BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26928_g1_i1 len=1345 path=[1323:0-1344]

Length=1345
                                                                      Score     E

ref|XP_011092915.1|  PREDICTED: uncharacterized protein LOC105172985    155   1e-38   
emb|CDP20930.1|  unnamed protein product                                152   3e-37   
emb|CDP14239.1|  unnamed protein product                                151   2e-36   
ref|XP_007026454.1|  Uncharacterized protein TCM_030494                 152   3e-36   
ref|XP_011071645.1|  PREDICTED: uncharacterized protein LOC105157045    149   3e-36   
ref|XP_011101871.1|  PREDICTED: uncharacterized protein LOC105179909    146   2e-34   
ref|XP_007026457.1|  Uncharacterized protein TCM_021521                 145   2e-33   
ref|XP_007040951.1|  Uncharacterized protein TCM_016760                 143   4e-33   
ref|XP_007017130.1|  Uncharacterized protein TCM_042329                 144   6e-33   
ref|XP_007031319.1|  Uncharacterized protein TCM_016772                 143   6e-33   
ref|XP_007026455.1|  Uncharacterized protein TCM_021519                 141   7e-33   
ref|XP_007010391.1|  Uncharacterized protein TCM_044158                 141   1e-32   
ref|XP_007026458.1|  Uncharacterized protein TCM_021522                 140   9e-32   
ref|XP_007031312.1|  Uncharacterized protein TCM_016762                 139   2e-31   
ref|XP_007046403.1|  Uncharacterized protein TCM_011922                 138   2e-31   
ref|XP_007022832.1|  Uncharacterized protein TCM_026877                 136   2e-30   
ref|XP_007031313.1|  Uncharacterized protein TCM_016763                 135   3e-30   
ref|XP_007031316.1|  Uncharacterized protein TCM_016767                 128   4e-28   
ref|XP_009621358.1|  PREDICTED: uncharacterized protein LOC104112999    120   1e-27   
ref|XP_007008705.1|  Uncharacterized protein TCM_042331                 126   2e-27   
ref|XP_007032524.1|  Uncharacterized protein TCM_018528                 124   2e-27   
gb|KDP31715.1|  hypothetical protein JCGZ_14928                         117   3e-27   
ref|XP_010275342.1|  PREDICTED: uncharacterized protein LOC104610424    119   3e-27   
ref|XP_007036697.1|  Uncharacterized protein TCM_012582                 123   1e-26   
ref|XP_010272338.1|  PREDICTED: uncharacterized protein LOC104608143    116   1e-25   
ref|XP_007023857.1|  Uncharacterized protein TCM_028230                 115   5e-24   
ref|XP_007014621.1|  Uncharacterized protein TCM_039863                 113   9e-24   
ref|XP_007020288.1|  Uncharacterized protein TCM_036737                 114   2e-23   
ref|XP_007017131.1|  Uncharacterized protein TCM_033752                 113   3e-23   
ref|XP_007031317.1|  Uncharacterized protein TCM_016768                 108   4e-23   
ref|XP_007022378.1|  Uncharacterized protein TCM_032655                 106   5e-23   
ref|XP_009610625.1|  PREDICTED: uncharacterized protein LOC104104285    107   6e-23   
ref|XP_007008704.1|  Uncharacterized protein TCM_042330                 110   2e-22   
ref|XP_007040947.1|  Uncharacterized protein TCM_016754                 109   3e-22   
ref|XP_009794929.1|  PREDICTED: uncharacterized protein LOC104241685    103   4e-22   
ref|XP_007042412.1|  Uncharacterized protein TCM_007050                 105   5e-22   
ref|XP_009758915.1|  PREDICTED: uncharacterized protein LOC104211...    106   5e-22   
ref|XP_009765415.1|  PREDICTED: uncharacterized protein LOC104216966    105   1e-21   
ref|XP_009784900.1|  PREDICTED: uncharacterized protein LOC104233234    105   2e-21   
ref|XP_007013771.1|  Uncharacterized protein TCM_038318                 101   2e-21   
ref|XP_009801081.1|  PREDICTED: uncharacterized protein LOC104246885    101   2e-21   
ref|XP_009783436.1|  PREDICTED: uncharacterized protein LOC104232043    103   3e-21   
ref|XP_009790478.1|  PREDICTED: uncharacterized protein LOC104237...    105   4e-21   
ref|XP_010319987.1|  PREDICTED: uncharacterized protein LOC104647107    106   4e-21   
ref|XP_011075252.1|  PREDICTED: uncharacterized protein LOC105159763    102   3e-20   
ref|XP_009785329.1|  PREDICTED: uncharacterized protein LOC104233603    102   6e-20   
ref|XP_009764067.1|  PREDICTED: uncharacterized protein LOC104215844  99.4    9e-20   
ref|XP_009801511.1|  PREDICTED: uncharacterized protein LOC104247246  96.3    6e-19   
ref|XP_009796298.1|  PREDICTED: uncharacterized protein LOC104242883  97.8    2e-18   
ref|XP_007010894.1|  Uncharacterized protein TCM_044962               95.1    7e-18   
ref|XP_007028079.1|  Uncharacterized protein TCM_023221               92.4    7e-17   
ref|XP_007010246.1|  Uncharacterized protein TCM_043721               91.3    7e-17   
ref|XP_007010292.1|  Uncharacterized protein TCM_043834               92.0    2e-16   
ref|XP_009767582.1|  PREDICTED: uncharacterized protein LOC104218716  88.6    2e-16   
ref|XP_007052625.1|  Uncharacterized protein TCM_005953               92.4    2e-16   
ref|XP_009793772.1|  PREDICTED: uncharacterized protein LOC104240602  89.0    2e-16   
ref|XP_007046404.1|  Uncharacterized protein TCM_011923               91.7    3e-16   
ref|XP_007019767.1|  Uncharacterized protein TCM_036083               85.9    3e-16   
ref|XP_009624265.1|  PREDICTED: uncharacterized protein LOC104115357  89.0    6e-16   
ref|XP_009628423.1|  PREDICTED: uncharacterized protein LOC104118...  88.2    1e-15   
ref|XP_009799697.1|  PREDICTED: uncharacterized protein LOC104245737  85.9    2e-15   
