mays]
 tpg|DAA39919.1| TPA: desaturase/cytochrome b5 protein isoform 2 [Zea mays]
Length=464

 Score =   509 bits (1310),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 321/451 (71%), Gaps = 6/451 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G  + I+++EL++H    DLW+SI G VYDV+ W+  HPGG+ PL++LAGQD TDAF AY
Sbjct  18    GDVRLISSKELREHASAADLWISISGDVYDVTPWLPHHPGGDLPLITLAGQDATDAFAAY  77

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A   L+RFF G  +SD+ VS  S DYR L+++ S  GLFE+ G       A ++ +
Sbjct  78    HPPSARPLLRRFFVGR-LSDYTVSPASADYRRLLAQLSSAGLFERVGPTPRVQLALMAVL  136

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F  +LY V+   S  AHM +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNC
Sbjct  137   FYAALYLVLACASASAHMLAGGLIGFVWIQSGWMGHDSGHHRITGHPLLDRVVQVLSGNC  196

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+ NHN HHIACN +D+DPD+Q +P+FA S KLF  ++ S+FY++ ++F++ 
Sbjct  197   LTGLSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSPKLF-GNIWSYFYQRTLAFDAA  255

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ++FL+SYQHWTFYPVM  IARIN+  QS   VL +K++   R  EI G+  FW WYP L+
Sbjct  256   SKFLISYQHWTFYPVMC-IARINLLAQSAVFVLTEKRV-PQRLLEIAGVAAFWAWYPLLV  313

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             + LPN  ER+ FV+LS  + G+Q +QF LNH +S  + GP  G DW EKQ  GTLDI C 
Sbjct  314   ACLPNWWERVAFVLLSFTICGIQHVQFCLNHFSSDVYVGPPKGNDWFEKQTAGTLDILCP  373

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQIEHHLFPR+PRC LRKV+P V+ LC+KHG+ Y+ ASFW AN L +K+
Sbjct  374   PWMDWFHGGLQFQIEHHLFPRLPRCHLRKVAPAVRDLCKKHGLTYSAASFWDANVLTWKT  433

Query  290   IRDAALMARDLS--PEKAPKNLVWEALNSFG  204
             +R AAL AR  +     APKNLVWEALN+ G
Sbjct  434   LRAAALQARSATGGGGGAPKNLVWEALNTHG  464



>gb|ACF85036.1| unknown [Zea mays]
Length=464

 Score =   507 bits (1305),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 243/451 (54%), Positives = 320/451 (71%), Gaps = 6/451 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G  + I+++EL++H    DLW+SI G VYDV+ W+  HPGG+ PL++LAGQD TDAF AY
Sbjct  18    GDVRLISSKELREHASAADLWISISGDVYDVTPWLPHHPGGDLPLITLAGQDATDAFAAY  77

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A   L+RFF G  +SD+ VS  S DYR L+++ S  GLFE+ G       A ++ +
Sbjct  78    HPPSARPLLRRFFVGR-LSDYTVSPASADYRRLLAQLSSAGLFERVGPTPRVQLALMAVL  136

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F  +LY V+   S  AH  +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNC
Sbjct  137   FYAALYLVLACASASAHTLAGGLIGFVWIQSGWMGHDSGHHRITGHPLLDRVVQVLSGNC  196

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+ NHN HHIACN +D+DPD+Q +P+FA S KLF  ++ S+FY++ ++F++ 
Sbjct  197   LTGLSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSPKLF-GNIWSYFYQRTLAFDAA  255

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ++FL+SYQHWTFYPVM  IARIN+  QS   VL +K++   R  EI G+  FW WYP L+
Sbjct  256   SKFLISYQHWTFYPVMC-IARINLLAQSAVFVLTEKRV-PQRLLEIAGVAAFWAWYPLLV  313

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             + LPN  ER+ FV+LS  + G+Q +QF LNH +S  + GP  G DW EKQ  GTLDI C 
Sbjct  314   ACLPNWWERVAFVLLSFTICGIQHVQFCLNHFSSDVYVGPPKGNDWFEKQTAGTLDILCP  373

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQIEHHLFPR+PRC LRKV+P V+ LC+KHG+ Y+ ASFW AN L +K+
Sbjct  374   PWMDWFHGGLQFQIEHHLFPRLPRCHLRKVAPAVRDLCKKHGLTYSAASFWDANVLTWKT  433

Query  290   IRDAALMARDLS--PEKAPKNLVWEALNSFG  204
             +R AAL AR  +     APKNLVWEALN+ G
Sbjct  434   LRAAALQARSATGGGGGAPKNLVWEALNTHG  464



>gb|ACG40941.1| desaturase/cytochrome b5 protein [Zea mays]
Length=463

 Score =   504 bits (1299),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 319/450 (71%), Gaps = 5/450 (1%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G  + I+++EL++H    DLW+SI G VYDV+ W+  HPGG+ PL++LAGQD TDAF AY
Sbjct  18    GDVRLISSKELREHASAADLWISISGDVYDVTPWLPHHPGGDLPLITLAGQDATDAFAAY  77

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A   L+RFF G  +SD+ VS  S DYR L+++ S  GLFE+ G       A ++ +
Sbjct  78    HPPSARPLLRRFFVGR-LSDYTVSPASADYRRLLAQLSSAGLFERVGPTPRVQLALMAVL  136

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F  +LY V+   S  AHM +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNC
Sbjct  137   FYAALYLVLACASASAHMLAGGLIGFVWIQSGWMGHDSGHHRITGHPLLDRVVQVLSGNC  196

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+ NHN HHIACN +D+DPD+Q +P+FA S KLF  ++ S+FY++ ++F++ 
Sbjct  197   LTGLSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSPKLF-GNIWSYFYQRTLAFDAA  255

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ++FL+SYQHWTFYPVM  IARIN+  QS   VL +K++   R  EI G+  FW WYP L+
Sbjct  256   SKFLISYQHWTFYPVMC-IARINLLAQSAVFVLTEKRV-PQRLLEIAGVAAFWAWYPLLV  313

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             + LPN  ER+ FV+LS    G+Q +QF LNH +S  + GP  G DW EKQ  GTLDI C 
Sbjct  314   ACLPNWWERVAFVLLSFTFCGIQHVQFCLNHFSSDVYVGPPKGNDWFEKQTAGTLDILCP  373

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
             PWMDWFHGGLQFQIEHHLFPR+PRC LRKV+P V+ LC+KHG+ Y+ ASF  AN L +K+
Sbjct  374   PWMDWFHGGLQFQIEHHLFPRLPRCHLRKVAPAVRDLCKKHGLTYSAASFLDANVLTWKT  433

Query  290   IRDAALMARDLS-PEKAPKNLVWEALNSFG  204
             +R AAL AR  +    APKNLVWEALN+ G
Sbjct  434   LRAAALQARSATGGGGAPKNLVWEALNTHG  463



>ref|XP_002455788.1| hypothetical protein SORBIDRAFT_03g025270 [Sorghum bicolor]
 gb|EES00908.1| hypothetical protein SORBIDRAFT_03g025270 [Sorghum bicolor]
Length=480

 Score =   494 bits (1273),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 244/457 (53%), Positives = 329/457 (72%), Gaps = 17/457 (4%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             + +T+ E+ +H   GD+WV++ GKVYDV+ W+  HPGG+ PLLSLAGQDVTDAF+AYHPA
Sbjct  30    RRVTSAEMARHCVEGDVWVAVQGKVYDVTPWLPHHPGGDLPLLSLAGQDVTDAFVAYHPA  89

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
              A   L R+     +SD+ VS+VS DYR LV+EF++ GLF++KGH  +    A++A+   
Sbjct  90    SAWRVLDRY-RVATLSDYAVSDVSSDYRRLVAEFAKAGLFDRKGHGCAASLCAMAALLAG  148

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             +++ V+   SV AHM +AV++GFLW+Q+G++GHDSGHY VM+T  L+RA QL+AGNC+ G
Sbjct  149   AVWLVLATTSVAAHMAAAVMLGFLWMQSGFLGHDSGHYVVMRTGPLNRAVQLVAGNCVAG  208

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             +SI WW+ NHNAHHIACN +D+DPDVQ +P+FA S +LF +SL S FY + M F++ AR 
Sbjct  209   ISIGWWKRNHNAHHIACNSLDHDPDVQHMPLFAVSPRLF-ASLTSAFYRRAMRFDAAARL  267

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFA---NRAQEILGLIIFWVWYPFLL  651
             LVSYQHWTFYPVM  +AR+N+F QS   +L      A    R  E+ G+ +FWVWYP+L+
Sbjct  268   LVSYQHWTFYPVM-CVARVNLFAQSLLLLLVVSDADARVPGRLMELAGVAVFWVWYPWLV  326

Query  650   SSLP-NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDC  474
             S LP   +ER  FV+LS  +TG+Q +QF LNH ++  + G   G DW +KQ  GTLD+ C
Sbjct  327   SRLPGGATERAAFVLLSFAVTGIQHVQFCLNHFSAGTYVGRPRGDDWFQKQTRGTLDVAC  386

Query  473   SPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFK  294
              PWMDWFHGGLQFQ+EHHLFPR+PRC LR+V+P V+ LC KHG+ Y    FW ANA   +
Sbjct  387   PPWMDWFHGGLQFQVEHHLFPRLPRCHLRRVAPMVRDLCRKHGLPYQRCGFWEANA---R  443

Query  293   SIRDAALMARDLSPEKA-------PKNLVWEALNSFG  204
             ++RDAA+ AR+++           PKNLVWEA+N+ G
Sbjct  444   TLRDAAMQAREVTAAGGGGGSGPKPKNLVWEAVNTHG  480



>gb|AAQ10731.1| delta-6-fatty acid desaturase [Anemone leveillei]
Length=446

 Score =   486 bits (1251),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 234/447 (52%), Positives = 321/447 (72%), Gaps = 5/447 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             ++ I++++L+ H+KPGD+W+SI GK+YDV++W   HPGGE PLL+LAGQDVTDAF+A+HP
Sbjct  5     RRSISSDDLRSHNKPGDVWISIQGKIYDVTEWGKDHPGGEGPLLNLAGQDVTDAFVAFHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L +F  GY + D+ VS+VSKDYR LVSEFS+ GL+EKKGH        +S +F+
Sbjct  65    GSAWKNLDKFHIGY-LQDYVVSDVSKDYRKLVSEFSKAGLYEKKGHGHLIRLLVMSLVFI  123

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
              S+ GVV  +    H+GSAVL+  +W+Q G++GHDSGHY++M + +L+R  Q+ + N ++
Sbjct  124   ASVSGVVLSDKTSVHVGSAVLLAVIWMQFGFIGHDSGHYNIMTSPELNRYMQIFSVNVVS  183

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             GVS+ WW+  HNAHHIA N ++YDPD+Q +P    S  +F  SL SHFY K M+F+++AR
Sbjct  184   GVSVGWWKRYHNAHHIAVNSLEYDPDLQYVPFLVVSTAIF-DSLTSHFYRKKMTFDAVAR  242

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             FLVS+QHWTFYP+M  I R++   QS   VL  KK   +R  E  GL++FW WY  L+S 
Sbjct  243   FLVSFQHWTFYPLMA-IGRVSFLAQS-IGVLLSKKPLPDRHLEWFGLVVFWAWYSLLISC  300

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ER++F+ ++  +TG+Q +QF LNH ++  + G     DW EKQ  G++DI CSPW
Sbjct  301   LPNWWERVIFIAVNFAVTGIQHVQFCLNHYSAQTYIGAPCANDWFEKQTKGSIDISCSPW  360

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
              DWFHGGLQFQIEHHLFPRMPRC LRK+SPFVK+LC KH + Y   SF+  N     +++
Sbjct  361   TDWFHGGLQFQIEHHLFPRMPRCNLRKISPFVKELCRKHNLVYTSVSFFEGNRRTLATLK  420

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
             +AAL ARDL+    PKNLVWEA+++ G
Sbjct  421   NAALKARDLT-SPIPKNLVWEAVHTHG  446



>ref|XP_004971923.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Setaria italica]
Length=470

 Score =   484 bits (1247),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 242/450 (54%), Positives = 328/450 (73%), Gaps = 6/450 (1%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+++T+ E+ KH   GD+WV++ GKVYDV+ W+  HPGG+ PLLSLAGQDVTDAF+AYHP
Sbjct  24    KRYVTSAEIAKHSAEGDVWVAVQGKVYDVTSWLPLHPGGDLPLLSLAGQDVTDAFVAYHP  83

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
             A A   L R+     +SD+ VSEVS+DYR LV+EF+R GLF++KGH  +    A++A+  
Sbjct  84    ASAWRVLDRY-RVATLSDYTVSEVSRDYRRLVAEFARAGLFDRKGHGCAASLCAMAALLA  142

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
              +L+ V+   SV AHM +AV++GFLW+Q+G++GHDSGHY VM++K L+RA Q++AGNC+ 
Sbjct  143   GALWLVLATASVAAHMAAAVMLGFLWMQSGFLGHDSGHYVVMRSKLLNRAVQVVAGNCVA  202

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+ NHNAHHIACN +D+DPDVQ +P+FA S +LF +SL S FY + M F++ AR
Sbjct  203   GISIGWWKRNHNAHHIACNSLDHDPDVQHMPLFAVSPRLF-ASLTSAFYRRVMRFDAAAR  261

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
              LVSYQHWTFYPVM  +AR N+F QS   +   +     R  E+ G+ +FW+WYP+L+S 
Sbjct  262   LLVSYQHWTFYPVM-CVARANLFAQSLLLLTDTRTRVPGRLAEVAGVAVFWLWYPWLVSR  320

Query  644   LPNHS-ERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSP  468
             LP  + ER  FV++S  +TG+Q +QF LNH ++  + G   G DW +KQ  GTLD+ C P
Sbjct  321   LPGGAGERAAFVLVSFAVTGIQHVQFCLNHFSAGTYVGRPRGDDWFQKQTRGTLDVACPP  380

Query  467   WMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WMDWFHGGLQFQ+EHHLFPR+PRC LR+V+P V++LC KHG+ Y    FW ANAL  +++
Sbjct  381   WMDWFHGGLQFQVEHHLFPRLPRCHLRRVAPLVRELCRKHGLPYERCGFWEANALTLRTL  440

Query  287   RD--AALMARDLSPEKAPKNLVWEALNSFG  204
             RD      A   +   APKNL+WEA+N+ G
Sbjct  441   RDAAMQARAVAAAGGPAPKNLLWEAVNTHG  470



>gb|EEE69508.1| hypothetical protein OsJ_28957 [Oryza sativa Japonica Group]
Length=435

 Score =   477 bits (1227),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 235/446 (53%), Positives = 298/446 (67%), Gaps = 36/446 (8%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             + I++EEL+ H    DLW+SI G VYDV+ WV  HPGG+ PLL+LAGQD TDAF AYHP 
Sbjct  26    RMISSEELRAHASRDDLWISISGDVYDVTAWVPHHPGGDIPLLTLAGQDATDAFAAYHPP  85

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLV  1182
              A   L RF                                  G L  Y  A +  +   
Sbjct  86    SARPLLGRFL--------------------------------VGRLEDYTVAGMLLLLCA  113

Query  1181  SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTG  1002
             +LY V+   S WAH+ +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L+GNCLTG
Sbjct  114   ALYCVLACASAWAHLLAGGLIGFIWIQSGWMGHDSGHHRITGHAALDRLLQVLSGNCLTG  173

Query  1001  VSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARF  822
             +SI WW+ NHN HHIACN +D+DPD+Q +P+FA S+KLF   L S+FY++ + F++ ++F
Sbjct  174   LSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSSKLF--GLWSYFYQRTLVFDAASKF  231

Query  821   LVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSL  642
             L+SYQHWTFYPVM   ARIN+ IQS   +L  +K+   R  EI G+  FWVWYP ++S L
Sbjct  232   LISYQHWTFYPVMCF-ARINLLIQSAVFLLSSRKV-PQRGLEIAGVAAFWVWYPMVVSCL  289

Query  641   PNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWM  462
             PN  ER+ FVV S ++TG+Q +QF LNH +S  + GP  G DW EKQ  GTLDI CSPWM
Sbjct  290   PNWWERVAFVVASFVITGIQHVQFCLNHFSSEVYVGPPKGNDWFEKQTAGTLDIQCSPWM  349

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQIEHHLFPR+PRC LRKVSPFV+ LC+KHG+ Y  ASFW AN L +K++R 
Sbjct  350   DWFHGGLQFQIEHHLFPRLPRCHLRKVSPFVRDLCKKHGLPYAAASFWQANVLTWKTLRA  409

Query  281   AALMARDLSPEKAPKNLVWEALNSFG  204
             AAL AR  +   APKNLVWEA+N+ G
Sbjct  410   AALQARKATSGAAPKNLVWEAVNTHG  435



>emb|CDX79995.1| BnaA05g01610D [Brassica napus]
Length=402

 Score =   469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 223/447 (50%), Positives = 297/447 (66%), Gaps = 51/447 (11%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+FIT+++LKKH++PGDLW+SI GKVYDVS WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRFITSDDLKKHNQPGDLWISIQGKVYDVSHWVKSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL+   NGY+V DH VS+VS+DYR L +EFS+ GLF+KKGH+  Y    ++AM  
Sbjct  67    GTAWRHLENLHNGYHVKDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVAAMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGVV   S+WAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNC+T
Sbjct  127   AVVYGVVACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKLVQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHI+CN +D+DPD+Q +P+ A SNK F+ S+  H  ++ ++   +  
Sbjct  187   GISIAWWKWTHNAHHISCNSLDHDPDLQHIPVLAVSNKFFK-SMTRHVPDRALNIAGILV  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F      WT++P+                                           L+S 
Sbjct  246   F------WTWFPL-------------------------------------------LVSF  256

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERI+FV LS+ +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  257   LPNWQERIIFVFLSMAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCKSY  316

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  317   MDWFFGGLQFQLEHHLFPRLPRCHLRGVSPVVQELCKKHNLPYRSLSWWEANVWTLRTLR  376

Query  284   DAALMARDLSPEKAPKNLVWEALNSFG  204
              AA+ ARD++     +NL+WEALN+ G
Sbjct  377   KAAVQARDVT-NPVLENLLWEALNTHG  402



>ref|XP_008675512.1| PREDICTED: delta(8)-fatty-acid desaturase 2-like [Zea mays]
Length=430

 Score =   463 bits (1191),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 220/416 (53%), Positives = 298/416 (72%), Gaps = 9/416 (2%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T K +T+ E+ +H   GD+WV++ GKVYDV+ W+  HPGG+ PLLSLAGQDVTDAF+AYH
Sbjct  19    TTKRVTSAEMARHCGEGDVWVAVQGKVYDVTAWLPHHPGGDLPLLSLAGQDVTDAFVAYH  78

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
             PA A   L R+     +SD+ VSEVS+DYR LV+EF++ GLF++KGH  +    A++A+ 
Sbjct  79    PASAWRVLDRY-RVATLSDYAVSEVSRDYRRLVAEFAKAGLFDRKGHGCAASLCAMAALL  137

Query  1187  LVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
               +++ V+   +V AHM +A+++GFLW+Q+G++GHDSGHY  +    L+R  QL+AGNC+
Sbjct  138   AGAIWLVLATTNVAAHMAAAIMLGFLWMQSGFLGHDSGHYGSV-CGLLNRVVQLVAGNCV  196

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLA  828
              G+SI WW+ NHNAHHIACN +D+DPDVQ +P+FA S +LF +S+ S FY + M F++ A
Sbjct  197   AGISIGWWKRNHNAHHIACNSLDHDPDVQHMPLFAVSPRLF-ASITSAFYRRAMRFDAAA  255