ref|XP_009593540.1|  PREDICTED: uncharacterized protein LOC104090193  86.3    9e-15   
ref|XP_011094921.1|  PREDICTED: uncharacterized protein LOC105174492  82.0    1e-14   
ref|XP_009766914.1|  PREDICTED: uncharacterized protein LOC104218...  85.9    2e-14   
ref|XP_009766911.1|  PREDICTED: uncharacterized protein LOC104218...  85.1    2e-14   
ref|XP_007022011.1|  Uncharacterized protein TCM_032141               83.6    3e-14   
ref|XP_009779392.1|  PREDICTED: uncharacterized protein LOC104228608  82.0    3e-14   
ref|XP_009786979.1|  PREDICTED: uncharacterized protein LOC104235009  84.7    3e-14   
ref|XP_010324834.1|  PREDICTED: uncharacterized protein LOC104648709  82.8    5e-14   
ref|XP_011083357.1|  PREDICTED: uncharacterized protein At4g02000...  79.0    8e-14   
ref|XP_009622058.1|  PREDICTED: uncharacterized protein LOC104113559  81.3    1e-13   
ref|XP_007045383.1|  Uncharacterized protein TCM_011161               78.2    2e-13   
ref|XP_009768438.1|  PREDICTED: myb-like protein D                    80.9    2e-13   
ref|XP_009608952.1|  PREDICTED: uncharacterized protein LOC104102821  82.0    2e-13   
ref|XP_007040952.1|  Uncharacterized protein TCM_005954               82.4    3e-13   
ref|XP_007052624.1|  Uncharacterized protein TCM_005952               81.3    4e-13   
ref|XP_009768788.1|  PREDICTED: uncharacterized protein LOC104219761  80.1    6e-13   
ref|XP_007015656.1|  Uncharacterized protein TCM_041218               74.3    2e-12   
ref|XP_007044276.1|  Uncharacterized protein TCM_009619               75.5    3e-12   
ref|XP_009619610.1|  PREDICTED: uncharacterized protein LOC104111...  78.2    4e-12   
ref|XP_009619609.1|  PREDICTED: uncharacterized protein LOC104111...  77.8    5e-12   
ref|XP_007020072.1|  Uncharacterized protein TCM_036445               77.4    1e-11   
ref|XP_009760564.1|  PREDICTED: uncharacterized protein LOC104212897  74.7    1e-11   
ref|XP_009766116.1|  PREDICTED: uncharacterized protein LOC104217535  75.5    1e-11   
ref|XP_009765551.1|  PREDICTED: uncharacterized protein LOC104217093  75.9    3e-11   
ref|XP_007019295.1|  Uncharacterized protein TCM_035322               71.2    4e-11   
ref|XP_009590293.1|  PREDICTED: uncharacterized protein LOC104087503  74.7    4e-11   
ref|XP_006282176.1|  hypothetical protein CARUB_v10028438mg           74.7    5e-11   
ref|XP_009600598.1|  PREDICTED: uncharacterized protein LOC104096022  71.2    8e-11   
ref|XP_007014777.1|  Uncharacterized protein TCM_040289               72.8    1e-10   
ref|XP_007032187.1|  Uncharacterized protein TCM_017591               73.6    1e-10   
ref|XP_009765570.1|  PREDICTED: uncharacterized protein LOC104217118  72.4    1e-10   
ref|XP_007010225.1|  Uncharacterized protein TCM_043662               73.6    1e-10   
ref|XP_007023839.1|  Uncharacterized protein TCM_028132               71.2    1e-10   
ref|XP_010687516.1|  PREDICTED: uncharacterized protein LOC104901625  70.9    1e-10   
ref|XP_006304881.1|  hypothetical protein CARUB_v10012644mg           73.2    1e-10   
ref|XP_006382571.1|  hypothetical protein POPTR_0005s034102g          72.8    2e-10   
ref|XP_010484910.1|  PREDICTED: uncharacterized protein LOC104763199  72.0    2e-10   
ref|XP_009759333.1|  PREDICTED: uncharacterized protein LOC104211895  70.9    2e-10   
ref|XP_009777335.1|  PREDICTED: stress response protein NST1-like     70.5    2e-10   
ref|XP_006369230.1|  hypothetical protein POPTR_0001s19740g           72.4    3e-10   
ref|XP_010687419.1|  PREDICTED: uncharacterized protein LOC104901529  72.0    3e-10   
ref|XP_009603706.1|  PREDICTED: uncharacterized protein LOC104098627  72.4    3e-10   
ref|XP_010463327.1|  PREDICTED: uncharacterized protein LOC104743994  72.8    3e-10   
ref|XP_009600554.1|  PREDICTED: uncharacterized protein LOC104095990  69.3    3e-10   
ref|XP_006387777.1|  hypothetical protein POPTR_0590s00210g           71.2    5e-10   
ref|XP_010317263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  72.0    5e-10   
ref|XP_009788948.1|  PREDICTED: uncharacterized protein LOC104236667  70.9    8e-10   
ref|XP_006282222.1|  hypothetical protein CARUB_v10028495mg           70.5    9e-10   
ref|XP_007028009.1|  Uncharacterized protein TCM_023008               71.2    9e-10   
ref|XP_009799813.1|  PREDICTED: uncharacterized protein LOC104245...  70.5    1e-09   
ref|XP_009798971.1|  PREDICTED: uncharacterized protein LOC104245101  67.0    1e-09   
ref|XP_010689805.1|  PREDICTED: uncharacterized protein LOC104903466  70.1    1e-09   
ref|XP_009799814.1|  PREDICTED: uncharacterized protein LOC104245...  70.1    1e-09   
ref|XP_006301986.1|  hypothetical protein CARUB_v10022467mg           69.7    2e-09   
emb|CCA65996.1|  hypothetical protein                                 70.5    2e-09   
ref|XP_009762468.1|  PREDICTED: uncharacterized protein LOC104214497  69.3    2e-09   
ref|XP_006279197.1|  hypothetical protein CARUB_v10016517mg           69.3    2e-09   
ref|XP_010418769.1|  PREDICTED: uncharacterized protein LOC104704363  68.9    2e-09   
ref|XP_010682918.1|  PREDICTED: uncharacterized protein LOC104897680  69.3    2e-09   
ref|XP_010690660.1|  PREDICTED: uncharacterized protein LOC104904165  69.3    3e-09   
ref|XP_010695085.1|  PREDICTED: uncharacterized protein LOC104907793  68.9    3e-09   
ref|XP_009604423.1|  PREDICTED: uncharacterized protein LOC104099212  69.3    3e-09   
ref|XP_006375666.1|  hypothetical protein POPTR_0014s19100g           68.6    3e-09   
ref|XP_010670298.1|  PREDICTED: uncharacterized protein LOC104887379  68.6    4e-09   
ref|XP_010686891.1|  PREDICTED: uncharacterized protein LOC104901048  66.2    4e-09   
ref|XP_009341595.1|  PREDICTED: uncharacterized protein LOC103933633  68.9    4e-09   
ref|XP_010314948.1|  PREDICTED: uncharacterized protein LOC104645283  68.9    5e-09   
ref|XP_010668455.1|  PREDICTED: uncharacterized protein LOC104885464  67.8    5e-09   
ref|XP_006361065.1|  PREDICTED: putative NPIP-like protein LOC613...  68.2    5e-09   
ref|XP_007022714.1|  Uncharacterized protein TCM_033530               68.6    5e-09   
ref|XP_006295777.1|  hypothetical protein CARUB_v10024899mg           68.2    6e-09   
ref|XP_009770244.1|  PREDICTED: uncharacterized protein LOC104220969  66.6    8e-09   
ref|XP_010685587.1|  PREDICTED: uncharacterized protein LOC104899978  67.4    9e-09   
ref|XP_010682589.1|  PREDICTED: uncharacterized protein LOC104897413  67.0    1e-08   
ref|XP_006296651.1|  hypothetical protein CARUB_v10015577mg           67.0    1e-08   
ref|XP_010423120.1|  PREDICTED: uncharacterized protein LOC104708268  65.9    1e-08   
ref|XP_008350100.1|  PREDICTED: uncharacterized protein LOC103413411  66.6    1e-08   
ref|XP_006296775.1|  hypothetical protein CARUB_v10015820mg           67.0    1e-08   
ref|XP_010667206.1|  PREDICTED: uncharacterized protein LOC104884282  64.3    1e-08   
ref|XP_003592894.1|  hypothetical protein MTR_2g005460                66.6    2e-08   
ref|XP_009765697.1|  PREDICTED: uncharacterized protein LOC104217212  66.6    2e-08   
ref|XP_010324142.1|  PREDICTED: uncharacterized protein LOC104648514  64.7    2e-08   
ref|XP_009355139.1|  PREDICTED: uncharacterized protein LOC103946202  66.6    2e-08   
ref|XP_009613478.1|  PREDICTED: uncharacterized protein LOC104106604  63.5    2e-08   
ref|XP_009605272.1|  PREDICTED: uncharacterized protein LOC104099852  63.5    2e-08   
ref|XP_007023504.1|  Uncharacterized protein TCM_027547               65.5    2e-08   
ref|XP_007037027.1|  Uncharacterized protein TCM_013236               63.5    2e-08   
ref|XP_003615067.1|  hypothetical protein MTR_5g063260                66.2    3e-08   
ref|XP_003604996.1|  hypothetical protein MTR_4g022640                66.2    3e-08   
ref|XP_006375692.1|  hypothetical protein POPTR_0014s19680g           65.5    4e-08   
ref|XP_008779956.1|  PREDICTED: uncharacterized protein LOC103699731  65.9    4e-08   
ref|XP_007158338.1|  hypothetical protein PHAVU_002G144100g           62.4    4e-08   
ref|XP_006295613.1|  hypothetical protein CARUB_v10024726mg           65.5    4e-08   
ref|XP_006380553.1|  hypothetical protein POPTR_0007s09200g           64.7    4e-08   
ref|XP_009775461.1|  PREDICTED: uncharacterized protein LOC104225384  62.4    6e-08   
ref|XP_009770480.1|  PREDICTED: uncharacterized protein LOC104221176  62.0    6e-08   
ref|XP_006301503.1|  hypothetical protein CARUB_v10021929mg           65.1    6e-08   
ref|XP_006371236.1|  hypothetical protein POPTR_0019s07150g           65.1    6e-08   
ref|XP_003630108.1|  hypothetical protein MTR_8g091870                64.7    6e-08   
ref|XP_011101696.1|  PREDICTED: uncharacterized protein LOC105179751  63.2    9e-08   
ref|XP_006301940.1|  hypothetical protein CARUB_v10022418mg           64.3    1e-07   
ref|XP_006292963.1|  hypothetical protein CARUB_v10019240mg           63.9    1e-07   
ref|XP_003614993.1|  hypothetical protein MTR_5g062140                63.9    1e-07   
ref|XP_010693979.1|  PREDICTED: uncharacterized protein LOC104906849  63.9    1e-07   
ref|XP_009125818.1|  PREDICTED: uncharacterized protein LOC103850783  64.3    1e-07   
ref|XP_006285413.1|  hypothetical protein CARUB_v10006824mg           63.9    1e-07   
ref|XP_007010751.1|  Uncharacterized protein TCM_044700               61.2    1e-07   
ref|XP_006285575.1|  hypothetical protein CARUB_v10007019mg           63.2    1e-07   
ref|XP_006286623.1|  hypothetical protein CARUB_v10002432mg           63.5    1e-07   
ref|XP_006595286.1|  PREDICTED: uncharacterized protein LOC102660169  61.6    1e-07   
ref|XP_011075697.1|  PREDICTED: uncharacterized protein LOC105160128  61.2    1e-07   
ref|XP_004151750.1|  PREDICTED: uncharacterized protein LOC101220238  60.8    1e-07   
gb|AEL30359.1|  RNA-directed DNA polymerase                           64.3    1e-07   
ref|XP_006378909.1|  hypothetical protein POPTR_0009s00490g           63.5    1e-07   
ref|XP_010436519.1|  PREDICTED: uncharacterized protein LOC104720287  62.0    2e-07   
ref|XP_009761559.1|  PREDICTED: uncharacterized protein LOC104213719  63.9    2e-07   
ref|XP_011101714.1|  PREDICTED: uncharacterized protein LOC105179775  63.5    2e-07   
ref|XP_007162543.1|  hypothetical protein PHAVU_001G160900g           62.4    2e-07   
ref|XP_007206965.1|  hypothetical protein PRUPE_ppb019035mg           63.2    2e-07   
gb|KFK31800.1|  hypothetical protein AALP_AA6G160500                  63.9    2e-07   
ref|XP_010467353.1|  PREDICTED: uncharacterized protein LOC104747...  62.8    2e-07   
ref|XP_009603376.1|  PREDICTED: uncharacterized protein LOC104098367  63.2    2e-07   
ref|XP_004252199.1|  PREDICTED: uncharacterized protein LOC101262390  63.2    2e-07   
ref|XP_010694770.1|  PREDICTED: uncharacterized protein LOC104907528  62.4    2e-07   
ref|XP_010467351.1|  PREDICTED: uncharacterized protein LOC104747...  62.8    2e-07   
ref|XP_010692626.1|  PREDICTED: uncharacterized protein LOC104905715  63.5    2e-07   
ref|XP_004243802.1|  PREDICTED: uncharacterized protein LOC101261248  63.2    2e-07   