Query  827   RFLVSYQHWTFYPVMLLIARINMFIQSWKTVLF--KKKIFANRAQEILGLIIFWVWYPFL  654
             RFLVSYQHWTFYPVM  +AR+N+F QS   +L    +     R  E+ G+ +FWVWYP+L
Sbjct  256   RFLVSYQHWTFYPVMC-VARVNLFAQSLLLLLAADTRTRVPGRLAELAGVAVFWVWYPWL  314

Query  653   LSSLPNH-SERIMFVVLSLMMTGVQQIQFSLNHLASSFFA--GPLTGKDWVEKQIDGTLD  483
             +S LP    E   FV+LS  +TG+Q +QF LNH ++  +   G   G DW +KQ  GTLD
Sbjct  315   VSRLPGGVHEHAAFVLLSFAVTGIQHVQFCLNHFSAGTYTYVGRPRGDDWFQKQTRGTLD  374

Query  482   IDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWA  315
             + C PWMDWFHGGLQFQ+EHHLFPR+PRC LR+V+P V+ LC KHG+ Y    FW 
Sbjct  375   VACPPWMDWFHGGLQFQVEHHLFPRLPRCHLRRVAPLVRDLCRKHGLPYERCGFWC  430



>emb|CDY42017.1| BnaC04g00950D [Brassica napus]
Length=406

 Score =   459 bits (1182),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 219/443 (49%), Positives = 293/443 (66%), Gaps = 51/443 (12%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             K+FIT+++LKKH++PGDLW+SI GKVYDVS WV  HPGGE  +L+LAGQDVTDAF+AYHP
Sbjct  7     KRFITSDDLKKHNQPGDLWISIQGKVYDVSHWVKSHPGGEAAILNLAGQDVTDAFIAYHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL+   NGY+V DH VS+VS+DYR L +EFS+ GLF+KKGH+  Y    ++ M  
Sbjct  67    GTAWRHLENLHNGYHVKDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVAVMLA  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               +YGVV   S+WAH+ SAVL+G LWIQ+ +VGHDSGHY+V  TK  ++  QLL+GNC+T
Sbjct  127   AVVYGVVACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYNVTSTKPCNKLVQLLSGNCIT  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLAR  825
             G+SI WW+W HNAHHI+CN +D+DPD+Q +P+ A SNK F+ S+  H  ++ ++   +  
Sbjct  187   GISIAWWKWTHNAHHISCNSLDHDPDLQHIPVLAVSNKFFK-SMTRHVPDRALNIAGILV  245

Query  824   FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSS  645
             F      WT++P+                                           L+S 
Sbjct  246   F------WTWFPL-------------------------------------------LVSF  256

Query  644   LPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             LPN  ERI+FV LS+ +T +Q +QF LNH A+  + GP  G DW EKQ  GTLDI C  +
Sbjct  257   LPNWQERIIFVFLSMAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSY  316

Query  464   MDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIR  285
             MDWF GGLQFQ+EHHLFPR+PRC LR VSP V++LC+KH + Y   S+W AN    +++R
Sbjct  317   MDWFFGGLQFQLEHHLFPRLPRCHLRGVSPVVQELCKKHNLPYRSLSWWEANVWTIRTLR  376

Query  284   DAALMARDLSPEKAPKNLVWEAL  216
              AA+ ARD++     ++L+WEAL
Sbjct  377   KAAVQARDVT-NPVLESLLWEAL  398



>ref|XP_008356929.1| PREDICTED: LOW QUALITY PROTEIN: delta(8)-fatty-acid desaturase-like 
[Malus domestica]
Length=411

 Score =   458 bits (1178),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 300/449 (67%), Gaps = 40/449 (9%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G KK+IT E+LK H+KP DLW+SI GKVY+++DW   HPGG+  L +++GQDVTD F+AY
Sbjct  3     GEKKYITVEQLKLHNKPSDLWISIQGKVYNITDWAKDHPGGDAILFNMSGQDVTDGFIAY  62

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A  +L +FF GYY+ D ++SEVSKDYR L SEF+++GLFE KGH   Y   ++ AM
Sbjct  63    HPPSAWKYLGKFFTGYYLKDFEISEVSKDYRKLASEFNQLGLFENKGHGALYSVISILAM  122

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               + +YGV+  ESV  H G   L+G LW+Q  ++GHDSGHY VM +++ ++ AQ LAGNC
Sbjct  123   LYLVVYGVLKSESVLVHFGCGCLLGVLWVQGAYMGHDSGHYQVMSSRRYNKLAQFLAGNC  182

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             LTG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S K F+ S+ S FY + ++F+++
Sbjct  183   LTGISIAWWKWTHNAHHIACNSLDYDPDLQHMPVFAVSTKFFQ-SITSTFYGRELTFDAV  241

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVS+QH+T+YP+M ++ R N+FIQ++  +LF K+   +RA  I+G+++FW W+P L+
Sbjct  242   ARFLVSHQHFTYYPIM-IVGRXNLFIQTF-LLLFSKRSIPDRALNIMGILVFWTWFPLLV  299

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN SER MFV+ S  +T +Q IQF+LNH     + GP TG DW EKQ  GT+DI CS
Sbjct  300   SCLPNWSERFMFVLASFTVTALQHIQFTLNHFTGDTYLGPPTGNDWFEKQTAGTVDILCS  359

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMD F+GGL                                    H SF  AN    + 
Sbjct  360   SWMDGFYGGL------------------------------------HLSFLDANVTTIRM  383

Query  290   IRDAALMARDLSPEKAPKNLVWEALNSFG  204
             +R+AA  A D++    PKNL WEA+N+ G
Sbjct  384   LRNAAQQAWDMT-XPVPKNLAWEAVNTHG  411



>gb|AAT85664.1| putative desaturase [Marchantia polymorpha]
Length=464

 Score =   456 bits (1172),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 223/447 (50%), Positives = 306/447 (68%), Gaps = 9/447 (2%)
 Frame = -1

Query  1535  ITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIA  1356
             I +EEL+KHDK GDLW+SI GKVYDV+DW+ +HPGGE  L SLAGQDVTDAFLA+HP  A
Sbjct  24    INSEELRKHDKVGDLWISIEGKVYDVTDWLTKHPGGENALKSLAGQDVTDAFLAFHPGTA  83

Query  1355  AHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSL  1176
                L +F  G  ++D++VS +  DYR L+++  R GL++   H+   Y A +  MF++ +
Sbjct  84    WSLLPQFQIGV-LTDYEVSPIQADYRKLLTDLKRAGLYKNPLHVYGQYLAVMIPMFVLCV  142

Query  1175  YGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVS  996
              GVV+    W H+G  VL+GF WIQAG++GHD  H  + KT  + +  +L  G C TG+ 
Sbjct  143   LGVVYSPGFWIHIGCGVLMGFFWIQAGFMGHDIAHSGMFKTG-IDKYLKLSIG-CFTGIG  200

Query  995   IWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLV  816
             + WWR NHNAHH +CN VDYDPD+Q +P+FA + K F +SL S+FYE+ M F++ ARFLV
Sbjct  201   MQWWRNNHNAHHYSCNCVDYDPDIQYMPLFAITPKFF-ASLYSNFYERKMDFDAAARFLV  259

Query  815   SYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPN  636
             SYQH+TFY VM L ARIN++ Q+      +K  F+ RA E+  L  +W W+  LLS LPN
Sbjct  260   SYQHYTFYIVMAL-ARINLYAQTLIVAFTRKMPFSTRAWELGALAFYWSWFSLLLSCLPN  318

Query  635   HSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDW  456
             +  R+ FV+ +   TG+Q +QF LNH +S  + G    K W E Q+ G+L+I  SPW DW
Sbjct  319   NYHRLAFVLSAFATTGIQHVQFVLNHFSSPVYEGRPESKTWFESQVRGSLNISSSPWTDW  378

Query  455   FHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAA  276
             FHGGL FQI+HH+FP +PR  LRKV+PFVK LC+K+ + Y   S+W AN  + ++++ AA
Sbjct  379   FHGGLNFQIDHHVFPTLPRHNLRKVAPFVKPLCDKYDLPYESVSWWEANLRVLRTLKAAA  438

Query  275   LMARDLSPEKAP---KNLVWEALNSFG  204
             + ARD+S + AP   K+L+WEA N+ G
Sbjct  439   MEARDIS-KPAPSLSKSLIWEAANARG  464



>emb|CBI40451.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   455 bits (1171),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 218/428 (51%), Positives = 289/428 (68%), Gaps = 57/428 (13%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G +K+I+ EELK+HDKPGDLW+SI GKVY+V+DW   HPGG+ PLL+LAGQDVTDAF+AY
Sbjct  14    GERKYISAEELKQHDKPGDLWISIQGKVYNVTDWAKVHPGGDIPLLNLAGQDVTDAFIAY  73

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP                          D+R L +EFS++GLFEKKGH +         +
Sbjct  74    HP--------------------------DFRKLANEFSKLGLFEKKGHGI---------L  98

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             +  S+ G +FM S                   ++GHDSGHY +M +   ++ AQ+L GNC
Sbjct  99    YTCSIIGFLFMSS-------------------YLGHDSGHYQIMSSPGFNKLAQMLIGNC  139

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             +TG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S+ LF  S+ S FY + + F+S+
Sbjct  140   ITGISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSSSLF-DSINSVFYGRILKFDSV  198

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARF VSYQHWT+YPVM  +ARIN+F+Q+   +   + I  +RA  I+G+ +FW WYP L+
Sbjct  199   ARFFVSYQHWTYYPVMC-VARINLFLQTLLLLFSGRNI-PDRALNIMGICVFWTWYPLLV  256

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCS  471
             S LPN  ER+MFV++S+ +T +Q IQF+LNH +++ + GP  G DW EKQ  GT+DI CS
Sbjct  257   SCLPNWGERVMFVIVSMAVTSIQHIQFTLNHFSANVYVGPPCGNDWFEKQTSGTIDISCS  316

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWFHGGLQFQ+EHHLFPR+PRC LR +SP VK LC+KH + Y   SFW AN    ++
Sbjct  317   AWMDWFHGGLQFQLEHHLFPRLPRCHLRSISPVVKDLCKKHNLPYRSLSFWEANVSTIRT  376

Query  290   IRDAALMA  267
             +R AAL A
Sbjct  377   LRTAALQA  384



>ref|XP_001778179.1| predicted protein [Physcomitrella patens]
 gb|EDQ57069.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   452 bits (1162),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 220/447 (49%), Positives = 318/447 (71%), Gaps = 9/447 (2%)
 Frame = -1

Query  1535  ITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIA  1356
             IT+ EL +H+K  DLW+SI GKVY+V+ W+ +HPGGE PLL LAGQDVTDAFLA+HP  A
Sbjct  29    ITSGELSRHNKTDDLWISIQGKVYNVTGWLRKHPGGEIPLLHLAGQDVTDAFLAFHPGTA  88

Query  1355  AHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSL  1176
              + L +F  G  +SD+ V  V++++R L+ EF + GL++   ++ + YA  +  +  +S+
Sbjct  89    WNLLPQFLVGT-LSDYDVPLVAEEHRRLLREFKKAGLYKNPLNVYALYACWVVPLLALSV  147

Query  1175  YGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVS  996
              GV++ +S   HM SA ++G +W Q+GWVGHD+GH  + K   + R   ++ G+CL+G+S
Sbjct  148   LGVLYSQSFMVHMLSAAMLGVVWNQSGWVGHDTGHCGMFKNPNIDRWFAIIVGDCLSGIS  207

Query  995   IWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLV  816
             + WW+ NHNAHHIACN ++YDPD+Q +P+FA ++KLF S+L S+FY++ M F+ LAR L+
Sbjct  208   MGWWKRNHNAHHIACNSIEYDPDLQYIPLFAVTSKLF-SNLYSYFYDRVMPFDGLARSLI  266

Query  815   SYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPN  636
             +YQHWTFYP+M  +AR+N+F+QS   VL  KK   +R  E+  +  F++W+  LLS LP+
Sbjct  267   AYQHWTFYPIMA-VARVNLFVQS-LLVLTSKKHVPDRWLELGAIGFFYLWFFTLLSYLPS  324

Query  635   HSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDW  456
              SER++FV++S  +TG+Q +QF LNH +S  + G    K WVE Q  GTL++    +MDW
Sbjct  325   -SERLVFVLVSFAVTGIQHVQFCLNHFSSPVYQGQPKSKAWVESQARGTLNLSTPAYMDW  383

Query  455   FHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAA  276
             FHGGLQFQIEHHLFP +PR  LRKV+ FV+  CEKHG+ Y   SFW AN ++ +++R AA
Sbjct  384   FHGGLQFQIEHHLFPTLPRHNLRKVTKFVRPFCEKHGLPYESVSFWEANRMIIRTLRTAA  443

Query  275   LMARDLSPEKAP---KNLVWEALNSFG  204
             L ARD + + AP   ++L+WEA+NS G
Sbjct  444   LQARDFT-KPAPALSESLLWEAVNSKG  469



>gb|ACF85529.1| unknown [Zea mays]
 tpg|DAA61084.1| TPA: hypothetical protein ZEAMMB73_017902 [Zea mays]
Length=330

 Score =   403 bits (1035),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 246/333 (74%), Gaps = 3/333 (1%)
 Frame = -1

Query  1202  LSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLL  1023
             ++ +F  +LY V+   S WAH+ +  L+GF+WIQ+GW+GHDSGH+ +     L R  Q+L
Sbjct  1     MAVLFYAALYLVLACASAWAHLLAGGLIGFVWIQSGWMGHDSGHHRITGHPVLDRVVQVL  60

Query  1022  AGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMS  843
             +GNCLTG+SI WW+ NHN HHIACN +D+DPD+Q +P+FA S KLF  ++ S+FY++ ++
Sbjct  61    SGNCLTGLSIAWWKCNHNTHHIACNSLDHDPDLQHMPLFAVSPKLF-GNIWSYFYQRTLA  119

Query  842   FNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWY  663
             F++ ++F +SYQHWTFYPVM  IARIN+  QS   VL +K++   R  EI G+  FW WY
Sbjct  120   FDAASKFFISYQHWTFYPVMC-IARINLLAQSALFVLTEKRV-PQRLLEIAGVATFWAWY  177

Query  662   PFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLD  483
             P L++SLPN  ER+ FV+ S  + G+Q +QF LNH +S  + GP  G DW EKQ  GTLD
Sbjct  178   PLLVASLPNWWERVAFVLFSFTICGIQHVQFCLNHFSSDVYVGPPKGNDWFEKQTAGTLD  237

Query  482   IDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANAL  303
             I CSPWMDWFHGGLQFQIEHHLFPR+PRC LRKV+P V+ LC+KHG+ Y+ A+FW AN L
Sbjct  238   ILCSPWMDWFHGGLQFQIEHHLFPRLPRCHLRKVAPAVRDLCKKHGLTYSAATFWGANVL  297

Query  302   MFKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
              +K++R AAL AR  +   APKNLVWEA+N+ G
Sbjct  298   TWKTLRAAALQARTATSGGAPKNLVWEAVNTHG  330



>ref|XP_002968817.1| hypothetical protein SELMODRAFT_231254 [Selaginella moellendorffii]
 ref|XP_002974155.1| hypothetical protein SELMODRAFT_100447 [Selaginella moellendorffii]
 gb|EFJ25110.1| hypothetical protein SELMODRAFT_100447 [Selaginella moellendorffii]
 gb|EFJ29933.1| hypothetical protein SELMODRAFT_231254 [Selaginella moellendorffii]
Length=457

 Score =   405 bits (1042),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 205/453 (45%), Positives = 290/453 (64%), Gaps = 9/453 (2%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQ-DVTDAFLAYHP  1365
             + IT +EL +H   GDLW+SI GKVYDVS W   HPGG+  L S AGQ D TDAFLA+HP
Sbjct  7     RVITRDELAEHRNDGDLWISIQGKVYDVSKWAAIHPGGDLALKSFAGQPDATDAFLAFHP  66

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
                A  +   F    ++D  +S ++ D+ +++    + G             AA+ A+  
Sbjct  67    RQRAFQILPKFLIGTLADPVLSPLTADHALVLERLGKAGFLTVDLFFYCKILAAIVALVT  126

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
               + GV+F  S   H  SAVL+GF WIQAGW+GHD+GH  +  + +      LL GN L+
Sbjct  127   ACVAGVIFSSSAIVHCASAVLLGFAWIQAGWIGHDTGHTGMTGSPRADSWIGLLIGNALS  186

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSS--LISHFYEKPMSFNSL  831
             G+   WW  NHNAHH +CN ++YDPD+Q +PIFA S++ FRSS  L S+FY++ M+F+++
Sbjct  187   GIGFQWWLRNHNAHHFSCNNLEYDPDLQYMPIFAISSRFFRSSRALHSYFYDREMAFDAI  246

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             AR LVSYQHWTFY VM  +AR+N++ QS+   +++K++  +R  EI  L+ FW W   LL
Sbjct  247   ARLLVSYQHWTFYLVM-AVARVNLYAQSFIVAIWRKRV-PHRGWEIGSLLFFWAWLFSLL  304

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAG--PLTGKDWVEKQIDGTLDID  477
             S LP++SERI F+++++  TGVQ +QF LNH +S  + G  P     W+  Q  GTL++ 
Sbjct  305   SYLPSYSERIAFLLIAMATTGVQHVQFCLNHFSSPVYQGRRPRGDGQWLADQATGTLNLS  364

Query  476   CSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQ--LCEKHGIAYNHASFWAANAL  303
             CS   DWFHGGLQFQIEHHLFP++PR  LR  S  V +  L +KHG+ Y   +FW AN +
Sbjct  365   CSKKWDWFHGGLQFQIEHHLFPQVPRHHLRAASEMVIKPLLVDKHGLDYKMVTFWEANVM  424

Query  302   MFKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
             + +++R AA+ ARD+S      N++WEA+N+ G
Sbjct  425   IIRTLRAAAMEARDVSKPLRKGNMLWEAVNAHG  457



>gb|KHN12218.1| Fatty acid desaturase 3 [Glycine soja]
Length=326

 Score =   388 bits (996),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 181/330 (55%), Positives = 248/330 (75%), Gaps = 4/330 (1%)
 Frame = -1

Query  1193  MFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGN  1014
             MFL+ +YGV+   SVWAH+GS +L+G LW+Q+ +VGHDSGHY VM +   ++ AQ+L+GN
Sbjct  1     MFLIVMYGVLRCTSVWAHLGSGMLLGLLWMQSAYVGHDSGHYVVMTSNGFNKVAQILSGN  60

Query  1013  CLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNS  834
             CLTG+SI WW+W HNAHHIACN +D+DPD+Q +P+FA S++ F +S+ SHFY + + F+ 
Sbjct  61    CLTGISIAWWKWTHNAHHIACNSLDHDPDLQHMPVFAVSSRFF-NSITSHFYGRKLEFDF  119

Query  833   LARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFL  654
             +ARFL+ YQH+TFYPVM  +AR+N+++Q+   +LF ++   +RA  I+G+++FW W+P L
Sbjct  120   IARFLICYQHFTFYPVMC-VARVNLYLQT-ILLLFSRRKVQDRALNIMGILVFWTWFPLL  177

Query  653   LSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDC  474
             +S LPN  ER+MFV+ S  +  +Q IQF LNH A++ + G  +G DW EKQ  GTLDI C
Sbjct  178   VSFLPNWPERVMFVLASFAVCSIQHIQFCLNHFAANVYVGLPSGNDWFEKQTSGTLDISC  237

Query  473   SPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFK  294
             S  MDWF GGLQFQ+EHHLFPR+PRCQLR +SP V  LC+KH + Y   SFW AN    +
Sbjct  238   SSSMDWFFGGLQFQLEHHLFPRLPRCQLRNISPLVSDLCKKHNLPYRSLSFWEANQWTIR  297

Query  293   SIRDAALMARDLSPEKAPKNLVWEALNSFG  204
             ++R AAL ARDL+   APKNL+WEA+N+ G
Sbjct  298   TLRTAALQARDLT-NPAPKNLLWEAVNTHG  326



>tpg|DAA59013.1| TPA: hypothetical protein ZEAMMB73_379395 [Zea mays]
Length=496

 Score =   389 bits (998),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 214/480 (45%), Positives = 283/480 (59%), Gaps = 73/480 (15%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T K +T+ E+ +H   GD+WV++ GKVYDV+ W+  HPGG+ PLLSLAGQDVTDAF+AYH
Sbjct  19    TTKRVTSAEMARHCGEGDVWVAVQGKVYDVTAWLPHHPGGDLPLLSLAGQDVTDAFVAYH  78

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSE------FSRMG--------------  1248
             PA A   L R+     +SD+ VSEVS+DYR LV+E      F R G              
Sbjct  79    PASAWRVLDRYRVAT-LSDYAVSEVSRDYRRLVAEFAKAGLFDRKGHGCAASLCAMAALL  137

Query  1247  -----LFEKKGHLVSYYAAALSAMFL----------VSLYGVVFMES---------VWAH  1140
                  L     ++ ++ AAA+   FL             YG V++           +  +
Sbjct  138   AGAIWLVLATTNVAAHMAAAIMLGFLWMQSGFLGHDSGHYGSVWLSGWSLALEKRPISTY  197

Query  1139  MGSAVLVGFL------------WIQAGWVGHDSGH---------YDVMKTKKLSRAAQLL  1023
             +GS     FL              Q   V  + G          Y VM++  L+R  QL+
Sbjct  198   LGSQAQEEFLHPASQTEEANQATKQKKVVSREPGQTIYRQPNAPYMVMRSGLLNRVVQLV  257

Query  1022  AGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMS  843
             AGNC+ G+SI WW+ NHNAHHIACN +D+DPDVQ +P+FA S +LF +S+ S FY + M 
Sbjct  258   AGNCVAGISIGWWKRNHNAHHIACNSLDHDPDVQHMPLFAVSPRLF-ASITSAFYRRAMR  316

Query  842   FNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLF--KKKIFANRAQEILGLIIFWV  669
             F++ ARFLVSYQHWTFYPVM  +AR+N+F QS   +L    +     R  E+ G+ +FWV
Sbjct  317   FDAAARFLVSYQHWTFYPVMC-VARVNLFAQSLLLLLAADTRTRVPGRLAELAGVAVFWV  375

Query  668   WYPFLLSSLPNH-SERIMFVVLSLMMTGVQQIQFSLNHLASSFFA--GPLTGKDWVEKQI  498
             WYP+L+S LP    E   FV+LS  +TG+Q +QF LNH ++  +   G   G DW +KQ 
Sbjct  376   WYPWLVSRLPGGVHEHAAFVLLSFAVTGIQHVQFCLNHFSAGTYTYVGRPRGDDWFQKQT  435

Query  497   DGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFW  318
              GTLD+ C PWMDWFHGGLQFQ+EHHLFPR+PRC LR+V+P V+ LC KHG+ Y    FW
Sbjct  436   RGTLDVACPPWMDWFHGGLQFQVEHHLFPRLPRCHLRRVAPLVRDLCRKHGLPYERCGFW  495



>gb|ACJ84950.1| unknown [Medicago truncatula]
Length=331

 Score =   373 bits (957),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 173/333 (52%), Positives = 243/333 (73%), Gaps = 2/333 (1%)
 Frame = -1

Query  1253  MGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSG  1074
             MGLFEKK H+  +   +++ M  + +YGVV   SVWAH+GS +L+G LW+Q+ ++GHDSG
Sbjct  1     MGLFEKKEHVALFTLTSVAIMLAIVVYGVVGCTSVWAHLGSGMLLGLLWMQSTYIGHDSG  60

Query  1073  HYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSN  894
             HY+VM ++  ++ AQ+L GNC+TG+SI WW+W HNAHHIACN +DYDPD+Q +P+FA S+
Sbjct  61    HYEVMSSRSYNKLAQILCGNCMTGISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSS  120

Query  893   KLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIF  714
             + F  S+ S+FY++ + F++L+RFL+SYQH TFYPV L  AR+N+++Q++  +    +  
Sbjct  121   RFF-GSIKSYFYDRQLKFDTLSRFLISYQHITFYPV-LCFARLNLYLQTFLLLFSPSRNV  178

Query  713   ANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAG  534
              +R   I+G+ +FW W+P LLS+LP+  ER+MFV+   ++  +Q +QF LNH A++ + G
Sbjct  179   PDRLYNIMGIGVFWTWFPLLLSALPSWPERLMFVLACFVVCSIQHLQFCLNHFAANVYLG  238

Query  533   PLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCE  354
             P +G DW +KQ  GTLDI CS WMDWF GGLQFQ+EHHLFPR+PR QLRKVSP V  LC+
Sbjct  239   PPSGNDWFQKQTAGTLDITCSTWMDWFFGGLQFQLEHHLFPRLPRAQLRKVSPLVIDLCK  298

Query  353   KHGIAYNHASFWAANALMFKSIRDAALMARDLS  255
             KH + Y   SF  AN    K+ R AAL ARD +
Sbjct  299   KHNLPYRSLSFVEANLWTLKTFRTAALQARDFT  331



>emb|CDP08743.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   363 bits (933),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 228/312 (73%), Gaps = 4/312 (1%)
 Frame = -1

Query  1139  MGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHH  960
             M    L+GF W+Q  ++GHDSGHY +M T+  ++ AQ+L GNCLTG+SI WW+W HNAHH
Sbjct  1     MFCGALLGFSWVQVTFLGHDSGHYQIMSTRGFNKLAQILTGNCLTGISIAWWKWTHNAHH  60

Query  959   IACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVML  780
             +ACN +D+DPD+Q LP+FA S  LF+S L S FY + ++F+S+ARFLVSYQH+TFYPVM+
Sbjct  61    VACNSLDHDPDLQHLPVFAVSANLFKS-LTSKFYGRKLTFDSMARFLVSYQHFTFYPVMV  119

Query  779   LIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSL  600
              +ARIN+++Q+   +  K+K+  +RA  ILG+ +FW W+P L+S LPN  ERI+FV+ S 
Sbjct  120   -VARINLYLQTLLLLFSKRKV-PDRALNILGICVFWTWFPLLISCLPNWQERILFVLASF  177

Query  599   MMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHH  420
              ++  Q IQF LNH A++ + G   G DW +KQ  GT+DI C  WMDW +GGLQFQ+EHH
Sbjct  178   FVSAFQHIQFCLNHFAANTYVGAPQGNDWFQKQTSGTIDISCPSWMDWVYGGLQFQLEHH  237

Query  419   LFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDLSPEKAP  240
             LFPR+PRC LR++SP V+ LC+KH + Y    F+ AN    +++R AAL ARDL+    P
Sbjct  238   LFPRLPRCHLRRISPLVQDLCKKHNLPYRSYGFYQANLTTIRTLRAAALQARDLT-NPVP  296

Query  239   KNLVWEALNSFG  204
             +NL+WEA N+ G
Sbjct  297   QNLLWEAFNTHG  308



>ref|XP_003588983.1| Esterase/lipase/thioesterase [Medicago truncatula]
 gb|AES59234.1| fatty acid/sphingolipid desaturase [Medicago truncatula]
Length=645

 Score =   367 bits (942),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 246/356 (69%), Gaps = 7/356 (2%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
             G   +I+ +EL+KH+K     V+I GK+YDVS W   HPGGE+PL+SLAGQ+VT+AFLA+
Sbjct  8     GKPTYISLQELQKHNKR----VAIDGKIYDVSKWANHHPGGEFPLISLAGQEVTEAFLAF  63

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             HP  A + L  FF G Y+ D  VS+VS+DY+ L SE + MG FE KG  V    + +  M
Sbjct  64    HPPTAYNRLNTFFTGSYLCDCAVSDVSRDYQNLFSELTEMGFFEYKGCGVLLMISLIIVM  123

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               VS+ GV+F +S    +    L+GFLWIQ+GW+ HDS HY +M     +   Q+L+GN 
Sbjct  124   LCVSVCGVLFSDSSCVCVCCGGLMGFLWIQSGWISHDSCHYQIMANCNWNWFVQILSGNF  183

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             L+ +S+ WW+WNHNAHH+ACN +D+DPD+Q LP F  S+K F +SL S F+++ M+F+S 
Sbjct  184   LSSISMEWWKWNHNAHHLACNSLDFDPDLQHLPFFVVSSKFF-TSLTSCFHDRKMNFDSF  242

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             ARFLVSYQHW++ P + L AR N+F +S+  +L  +K+  NR  E+LGL++FW+WYP L+
Sbjct  243   ARFLVSYQHWSYCPGICL-ARFNLFARSFFLLLSNRKV-PNRKIELLGLLVFWIWYPLLV  300

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLD  483
             S LPN  ER++FV+ S  +TG+Q +QF+ NH ++S + G  T  DW EKQ  GTLD
Sbjct  301   SCLPNWGERVLFVIASFSVTGIQHVQFTFNHFSASVYIGQPTSHDWFEKQTSGTLD  356



>gb|AFK46578.1| unknown [Medicago truncatula]
Length=299

 Score =   351 bits (900),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 220/299 (74%), Gaps = 3/299 (1%)
 Frame = -1

Query  1100  AGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQ  921
             + ++GHDSGHY+VM ++  ++ AQ+L GNC+TG+SI WW+W HNAHHIACN +DYDPD+Q
Sbjct  4     STYIGHDSGHYEVMSSRSYNKLAQILCGNCMTGISIAWWKWTHNAHHIACNSLDYDPDLQ  63

Query  920   LLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWK  741
              +P+FA S++ F  S+ S+FY++ + F++L+RFL+SYQH TFYPV L  AR+N+++Q++ 
Sbjct  64    HIPVFAVSSRFF-GSIKSYFYDRQLKFDALSRFLISYQHITFYPV-LCFARLNLYLQTFL  121

Query  740   TVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLN  561
              +    +   +R   I+G+ +FW W+P LLS+LP+  ER+MFV+   ++  +Q +QF LN
Sbjct  122   LLFSPSRNVPDRLYNIMGIGVFWTWFPLLLSALPSWPERLMFVLACFVVCSIQHLQFCLN  181

Query  560   HLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKV  381
             H A++ + GP +G DW +KQ  GTLDI CS WMDWF GGLQFQ+EHHLFPR+PR QLRKV
Sbjct  182   HFAANVYLGPPSGNDWFQKQTAGTLDITCSTWMDWFFGGLQFQLEHHLFPRLPRAQLRKV  241

Query  380   SPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
             SP V  LC++H + Y   SF  AN    K++R AAL ARD +   AP+NL+WEA N+ G
Sbjct  242   SPLVIDLCKRHNLPYRSLSFVEANLWTLKTLRTAALQARDFT-NSAPQNLLWEAFNTHG  299



>ref|XP_002108055.1| hypothetical protein TRIADDRAFT_36979 [Trichoplax adhaerens]
 gb|EDV28853.1| hypothetical protein TRIADDRAFT_36979 [Trichoplax adhaerens]
Length=472

 Score =   326 bits (836),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 166/426 (39%), Positives = 253/426 (59%), Gaps = 6/426 (1%)
 Frame = -1

Query  1532  TTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIAA  1353
             T EE+ KH+   DLW+ I+ KVYDV+ W+  HPGG  P+L+L G DVTDAF  +HP  A 
Sbjct  28    TIEEVAKHNTENDLWIIINNKVYDVTKWIPYHPGGNLPILNLGGHDVTDAFRGFHPDWAF  87

Query  1352  HHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLY  1173
               L  F  G  ++ ++ ++V KDYR L  +  R G ++      +     LS +F +S+Y
Sbjct  88    KKLSAFQVGI-LTGYEPNQVVKDYRALDEKLRREGYYKTHYMFYAKLYLWLSFLFCLSMY  146

Query  1172  GVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSI  993
               ++   +   M  A+++G  W Q  +VGHD+GH  +   + +        GN   GVS+
Sbjct  147   LTIYTTELKWQMLGALVLGMFWQQLAFVGHDTGHISISHNRDIDGWIGSTVGNFFGGVSL  206

Query  992   WWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVS  813
              WW+  HN HH+  N V +DPD+Q LPIFA ++K+    + S++++K M+F+S A+F+VS
Sbjct  207   AWWKRTHNVHHVVPNSVQHDPDIQHLPIFAVTDKVIPDGVFSNYHKKQMTFDSFAKFMVS  266

Query  812   YQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNH  633
              QH  +YPVM  +AR N+++QS   +LF       R  EI+ + +FW WY  +L  LP+ 
Sbjct  267   NQHIFYYPVM-AVARFNLYLQS-ILLLFSNVDVQCRKAEIVSVGLFWCWYIKVLGFLPST  324

Query  632   SERIMFVVLSLMMTGVQQIQFSLNHLASSFFAG-PLTGKD--WVEKQIDGTLDIDCSPWM  462
             S  I +V++S ++ G+  +Q  L+H     + G P    D  +   Q+  TL++DC  W+
Sbjct  325   SAMIAYVLISHVVAGLVHVQICLSHFPMETYDGVPYNSDDECYCITQLKTTLNVDCPEWL  384

Query  461   DWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRD  282
             DWFHGGLQFQ+EHHLFPR+PR  LR     VK+LC+KH + Y    F  AN L+  ++++
Sbjct  385   DWFHGGLQFQVEHHLFPRLPRHNLRHARKLVKELCKKHNLPYYEYGFVEANRLLLLTLKN  444

Query  281   AALMAR  264
             AA +A+
Sbjct  445   AAEVAK  450



>ref|XP_001640617.1| predicted protein [Nematostella vectensis]
 gb|EDO48554.1| predicted protein [Nematostella vectensis]
Length=455

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/456 (37%), Positives = 266/456 (58%), Gaps = 17/456 (4%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T K  T +E+K+H   GD WV +   VYD+S W+  HPGGE P+L +AG++ TD F A+H
Sbjct  9     TPKVYTLDEVKEHCSKGDCWVVVEDSVYDLSKWIGHHPGGELPILYMAGRECTDVFKAFH  68

Query  1367  PA-IAAHHLQRFFNGYY---VSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAAL  1200
             PA +    L  F  G       + + + +S+D+  L  E    G  +         A+ L
Sbjct  69    PAWVFTKKLPAFKIGKLDDTRKEKKETSLSEDFEKLRQEIIEGGGLQTNYWFYIRLASML  128

Query  1199  SAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLA  1020
             + +F   +Y VVF  +V+  + + +LV   W Q  ++GHD+GH+ +   ++      L+ 
Sbjct  129   ALLFASIIYCVVFSNNVYIQVAAGILVAVFWQQMAFIGHDAGHHAIFHDEQWDDRLGLVV  188

Query  1019  GNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSF  840
             GN LTGVSI WW+ +HNAHH+  N V+ DPD+Q LP+ A ++K F +S+ S ++++ M F
Sbjct  189   GNLLTGVSIGWWKKSHNAHHVVTNSVELDPDIQHLPVLAVTDKFF-NSIKSIYHDRVMHF  247

Query  839   NSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYP  660
             + LA+F V YQH  ++ +M L AR N++ QS+  VL K+++   R  E + +++FW WY 
Sbjct  248   DGLAKFFVRYQHHLYFLIMGL-ARFNLYAQSFLLVLSKERV-KLRVMEFVTMVLFWTWYL  305

Query  659   FLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAG-PLTG---KDWVEKQIDG  492
              L S LP  S R  FV L+  + G+  IQ +L+H +   + G PL       ++  Q+D 
Sbjct  306   TLCSYLPTWSTRFAFVFLAHFLAGIIHIQITLSHFSMETYNGLPLDAFKENRFLLSQMDT  365

Query  491   TLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAA  312
             T+DI+C P +D+FHGGLQFQ EHHLFPR+ R  LR +   +K LC+KHG+ Y   SF  A
Sbjct  366   TMDIECDPNLDFFHGGLQFQFEHHLFPRVARQNLRSIQEKMKLLCKKHGLPYRSKSFVDA  425

Query  311   NALMFKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
             N  + + ++D A  ++  SP+      +W++++  G
Sbjct  426   NIEVIQCLKDTAEKSKCFSPK------IWDSVHCIG  455



>ref|XP_002506304.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67562.1| predicted protein [Micromonas sp. RCC299]
Length=474

 Score =   309 bits (792),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 178/463 (38%), Positives = 261/463 (56%), Gaps = 41/463 (9%)
 Frame = -1

Query  1532  TTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI--  1359
             + E++ +H    D WV +   VYD+++W+ RHPGG  PL+  AG+D+TDAF AYH     
Sbjct  7     SAEDVARHCAKDDAWVIVGDGVYDITEWIPRHPGGSIPLVQYAGRDMTDAFRAYHSPTGK  66

Query  1358  AAHHLQRFFNGYYV-------SDHQVSEVSKDYRMLVSEFS------------------R  1254
             AA  L  +  G YV       SD +  E  KD+    S  S                  R
Sbjct  67    AAKTLNAYRIGEYVGRAGSRASDSEC-ESPKDHLATASGDSVGSAASSDAAAPPHVAAFR  125

Query  1253  MGLFEKKGHLVSYYA------AALSAMFLVSLYGVVFM-ESVWAHMGSAVLVGFLWIQAG  1095
               +   +G   + Y       A L+A+F  +++ VV     VW HM  AVL+G  W Q  
Sbjct  126   ALVAGLEGEFRTDYRHYFKLFACLTALFATAVWCVVGAGHGVWTHMLGAVLLGMFWQQTM  185

Query  1094  WVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLL  915
             ++GHD+GH  +           L+ GN   GV I WW   HN HH ACN ++ DPD+Q +
Sbjct  186   FIGHDAGHGAITHNHAKDFFIGLIVGNLCNGVGITWWTTTHNVHHCACNSLECDPDIQHM  245

Query  914   PIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTV  735
             P+ A + K F  S+ S ++++ M+F+  ARFLVS QH++FYP+M  +AR N++ QS   +
Sbjct  246   PVLAVTPKYF-DSVWSLYHQRRMTFDRAARFLVSVQHYSFYPIM-AVARFNLYAQSLILL  303

Query  734   LFKKKI-FANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNH  558
             L  K+I    RA EI  + +++ W   L+S+LP  +ER+ F++LS  + G+  +Q  L+H
Sbjct  304   LTSKEIKNKRRALEICVMGLYFTWLGALVSALPA-NERLGFLLLSHAVGGIIHVQICLSH  362

Query  557   LASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKV-  381
              +   F G      WV  Q+DGT+DIDC PW+DWFHGGLQFQ EHHL PRMPR +LR+  
Sbjct  363   FSRKIFDGRPENDKWVTMQLDGTMDIDCPPWLDWFHGGLQFQTEHHLVPRMPRHKLRRFR  422

Query  380   SPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDLSP  252
                VK  C++HG+ ++  SFW AN  ++++++ +A  A+ LSP
Sbjct  423   EEVVKPFCDEHGLKHDCPSFWEANVEVWRTLKASAKAAK-LSP  464



>gb|AEV77089.1| delta-6 fatty acid desaturase [Isochrysis galbana]
 gb|AEY63643.1| delta-8 sphingolipid desaturase [Isochrysis sp. CCMM5001]
Length=468

 Score =   305 bits (781),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 168/456 (37%), Positives = 251/456 (55%), Gaps = 14/456 (3%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             K     ++ KH+   DLW+ + G VYDV+ +V RHPGG  PL+++AG+D TD F  YH A
Sbjct  17    KLFRMGDVAKHNTRDDLWIIVDGLVYDVTRYVDRHPGGWLPLVNMAGKDCTDVFANYHGA  76