ref|XP_006289412.1|  hypothetical protein CARUB_v10002911mg           63.2    2e-07   
ref|XP_003595953.1|  hypothetical protein MTR_2g064100                62.8    2e-07   
ref|XP_006369223.1|  hypothetical protein POPTR_0001s19460g           62.8    2e-07   
ref|XP_006282338.1|  hypothetical protein CARUB_v10028633mg           63.2    2e-07   
ref|XP_009617694.1|  PREDICTED: uncharacterized protein LOC104109986  61.2    2e-07   
ref|XP_003609254.1|  hypothetical protein MTR_4g113700                63.2    3e-07   
ref|XP_006299881.1|  hypothetical protein CARUB_v10016088mg           62.4    3e-07   
gb|KHN17248.1|  hypothetical protein glysoja_010707                   63.2    3e-07   
ref|XP_007022413.1|  Uncharacterized protein TCM_032793               60.5    3e-07   
ref|XP_009596743.1|  PREDICTED: uncharacterized protein LOC104092781  62.0    3e-07   
ref|XP_009617980.1|  PREDICTED: uncharacterized protein LOC104110235  62.0    3e-07   
emb|CAB10338.1|  hypothetical protein                                 63.2    3e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74218.1|  BnaA03g28290D                                        62.8    3e-07   
ref|XP_010670315.1|  PREDICTED: uncharacterized protein LOC104887397  62.8    3e-07   
ref|XP_010682177.1|  PREDICTED: uncharacterized protein LOC104897068  62.8    3e-07   
ref|XP_006406430.1|  hypothetical protein EUTSA_v10022289mg           62.8    3e-07   
ref|XP_006580860.1|  PREDICTED: uncharacterized protein LOC102664004  62.0    3e-07   
ref|XP_010682176.1|  PREDICTED: uncharacterized protein LOC104897066  60.1    3e-07   
ref|XP_006286068.1|  hypothetical protein CARUB_v10007601mg           62.4    3e-07   
ref|XP_006599769.1|  PREDICTED: uncharacterized protein LOC102668549  62.4    3e-07   
ref|XP_007014196.1|  Uncharacterized protein TCM_039002               62.4    3e-07   
ref|XP_007027950.1|  Uncharacterized protein TCM_022902               62.4    3e-07   
ref|XP_006375696.1|  hypothetical protein POPTR_0014s19730g           62.8    3e-07   
ref|XP_009801431.1|  PREDICTED: uncharacterized protein LOC104247173  61.6    4e-07   
emb|CDY53602.1|  BnaC09g51900D                                        62.8    4e-07   
ref|XP_010412659.1|  PREDICTED: uncharacterized protein At4g02000...  59.7    4e-07   
ref|XP_010317681.1|  PREDICTED: uncharacterized protein LOC101254124  62.4    4e-07   
ref|XP_009792300.1|  PREDICTED: uncharacterized protein LOC104239367  61.2    4e-07   
ref|XP_010520311.1|  PREDICTED: uncharacterized protein LOC104799464  62.4    4e-07   
ref|XP_006401148.1|  hypothetical protein EUTSA_v10015367mg           62.0    4e-07   
ref|XP_009103803.1|  PREDICTED: uncharacterized protein LOC103829870  62.0    5e-07   
ref|XP_010513494.1|  PREDICTED: uncharacterized protein LOC104789504  61.6    5e-07   
ref|XP_011101716.1|  PREDICTED: uncharacterized protein LOC105179778  60.1    5e-07   
ref|XP_010695579.1|  PREDICTED: uncharacterized protein LOC104908189  61.6    6e-07   
ref|XP_009101980.1|  PREDICTED: uncharacterized protein LOC103828133  62.0    6e-07   
ref|XP_009766307.1|  PREDICTED: uncharacterized protein LOC104217698  61.2    6e-07   
ref|XP_007206580.1|  hypothetical protein PRUPE_ppa020297mg           61.2    6e-07   
emb|CDX88033.1|  BnaA06g26240D                                        61.6    6e-07   
ref|XP_010317841.1|  PREDICTED: uncharacterized protein LOC104646245  62.4    6e-07   
ref|XP_006376764.1|  hypothetical protein POPTR_0012s06220g           60.8    7e-07   
gb|KHN21001.1|  hypothetical protein glysoja_009309                   61.6    7e-07   
ref|XP_007161440.1|  hypothetical protein PHAVU_001G068900g           60.1    7e-07   
ref|XP_003599061.1|  hypothetical protein MTR_3g027260                61.6    7e-07   
ref|XP_008780283.1|  PREDICTED: uncharacterized protein LOC103700090  60.1    7e-07   
ref|XP_009759575.1|  PREDICTED: uncharacterized protein LOC104212089  58.9    8e-07   
ref|XP_010322029.1|  PREDICTED: uncharacterized protein LOC104647883  61.2    8e-07   
ref|XP_010667274.1|  PREDICTED: uncharacterized protein LOC104884335  59.7    8e-07   
ref|XP_003596392.1|  hypothetical protein MTR_2g076760                61.2    8e-07   
ref|XP_003600952.1|  hypothetical protein MTR_3g071380                61.2    8e-07   
ref|XP_007219945.1|  hypothetical protein PRUPE_ppb019389mg           61.6    9e-07   
ref|XP_011102225.1|  PREDICTED: uncharacterized protein LOC105180248  59.7    9e-07   
ref|XP_009790310.1|  PREDICTED: uncharacterized protein LOC104237787  58.2    9e-07   
ref|XP_006367861.1|  PREDICTED: uncharacterized protein LOC102578882  61.6    9e-07   
ref|XP_006375691.1|  hypothetical protein POPTR_0014s19670g           61.2    1e-06   
ref|XP_009629264.1|  PREDICTED: uncharacterized protein LOC104119453  60.5    1e-06   
ref|XP_010694020.1|  PREDICTED: uncharacterized protein LOC104906887  60.8    1e-06   
ref|XP_006371913.1|  hypothetical protein POPTR_0018s06165g           58.5    1e-06   
ref|XP_010693202.1|  PREDICTED: uncharacterized protein LOC104906181  59.3    1e-06   
ref|XP_006295894.1|  hypothetical protein CARUB_v10025024mg           61.2    1e-06   
ref|XP_009787795.1|  PREDICTED: uncharacterized protein LOC104235683  60.1    1e-06   
ref|XP_006375671.1|  hypothetical protein POPTR_0014s19170g           60.8    1e-06   
ref|XP_006287598.1|  hypothetical protein CARUB_v10000810mg           60.8    1e-06   
ref|XP_009781721.1|  PREDICTED: uncharacterized protein LOC104230577  60.5    1e-06   