Query  1361  IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALS---AM  1191
                  L   F    V+D  V E  KD+R +  E  R GLF+     + YYA   +   A+
Sbjct  77    KVYRTLLPAFLVGKVTDLTVPEHVKDFRAVRQELLRRGLFKTD---MRYYAKMGTWYFAL  133

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
             F  +LY  +   S  AHM  A ++G  W Q   +GHD GH  V              GN 
Sbjct  134   FTSALYLSLACASPAAHMLGATVMGIFWQQLAGLGHDLGHSGVSHMFYTDMCVGSTIGNA  193

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             L G+S  WW+ +HN HH+ CN V+ DPD+Q LP+FA + K+F    +S ++ K  +F ++
Sbjct  194   LMGISTGWWKRSHNTHHVVCNSVENDPDIQHLPVFAVAAKIFDHPYLSSYHNKVFNFGAV  253

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKK-KIFANRAQEILGLIIFWVWYPFL  654
              RFLV++QH  FYPVM+  AR N+++QSW  +L    +    R  E   L+++  W   +
Sbjct  254   ERFLVAHQHLLFYPVMMF-ARFNLYVQSWTLLLSSSGREVHYRRIEAAALVVYATWVAAV  312

Query  653   LSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAG---PLTGKDWVEKQIDGTLD  483
               S+P  +E + ++++S  +T +  +Q +++H A   + G        +W   Q+  T++
Sbjct  313   ALSMPTWAETVGWILISHAVTALLHVQITVSHWAMETYHGHGYNDETDEWYITQLKTTMN  372

Query  482   IDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANAL  303
             +     +DW H GLQFQIEHHL+PR+PR  LRK    V+ +C KHGI Y+   F+ ANAL
Sbjct  373   VATPECLDWLHIGLQFQIEHHLYPRLPRHNLRKARELVRAVCAKHGIPYHEPGFFEANAL  432

Query  302   MFKSIRDAALMARDLSPEKAP---KNLVWEALNSFG  204
                ++RDAAL AR    +       + +WEA+N+ G
Sbjct  433   TISALRDAALEARKAKRDPGHGFYTSALWEAMNAIG  468



>gb|AIP90100.1| omega-3 fatty acid desaturase endoplasmic reticulum isozyme 3 
[Musa AB Group]
Length=234

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/238 (60%), Positives = 181/238 (76%), Gaps = 4/238 (2%)
 Frame = -1

Query  917  LPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKT  738
            +P+FA S+K F +S+ S+F+E  M+F+++ARFL+SYQHWTFYPVM   ARIN+  QS   
Sbjct  1    MPLFAVSSKFF-ASMTSYFFEGKMNFDAVARFLISYQHWTFYPVMCF-ARINLLAQSILL  58

Query  737  VLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNH  558
            +L KK +  NR QEI G+ +F +WYP L+S LPN  ER+ FVV SL +TG+Q +QF LNH
Sbjct  59   LLSKKNV-PNRWQEITGVAVFLIWYPLLVSCLPNWGERVTFVVASLAVTGIQHVQFCLNH  117

Query  557  LASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVS  378
             +SS + GP  G DW EKQ  GTLDI CSPWMDWFHGGLQFQ+EHHLFPR+PRC LRKVS
Sbjct  118  FSSSAYVGPPQGNDWCEKQTMGTLDISCSPWMDWFHGGLQFQVEHHLFPRLPRCHLRKVS  177

Query  377  PFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
            PFV++LC+KH + YN ASFW ANA+  +++R AAL ARD +    PKNLVWE +N+ G
Sbjct  178  PFVRELCKKHKLPYNIASFWEANAMTVRTLRAAALQARDFA-NPVPKNLVWETVNTHG  234



>ref|XP_005823399.1| hypothetical protein GUITHDRAFT_97578 [Guillardia theta CCMP2712]
 gb|EKX36419.1| hypothetical protein GUITHDRAFT_97578 [Guillardia theta CCMP2712]
Length=472

 Score =   295 bits (755),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 168/467 (36%), Positives = 266/467 (57%), Gaps = 29/467 (6%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             TK  IT E+LK HDK GD+WV+I GKVYDVS W   HPGGE+ L ++AGQD T  FLA+H
Sbjct  16    TKPIITLEQLKAHDKKGDVWVAIEGKVYDVSKWAAHHPGGEHLLENMAGQDATAVFLAFH  75

Query  1367  PAIAAHHLQRFFNGY--YVSDHQVSEVSK---DYRMLVSEFSRMGLFEKKGHLVSYY---  1212
                 +    R    +  +V+D  +   +K    +R L  +    GL++     VS+Y   
Sbjct  76    TEHGSGGQARKILQFLPHVADVYLPPETKLQIAFRKLRDQVDSDGLYKTS---VSFYVCL  132

Query  1211  ----AAALSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKL  1044
                 A   SAM  ++L      ++++A    AV   FL  Q  +VGHD+ H  +   +  
Sbjct  133   GIWIAFLFSAMLYLTLTAHNIAQAIFA---GAVFALFL-QQCAFVGHDTSHNGITHRRFT  188

Query  1043  SRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLI-S  867
                   + G  +TG+S  WW+ +HNAHH+  N   +DPD+Q +P FA +  LF+     S
Sbjct  189   DSVIGWIIGPSVTGISTAWWKRSHNAHHVVTNSTTHDPDIQHMPAFAITEDLFKKGGTWS  248

Query  866   HFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILG  687
             +++++   F+SLA+FL+SYQH+ +YP+M   AR+N+++QSW  VL        R  EI  
Sbjct  249   YYHKRLFHFDSLAKFLISYQHFFYYPIMSF-ARLNLYLQSWLLVLNFDVKMEYRTVEIAC  307

Query  686   LIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLA------SSFFAGPLT  525
             L+I+W W   L+S +P+   R+ F   S M+ G+  +Q +++H +      +SF A P  
Sbjct  308   LMIYWTWLSLLISCMPSVQLRLAFFFTSHMLAGILHVQITISHFSMPTYTGASFPAHP--  365

Query  524   GKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHG  345
             G++++ +Q+  ++D++   W +WF+GGLQ+Q+ HHLFPR+PR  L +V   ++ LC++HG
Sbjct  366   GEEFLRQQLYTSMDLESYWWNNWFYGGLQWQVAHHLFPRLPRHNLPEVKKRLQVLCQEHG  425

Query  344   IAYNHASFWAANALMFKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
             + Y    +W  NA +  S+R AA+ AR        ++L+W  +N+ G
Sbjct  426   LEYKSVGWWKGNAEILYSLRKAAMKARSTKVISFQESLLWAGMNAEG  472



>emb|CEG01739.1| Cytochrome b5-like heme/steroid binding domain [Ostreococcus 
tauri]
Length=505

 Score =   294 bits (753),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/438 (37%), Positives = 238/438 (54%), Gaps = 28/438 (6%)
 Frame = -1

Query  1532  TTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIAA  1353
             T  E++ HD   D W+ + G+VYDV+ WV +HPGG   L   AG+D TDAF AYH     
Sbjct  70    TRAEVRAHDGGDDCWMIVRGEVYDVTAWVEKHPGGRTVLEQYAGRDATDAFTAYHGGERK  129

Query  1352  --HHLQRFFNGYYVSDHQVSE------------VSKDYRMLVSEFSRMGLFEKKGHLVSY  1215
                 L+    G        +             +  D++ML S FS       +  LV +
Sbjct  130   VLARLRTMRVGTVAEGETPTPTHLKGFREMREMMEGDHKMLRSSFSDYAFVLVR--LVIF  187

Query  1214  YAAALSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRA  1035
             +  AL+ +      G  F      HM  AV +G  W Q+ ++GHD+GH  +   +     
Sbjct  188   FGGALACVLAP---GAGFK----THMLGAVSLGLFWQQSMFIGHDAGHSSITFNRSSDAM  240

Query  1034  AQLLAGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYE  855
                  GN   GV I WW   HN HH ACN ++ DPD+Q +P+ A S K F+S + S ++ 
Sbjct  241   IGWTVGNLFNGVGIAWWMATHNVHHCACNSLECDPDIQHMPVLAVSEKYFKS-VYSLYHR  299

Query  854   KPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIF  675
             + M+++ +AR LV YQH TFYP+M  +ARIN+++Q+    LFK K   NR  E L L +F
Sbjct  300   RRMTYDRVARLLVRYQHLTFYPIMA-VARINLYLQTL-IFLFKAKRVRNRGMEFLTLGMF  357

Query  674   WVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQID  495
               W   L++ LP+   R+ F  LS  + G+  +Q  L+H +   F G     +WV+ Q+ 
Sbjct  358   AAWLSALIAQLPS-GHRVPFFFLSHAVAGIIHVQICLSHFSRDVFEGRPENDEWVKMQLS  416

Query  494   GTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKV-SPFVKQLCEKHGIAYNHASFW  318
             GT+DI+C  W+DWFHGGLQFQ+EHHL PR+PR +LR+     VK   EK+G+  +   FW
Sbjct  417   GTMDIECPRWLDWFHGGLQFQVEHHLCPRVPRHKLREFRETVVKPFAEKNGLQLHSVGFW  476

Query  317   AANALMFKSIRDAALMAR  264
             AAN  +F++++ AA  +R
Sbjct  477   AANLEVFRTLKLAAKQSR  494



>ref|XP_001417552.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95845.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=498

 Score =   290 bits (743),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 169/432 (39%), Positives = 235/432 (54%), Gaps = 22/432 (5%)
 Frame = -1

Query  1523  ELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA--IAAH  1350
             +++ HD   D W+ +   VYD + WV +HPGG   L   AG+D TDAF+AYH     A  
Sbjct  66    DVRSHDVGSDCWLVVGDGVYDATSWVEKHPGGSTILEQYAGRDATDAFMAYHGGERRALA  125

Query  1349  HLQRFFNGYYVSDHQVSEVS-KDYRMLVSEFSRMGLFEK--KGHLVSYYAAALSAMFLVS  1179
              L+    G  V +        K +R +      M   EK  K  L  Y   A     LV 
Sbjct  126   RLETLRIGRLVDESAAPPTHLKAFRRMRDA---MEGSEKLLKSDLTDY---AFIIARLVV  179

Query  1178  LYGVVFM------ESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAG  1017
             L+G V             HM  AVL+G  W Q+ ++GHD+GH  +   +K         G
Sbjct  180   LFGGVLACVLSSGAGFKTHMFGAVLLGLFWQQSMFIGHDAGHTSITYDRKKDAMIGWCVG  239

Query  1016  NCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFN  837
             N   GV I WW   HN HH ACN ++ DPD+Q +P+FA SNK F  S+ S ++ + M+++
Sbjct  240   NLFNGVGIAWWMATHNVHHCACNSLECDPDIQHMPVFAVSNKYF-GSVYSLYHRRRMTYD  298

Query  836   SLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPF  657
              LAR LV +QH+TFYP+M  +ARIN+++Q+    L K K   +RA E L L +F  W   
Sbjct  299   RLARTLVRFQHYTFYPIMA-VARINLYLQTL-IFLIKAKRVRSRAMEFLTLGVFATWLTT  356

Query  656   LLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDID  477
             L++ LP    ++ F  LS  + GV  +Q  L+H +   F G     +WV  Q+ GTLDID
Sbjct  357   LIAQLPV-GHKVPFFFLSHAVAGVIHVQICLSHFSRDVFEGRPENDEWVNMQLAGTLDID  415

Query  476   CSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKV-SPFVKQLCEKHGIAYNHASFWAANALM  300
             C  W+DWFHGGLQFQ EHHL PR+PR +LR      VK   + +G+  +  SFWAANA +
Sbjct  416   CPRWLDWFHGGLQFQTEHHLCPRVPRHKLRAFREDVVKPYAKANGLGLHSVSFWAANAEV  475

Query  299   FKSIRDAALMAR  264
             F++++ AA  +R
Sbjct  476   FRTLKLAAKQSR  487



>gb|KCW78123.1| hypothetical protein EUGRSUZ_D02331 [Eucalyptus grandis]
Length=337

 Score =   278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             KK+IT EEL+KH  PGDLW+SI GKVYDV++W  RHPGGE PL +LAGQDVTDAFLAYHP
Sbjct  5     KKYITAEELRKHSTPGDLWISIRGKVYDVTEWAERHPGGEIPLRTLAGQDVTDAFLAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  HL+  + GY V D   SEVSKDYR L +E +R+G+FEKKGH+      A++ M  
Sbjct  65    VSAWQHLEGLYTGYRVRDFAPSEVSKDYRRLHAELARLGMFEKKGHIAVCALTAIALMLS  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT  1005
             + +YGVV  E V  H   AVL+G LWIQ  ++GHDSGHY VM T   ++  QLLAGNCLT
Sbjct  125   LCVYGVVACEGVAVHFLCAVLLGLLWIQGAYMGHDSGHYQVMTTTGCNQITQLLAGNCLT  184

Query  1004  GVSIWWWRWNHNAHHIACNVVDYDPDVQLLP  912
             G+SI WW+W HNAHH+ACN +D+DPD+Q +P
Sbjct  185   GISIAWWKWTHNAHHLACNSLDHDPDLQHIP  215


 Score =   173 bits (438),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = -1

Query  587  VQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPR  408
            +Q I F LNH +++ + GP  G DW EKQ  GT+DI C  WMDWFHGGLQFQ+EHHLFPR
Sbjct  211  LQHIPFCLNHFSANVYMGPPNGSDWFEKQTGGTIDISCPTWMDWFHGGLQFQLEHHLFPR  270

Query  407  MPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDLSPEKAPKNLV  228
            +PRCQLR +SP  + LC+KH + Y   SFW AN    +++R AAL ARDLS    PKNLV
Sbjct  271  LPRCQLRGISPLARDLCKKHNLPYRSLSFWDANISTLRTLRTAALQARDLS-SPVPKNLV  329

Query  227  WEALNSFG  204
            WEA+N+ G
Sbjct  330  WEAVNTHG  337



>ref|XP_003063519.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52655.1| predicted protein [Micromonas pusilla CCMP1545]
Length=527

 Score =   283 bits (725),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 171/485 (35%), Positives = 256/485 (53%), Gaps = 56/485 (12%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T+   T E++ +HD P D W  +H  VYD++ W+ +HPGG  PL   AG+D+TDAF AYH
Sbjct  36    TRPGYTFEDVARHDAPDDAWCVVHDVVYDITHWISKHPGGSIPLRQYAGRDMTDAFNAYH  95

Query  1367  -PAIAAHHLQRFF----------------------NGYYVSDHQVSEVSK----------  1287
              P+  A    R +                      +G    +    EVS+          
Sbjct  96    GPSGKAARTLRAYAIGDLVDPASVLDPVASDASSDDGSEFQEEGAEEVSEVPVSPKKANG  155

Query  1286  ----------DYRMLVSEFSRM--GLFEKKGHLVSYY---AAALSAMFLVSLYGVVFMES  1152
                       DY   V  F  +  GL ++     ++Y   AA L  +   + Y V+  E 
Sbjct  156   AKVREEKQRADYPDHVGAFRELVAGLEDEFHTDYAHYFKLAAFLVTLLSGAFYCVLGYEG  215

Query  1151  ---VWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWR  981
                V      A L+G  W Q+ ++GHD+GH  +    +      L+ GN   GV I WW 
Sbjct  216   EHGVAVRALGACLLGLFWQQSMFIGHDAGHGAITHDHRRDFLVGLVVGNLCNGVGITWWT  275

Query  980   WNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHW  801
               HN HH+ACN ++ DPD+Q +PI A + K F+S + S ++ + M F++ AR+LVS QH+
Sbjct  276   TTHNVHHVACNSLECDPDIQHMPIIAVTPKYFKS-VWSLYHNRRMPFDAAARWLVSKQHY  334

Query  800   TFYPVMLLIARINMFIQSWKTVLFKKKI-FANRAQEILGLIIFWVWYPFLLSSLPNHSER  624
             TFYP+M  +AR N++ QS   +L  K+I    R  E+  +  ++ W   L+S++P+  ER
Sbjct  335   TFYPIMA-VARFNLYAQSIILLLTSKEITLKRRTLELAVMGAYFAWLAALVSAVPSGWER  393

Query  623   IMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGG  444
             + F++LS  + GV  +Q  L+H + + F G      WVE Q+ GT+DIDC  +MDWFHGG
Sbjct  394   LGFLLLSHAVGGVIHVQICLSHFSRNIFEGRPENGKWVEMQLSGTMDIDCPRYMDWFHGG  453

Query  443   LQFQIEHHLFPRMPRCQLRKV-SPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMA  267
             LQFQ EHHL PRMPR +LR+     ++   + HG+  +  +FW AN  ++ ++R+ A  A
Sbjct  454   LQFQTEHHLVPRMPRHKLRRFREETLRPWLKAHGLTMDAPTFWEANREVWCTLRNCAREA  513

Query  266   RDLSP  252
             R LSP
Sbjct  514   R-LSP  517



>gb|ERZ96241.1| hypothetical protein GLOINDRAFT_12826 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78418.1| hypothetical protein RirG_015060 [Rhizophagus irregularis DAOM 
197198w]
Length=459

 Score =   276 bits (707),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/441 (34%), Positives = 246/441 (56%), Gaps = 19/441 (4%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
              +I+ E+ +K  + G + +  + KVY ++ W+  HPGGE  +  + G+D TD    +HP 
Sbjct  14    NYISQEDFEKRVQNGQILIIYNNKVYKLNKWIKYHPGGELAIRHMIGKDATDEINVFHPE  73

Query  1361  -IAAHHLQRFFNGYYVSDHQVSE--------VSKDYRMLVSEFSRMGLFEKKGHLVSYYA  1209
              +    +  F+ G Y  +  + E        +S+ YR    +   +GL+E   +  +Y+ 
Sbjct  74    YVFKKKINTFYIGEYEENTNLKEEKLSEQKLISQTYRRYYLKLHELGLYE--CNYWNYFY  131

Query  1208  AALSAMFLV--SLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRA  1035
              ++  +FL+  +   V++   VW ++ SA  +G  W Q  +  HD+GH  +     +   
Sbjct  132   ESIRYIFLIISAWILVIYGTQVWQYLLSAFFLGLFWHQLAFTAHDAGHNGITHNLLVDNL  191

Query  1034  AQLLAGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYE  855
               +   + + G+SI WW+ NH  HHI  N  ++DPD+Q LP FA + K F ++L S FY+
Sbjct  192   IGIFIADFMGGLSIGWWKRNHYVHHIVTNDPEHDPDIQHLPFFAVTTKFF-NNLYSSFYK  250

Query  854   KPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIF  675
             + + F++ ARF V +QH+ +YPV L   R N++  S    LF ++  A R  EI G+I F
Sbjct  251   RTLYFDTPARFFVKFQHYLYYPV-LCFGRFNLYALS-INFLFNEENVAFRRLEISGMIFF  308

Query  674   WVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLA-SSFFAGPLTGKDWVEKQI  498
             W WY +LLS LP+ S  ++++++S M+T +  +Q +L+H   S+   GPL  + + +K +
Sbjct  309   WCWYTYLLSLLPSISTIVLYILISHMVTMILHVQITLSHFGMSTEDYGPL--ESFPKKML  366

Query  497   DGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFW  318
               T+D+DC  WMDWFHGGLQFQ  HHLFPR+PR  LR     V + C++ G+ Y+   F 
Sbjct  367   RTTMDVDCPWWMDWFHGGLQFQAIHHLFPRVPRHNLRDCQRLVNEFCKEVGLEYHLYGFI  426

Query  317   AANALMFKSIRDAALMARDLS  255
               N ++  ++RD A  A  LS
Sbjct  427   KGNGIVLGALRDVANQAELLS  447



>ref|XP_002291331.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|AAX14504.1| sphingolipid delta-8 desaturase [Thalassiosira pseudonana]
 gb|EED91438.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=493

 Score =   277 bits (709),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 162/467 (35%), Positives = 242/467 (52%), Gaps = 29/467 (6%)
 Frame = -1

Query  1541  KFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA  1362
             K  +  ++ +H+ P D W+    +V D+S W+  HPGGE  LL  AG D TD   A+H  
Sbjct  35    KRYSPSQISQHNTPTDAWLIYKSQVLDISKWISHHPGGEQTLLRFAGMDATDELRAFHDD  94

Query  1361  -IAAHHLQRFFNG------------YYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLV  1221
              +    L  F  G                D QVSE+ KD+R L   F R+G F       
Sbjct  95    WVLEEKLPHFVIGEVDWTTTGGAENTVTKDGQVSELIKDFRELGEHFDRLGYFHVSPWYY  154

Query  1220  SYYAAALSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLS  1041
                 A + A+F  +L  +   +S+ AHM +AVL+G  W Q  +VGHD GH       +  
Sbjct  155   VRKVATVFAIFGCALGLLFNTDSIPAHMLAAVLLGIFWQQFAFVGHDCGHMSARTHARDH  214

Query  1040  RAAQLLAG--NCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLIS  867
                  L        G+S+ WW+  HN HH   N VD DPD+  LP+FA    +F +SL +
Sbjct  215   IDVPKLGALVTFFNGISVAWWKATHNVHHAVPNSVDCDPDIAHLPVFALHEHMF-TSLFN  273

Query  866   HFYEKPMSFNSLAR-FLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQ-EI  693
              ++ + M F+ LAR   V +QH+ +YP+M  +AR N++IQS   +  K    A R   ++
Sbjct  274   KYHGRVMEFDWLARNVFVPFQHFWYYPIMA-VARFNLYIQSALFLASKNDGHAGRTTLDL  332

Query  692   LGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFF----AGPLT  525
             +  I F+ W   L+S +P+  ERI FV +S  + G+  +Q +L+H +   F     GP  
Sbjct  333   MAFIGFFSWLAVLVSCIPSWPERIAFVFVSHAVAGLLNVQITLSHFSRPIFDTNKEGPRF  392

Query  524   GKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHG  345
             G D+  + +  +LD+ C  ++DWFHGGLQFQ  HH +PR+ R  LRK  P +  LC+KH 
Sbjct  393   GGDFYSRNVLASLDVACPTYLDWFHGGLQFQTLHHCYPRLGRQHLRKTEPLIASLCKKHS  452

Query  344   IAYNHASFWAANALMFKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
             + Y   SF   N  +F +++DAA  A+  SP      L++E++ + G
Sbjct  453   LPYTSKSFVECNMEVFNTLKDAARSAKKWSP------LIYESMCAQG  493



>ref|XP_009039034.1| hypothetical protein AURANDRAFT_29200 [Aureococcus anophagefferens]
 gb|EGB06465.1| hypothetical protein AURANDRAFT_29200 [Aureococcus anophagefferens]
Length=508

 Score =   276 bits (706),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 163/462 (35%), Positives = 253/462 (55%), Gaps = 25/462 (5%)
 Frame = -1

Query  1535  ITTEELKKHDK-PGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAI  1359
             +T E++++ +   G+LWV I  K YD++++ +RHPGG   L  +AG++ T+AF  +HPA 
Sbjct  54    VTREDVRRREALTGELWVIIEDKAYDLTEFQHRHPGGYLCLRGVAGRNATEAFDNFHPAK  113

Query  1358  AAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
                 L   ++   V+D  VSE    +R +  +    GLFE +    SYYA   + +  + 
Sbjct  114   VWETLLPAYHVADVTDVAVSEYVAGHREIRQQLLERGLFETRP---SYYAKVAAWLAALL  170

Query  1178  LYGV---VFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGN-C  1011
                V   V        +  A ++GF W Q  ++GHD GH  +  T K    + L A +  
Sbjct  171   AAAVGLTVAGGGAGPRLLGAAVLGFFWQQLAFLGHDIGHNSI--THKRGVDSLLGAAHVA  228

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEK---PMSF  840
             L GVS+ WW+ +HN HH+ CN V+ DPD+Q LP+ A S  +F     S ++ K   P+  
Sbjct  229   LFGVSMAWWKRSHNTHHVVCNSVENDPDIQHLPVLAVSPAIF-EGFASTYHAKAFAPLVL  287

Query  839   NSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYP  660
             + +A F+VSYQH  +Y V +   R N+++QS+  +L  K+    R  E+  +  +WVW+ 
Sbjct  288   DPIAHFIVSYQHLLYY-VFMFFGRYNLYVQSFALLLDFKERVELRFVELGAVAAYWVWFC  346

Query  659   FLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAG--PL---TGKDWVEKQID  495
              L SS  +  E + +V++S  ++G+  +Q +L+H     F    P+      DW   Q+ 
Sbjct  347   ALASSTESTRELLAYVIISHGVSGILHVQITLSHFCMETFTKDQPVYTADENDWFRLQLA  406

Query  494   GTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWA  315
              T+D+DC  W+DWFHGGLQFQIEHHLFPR+PR  LR+V   VK  C+K G+ Y+  SF  
Sbjct  407   TTMDVDCPEWLDWFHGGLQFQIEHHLFPRVPRHNLREVRKLVKAFCKKEGLHYHEVSFLQ  466

Query  314   ANALMFKSIRDAALMARDLSPE-----KAPKNLVWEALNSFG  204
              NA +   + + AL AR L  +     +  ++  WE LN+ G
Sbjct  467   GNAEVIAGLYETALAARRLPRDGKSIGRLRESWTWEMLNAQG  508



>ref|XP_002158999.1| PREDICTED: delta(8)-fatty-acid desaturase-like [Hydra vulgaris]
Length=454

 Score =   274 bits (700),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/453 (34%), Positives = 250/453 (55%), Gaps = 19/453 (4%)
 Frame = -1

Query  1532  TTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIAA  1353
             + EE+  H    D WV I  KVY+V++W+ +HPGG   +L+LAG+D +  F ++H     
Sbjct  11    SREEVALHTAKSDAWVIIRDKVYNVTNWLDKHPGGVSLILNLAGKDCSVEFNSFHLNPNY  70

Query  1352  HHLQRFFNGYYVSD--HQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
               L+ +  G   +   H+ +++ KD + L  E   +  FE    L    A+ +S++F+ S
Sbjct  71    DRLKPYLIGQLPAAQWHKDTQLGKDLKALFEELKNLKAFESDYWLYIKLASIISSLFVAS  130

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
             ++ + F  S W+   SA+ +G  W Q  +VGHD GH+ V   KK       + GN L G+
Sbjct  131   IFFLHFSSSYWSLCLSAMFLGLFWQQLAFVGHDLGHHAVTHNKKKDETLGYIFGNFLQGI  190

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
             S+ WWR +HN HH   N +++DPD+Q LP+ A S   F +++ S +Y + + F+ +A   
Sbjct  191   SVAWWRHSHNTHHTLTNSINHDPDIQHLPVLAVSKSYF-NNIFSTYYHRVLKFDRIAHLF  249

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQ-EILGLIIFWVWYPFLL---  651
             VS QH+ F+P+M L AR N++ QS+   L      +   Q E+  L+ FW W+  LL   
Sbjct  250   VSIQHYMFFPIMGL-ARFNLYAQSFIFNLIGVGASSKGKQAELFSLLGFWTWFLLLLMYI  308

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAG-PLTGKD---WVEKQIDGTLD  483
             SS  ++S  I+F+ LS    G+  IQ  ++H +   + G P +  +   +   Q+  T++
Sbjct  309   SSTLSYSHAIIFLFLSHATAGLVHIQICISHFSMETYMGVPQSNYENDGYFLSQLMTTMN  368

Query  482   IDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANAL  303
             +DC PWMD FHGGLQFQIEHH+FP + R +LR V   ++ LC+KHG+ ++   F+ A   
Sbjct  369   VDCPPWMDLFHGGLQFQIEHHIFPHLTRSKLRYVQGRLQSLCKKHGLPHHSKPFFGAVLA  428

Query  302   MFKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
             + + + +        S E    N++W+ +N  G
Sbjct  429   VVEKLHET-------SKELKLSNMIWDGMNLVG  454



>ref|XP_007515499.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14378.1| predicted protein [Bathycoccus prasinos]
Length=469

 Score =   272 bits (696),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/428 (38%), Positives = 239/428 (56%), Gaps = 24/428 (6%)
 Frame = -1

Query  1472  KVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP--AIAAHHLQRFFNGYYVSDHQVS  1299
              VYD+S W+ +HPGGE  L   +G+D+TDAF AYH     A   L+    G      ++S
Sbjct  53    NVYDISSWISKHPGGETVLKQYSGRDITDAFRAYHSENGKAMKTLKSMRVG--AVQRKIS  110

Query  1298  EVSK----DYRMLVSEFSRMGLFEKKGHLVSYYAAA--LSAMFLVSLYGVVFMESVWAHM  1137
             E +     D+R LV         E K     YYA A  L ++  V+++ VV  E  ++HM
Sbjct  111   EEAPQHLHDFRELVKTAENA---EFKTDYKHYYAIAIRLVSLLAVAIHLVVNKEDTFSHM  167

Query  1136  GSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHI  957
               AV +G  W Q+ ++GHD+GH  V   +KL  A   L GN   GV I WW   HN HH 
Sbjct  168   LGAVSLGMFWQQSMFIGHDAGHCAVTHNRKLDTAIGWLIGNMCNGVGISWWSSTHNVHHC  227

Query  956   ACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLL  777
             A N ++ DPD+Q +PI A + K F S + S ++ + + F+ LA+  VS QH+TFYP+M  
Sbjct  228   AVNSLECDPDIQHMPILAVTRKYFES-VYSLYHNRQLKFDWLAKKFVSVQHYTFYPIMA-  285

Query  776   IARINMFIQS---WKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVL  606
             +AR+N++ Q+     TV   KK    R  E   L  ++ WY  L+S LP   E+  F  L
Sbjct  286   VARVNLYAQTLIHCATVKMSKK---QRVIEFATLGFYFAWYSTLVSMLPTAGEKWAFFFL  342

Query  605   SLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIE  426
             S  + G+  +Q  L+H +   F G     +W+E Q+ GT+DI+C  ++DWFHGGLQFQ+E
Sbjct  343   SHAIGGIIHVQICLSHFSRDVFDGIPKNNEWIEMQLAGTMDIECPKYLDWFHGGLQFQVE  402

Query  425   HHLFPRMPRCQLRKV-SPFVKQLCEKHGIAYNHA-SFWAANALMFKSIRDAALMARDLSP  252
             HHL PR+PR +LR      +K   +K+G+   H+  F+ AN  ++K+++ AA  +  LSP
Sbjct  403   HHLCPRLPRHKLRDFREEVIKPYAKKNGLKNFHSVGFFEANVQVWKTLKKAASQSV-LSP  461

Query  251   EKAPKNLV  228
               + +N +
Sbjct  462   AFSTENYI  469



>ref|XP_006675166.1| hypothetical protein BATDEDRAFT_18307 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83925.1| hypothetical protein BATDEDRAFT_18307 [Batrachochytrium dendrobatidis 
JAM81]
Length=516

 Score =   272 bits (696),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 146/425 (34%), Positives = 232/425 (55%), Gaps = 11/425 (3%)
 Frame = -1

Query  1523  ELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA-IAAHH  1347
             ++ +  K G+  + +H KVY+++ WV  HPGG+  +  ++G+D TDA +A+HP  + +  
Sbjct  77    DIIERAKSGETIIIVHHKVYNLTKWVKYHPGGDLAVRHMSGKDATDAMIAFHPPEVFSER  136

Query  1346  LQRFFNGYY-VSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYG  1170
             L  F  G   + D   S VS  YR L  +    G+F               A++L  LY 
Sbjct  137   LPNFCIGEIALEDRITSPVSLAYRQLEFKLHEAGIFNTDYSFYGREIIKFLALWLGMLYF  196

Query  1169  VVFM-ESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSI  993
              ++  ES+  +  SA+    LW QA +V HD+GH  +  +        +   N   G+SI
Sbjct  197   ALYAKESIIWYFASAMCAAILWHQAAFVAHDAGHSGISHSCLGDTLFGIGLANFFGGLSI  256

Query  992   WWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVS  813
              WW+ NHN HHI  N  ++DPD+Q +P  A + KL   SL S +Y + M F+ +A++ + 
Sbjct  257   GWWKRNHNVHHIVTNDAEHDPDIQHMPFMAITTKLM-DSLYSTYYNRVMEFDVVAQYFIP  315

Query  812   YQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNH  633
              QH+ FY ++L   R N+++ SW  V  +  I  +R+ EILG++ FW+W+ +LLS LP  
Sbjct  316   KQHYLFY-IILAFGRFNLYVNSWSYVFSRSFIVPHRSLEILGMVCFWIWFSWLLSHLPTG  374

Query  632   SERIMFVVLSLMMTGVQQIQFSLNHLASSF------FAGPLTGKDWVEKQIDGTLDIDCS  471
                  ++++S M T    +Q +L+H   S         G +T + + EK    T+DIDC 
Sbjct  375   WHIAGYILVSHMATVFLHLQITLSHFGMSTDNALVEVNGVMTDETYAEKAFRTTMDIDCP  434

Query  470   PWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKS  291
              WMDWFHGGLQFQ+ HHL+PR+PR  LRK+ P V+   ++HG+ ++   F + N  +   
Sbjct  435   RWMDWFHGGLQFQVGHHLYPRVPRPNLRKLRPLVESFAKEHGLEFHSYGFVSGNRYVLGC  494

Query  290   IRDAA  276
             + + A
Sbjct  495   LEEVA  499



>emb|CBN74378.1| Fatty acid desaturase [Ectocarpus siliculosus]
Length=513

 Score =   271 bits (692),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/452 (36%), Positives = 234/452 (52%), Gaps = 15/452 (3%)
 Frame = -1

Query  1535  ITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIA  1356
             +T + + KH K  D WV I   VYDV  W   HPGGE  ++ ++G+DVTD F A+H    
Sbjct  69    VTMDAVHKHCKANDAWVVIGDGVYDVGKWAPHHPGGERNIVDISGRDVTDVFEAFHREPR  128

Query  1355  AHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKG-HLVSYYAAALSAMFLVS  1179
                    F    +  +  S + +D+R L  E    GLFE      +  Y   L  + L +
Sbjct  129   HRQKLEGFRIGTLVGYTPSPLVQDFRALGQEIEDEGLFEIDPWFFIKRYIVLLPILALGA  188

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLT--  1005
                + + +     +  A LVGF W Q  ++GHD+GH    ++    RA+      CL   
Sbjct  189   YIVITYRDCTGIQLCGAGLVGFYWQQLAFLGHDAGH----RSHTADRASDDFTAYCLILP  244

Query  1004  --GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
               G+   WW  +HN HH+ CN V  DPD+Q LP  A S K F +SL S +++K M ++ L
Sbjct  245   LLGIGPQWWIDSHNIHHVVCNDVHCDPDIQHLPFMAISPKFF-ASLYSVYHDKIMIYDFL  303

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
              R LVS QH  FYP+M L +R  +++QS   VL K +    R  E+L  +IF+ W  +L 
Sbjct  304   GRCLVSVQHLLFYPLMCL-SRTFLYVQSIVFVLAKARA-KKRVHELLSYVIFFCWNAYLC  361

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKD---WVEKQIDGTLDI  480
             S L     R  + ++S  ++G+  +Q +L+H +      P    D   WV  Q++ TLD+
Sbjct  362   SHLQGAWPRASYFLVSHAVSGILHVQITLSHFSMDVTEQPQYRNDEEGWVVTQLNTTLDV  421

Query  479   DCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALM  300
             DC  WMDWFHGGLQFQ  HHLFP++PR  LR V   V  L EKHG+ Y+   F  AN   
Sbjct  422   DCYRWMDWFHGGLQFQTLHHLFPKLPRYNLRTVQSRVAALAEKHGLTYHLYPFLQANIKT  481

Query  299   FKSIRDAALMARDLSPEKAPKNLVWEALNSFG  204
             + ++R+ A  A      K   ++++E  +  G
Sbjct  482   YLAMRETARQAWTKPNFKFTDSMLYEGASLVG  513



>gb|KFH68785.1| hypothetical protein MVEG_05590 [Mortierella verticillata NRRL 
6337]
Length=490

 Score =   265 bits (678),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/453 (31%), Positives = 234/453 (52%), Gaps = 41/453 (9%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +  I   +L    K G++ + ++ KVY +  W+  HPGG+  +    G+D TD   A HP
Sbjct  14    RNVINKSQLDARCKAGEILIVVNHKVYKLDKWIKHHPGGQLAIRHCIGRDCTDEVKALHP  73

Query  1364  AIAAHHLQRFFNGYYVSDH--------------------------QVSEVSKDYRMLVSE  1263
                     ++F    ++D+                          Q ++VS  YR L   
Sbjct  74    DYVLEKKIKYFE---IADYLPRESDPDFEPLLLSNKKSKEDVFATQEAQVSAAYRQLEQR  130

Query  1262  FSRMGLFEKK----GHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAG  1095
                  LFE          S Y    +   +++LYG   M     +M SA+ +   W Q  
Sbjct  131   LRANHLFETNYINYAWEFSRYLTLFTMAIVLNLYGTCTMH----YMASALCLAMFWHQIS  186

Query  1094  WVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLL  915
             +  HD+GH  +    ++     +   + L G+SI WW+ +H  HHI  N   +DPD+Q L
Sbjct  187   FFAHDAGHNSISHNLQIDNGIGIFLADFLGGLSIGWWKKSHYVHHIVTNHPIHDPDIQHL  246

Query  914   PIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTV  735
             P FA + ++F+    S +++K M F+  A+F VSYQH+ +YP+M++  R N++IQS + +
Sbjct  247   PFFAVTTRIFK-GFFSTYHQKEMVFDRAAQFFVSYQHYLYYPIMMM-GRFNLYIQSMQFL  304

Query  734   LFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHL  555
             +F + ++  R QEI+GL ++W+WYP  +  LP  +    +V++S M T +  +Q +L+H 
Sbjct  305   MF-EPVYPYRKQEIVGLTVYWIWYPLFIKQLPTWNMIFAYVMVSHMFTFMLHVQITLSHF  363

Query  554   ASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSP  375
               S        + +  K +  T+D+DC  W+DWFHGGLQFQ  HHLFPRMPR  LR   P
Sbjct  364   GMS-TEDLGEYESFAAKMLRTTMDVDCPLWLDWFHGGLQFQAIHHLFPRMPRHNLRNAQP  422

Query  374   FVKQLCEKHGIAYNHASFWAANALMFKSIRDAA  276
             +V++ CE+ G+ Y+   F   N++++ +++D A
Sbjct  423   YVREFCEEVGLTYHIHGFAKGNSIVYSALKDVA  455



>gb|AFK47389.1| unknown [Lotus japonicus]
Length=255

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 155/224 (69%), Gaps = 2/224 (1%)
 Frame = -1

Query  1136  GSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHI  957
             G    VGF         HDSGH+  M  +  ++ AQLL+GNCLT +SI WW+W HNAHHI
Sbjct  9     GFCYAVGFALDAECLFSHDSGHHVFMMNRGFNKFAQLLSGNCLTRISIAWWKWTHNAHHI  68

Query  956   ACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLL  777
             ACN +D+DPD+Q +P+FA S + F +++ SHFY +P+ F+SLARFL+SYQHWTFYPVM  
Sbjct  69    ACNSLDHDPDLQHMPVFAVSARFF-NTITSHFYGRPLKFDSLARFLISYQHWTFYPVMC-  126