ref|XP_009599442.1|  PREDICTED: uncharacterized protein LOC104095100  58.5    1e-06   
ref|XP_007019346.1|  Uncharacterized protein TCM_035367               60.8    1e-06   
ref|XP_009794445.1|  PREDICTED: uncharacterized protein LOC104241223  59.7    1e-06   
ref|XP_010684855.1|  PREDICTED: uncharacterized protein LOC104899376  60.1    1e-06   
ref|XP_006375665.1|  hypothetical protein POPTR_0014s19090g           60.5    1e-06   
ref|XP_006375693.1|  hypothetical protein POPTR_0014s19700g           60.1    1e-06   
ref|XP_009603757.1|  PREDICTED: uncharacterized protein LOC104098665  58.9    1e-06   
ref|XP_010677503.1|  PREDICTED: uncharacterized protein LOC104893120  60.5    1e-06   
ref|XP_010481113.1|  PREDICTED: uncharacterized protein LOC104759949  59.7    1e-06   
ref|XP_011101688.1|  PREDICTED: uncharacterized protein LOC105179744  60.5    2e-06   
ref|XP_010314925.1|  PREDICTED: uncharacterized protein LOC104645270  58.9    2e-06   
ref|XP_003623432.1|  Stachyose synthase                               60.8    2e-06   
ref|XP_006380098.1|  hypothetical protein POPTR_0008s218701g          58.5    2e-06   
ref|XP_009804631.1|  PREDICTED: uncharacterized protein LOC104249830  58.2    2e-06   
ref|XP_006410836.1|  hypothetical protein EUTSA_v10017665mg           60.1    2e-06   
ref|XP_009101806.1|  PREDICTED: uncharacterized protein LOC103827989  60.5    2e-06   
ref|XP_010463475.1|  PREDICTED: uncharacterized protein LOC104744160  58.9    2e-06   
ref|XP_009629202.1|  PREDICTED: uncharacterized protein LOC104119...  57.8    2e-06   
ref|XP_010424626.1|  PREDICTED: uncharacterized protein LOC104709762  58.5    2e-06   
ref|XP_009591529.1|  PREDICTED: uncharacterized protein LOC104088537  60.1    2e-06   
ref|XP_010314397.1|  PREDICTED: uncharacterized protein LOC104645079  60.5    2e-06   
ref|XP_009760103.1|  PREDICTED: uncharacterized protein LOC104212512  59.7    2e-06   
ref|XP_010668397.1|  PREDICTED: uncharacterized protein LOC104885398  57.4    2e-06   
ref|XP_006293025.1|  hypothetical protein CARUB_v10019305mg           59.7    2e-06   
ref|XP_009787638.1|  PREDICTED: uncharacterized protein LOC104235548  58.9    2e-06   
ref|XP_011101721.1|  PREDICTED: uncharacterized protein LOC105179786  60.1    2e-06   
ref|XP_003635992.1|  hypothetical protein MTR_021s0028                60.1    2e-06   
ref|XP_006289364.1|  hypothetical protein CARUB_v10002859mg           59.3    3e-06   
ref|XP_006605232.1|  PREDICTED: uncharacterized protein LOC102667279  59.3    3e-06   
ref|XP_009766744.1|  PREDICTED: uncharacterized protein LOC104218041  57.8    3e-06   
ref|XP_006285607.1|  hypothetical protein CARUB_v10007057mg           59.3    3e-06   
ref|XP_009139888.1|  PREDICTED: uncharacterized protein LOC103863877  59.7    3e-06   
ref|XP_008232499.1|  PREDICTED: uncharacterized protein LOC103331632  59.7    3e-06   
ref|XP_006294233.1|  hypothetical protein CARUB_v10023230mg           59.3    3e-06   
ref|XP_006380152.1|  hypothetical protein POPTR_0008s22400g           58.9    3e-06   
ref|XP_006372295.1|  hypothetical protein POPTR_0017s00301g           58.5    3e-06   
gb|KHN25996.1|  hypothetical protein glysoja_046925                   56.6    3e-06   
ref|XP_010693316.1|  PREDICTED: uncharacterized protein LOC104906278  59.3    4e-06   
gb|KFK41009.1|  hypothetical protein AALP_AA2G073500                  59.3    4e-06   
ref|XP_010682294.1|  PREDICTED: uncharacterized protein LOC104897167  57.8    4e-06   
ref|XP_009586783.1|  PREDICTED: uncharacterized protein LOC104084588  57.8    4e-06   
ref|XP_009615056.1|  PREDICTED: uncharacterized protein LOC104107849  59.3    4e-06   
ref|XP_002324399.2|  hypothetical protein POPTR_0018s07080g           56.6    4e-06   
ref|XP_009151454.1|  PREDICTED: uncharacterized protein LOC103874766  59.3    4e-06   
ref|XP_006372334.1|  hypothetical protein POPTR_0017s00650g           58.2    4e-06   
ref|XP_006372335.1|  hypothetical protein POPTR_0017s00660g           58.5    4e-06   
ref|XP_006577696.1|  PREDICTED: uncharacterized protein LOC102664242  58.9    5e-06   
ref|XP_006389157.1|  hypothetical protein POPTR_0041s00210g           58.2    5e-06   
ref|XP_010313013.1|  PREDICTED: uncharacterized protein LOC104644633  57.4    5e-06   
ref|XP_009777941.1|  PREDICTED: uncharacterized protein LOC104227398  56.6    5e-06   
ref|NP_178215.1|  zinc ion binding / nucleic acid binding protein     58.9    5e-06   
ref|XP_003606211.1|  hypothetical protein MTR_4g054760                58.9    5e-06   
ref|XP_006372291.1|  hypothetical protein POPTR_0017s00270g           58.2    5e-06   
ref|XP_006391950.1|  hypothetical protein EUTSA_v10024027mg           58.5    6e-06   
ref|XP_011102037.1|  PREDICTED: uncharacterized protein LOC105180082  57.8    6e-06   
gb|KFK41008.1|  hypothetical protein AALP_AA2G073500                  58.9    6e-06   
ref|XP_010681224.1|  PREDICTED: uncharacterized protein LOC104896206  57.0    6e-06   
ref|XP_003598124.1|  hypothetical protein MTR_3g007530                58.5    6e-06   
ref|XP_009768291.1|  PREDICTED: uncharacterized protein LOC104219326  57.0    6e-06   
ref|XP_006389695.1|  hypothetical protein POPTR_0020s00540g           58.2    6e-06   
gb|KHN15915.1|  hypothetical protein glysoja_013131                   58.5    6e-06   
ref|XP_006371222.1|  hypothetical protein POPTR_0019s06260g           57.4    6e-06   
ref|XP_010666802.1|  PREDICTED: uncharacterized protein LOC104883924  56.2    7e-06   