Query  776   IARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLM  597
             +AR+N++IQ++  +    +   +RA  ILG+++FW W+P L+S LPN  ER MFV+ S  
Sbjct  127   VARVNLYIQTFLLLFSPTRRVPDRALNILGILVFWTWFPLLVSCLPNWPERFMFVLASFA  186

Query  596   MTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPW  465
             +  +Q IQF LNH A++ + G  +G DW EKQ  GTLDI CS W
Sbjct  187   VCSIQHIQFCLNHFAANVYVGAPSGNDWFEKQTGGTLDISCSSW  230



>ref|XP_002776803.1| fatty acid desaturase, putative [Perkinsus marinus ATCC 50983]
 gb|EER08619.1| fatty acid desaturase, putative [Perkinsus marinus ATCC 50983]
Length=1028

 Score =   263 bits (672),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 156/453 (34%), Positives = 241/453 (53%), Gaps = 41/453 (9%)
 Frame = -1

Query  1532  TTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQ-DVTDAFLAYHPAIA  1356
             T EE+ KH      W+ ++G VYD+++W+ RHPGG  P+L+ AG  D TD F++ HP   
Sbjct  570   TWEEVSKHASRESCWIVVNGFVYDLTNWLDRHPGGILPILNCAGDVDATDVFVSNHPPKV  629

Query  1355  AHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSL  1176
                +   F    +  + VS  + ++R LVS+    G F+     ++YY   L   + + L
Sbjct  630   VKRILPAFKIGRLEGYTVSPATAEFRKLVSDMEASGWFDTD---LTYYMG-LGVWYALLL  685

Query  1175  YGVVFMESVWAHMGSAVLVGFL----WIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCL  1008
              G ++       + SAVL GFL    W QA + GHD GH  V   K       +  GN L
Sbjct  686   AGAIYS---LVALQSAVLGGFLMGLVWQQAAFTGHDLGHNAVFHDKARDDRWAVFVGNFL  742

Query  1007  TGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISH--------FYEK  852
              GVSI WW+  HN HH+  N +  DPD+Q +P+ A ++K+       H        ++EK
Sbjct  743   GGVSIGWWKATHNVHHVVTNSIPSDPDIQHMPVLAVTSKIALPQDAEHAAKGFWSNYHEK  802

Query  851   PMSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQ-----EILG  687
                 +++AR ++  QH+ +Y VML +AR N+++QS   +   K+    +       E+  
Sbjct  803   YFPLDAVARKVLPRQHYLYYIVML-VARFNLYLQSVLLLTADKRTRLMKGVRSPKWELAA  861

Query  686   LIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFF-----------  540
             L  F +WY +L+S LP+ + R +FV++S  + GV  IQ +L+H A   +           
Sbjct  862   LAGFAIWYVYLVSFLPSSAARFLFVLISHSVAGVLHIQITLSHFAMPTYDVDQRPLKVEA  921

Query  539   AGPLTGK----DWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPF  372
             A  +T K     ++  Q+  +LDI C  W+DWFHGGLQFQ  HH+FPR PR + R++S  
Sbjct  922   ATAITDKVDHPAFLAHQLRTSLDITCPWWLDWFHGGLQFQSAHHVFPRSPRHKARQLSII  981

Query  371   VKQLCEKHGIAYNHASFWAANALMFKSIRDAAL  273
             +K  C+KHG+ YN   F  AN ++ K++ + AL
Sbjct  982   IKDFCKKHGMVYNEVGFVEANRMVLKTLSNVAL  1014



>ref|XP_005647122.1| fatty acid/sphingolipid desaturase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22578.1| fatty acid/sphingolipid desaturase [Coccomyxa subellipsoidea 
C-169]
Length=417

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 146/438 (33%), Positives = 230/438 (53%), Gaps = 35/438 (8%)
 Frame = -1

Query  1550  GTKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAY  1371
              T + +T +ELK H    DLWV+++G+ YD++++ + HPG    L  +AG D ++AF A+
Sbjct  6     ATGRPVTWKELKLHATAEDLWVAVNGRAYDLTEYQHLHPGSALILQHVAGTDASEAFQAF  65

Query  1370  -HPAIAAHHLQRFFNGYYVSDHQV--SEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAAL  1200
              HP  A   + ++  G+  S  +   ++ ++    + S+    GLF          AA L
Sbjct  66    KHPTSARLTMLKYGVGFMESAREKPRTDAAQQLIQVRSKMEAAGLFRVNYWNYVVLAAGL  125

Query  1199  SAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLA  1020
             +  F+  L  V   +  W   G A+L+   W Q   VGHD GH  +++T+ L     +  
Sbjct  126   AVAFIAVLLCV---KERWVVPG-ALLLSLFWQQLALVGHDVGHNQILRTRSLDSMIGI-G  180

Query  1019  GNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSF  840
                  G S+ WW++NHN HH+  N  ++DPD+Q LP FA SN+ FR+ L S FY+  M F
Sbjct  181   ITLFLGASVQWWKYNHNTHHVTPNSSEHDPDIQHLPFFALSNQFFRN-LRSTFYQATMVF  239

Query  839   -NSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWY  663
              N++ + ++S QH+TF P M+L+AR   +  S   +L K +    +  E+   + F+ WY
Sbjct  240   DNAVTKMMISVQHYTFLP-MMLVARFGFYAMSTFHLLAKGRPAIYKPFEVAAFLGFFTWY  298

Query  662   PFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLD  483
               L   LP  +ERI+F V+S    G+                        +  Q+  T +
Sbjct  299   LALCFCLPTWTERILFFVISHACFGI------------------------INLQMAATNN  334

Query  482   IDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANAL  303
             + C  WMDWFHGGLQ+QIEHHL+P +PR  LR  S +V+ +C K GI Y+  +F+ A   
Sbjct  335   VSCPEWMDWFHGGLQYQIEHHLYPDLPRHHLRAASAYVRPMCAKLGIKYHSPTFFQAIGE  394

Query  302   MFKSIRDAALMARDLSPE  249
             +  +++  A  AR+L  E
Sbjct  395   VLGALKVVASQARNLPKE  412



>gb|ACF85518.1| unknown [Zea mays]
Length=194

 Score =   238 bits (606),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 139/195 (71%), Gaps = 3/195 (2%)
 Frame = -1

Query  782  LLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLS  603
            + IARIN+  QS   VL +K++   R  EI G+  FW WYP L++ LPN  ER+ FV+LS
Sbjct  1    MCIARINLLAQSAVFVLTEKRV-PQRLLEIAGVAAFWAWYPLLVACLPNWWERVAFVLLS  59

Query  602  LMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEH  423
              + G+Q +QF LNH +S  + GP  G DW EKQ  GTLDI C PWMDWFHGGLQFQIEH
Sbjct  60   FTICGIQHVQFCLNHFSSDVYVGPPKGNDWFEKQTAGTLDILCPPWMDWFHGGLQFQIEH  119

Query  422  HLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDLS--PE  249
            HLFPR+PRC LRKV+P V+ LC+KHG+ Y+ ASFW AN L +K++R AAL AR  +    
Sbjct  120  HLFPRLPRCHLRKVAPAVRDLCKKHGLTYSAASFWDANVLTWKTLRAAALQARSATGGGG  179

Query  248  KAPKNLVWEALNSFG  204
             APKNLVWEALN+ G
Sbjct  180  GAPKNLVWEALNTHG  194



>gb|AIA24278.1| delta-6 fatty acid desaturase, partial [Isochrysis galbana]
Length=354

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 189/338 (56%), Gaps = 8/338 (2%)
 Frame = -1

Query  1196  AMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAG  1017
             A+F  +LY  +   S  AHM  A ++G  W Q   +GHD GH  V              G
Sbjct  18    ALFTSALYLSLACASPAAHMLGATVMGIFWQQLAGLGHDLGHSGVSHMFYTDMCVGSTIG  77

Query  1016  NCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFN  837
             N L G+S  WW+ +HN HH+ CN V+ DPD+Q LP+FA + K+F    +S ++ K  +F 
Sbjct  78    NALMGISTGWWKRSHNTHHVVCNSVENDPDIQHLPVFAVAAKIFDHPYLSSYHNKVFNFG  137

Query  836   SLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKK-KIFANRAQEILGLIIFWVWYP  660
             ++ RFLV++QH  FYPVM+  AR N+++QSW  +L    +    R  E   L+++  W  
Sbjct  138   AVERFLVAHQHLLFYPVMMF-ARFNLYVQSWTLLLSSSGREVHYRRIEAAALVVYATWVA  196

Query  659   FLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAG---PLTGKDWVEKQIDGT  489
              +  S+P  +E + ++++S  +T +  +Q +++H A   + G        +W   Q+  T
Sbjct  197   AVALSMPTWAETVGWILISHAVTALLHVQITVSHWAMETYHGHGYNDETDEWYITQLKTT  256

Query  488   LDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAAN  309
             +++     +DW H GLQFQIEHHL+PR+PR  LRK    V+ +C KHGI Y+   F+ AN
Sbjct  257   MNVATPECLDWLHIGLQFQIEHHLYPRLPRHNLRKARELVRAVCAKHGIPYHEPGFFEAN  316

Query  308   ALMFKSIRDAALMARDLSPEKAP---KNLVWEALNSFG  204
             AL   ++RDAAL AR    +       + +WEA+N+ G
Sbjct  317   ALTISALRDAALEARKAKRDPGHGFYTSALWEAMNAIG  354



>gb|EIE81042.1| hypothetical protein RO3G_05747 [Rhizopus delemar RA 99-880]
Length=510

 Score =   235 bits (600),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 149/481 (31%), Positives = 233/481 (48%), Gaps = 69/481 (14%)
 Frame = -1

Query  1538  FITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPA-  1362
             FI  E+ +++ K GD       KVY V++++Y+HPGGE  L S  G+DVTD   + HP  
Sbjct  16    FIDEEQFQEYVKRGDCVFIFESKVYKVNNFIYKHPGGEAALRSALGRDVTDEIRSMHPPQ  75

Query  1361  IAAHHLQRFFNGYYVS-------------------------------DHQVSEVSK----  1287
             +    +Q +  G Y+                                D  + E+ K    
Sbjct  76    VYEKMIQLYCIGDYIKTTRPSKGPKEIKRKKKELIASWEGGMSKKAYDDALDEIHKVHSG  135

Query  1286  ------------DY-------RMLVSEFSRMGLFE----KKGHLVSYYAAALSAMFLVSL  1176
                         DY       R L  E    GL+E    K G     Y   LS     +L
Sbjct  136   DLAQDEIDQQDLDYTKIREAYRRLEQEIKDRGLYECNYWKYGEECCRYITLLSLCLWFTL  195

Query  1175  YGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVS  996
              G     S W  +  A  +G  W Q  +  HD+GH ++    ++     ++  N + G+S
Sbjct  196   GGT----SSWHFIAGAAFLGGFWHQLVFTAHDAGHNEITGKSEIDHVIGVIIANFIGGLS  251

Query  995   IWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLV  816
             + WW+ NHN HHI  N  ++DPD+Q LP  A + KLF ++L S +Y++ + F++ A+F V
Sbjct  252   LGWWKDNHNVHHIVTNHPEHDPDIQHLPFMAITTKLF-NNLYSTYYKRVLPFDTAAQFFV  310

Query  815   SYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPN  636
              YQH+ +Y ++L   R N+   S+   LF  K       E  G+  F++W+  LLS +P 
Sbjct  311   RYQHYLYY-LILSFGRFNLHRLSF-LYLFTSKDVRTPKLEWTGITFFFIWFSALLSHVPT  368

Query  635   HSERIMFVVLSLMMTGVQQIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
              + RI ++ +S M+T    +Q +L+H   S+   GP   + +  K +  T+D+DC  W+D
Sbjct  369   WNLRIAYLFVSYMLTFPLHVQITLSHFGMSTEDKGP--NEPFPAKMLRTTMDVDCPVWLD  426

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQ+Q  HHLFPR+PR  LR   P V+Q C++ G+ Y   +F   N ++  +++  
Sbjct  427   WFHGGLQYQAVHHLFPRIPRHNLRACVPLVRQFCDEVGLHYYMYNFSTGNGVVLGALKSV  486

Query  278   A  276
             A
Sbjct  487   A  487



>gb|ACE06759.1| delta-6 fatty acid desaturase [Mucor sp. EIM-10]
Length=523

 Score =   234 bits (597),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/486 (29%), Positives = 238/486 (49%), Gaps = 67/486 (14%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +   +T E+ ++  K GD       KVY V++++ +HPGGE  L S  G+DVTD     H
Sbjct  18    SSNIVTEEQFQELIKQGDSVFIYEQKVYRVNNFLAKHPGGEAALRSALGRDVTDEVRTMH  77

Query  1367  -PAIAAHHLQRFFNGYYVSD----------------------------------------  1311
              P +    +  +  G Y+ D                                        
Sbjct  78    PPQVYEKMINLYCIGDYMPDVIRPASMKQQHTFTKPTEDKPVLTATWEGGFTVQAYDDAI  137

Query  1310  -----HQVSEVSKD---------------YRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
                  H   ++ KD               YR L +E  + GLF+      +      + +
Sbjct  138   QDLHKHHAHDLRKDAVLQKDLNGDQIRMAYRKLEAELYKKGLFKCNYWKYAREGCRYTLL  197

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               +SL+  +     W +M  AV +   W Q  +  HD+GH ++    ++     ++  N 
Sbjct  198   IFLSLWFTLNGTETWHYMAGAVFMAMFWHQLVFTAHDAGHNEITGKSEIDHVIGVIIANF  257

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             + G+S+ WW+ NHN HHI  N  ++DPD+Q LP  A + K F +++ S +Y++ + F++ 
Sbjct  258   IGGLSLGWWKDNHNVHHIVTNHPEHDPDIQHLPFMAITTKFF-NNIYSTYYKRVLPFDAA  316

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             +RF + +QH+ +Y ++L   R N+   S+  +L  K +   R  E++G+  F+VW+  LL
Sbjct  317   SRFFIRHQHYLYY-LILSFGRFNLHRLSFAYLLTCKNV-RTRTLELVGISFFFVWFGALL  374

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTLDIDC  474
             S+LP  + RI ++++S M+T    +Q +L+H   S+   GP   + +  K +  T+D+DC
Sbjct  375   STLPTWNIRIAYIMVSYMLTFPLHVQITLSHFGMSTEDRGP--DEPFPAKMLRTTMDVDC  432

Query  473   SPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFK  294
               W+DWFHGGLQ+Q  HHLFPR+PR  LR+  P VK+ C++ G+ Y   +F   N ++  
Sbjct  433   PEWLDWFHGGLQYQAVHHLFPRLPRHNLRQCVPLVKKFCDEVGLHYYMYNFSTGNGVVLG  492

Query  293   SIRDAA  276
             +++  A
Sbjct  493   TLKSVA  498



>ref|XP_005783065.1| hypothetical protein EMIHUDRAFT_72565, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD30636.1| hypothetical protein EMIHUDRAFT_72565, partial [Emiliania huxleyi 
CCMP1516]
Length=481

 Score =   233 bits (593),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 144/439 (33%), Positives = 225/439 (51%), Gaps = 49/439 (11%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T +  T  E+ KH   GD W+ +  +VYDVS ++  HPGG  P+L+LAG+D TD F  YH
Sbjct  5     TLREYTLAEVGKHCSRGDAWIVVDERVYDVSRFIDAHPGGVGPILNLAGKDCTDVFANYH  64

Query  1367  PA--IAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSA  1194
              A  + A H+                   D+R +  E  R GLFE          A    
Sbjct  65    AARIVVAPHV------------------ADFRRIRQELLRRGLFETDSRFYLKMLAWHCT  106

Query  1193  MFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGN  1014
             ++L ++Y  +  +S  AHM  A L+G  W Q   +GHD GH  V  + +       L G+
Sbjct  107   LWLCAMYLSLGCDSCGAHMLGAALMGVFWQQLAGIGHDLGHSGVTHSFRRDH----LVGS  162

Query  1013  CLT---GVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLI-SHFYEKPM  846
              L+   G+S+ WW+ +HN HH+ CN V++DP++Q +P+ A ++K+FR       ++ K +
Sbjct  163   LLSAFMGLSVGWWKSDHNTHHVVCNAVEHDPNIQHMPMLAITDKVFRRPRFWDTYHRKWV  222

Query  845   SFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVW  666
               +  A +LVS+QH  FYP+M L  R N++ Q    +L +      R  E+ G+ +++ W
Sbjct  223   GMDDAAHWLVSHQHLFFYPLMAL-GRWNLYAQGLIYLLTQPDKTHFRKTELAGIAVYFGW  281

Query  665   YPFLLSSLPNHSERIMFVVLS---LMMTGVQQIQFSLNHLASSFFAG-PLTGKD--WVEK  504
                   S+P+ +E + +V+LS   +  +G+  +Q  L+H +   + G    G D  W   
Sbjct  282   VLGTALSMPSWAESVGWVMLSHACMDESGILHVQIVLSHWSMHTYEGRAYNGADDEWYVT  341

Query  503   QIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKH--------  348
              +  T+++   PW+DW H GLQFQIEHHLFPR+PR  LR     V+++ E H        
Sbjct  342   TMRTTMNVATPPWLDWVHIGLQFQIEHHLFPRLPRHNLRLARDMVREVVEAHFPAGSAEC  401

Query  347   ------GIAYNHASFWAAN  309
                   G+AY+   F+A  
Sbjct  402   KRLFPLGVAYHEPGFFAGE  420



>emb|CEG79161.1| Putative Delta-6 desaturase [Rhizopus microsporus]
Length=515

 Score =   231 bits (590),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 146/490 (30%), Positives = 240/490 (49%), Gaps = 78/490 (16%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T+ FI+ E+ +++ K GD       KVY V++++ +HPGGE  L S  G+DVTD   + H
Sbjct  13    TRIFISEEQFQEYIKRGDAVFIFESKVYKVNNFLAKHPGGEASLRSALGRDVTDEIRSLH  72

Query  1367  PAIAAHHLQRFFNGYYVSD--------------HQVSEVSKD------------------  1284
             P       ++  + YY+ D              H+++  +K+                  
Sbjct  73    PPKV---YEKMIHLYYIGDYLDIKTTETTTQGPHKITRPNKELTATWEGGMTIKAFDDAI  129

Query  1283  -----------------------------YRMLVSEFSRMGLFE----KKGHLVSYYAAA  1203
                                          YR L  E    GLF+    K G     Y   
Sbjct  130   DELHKSHFEDLTQDSVDQRDLNRVKVREAYRRLEQEIKARGLFKCNYWKYGEECCRY---  186

Query  1202  LSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLL  1023
             ++ +FL   + +   ES     G+A L GF W Q  +  HD+GH  +    ++     ++
Sbjct  187   ITLLFLSLWFTLRGTESWHFIAGAAFLAGF-WHQLVFTAHDAGHNGITGRSEIDHIIGVI  245

Query  1022  AGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMS  843
               + + G+SI WW+ NHN HHI  N  ++DPD+Q LP  A + K F +++ S +Y++ + 
Sbjct  246   IADFIGGLSIGWWKDNHNVHHIVTNHPEHDPDIQHLPFLAITTKFF-NNVYSTYYKRVLP  304

Query  842   FNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWY  663
             F++ A+F V YQH+ +Y ++L   R N+   S+   LF  K    R  E++G+  F++W+
Sbjct  305   FDAAAKFFVRYQHYLYY-LILSFGRFNLHRLSF-VYLFTAKNVRTRRLELIGITFFFIWF  362

Query  662   PFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTL  486
               LLS +P    RI ++ +S M+T    +Q +L+H   S+   GP   + +  K +  T+
Sbjct  363   SALLSYVPTWKLRIAYLFVSYMLTFPLHVQITLSHFGMSTEDKGP--NEPFAAKMLRTTM  420