ref|XP_003636148.1|  hypothetical protein MTR_030s0014                58.2    7e-06   
ref|XP_009597118.1|  PREDICTED: uncharacterized protein LOC104093109  56.2    7e-06   
ref|XP_009802945.1|  PREDICTED: uncharacterized protein LOC104248390  58.5    7e-06   
ref|XP_010687396.1|  PREDICTED: uncharacterized protein LOC104901505  58.2    7e-06   
gb|KDO60122.1|  hypothetical protein CISIN_1g045711mg                 58.5    7e-06   
ref|XP_010314877.1|  PREDICTED: uncharacterized protein LOC104645238  58.2    7e-06   
ref|XP_009610911.1|  PREDICTED: uncharacterized protein LOC104104509  56.2    7e-06   
ref|XP_006490301.1|  PREDICTED: uncharacterized protein LOC102612828  58.5    7e-06   
ref|XP_010681517.1|  PREDICTED: uncharacterized protein LOC104896467  58.2    7e-06   
ref|XP_010692777.1|  PREDICTED: uncharacterized protein LOC104905839  58.2    8e-06   
ref|XP_006296777.1|  hypothetical protein CARUB_v10015822mg           57.8    8e-06   
ref|XP_008220882.1|  PREDICTED: uncharacterized protein LOC103320918  58.5    8e-06   
ref|XP_006286839.1|  hypothetical protein CARUB_v10003838mg           58.2    8e-06   
ref|XP_006376160.1|  hypothetical protein POPTR_0013s10355g           58.5    8e-06   
emb|CCA65978.1|  hypothetical protein                                 58.2    8e-06   
ref|XP_003603988.1|  hypothetical protein MTR_3g117300                54.7    8e-06   
ref|XP_011004665.1|  PREDICTED: uncharacterized protein LOC105111104  58.9    8e-06   
ref|XP_003627763.1|  hypothetical protein MTR_8g038020                58.2    9e-06   
ref|XP_011016272.1|  PREDICTED: uncharacterized protein LOC105119785  58.5    9e-06   
ref|XP_009604425.1|  PREDICTED: uncharacterized protein LOC104099216  55.1    9e-06   
ref|XP_010684435.1|  PREDICTED: uncharacterized protein LOC104898994  57.0    9e-06   
ref|XP_010474044.1|  PREDICTED: uncharacterized protein LOC104753498  56.6    1e-05   
dbj|BAE79384.1|  unnamed protein product                              58.5    1e-05   
ref|XP_010324170.1|  PREDICTED: uncharacterized protein LOC101266048  57.8    1e-05   
ref|XP_009781293.1|  PREDICTED: uncharacterized protein LOC104230235  55.5    1e-05   
ref|XP_010319903.1|  PREDICTED: uncharacterized protein LOC104647041  57.4    1e-05   
ref|XP_010681547.1|  PREDICTED: uncharacterized protein LOC104896496  56.2    1e-05   
ref|XP_006380103.1|  hypothetical protein POPTR_0008s21940g           58.2    1e-05   
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085  58.5    1e-05   
dbj|BAE79381.1|  unnamed protein product                              57.8    1e-05   
ref|XP_008379904.1|  PREDICTED: uncharacterized protein LOC103442894  57.0    1e-05   
ref|XP_006375678.1|  hypothetical protein POPTR_0014s19280g           57.4    1e-05   
ref|XP_006378911.1|  hypothetical protein POPTR_0009s005102g          55.8    1e-05   
gb|KHN09077.1|  hypothetical protein glysoja_034262                   55.8    1e-05   
ref|XP_010674912.1|  PREDICTED: uncharacterized protein LOC104890982  57.4    1e-05   
dbj|BAB01940.1|  non-LTR retrolelement reverse transcriptase-like...  57.8    1e-05   
ref|XP_010695483.1|  PREDICTED: uncharacterized protein LOC104908105  57.4    1e-05   
ref|XP_006591625.1|  PREDICTED: uncharacterized protein LOC102667520  57.4    1e-05   
ref|XP_010669122.1|  PREDICTED: uncharacterized protein LOC104886362  57.0    1e-05   
ref|XP_006378895.1|  hypothetical protein POPTR_0009s00290g           55.8    2e-05   
ref|XP_011101715.1|  PREDICTED: uncharacterized protein LOC105179777  55.8    2e-05   
ref|XP_006603418.1|  PREDICTED: uncharacterized protein LOC102664224  55.8    2e-05   
ref|XP_006376758.1|  hypothetical protein POPTR_0012s05830g           55.1    2e-05   
ref|XP_010686465.1|  PREDICTED: uncharacterized protein LOC104900672  57.0    2e-05   
ref|XP_010683803.1|  PREDICTED: uncharacterized protein LOC104898415  56.6    2e-05   
ref|XP_009781839.1|  PREDICTED: uncharacterized protein LOC104230675  55.8    2e-05   
ref|XP_009144746.1|  PREDICTED: uncharacterized protein LOC103868394  57.4    2e-05   
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431  57.8    2e-05   
ref|XP_009625578.1|  PREDICTED: uncharacterized protein LOC104116432  56.2    2e-05   
ref|XP_010677657.1|  PREDICTED: uncharacterized protein LOC104893250  56.6    2e-05   
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  57.8    2e-05   
ref|XP_010666564.1|  PREDICTED: uncharacterized protein LOC104883706  57.4    2e-05   
ref|XP_006385336.1|  hypothetical protein POPTR_0003s02910g           53.9    2e-05   
gb|KEH41027.1|  DUF4283 domain protein                                56.6    2e-05   
ref|XP_010681429.1|  PREDICTED: uncharacterized protein LOC104896381  56.6    2e-05   
ref|XP_003637539.1|  hypothetical protein MTR_090s0002                56.6    2e-05   
dbj|BAE79383.1|  unnamed protein product                              57.0    2e-05   
ref|XP_007049682.1|  Uncharacterized protein TCM_002788               56.6    2e-05   
ref|XP_010501556.1|  PREDICTED: uncharacterized protein LOC104778826  57.4    2e-05   
ref|XP_011101580.1|  PREDICTED: uncharacterized protein LOC105179639  55.8    2e-05   
ref|XP_007132828.1|  hypothetical protein PHAVU_011G127900g           53.1    2e-05   
ref|XP_006388111.1|  hypothetical protein POPTR_0333s00200g           57.0    2e-05   
ref|XP_010689623.1|  PREDICTED: uncharacterized protein LOC104903305  56.2    2e-05   
ref|XP_009770224.1|  PREDICTED: uncharacterized protein LOC104220956  56.6    2e-05   
ref|XP_010549581.1|  PREDICTED: uncharacterized protein LOC104820719  56.6    2e-05   
ref|XP_010689916.1|  PREDICTED: uncharacterized protein LOC104903566  53.9    2e-05   
ref|XP_009788503.1|  PREDICTED: uncharacterized protein LOC104236304  55.5    3e-05   
ref|XP_011004562.1|  PREDICTED: uncharacterized protein LOC105111...  55.8    3e-05   
ref|XP_009612471.1|  PREDICTED: uncharacterized protein LOC104105787  55.8    3e-05   
ref|XP_009758696.1|  PREDICTED: uncharacterized protein LOC104211352  56.2    3e-05   
ref|XP_010694057.1|  PREDICTED: uncharacterized protein LOC104906925  55.8    3e-05   
ref|XP_009763858.1|  PREDICTED: uncharacterized protein LOC104215701  53.9    3e-05   
ref|XP_007039835.1|  Uncharacterized protein TCM_015964               54.3    3e-05   
ref|XP_009794470.1|  PREDICTED: uncharacterized protein LOC104241241  56.6    3e-05   
ref|XP_010686029.1|  PREDICTED: uncharacterized protein LOC104900325  55.8    3e-05   
gb|KHN26207.1|  hypothetical protein glysoja_035500                   56.2    3e-05   
ref|XP_007044005.1|  Uncharacterized protein TCM_008800               56.2    3e-05   
ref|XP_011004563.1|  PREDICTED: uncharacterized protein LOC105111...  55.5    3e-05   
ref|XP_006378920.1|  hypothetical protein POPTR_0009s00580g           56.2    4e-05   
ref|XP_009594501.1|  PREDICTED: uncharacterized protein LOC104090981  55.5    4e-05   
ref|XP_003614149.1|  hypothetical protein MTR_5g045440                56.6    4e-05   
ref|XP_008369979.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...  56.6    4e-05   
gb|ABW81177.1|  gag non-LTR retrotransposase                          56.2    4e-05   
ref|XP_006374506.1|  hypothetical protein POPTR_0015s08060g           55.8    4e-05   
ref|XP_011101577.1|  PREDICTED: uncharacterized protein LOC105179637  56.2    4e-05   
gb|KHN42237.1|  hypothetical protein glysoja_044118                   54.3    5e-05   
ref|XP_007050032.1|  Uncharacterized protein TCM_003626               53.5    5e-05   
emb|CDY67396.1|  BnaUnng02150D                                        55.1    5e-05   
ref|XP_009141433.1|  PREDICTED: uncharacterized protein LOC103865384  55.5    6e-05   
ref|XP_003614444.1|  hypothetical protein MTR_5g053720                55.5    6e-05   
ref|XP_009121310.1|  PREDICTED: uncharacterized protein LOC103846155  55.5    6e-05   
ref|XP_006378903.1|  hypothetical protein POPTR_0009s00420g           55.5    6e-05   
ref|XP_003607073.1|  hypothetical protein MTR_4g071930                54.7    6e-05   
ref|XP_009608135.1|  PREDICTED: uncharacterized protein LOC104102190  55.1    6e-05   
ref|XP_011004561.1|  PREDICTED: uncharacterized protein LOC105111...  55.1    6e-05   
ref|XP_010681272.1|  PREDICTED: uncharacterized protein LOC104896254  53.5    6e-05   
ref|XP_010679582.1|  PREDICTED: uncharacterized protein LOC104894914  55.8    6e-05   
gb|KDO70278.1|  hypothetical protein CISIN_1g046866mg                 55.5    6e-05   
ref|XP_006402236.1|  hypothetical protein EUTSA_v10015497mg           55.5    7e-05   
ref|XP_008460523.1|  PREDICTED: uncharacterized protein LOC103499...  55.5    7e-05   
ref|XP_010548758.1|  PREDICTED: uncharacterized protein LOC104820083  55.8    7e-05   
ref|XP_010425860.1|  PREDICTED: uncharacterized protein LOC104710904  54.3    7e-05   
ref|XP_010322091.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  55.8    7e-05   
ref|XP_007208943.1|  hypothetical protein PRUPE_ppb015526mg           55.5    7e-05   
ref|XP_003636737.1|  hypothetical protein MTR_054s0011                55.1    8e-05   
ref|XP_008463187.1|  PREDICTED: uncharacterized protein LOC103501395  55.5    8e-05   
ref|XP_009587269.1|  PREDICTED: uncharacterized protein LOC104085011  53.5    8e-05   
ref|XP_009129252.1|  PREDICTED: uncharacterized protein LOC103854088  55.1    8e-05   
ref|XP_010681834.1|  PREDICTED: uncharacterized protein LOC104896742  54.7    8e-05   
ref|XP_010671910.1|  PREDICTED: uncharacterized protein LOC104888586  55.1    8e-05   
ref|XP_006410277.1|  hypothetical protein EUTSA_v10017828mg           54.7    8e-05   
ref|XP_003613024.1|  hypothetical protein MTR_5g031820                55.5    8e-05   
ref|XP_006388049.1|  hypothetical protein POPTR_0380s00210g           54.7    8e-05   
gb|KFK35541.1|  hypothetical protein AALP_AA4G004100                  55.5    8e-05   
ref|XP_003616601.1|  hypothetical protein MTR_5g082240                55.1    9e-05   
ref|XP_006589932.1|  PREDICTED: uncharacterized protein LOC102669251  53.5    9e-05   
ref|XP_009782929.1|  PREDICTED: uncharacterized protein LOC104231611  53.5    9e-05   
ref|XP_007208970.1|  hypothetical protein PRUPE_ppb020897mg           55.1    9e-05   
ref|XP_006384334.1|  hypothetical protein POPTR_0004s13050g           52.0    9e-05   
ref|XP_009777272.1|  PREDICTED: uncharacterized protein LOC104226878  52.4    9e-05   
ref|XP_010694730.1|  PREDICTED: uncharacterized protein LOC104907492  54.7    9e-05   
ref|XP_010677868.1|  PREDICTED: uncharacterized protein LOC104893461  55.1    9e-05   
ref|XP_003636738.1|  hypothetical protein MTR_054s0011                54.7    9e-05   
ref|XP_011101570.1|  PREDICTED: uncharacterized protein LOC105179625  53.1    9e-05   
ref|XP_006603354.1|  PREDICTED: uncharacterized protein LOC102667571  52.0    1e-04   
ref|XP_006371967.1|  hypothetical protein POPTR_0018s06750g           53.5    1e-04   
ref|XP_006469095.1|  PREDICTED: uncharacterized protein LOC102629728  54.7    1e-04   