Query  485   DIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANA  306
             D+DC  W+DWFHGGLQ+Q  HHLFPR+PR  LR   P V++ C++ G+ Y   +F   N 
Sbjct  421   DVDCPEWLDWFHGGLQYQAVHHLFPRIPRHNLRACVPLVRKFCDEVGLHYYMYNFSTGNG  480

Query  305   LMFKSIRDAA  276
             ++  +++  A
Sbjct  481   VVLGALKSVA  490



>emb|CEI98987.1| Putative Delta-6 desaturase [Rhizopus microsporus]
Length=515

 Score =   231 bits (588),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 145/490 (30%), Positives = 239/490 (49%), Gaps = 78/490 (16%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T+ FI+ E+ +++ K GD       KVY V++++ +HPGGE  L S  G+DVTD   + H
Sbjct  13    TRIFISEEQFQEYVKRGDAVFIFESKVYKVNNFLAKHPGGEASLRSALGRDVTDEVRSLH  72

Query  1367  PAIAAHHLQRFFNGYYVSD--------------HQVSEVSKD------------------  1284
             P       ++  + YY+ D              H+++  +K+                  
Sbjct  73    PPKV---YEKMIHLYYIGDYLDIKTTESTAQEPHKITRSNKELAATWEGGMTIKAFDDAI  129

Query  1283  -----------------------------YRMLVSEFSRMGLFE----KKGHLVSYYAAA  1203
                                          YR L  E    GLF+    K G     Y   
Sbjct  130   DELHKSHFEDLTQDSVDQRDLDRDKVREAYRRLEQEIKARGLFKCNYWKYGEECCRY---  186

Query  1202  LSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLL  1023
             ++ +FL   + +   ES     G+A L GF W Q  +  HD+GH  +    ++     ++
Sbjct  187   ITLLFLALWFTLRGTESWHFIAGAAFLAGF-WHQLVFTAHDAGHNGITGKSEIDHIIGVI  245

Query  1022  AGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMS  843
               + + G+SI WW+ NHN HHI  N  ++DPD+Q LP  A + K F +++ S +Y++ + 
Sbjct  246   IADFIGGLSIGWWKDNHNVHHIVTNHPEHDPDIQHLPFLAITTKFF-NNVYSTYYKRVLP  304

Query  842   FNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWY  663
             F++ A+F V YQH+ +Y ++L   R N+   S+   LF       R  E++G+  F++W+
Sbjct  305   FDAAAKFFVRYQHYLYY-LILSFGRFNLHRLSF-VYLFTANNVRTRKLELIGITFFFIWF  362

Query  662   PFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTL  486
               LLS +P    RI ++ +S M+T    +Q +L+H   S+   GP   + +  K +  T+
Sbjct  363   SALLSYVPTWKLRIAYLFVSYMLTFPLHVQITLSHFGMSTEDKGP--NEPFAAKMLRTTM  420

Query  485   DIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANA  306
             D+DC  W+DWFHGGLQ+Q  HHLFPR+PR  LR   P V++ C++ G+ Y   +F   N 
Sbjct  421   DVDCPEWLDWFHGGLQYQAVHHLFPRIPRHNLRACVPLVRKFCDEVGLHYYMYNFSTGNG  480

Query  305   LMFKSIRDAA  276
             ++  +++  A
Sbjct  481   VVLGALKSVA  490



>gb|KDP28546.1| hypothetical protein JCGZ_14317 [Jatropha curcas]
Length=212

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 148/200 (74%), Gaps = 8/200 (4%)
 Frame = -1

Query  1544  KKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHP  1365
             +++IT+E+LK+H+K GDLW+SI GKVYDVSDWV  HPGG+ PLL+L GQDVTDAF+AYHP
Sbjct  5     RRYITSEQLKQHNKSGDLWISIQGKVYDVSDWVKEHPGGDTPLLNLGGQDVTDAFIAYHP  64

Query  1364  AIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFL  1185
               A  +L + F GYY+ D +VS+VSKDYR L S+F+++GLF+KKGH+  Y   +++ +F 
Sbjct  65    GTAWKYLDKLFTGYYLEDFKVSDVSKDYRKLYSDFAKLGLFDKKGHIALYSMTSVAVLFC  124

Query  1184  VSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLS-RAAQLLAGNCL  1008
             +++YGV+  +S+WAHMGSAVL+G LWIQ+ +VGHDSGHY  ++   +  R  Q+  G+ +
Sbjct  125   IAVYGVLCCQSIWAHMGSAVLLGILWIQSAYVGHDSGHYQDLQVGMIGLRNRQV--GHWI  182

Query  1007  TGVSIWWWRWNHNAHHIACN  948
               V + W       H +AC+
Sbjct  183   FHVHLGW-----TGHMVACS  197



>emb|CEG69766.1| Putative Delta-6 desaturase [Rhizopus microsporus]
Length=515

 Score =   230 bits (587),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 145/490 (30%), Positives = 239/490 (49%), Gaps = 78/490 (16%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             T+ FI+ E+ +++ K GD       KVY V++++ +HPGGE  L S  G+DVTD   + H
Sbjct  13    TRIFISEEQFQEYVKRGDAVFIFESKVYKVNNFLAKHPGGEASLRSALGRDVTDEVRSLH  72

Query  1367  PAIAAHHLQRFFNGYYVSD--------------HQVSEVSKD------------------  1284
             P       ++  + YY+ D              H+++  +K+                  
Sbjct  73    PPKV---YEKMIHLYYIGDYLDIKTTESTAQEPHKITRSNKELAATWEGGMTIKAFDNAI  129

Query  1283  -----------------------------YRMLVSEFSRMGLFE----KKGHLVSYYAAA  1203
                                          YR L  E    GLF+    K G     Y   
Sbjct  130   DELHKSHFEDLTQDSVDQRDLDRDKVREAYRRLEQEIKARGLFKCNYWKYGEECCRY---  186

Query  1202  LSAMFLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLL  1023
             ++ +FL   + +   ES     G+A L GF W Q  +  HD+GH  +    ++     ++
Sbjct  187   ITLLFLALWFTLRGTESWHFIAGAAFLAGF-WHQLVFTAHDAGHNGITGKSEIDHIIGVI  245

Query  1022  AGNCLTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMS  843
               + + G+SI WW+ NHN HHI  N  ++DPD+Q LP  A + K F +++ S +Y++ + 
Sbjct  246   IADFIGGLSIGWWKDNHNVHHIVTNHPEHDPDIQHLPFLAITTKFF-NNVYSTYYKRVLP  304

Query  842   FNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWY  663
             F++ A+F V YQH+ +Y ++L   R N+   S+   LF       R  E++G+  F++W+
Sbjct  305   FDAAAKFFVRYQHYLYY-LILSFGRFNLHRLSF-IYLFTANNVRTRKLELIGITFFFIWF  362

Query  662   PFLLSSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTL  486
               LLS +P    RI ++ +S M+T    +Q +L+H   S+   GP   + +  K +  T+
Sbjct  363   SALLSYVPTWKLRIAYLFVSYMLTFPLHVQITLSHFGMSTEDKGP--NEPFAAKMLRTTM  420

Query  485   DIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANA  306
             D+DC  W+DWFHGGLQ+Q  HHLFPR+PR  LR   P V++ C++ G+ Y   +F   N 
Sbjct  421   DVDCPEWLDWFHGGLQYQAVHHLFPRIPRHNLRACVPLVRKFCDEVGLHYYMYNFSTGNG  480

Query  305   LMFKSIRDAA  276
             ++  +++  A
Sbjct  481   VVLGALKSVA  490



>gb|ABQ63083.1| delta-6-fatty acid desaturase [Rhizomucor pusillus]
Length=522

 Score =   227 bits (579),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 134/481 (28%), Positives = 235/481 (49%), Gaps = 66/481 (14%)
 Frame = -1

Query  1535  ITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH-PAI  1359
             +T E+ ++  K GD       KVY V++++ +HPGGE  L S  G+DVTD     H P +
Sbjct  22    VTEEKFQELIKQGDSLFIYEQKVYKVNNFMAKHPGGEAALKSALGRDVTDEIRTMHPPKV  81

Query  1358  AAHHLQRFFNGYYVSD--------------------------------------------  1311
                 +  +  G Y+ D                                            
Sbjct  82    YEKMINLYCIGDYMPDVIRPASMKQHQTFTKKEEKPVLTATWEGGLTVQAFDDAIEDLHK  141

Query  1310  HQVSEVSKD---------------YRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSL  1176
             H   +++KD               YR L ++    GLF+      +  +   +    +SL
Sbjct  142   HHSHDLTKDAVLQKDLNGDQIRDAYRKLEADLYERGLFKCNYWKYARESCRYTLFLFLSL  201

Query  1175  YGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVS  996
             +  +     W +M  A+ +   W Q  +  HD+GH ++    ++     ++  + + G+S
Sbjct  202   WFTLKGTETWHYMTGAMFLAMFWHQLVFTAHDAGHNEITGKSEIDHIIGVIIADFIGGLS  261

Query  995   IWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLV  816
             + WW+ NHN HHI  N  ++DPD+Q +P  A + K F +++ S +Y + + F++ +RF +
Sbjct  262   LGWWKDNHNVHHIVTNHPEHDPDIQHVPFLAITTKFF-NNIYSTYYNRVLPFDAASRFFI  320

Query  815   SYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPN  636
              YQH+ +Y ++L   R N+   S+  +L  K +   R  E++G+  F+ W+  LLS+LP 
Sbjct  321   KYQHYLYY-LILSFGRFNLHRLSFAYLLTCKNV-RTRTLELVGIAFFFTWFGSLLSTLPT  378

Query  635   HSERIMFVVLSLMMTGVQQIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
              + RI ++++S M+T    +Q +L+H   S+   GP   + +  K +  T+D+DC  W+D
Sbjct  379   WNIRIAYIMVSYMLTFPLHVQITLSHFGMSTEDRGP--NEPFPAKMLRTTMDVDCPEWLD  436

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDA  279
             WFHGGLQ+Q  HHLFPR+PR  LR+  P V++ C++ G+ Y   +F   N ++  +++  
Sbjct  437   WFHGGLQYQAVHHLFPRLPRHNLRQCVPLVRKFCDEVGLHYYMYNFSTGNGVVLGTLKSV  496

Query  278   A  276
             A
Sbjct  497   A  497



>emb|CDS10679.1| hypothetical protein LRAMOSA11165 [Absidia idahoensis var. thermophila]
Length=515

 Score =   224 bits (570),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 121/357 (34%), Positives = 194/357 (54%), Gaps = 9/357 (3%)
 Frame = -1

Query  1301  SEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVL  1122
             ++V   YR L  E    GLFE   +              +SL+  +     W H+  AV 
Sbjct  155   TQVRVAYRRLEQELLDRGLFECNYYRYGKECCRYVLFLYLSLWFTLRGTETWQHVLGAVF  214

Query  1121  VGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVV  942
             +  LW Q  +  HD+GH ++    ++     ++  + + G+S+ WW+ NHN HHI  N  
Sbjct  215   MACLWHQLVFTAHDAGHNEITGRVEIDHLIGVIIADFIGGLSLGWWKNNHNVHHIVTNHP  274

Query  941   DYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARIN  762
             ++DPD+Q LP FA + + F  ++ S +Y++   F++ ARF V YQH  +Y ++LL  R N
Sbjct  275   EHDPDIQHLPFFAITTRFF-DNIYSTYYKRVFEFDAPARFFVRYQHHLYY-IVLLFGRFN  332

Query  761   MFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGVQ  582
             +   S+  + F K++  NR  E+ G+  F++WY  LL+ LP+ S  I +V +S M+T   
Sbjct  333   LHRLSFLYLFFDKEV-RNRRLELFGITCFFIWYGALLAQLPSWSMAIAYVFISYMLTFPL  391

Query  581   QIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPRM  405
              +Q +L+H   S+   GP   + +  KQ+  T+D+DC  W DWFHGGLQ+Q  HHLFPR+
Sbjct  392   HVQITLSHFGMSTTDFGP--HEPFPVKQLRTTMDVDCPEWFDWFHGGLQYQAVHHLFPRL  449

Query  404   PRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALM---FKSIRDAALMARDLSPEKA  243
             PR  LR+  P V++ C++ G+ Y    F   N ++    KS+ D   +  D++   A
Sbjct  450   PRHNLRQCVPLVRRFCQETGLHYYMYDFTTGNGVILGALKSVADQVHLLNDVAKYNA  506



>emb|CDS10725.1| hypothetical protein LRAMOSA11211 [Absidia idahoensis var. thermophila]
Length=517

 Score =   221 bits (563),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 196/358 (55%), Gaps = 9/358 (3%)
 Frame = -1

Query  1304  VSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAV  1125
             V++V   YR L  +    GLF+   +              ++L+  +     W H+  AV
Sbjct  156   VTQVRVAYRRLEQDLLDRGLFQCNYYRYGKECCRYVLFLYLTLWFTLRGTETWQHVLGAV  215

Query  1124  LVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNV  945
              +  LW Q  +  HD+GH ++    ++     +   + + G+S+ WW+ NHN HHIA N 
Sbjct  216   FMACLWHQLAFTVHDAGHNEITGRVEIDHLIGVFIADFIGGLSVGWWKNNHNVHHIATNS  275

Query  944   VDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARI  765
              ++DPD+Q LP FA + + F +++ S +Y++   F++ ARF V YQH  +Y ++LL  R 
Sbjct  276   PEHDPDIQHLPFFAITTRFF-NNIYSTYYKRVFEFDAPARFFVRYQHHLYY-LILLFGRF  333

Query  764   NMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLPNHSERIMFVVLSLMMTGV  585
             N+   S   + F  ++  NR  E+ G++ F VWY  LL+ LP+ S  I ++ +S M+T  
Sbjct  334   NLQRLSLAYLFFHPQV-RNRLLELSGIMFFLVWYSALLAQLPSWSMVIAYIFISYMLTFP  392

Query  584   QQIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHLFPR  408
               +Q +L+H   S+   GP   + +  KQ+  T+D+DC  W+DWFHGGLQ+Q+ HHLFPR
Sbjct  393   LHVQITLSHFGMSTTDFGP--SEPFPVKQLRTTMDVDCPEWIDWFHGGLQYQVVHHLFPR  450

Query  407   MPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALM---FKSIRDAALMARDLSPEKA  243
             +PR  LR+  P V++ C++ G+ Y    F   N ++    KS+ D   +  D++   A
Sbjct  451   LPRHNLRQCVPLVRRFCQETGLRYYMYDFTTGNGVILGALKSVADQVHLFNDVAKYNA  508



>ref|XP_003851524.1| hypothetical protein MYCGRDRAFT_73189 [Zymoseptoria tritici IPO323]
 gb|EGP86500.1| hypothetical protein MYCGRDRAFT_73189 [Zymoseptoria tritici IPO323]
Length=559

 Score =   221 bits (562),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/363 (35%), Positives = 198/363 (55%), Gaps = 19/363 (5%)
 Frame = -1

Query  1316  SDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGV--VFMESVWA  1143
             +D Q + V+K Y++L       GL+       +Y A A+ A+  ++L  +   F+ S W 
Sbjct  192   ADTQNTIVNK-YKLLDQRLRAEGLYN-----CNYRAYAIEAVRYLTLGALSFCFLRSGWY  245

Query  1142  HMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAH  963
              + SAV +G LW Q  +  HD+GH  +  + ++     +   N L G+S  WW+ NHN H
Sbjct  246   AL-SAVFLGMLWHQLVFTVHDAGHMGITHSFQVDSCIGIFIANFLGGLSCCWWKRNHNVH  304

Query  962   HIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVM  783
             HI  N  ++DPD+Q +P FA S++ F SSL S +Y++PM  +  AR  + YQH+ +YP+ 
Sbjct  305   HIVTNSAEHDPDIQHMPFFAISHR-FLSSLYSTYYDRPMPLDRFARKALQYQHYLYYPI-  362

Query  782   LLIARINMFIQSWKTVLF-----KKKIFANRAQEILGLIIFWVWYPFLL--SSLPNHSER  624
             L   R N+++ SW+ +       K   + +R  E+ G   FW W+ +L+   S+P    R
Sbjct  363   LAFGRFNLYVLSWQHIFLGEGSRKGPSWWHRYLEMAGQAFFWFWFGYLVVYRSIPTAGAR  422

Query  623   IMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGG  444
             IMFV++S   T    +Q +L+H A S  A     + + ++ +  T+D+DC  W+D+ HGG
Sbjct  423   IMFVLISHATTMPVHLQITLSHFAMST-ADLGVAESFPQRMLRTTMDVDCPAWLDFIHGG  481

Query  443   LQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMAR  264
             LQFQ  HHLFPRMPR  LR+  P VK+ CE+  I Y    F   N  +   + + A   R
Sbjct  482   LQFQAVHHLFPRMPRHNLRQAQPLVKEFCEEVEIPYAIYGFREGNGKVISRLEEVAQQVR  541

Query  263   DLS  255
              L+
Sbjct  542   VLA  544



>ref|XP_001246122.1| hypothetical protein CIMG_05563 [Coccidioides immitis RS]
 gb|EAS30323.2| fatty acid desaturase [Coccidioides immitis RS]
Length=560

 Score =   220 bits (560),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 128/368 (35%), Positives = 200/368 (54%), Gaps = 17/368 (5%)
 Frame = -1

Query  1301  SEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVL  1122
              EV   YR L  +    GL++     VSY    +    L  L+ + F+   +  + SAV 
Sbjct  194   DEVVSKYRQLDEKLRSEGLYQCP--YVSYAVEFVRYSILFVLF-LTFLHYSYYTL-SAVF  249

Query  1121  VGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVV  942
             +G LW    +  HD+GH  +           +   + L G+S+ WW+ NHN HHIA N  
Sbjct  250   LGLLWHLLAFTVHDAGHLSITHGFHTDSCIGIFVADFLGGLSVGWWKRNHNVHHIATNSP  309

Query  941   DYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARIN  762
             ++DPD+Q +P FA S + F +SL S +Y++ M F+++ARF V +QH+ +YP+ LL+ R N
Sbjct  310   EHDPDIQHVPFFAISPRFF-TSLRSSYYDRDMKFDAIARFFVKHQHYLYYPI-LLMGRFN  367

Query  761   MFIQSWKTVL------FKKKIFANRAQEILGLIIFWVWYPF--LLSSLPNHSERIMFVVL  606
             ++  +W  +L       K   + +R  E+ G + FW W+ +  L  S+P  S RI F+++
Sbjct  368   LYRLAWSYLLDPAQAPRKGSAWWHRYLEMTGQVFFWYWFGYRTLYLSIPTWSSRIAFLLI  427

Query  605   SLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIE  426
             S M+T    +Q +L+H A S  A     + + +K +  T+D+DC PW+D+ HGGLQFQ+ 
Sbjct  428   SHMVTAPLHVQLTLSHFAMSS-ADVGIHESFAQKMVRTTMDVDCPPWLDFVHGGLQFQVV  486

Query  425   HHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMAR--DLSP  252
             HHLFPR+PR  LR+   +VK+ C+  GI Y    F   N  +   + + A   R  D   
Sbjct  487   HHLFPRLPRHNLRRAQKYVKEFCDDVGIPYVIFGFTQGNKEVISRLGEVARQLRVLDECR  546

Query  251   EKAPKNLV  228
             + A KNL+
Sbjct  547   KVAAKNLI  554



>ref|XP_003083258.1| S68358 Delta8 sphingolipid desaturase (EC 1.14.99.-) (ISS), partial 
[Ostreococcus tauri]
Length=473

 Score =   218 bits (554),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 215/454 (47%), Gaps = 54/454 (12%)
 Frame = -1

Query  1496  DLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYHPAIAA--HHLQRFFNGY  1323
             D W+ + G+VYDV+ WV +HPGG   L   AG+D TDAF AYH         L+    G 
Sbjct  48    DCWMIVRGEVYDVTAWVEKHPGGRTVLEQYAGRDATDAFTAYHGGERKVLARLRTMRVGT  107

Query  1322  YVSDHQVSE------------VSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVS  1179
                    +             +  D++ML S FS       +  LV ++  AL+ +    
Sbjct  108   VAEGETPTPTHLKGFREMREMMEGDHKMLRSSFSDYAFVLVR--LVIFFGGALACVLAP-  164

Query  1178  LYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGV  999
               G  F      HM  AV +G  W Q+ ++GHD+GH  +   +          GN   GV
Sbjct  165   --GAGFK----THMLGAVSLGLFWQQSMFIGHDAGHSSITFNRSSDAMIGWTVGNLFNGV  218

Query  998   SIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFL  819
              I WW   HN HH ACN ++ DPD+Q +P+ A S K F+ S+ S ++ + M+++ +AR L
Sbjct  219   GIAWWMATHNVHHCACNSLECDPDIQHMPVLAVSEKYFK-SVYSLYHRRRMTYDRVARLL  277

Query  818   VSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLLSSLP  639
             V YQH TFYP+M  +ARIN+++Q+    LFK K   NR  E L L I             
Sbjct  278   VRYQHLTFYPIM-AVARINLYLQTL-IFLFKAKRVRNRGMEFLTLGI-------------  322

Query  638   NHSERIMFVVLSLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMD  459
               S  I+  +      G       L+H +   F G     +WV+ Q+ GT+DI+C  W+D
Sbjct  323   GQSGTILLSLAR--RRGDHPRPDLLSHFSRDVFEGRPENDEWVKMQLSGTMDIECPRWLD  380

Query  458   WFHGGLQFQIEHHLFPRMPRCQLRK---VSPFVKQLCEKHGIAYNHASFWAANALMFKSI  288
             WFHGGLQFQ +    PR  R  LR    ++   +++  +     ++A          ++ 
Sbjct  381   WFHGGLQFQTQASRVPRDRRQTLRGKEWITVTFRRVLGRQSRGVSNA----------QAR  430

Query  287   RDAALMARDLSPEKAPKNLVWEALNSFG*RRHPP  186
             R+A  M   L    AP +LV E   +   RR+ P
Sbjct  431   REAIQMGAALLGGDAPLSLVPEPPQASSLRRNFP  464



>ref|XP_001555356.1| hypothetical protein BC1G_06061 [Botrytis cinerea B05.10]
Length=542

 Score =   218 bits (556),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/353 (36%), Positives = 190/353 (54%), Gaps = 12/353 (3%)
 Frame = -1

Query  1301  SEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVL  1122
             +E+   ++ L+++    GL++ K  L +Y    L    L SL  +VF+   W +  SA  
Sbjct  178   TELETRFQALIAKLEDEGLYDSK--LSAYITEILRCTILFSL-SMVFLRIEW-YAASAAF  233

Query  1121  VGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVV  942
             +G  W Q     HD+GH  V     +      +  N   G+SI WW+ NHN HHI  N  
Sbjct  234   LGMFWHQIVATAHDAGHLAVTHDYNIDFLIGGVVLNFCGGLSIGWWKRNHNIHHIVTNSP  293

Query  941   DYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARIN  762
              +D D+Q+LP  A S  +F  SL S   E  M +N  A+F+V  Q WT+Y  +L +AR N
Sbjct  294   THDQDLQILPFIAIS-PVFFDSLYSTASECIMHYNWFAKFMVPKQAWTYY-FLLSVARFN  351

Query  761   MFIQSWKTVLFKKKIFANRAQ---EILGLIIFWVWYPFLL--SSLPNHSERIMFVVLSLM  597
             ++  +W  +L       +R Q   E++G I FW W+ +L+   S+P  S+RI+F ++  M
Sbjct  352   LYYLAWDFILRDLGTKLHRKQRIFELVGQIFFWTWFGYLIVYRSIPTISQRIIFCLICHM  411

Query  596   MTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHL  417
             +T    +Q +++H + S        + W+++    T+D+DC  WMDWFHGGLQFQ+ HHL
Sbjct  412   ITLPLHLQLTVSHFSMSTEESE-PSEHWIQRMFRTTMDVDCPTWMDWFHGGLQFQVTHHL  470

Query  416   FPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDL  258
             FPRMPR  LRK S +VK+ C + G+ Y    F  +N  M   + + A  AR L
Sbjct  471   FPRMPRHNLRKASGYVKEFCAETGLKYEVYGFGESNGRMLDRLAEVARQARYL  523



>gb|EFW17362.1| delta-6 fatty acid desaturase [Coccidioides posadasii str. Silveira]
Length=560

 Score =   219 bits (557),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/368 (34%), Positives = 198/368 (54%), Gaps = 17/368 (5%)
 Frame = -1

Query  1301  SEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVL  1122
              EV   YR L  +    GL++        YA       ++ +  + F+   +  + SAV 
Sbjct  194   DEVVSKYRQLDEKLRSEGLYQCP---YGSYAVEFVRYSILFVLFLTFLHYSYYTL-SAVF  249

Query  1121  VGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVV  942
             +G LW    +  HD+GH  +           +   + L G+S+ WW+ NHN HHIA N  
Sbjct  250   LGLLWHLLAFTVHDAGHLSITHGFHTDSCIGIFVADFLGGLSVGWWKRNHNVHHIATNSP  309

Query  941   DYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARIN  762
             ++DPD+Q +P FA S + F SSL S +Y++ M F+++ARF V +QH+ +YP+ LL+ R N
Sbjct  310   EHDPDIQHVPFFAISPRFF-SSLRSSYYDRDMKFDAIARFFVKHQHYLYYPI-LLMGRFN  367

Query  761   MFIQSWKTVL------FKKKIFANRAQEILGLIIFWVWYPF--LLSSLPNHSERIMFVVL  606
             ++  +W  +L       K   + +R  E+ G + FW W+ +  L  S+P  S RI F+++
Sbjct  368   LYRLAWSYLLDPAQAPRKGSAWWHRYLEMTGQVFFWYWFGYRTLYLSIPTWSSRIAFLLI  427

Query  605   SLMMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIE  426
             S M+T    +Q +L+H A S  A     + + +K +  T+D+DC PW+D+ HGGLQFQ+ 
Sbjct  428   SHMVTAPLHVQLTLSHFAMSS-ADVGIHESFAQKMVRTTMDVDCPPWLDFVHGGLQFQVV  486

Query  425   HHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMAR--DLSP  252
             HHLFPR+PR  LR+   +VK+ C+  GI Y    F   N  +   + + A   R  D   
Sbjct  487   HHLFPRLPRHNLRRAQKYVKEFCDDVGIPYVIFGFTQGNKEVISRLGEVARQLRVLDECR  546

Query  251   EKAPKNLV  228
             + A KNL+
Sbjct  547   KVAAKNLI  554



>emb|CCD54490.1| similar to fatty acid desaturase [Botrytis cinerea T4]
 gb|EMR88253.1| putative fatty acid desaturase protein [Botrytis cinerea BcDW1]
Length=545

 Score =   218 bits (556),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/353 (36%), Positives = 190/353 (54%), Gaps = 12/353 (3%)
 Frame = -1

Query  1301  SEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVL  1122
             +E+   ++ L+++    GL++ K  L +Y    L    L SL  +VF+   W +  SA  
Sbjct  181   TELETRFQALIAKLEDEGLYDSK--LSAYITEILRCTILFSL-SMVFLRMEW-YATSAAF  236

Query  1121  VGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVV  942
             +G  W Q     HD+GH  V     +      +  N   G+SI WW+ NHN HHI  N  
Sbjct  237   LGMFWHQIVATAHDAGHLAVTHDYNIDFLIGGVVLNFCGGLSIGWWKRNHNIHHIVTNSP  296

Query  941   DYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARIN  762
              +D D+Q+LP  A S  +F  SL S   E  M +N  A+F+V  Q WT+Y  +L +AR N
Sbjct  297   THDQDLQILPFIAIS-PVFFDSLYSTASECIMHYNWFAKFMVPKQAWTYY-FLLSVARFN  354

Query  761   MFIQSWKTVLFKKKIFANRAQ---EILGLIIFWVWYPFLL--SSLPNHSERIMFVVLSLM  597
             ++  +W  +L       +R Q   E++G I FW W+ +L+   S+P  S+RI+F ++  M
Sbjct  355   LYYLAWDFILRDLGTKLHRKQRIFELVGQIFFWTWFGYLIVYRSIPTISQRIIFCLICHM  414

Query  596   MTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHL  417
             +T    +Q +++H + S        + W+++    T+D+DC  WMDWFHGGLQFQ+ HHL
Sbjct  415   ITLPLHLQLTVSHFSMSTEESE-PSEHWIQRMFRTTMDVDCPTWMDWFHGGLQFQVTHHL  473

Query  416   FPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDL  258
             FPRMPR  LRK S +VK+ C + G+ Y    F  +N  M   + + A  AR L
Sbjct  474   FPRMPRHNLRKASGYVKEFCAETGLKYEVYGFGESNGRMLDRLAEVARQARYL  526



>gb|AEU04700.1| fatty acid delta-6-desaturase [Lobosphaera incisa]
Length=480

 Score =   215 bits (548),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 141/435 (32%), Positives = 213/435 (49%), Gaps = 24/435 (6%)
 Frame = -1

Query  1547  TKKFITTEELKKHDKPGDLWVSIHGKVYDVSDWVYRHPGGEYPLLSLAGQDVTDAFLAYH  1368
             +K+ +T EEL +H+ P D W+ I  KVYDVS W  +HPGG + + + AG+D TD F  +H
Sbjct  62    SKQQVTLEELAQHNTPEDCWLVIKNKVYDVSGWGPQHPGG-HVIYTYAGKDATDVFACFH  120

Query  1367  PAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMF  1188
                    L+ F  G  V +  +  + KD+R L +   + GLF        Y  A+  ++ 
Sbjct  121   AQTTWSQLRPFCIGDIVEEEPMPALLKDFRELRTRLQQQGLFRSNKLYYLYKVASTLSLL  180

Query  1187  LVSLYGVVFMESVWAHM-GSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               +L  ++     W  + G A L+G  W Q+GW+ HD  H+ V   ++ +       GN 
Sbjct  181   AAALAVLITQRDSWLGLVGGAFLLGLFWQQSGWLAHDFLHHQVFTDRQWNNVMGYFLGNV  240

Query  1010  LTGVSIWWWRWNHNAHHIACNVVD------YDPDVQLLPIFAFSNKLFRSSLISHFYEKP  849
               G S  WW+  HN HH   N +D       DPD+  LP+ A+S+++  S          
Sbjct  241   CQGFSTDWWKSKHNVHHAVPNELDSDSKAARDPDIDTLPLLAWSSEMLDS----------  290

Query  848   MSFNSLARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWV  669
             MS NS AR  V  QH+ F+P+ LL AR++   QS        +       E+  L + + 
Sbjct  291   MS-NSGARLFVRMQHYFFFPI-LLFARMSWCQQSVAHASDLSRTSKAGVYELAYLALHYA  348

Query  668   WYPFLLSSLPNHSERIMFVVLSLMMTG-VQQIQFSLNHLASSFFAGPLTGKDWVEKQIDG  492
             W+     S+    + ++F +LS M +G +  I F  +H     ++     KD+V  QI  
Sbjct  349   WFLGAAFSVLPPLKAVVFALLSQMFSGFLLSIVFVQSHNGMEVYSDT---KDFVTAQIVS  405

Query  491   TLDIDCSPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAA  312
             T DI  + W DWF GGL +QIEHHLFP +PR  L KV   + +LC KHG+ Y +      
Sbjct  406   TRDILSNVWNDWFTGGLNYQIEHHLFPTLPRHNLGKVQKSIMELCHKHGLVYENCGMATG  465

Query  311   NALMFKSIRDAALMA  267
                + + + D A  A
Sbjct  466   TYRVLQRLADVAAEA  480



>gb|AGO13078.1| AaceriAFL079Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=534

 Score =   217 bits (552),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 119/354 (34%), Positives = 195/354 (55%), Gaps = 13/354 (4%)
 Frame = -1

Query  1298  EVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVLV  1119
              +S +Y  L  E    GL++      S     +SA+   S Y +V     W  + SAVL+
Sbjct  156   RISAEYNKLHQELIDAGLYDCPYGQYSIEILRISALLAASYYALVGRN--W-QLVSAVLL  212

Query  1118  GFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVVD  939
             GF W QA ++ HD+GH  +    ++     +L      G+S+ WW+ NHN HH+  N  +
Sbjct  213   GFAWQQAVFIAHDAGHISITHNYQVDSIFGMLISAWFGGLSLGWWKRNHNVHHLVTNDPE  272

Query  938   YDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARINM  759
             +DPD+Q LP FA + +LF + + S +YE+ ++F+  +R  V  QH  +YP+ L   R N+
Sbjct  273   HDPDIQHLPFFAVTTRLF-TGIKSSYYERVLNFDLPSRTFVPLQHLLYYPI-LAFGRFNL  330

Query  758   FIQSWKTVLFKKKIFANRAQ-----EILGLIIFWVW--YPFLLSSLPNHSERIMFVVLSL  600
             ++ SW  VL        +A      E+ GL+ F  W  Y  L  +LP  +ER+ +V++S 
Sbjct  331   YVLSWTHVLLGNGPRHGQAAWFRYFELCGLLFFCYWFGYRLLACTLPTAAERVQYVIVSH  390

Query  599   MMTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHH  420
             + T +  +Q +L+H A S  A     + + ++Q+  ++D+ C  W+D+FHGGLQFQ+ HH
Sbjct  391   LTTMIVHVQITLSHFAMST-ADLGVSESFPQRQLRTSMDVACPRWLDFFHGGLQFQVMHH  449

Query  419   LFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMARDL  258
             LFPR+PR  LR   P++ + CE+ GI Y+   F  +N+++   + + A  AR +
Sbjct  450   LFPRLPRHNLRPAQPYLLRFCERVGIKYSVYGFSQSNSMVLSHLEEIAQQARTV  503



>ref|XP_001595954.1| hypothetical protein SS1G_02169 [Sclerotinia sclerotiorum 1980]
 gb|EDN99316.1| hypothetical protein SS1G_02169 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=538

 Score =   216 bits (550),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 125/350 (36%), Positives = 187/350 (53%), Gaps = 12/350 (3%)
 Frame = -1

Query  1301  SEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAMFLVSLYGVVFMESVWAHMGSAVL  1122
             SE+   ++ L+++    GL++ K  L +Y    L    L SL  +VF+   W  + SA  
Sbjct  179   SELEAKFQALIAKLEDEGLYDSK--LSAYVTEILRCAILFSL-SLVFLRLGWYAI-SAAF  234

Query  1121  VGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNCLTGVSIWWWRWNHNAHHIACNVV  942
             +G  W Q     HD+GH  V     +      +  N   G+SI WW+ NHN HHI  N  
Sbjct  235   LGMFWHQIVATAHDAGHLAVTHDYNIDFLIGGIVLNFCGGLSIGWWKRNHNIHHIVTNSP  294

Query  941   DYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSLARFLVSYQHWTFYPVMLLIARIN  762
              +D D+Q+LP  A S  +F  SL S   E  M +N  A+F+V  Q WT+Y  +L +AR N
Sbjct  295   THDQDLQILPFIAIS-PVFFDSLYSTASECIMHYNWFAKFMVPKQAWTYY-FLLSVARFN  352

Query  761   MFIQSWKTVLFKKKIFANRAQ---EILGLIIFWVWYPFLL--SSLPNHSERIMFVVLSLM  597
             ++  +W  +L       +R Q   E++G I FW W+ + L   S+P  S+RI+F ++  M
Sbjct  353   LYYLAWDFILRDLGTKLHRKQRIFELIGQIFFWTWFGYFLVYRSIPTLSQRIIFCLICHM  412

Query  596   MTGVQQIQFSLNHLASSFFAGPLTGKDWVEKQIDGTLDIDCSPWMDWFHGGLQFQIEHHL  417
             +T    +Q +++H + S        + W+++    T+D+DC  WMDWFHGGLQFQ+ HHL
Sbjct  413   ITLPLHLQLTVSHFSMSTEESE-PSEHWIQRMFRTTMDVDCPTWMDWFHGGLQFQVTHHL  471

Query  416   FPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFKSIRDAALMA  267
             FPRMPR  LR+ S FVK+ C + G+ Y    F  +N  M   + + A  A
Sbjct  472   FPRMPRHNLRRASGFVKEFCRETGLKYEVYGFGVSNGRMLDRLAEVARQA  521



>gb|AAG36959.1|AF290983_1 delta-6 desaturase [Amylomyces rouxii]
 gb|AAG36960.1|AF296076_1 delta-6 desaturase [Amylomyces rouxii]
 dbj|BAC57562.1| delta-6 fatty acid desaturase [Mucor circinelloides]
 gb|EPB85956.1| hypothetical protein HMPREF1544_07288 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=523

 Score =   216 bits (549),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 199/366 (54%), Gaps = 14/366 (4%)
 Frame = -1

Query  1370  HPAIAAHHLQRFFNGYYVSDHQVSEVSKDYRMLVSEFSRMGLFEKKGHLVSYYAAALSAM  1191
             H  I    LQ+  NG         ++   YR L +E    GLF+      +      + +
Sbjct  146   HDLIKDAVLQKDLNG--------DQIRNAYRKLEAELYAKGLFKCNYWKYAREGCRYTLL  197

Query  1190  FLVSLYGVVFMESVWAHMGSAVLVGFLWIQAGWVGHDSGHYDVMKTKKLSRAAQLLAGNC  1011
               +SL+  +     W +M  A  +   W Q  +  HD+GH ++    ++     ++  N 
Sbjct  198   IFLSLWFTLKGTETWHYMAGAAFMAMFWHQLVFTAHDAGHNEITGKSEIDHVIGVIIANF  257

Query  1010  LTGVSIWWWRWNHNAHHIACNVVDYDPDVQLLPIFAFSNKLFRSSLISHFYEKPMSFNSL  831
             + G+S+ WW+ NHN HHI  N  ++DPD+Q +P  A + K F +++ S +Y++ + F++ 
Sbjct  258   IGGLSLGWWKDNHNVHHIVTNHPEHDPDIQHVPFMAITTKFF-NNIYSTYYKRVLPFDAA  316

Query  830   ARFLVSYQHWTFYPVMLLIARINMFIQSWKTVLFKKKIFANRAQEILGLIIFWVWYPFLL  651
             +RF V +QH+ +Y ++L   R N+   S+  +L  K +   R  E++G+  F+VW+  LL
Sbjct  317   SRFFVRHQHYLYY-LILSFGRFNLHRLSFAYLLTCKNV-RTRTLELVGITFFFVWFGSLL  374

Query  650   SSLPNHSERIMFVVLSLMMTGVQQIQFSLNHLA-SSFFAGPLTGKDWVEKQIDGTLDIDC  474
             S+LP  + RI ++++S M+T    +Q +L+H   S+   GP   + +  K +  T+D+DC
Sbjct  375   STLPTWNIRIAYIMVSYMLTFPLHVQITLSHFGMSTEDRGP--DEPFPAKMLRTTMDVDC  432

Query  473   SPWMDWFHGGLQFQIEHHLFPRMPRCQLRKVSPFVKQLCEKHGIAYNHASFWAANALMFK  294
               W+DWFHGGLQ+Q  HHLFPR+PR  LR+  P VK+ C++ G+ Y   +F   N ++  
Sbjct  433   PEWLDWFHGGLQYQAVHHLFPRLPRHNLRQCVPLVKKFCDEVGLHYYMYNFSTGNGVVLG  492

Query  293   SIRDAA  276
             +++  A
Sbjct  493   TLKSVA  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5133069304024