gb|KEH22373.1|  DUF4283 domain protein                                54.7    1e-04   
ref|XP_007219550.1|  hypothetical protein PRUPE_ppa025650mg           53.5    1e-04   
ref|XP_003622852.1|  hypothetical protein MTR_7g055500                54.7    1e-04   
ref|XP_009140327.1|  PREDICTED: uncharacterized protein LOC103864320  55.1    1e-04   
ref|XP_009784545.1|  PREDICTED: uncharacterized protein LOC104232966  53.9    1e-04   
ref|XP_003592211.1|  hypothetical protein MTR_1g100140                54.3    1e-04   
ref|XP_009765500.1|  PREDICTED: uncharacterized protein LOC104217044  53.5    1e-04   
ref|XP_006299187.1|  hypothetical protein CARUB_v10015332mg           53.9    2e-04   
ref|XP_003611643.1|  hypothetical protein MTR_5g016230                54.3    2e-04   
ref|XP_008238489.1|  PREDICTED: uncharacterized protein LOC103337115  54.7    2e-04   
ref|XP_003596896.1|  hypothetical protein MTR_2g087410                54.3    2e-04   
ref|XP_010681221.1|  PREDICTED: uncharacterized protein LOC104896202  52.0    2e-04   
ref|XP_010696567.1|  PREDICTED: uncharacterized protein LOC104909079  53.1    2e-04   
ref|XP_010474076.1|  PREDICTED: uncharacterized protein LOC104753532  53.1    2e-04   
ref|XP_009787602.1|  PREDICTED: uncharacterized protein LOC104235512  54.3    2e-04   
ref|XP_010693336.1|  PREDICTED: uncharacterized protein LOC104906297  53.5    2e-04   
ref|XP_009779969.1|  PREDICTED: uncharacterized protein LOC104229091  53.5    2e-04   
ref|XP_010326232.1|  PREDICTED: uncharacterized protein LOC104649186  53.9    2e-04   
ref|XP_006380110.1|  hypothetical protein POPTR_0008s22010g           53.9    2e-04   
ref|XP_007046406.1|  Uncharacterized protein TCM_000001               52.8    2e-04   
ref|XP_003598505.1|  NADPH:quinone oxidoreductase                     53.5    2e-04   
ref|XP_010684619.1|  PREDICTED: uncharacterized protein LOC104899180  54.3    2e-04   
ref|XP_009624495.1|  PREDICTED: uncharacterized protein LOC104115535  52.0    2e-04   
ref|XP_010694596.1|  PREDICTED: uncharacterized protein LOC104907367  52.0    2e-04   
ref|XP_006598642.1|  PREDICTED: uncharacterized protein LOC102666350  53.5    2e-04   
ref|XP_010666883.1|  PREDICTED: uncharacterized protein LOC104884000  53.9    3e-04   
ref|XP_009140418.1|  PREDICTED: uncharacterized protein LOC103864421  52.4    3e-04   
ref|XP_009612570.1|  PREDICTED: uncharacterized protein LOC104105862  52.4    3e-04   
ref|XP_003628610.1|  Coronatine-insensitive 1-like protein            53.9    3e-04   
ref|XP_006380111.1|  hypothetical protein POPTR_0008s22010g           53.5    3e-04   
ref|XP_003589413.1|  hypothetical protein MTR_1g023970                53.5    3e-04   
ref|XP_010690648.1|  PREDICTED: uncharacterized protein LOC104904155  53.1    3e-04   
ref|XP_006576082.1|  PREDICTED: uncharacterized protein LOC102659506  53.5    3e-04   
ref|XP_007138186.1|  hypothetical protein PHAVU_009G187600g           51.6    3e-04   
ref|XP_007027456.1|  Uncharacterized protein TCM_022291               53.5    3e-04   
ref|XP_003593078.1|  hypothetical protein MTR_2g007560                53.5    3e-04   
ref|XP_006387324.1|  hypothetical protein POPTR_1250s00200g           53.5    3e-04   
ref|XP_011014909.1|  PREDICTED: uncharacterized protein LOC105118...  52.0    3e-04   
ref|XP_003620586.1|  hypothetical protein MTR_6g087240                53.5    3e-04   
ref|XP_010532453.1|  PREDICTED: uncharacterized protein LOC104808473  52.4    3e-04   
ref|XP_009785842.1|  PREDICTED: uncharacterized protein LOC104234049  51.2    3e-04   
ref|XP_006378902.1|  hypothetical protein POPTR_0009s00410g           50.8    4e-04   
ref|XP_006373268.1|  hypothetical protein POPTR_0017s10440g           52.4    4e-04   
ref|XP_010682315.1|  PREDICTED: uncharacterized protein LOC104897190  51.6    4e-04   
ref|XP_006295736.1|  hypothetical protein CARUB_v10024855mg           52.8    4e-04   
ref|XP_010040240.1|  PREDICTED: uncharacterized protein LOC104429032  53.1    4e-04   
gb|AAL30109.1|  unknown                                               50.1    5e-04   
ref|XP_009804027.1|  PREDICTED: uncharacterized protein LOC104249321  51.6    5e-04   
ref|XP_006381942.1|  hypothetical protein POPTR_0006s21930g           52.4    5e-04   
gb|AAD37019.2|  putative non-LTR retrolelement reverse transcriptase  52.8    5e-04   
ref|XP_006378905.1|  hypothetical protein POPTR_0009s00440g           52.0    5e-04   
gb|KDO37843.1|  hypothetical protein CISIN_1g047084mg                 52.4    5e-04   
gb|KDO59838.1|  hypothetical protein CISIN_1g037799mg                 49.7    5e-04   
ref|XP_004309385.1|  PREDICTED: uncharacterized protein LOC101293944  52.0    5e-04   
ref|XP_007023729.1|  Uncharacterized protein TCM_027856               52.8    5e-04   
ref|XP_009765971.1|  PREDICTED: uncharacterized protein LOC104217424  52.4    6e-04   
ref|XP_010026316.1|  PREDICTED: uncharacterized protein LOC104416656  51.6    6e-04   
ref|XP_006376209.1|  hypothetical protein POPTR_0013s10920g           50.8    6e-04   
ref|XP_009624247.1|  PREDICTED: uncharacterized protein LOC104115348  52.0    6e-04   



>ref|XP_011092915.1| PREDICTED: uncharacterized protein LOC105172985 [Sesamum indicum]
Length=470

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/208 (39%), Positives = 122/208 (59%), Gaps = 4/208 (2%)
 Frame = -1

Query  1279  KGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHH  1100
             +GM  + F+  ++ + S  FR+ALVGKFS G PSM +L +     GF   FS+G ++  H
Sbjct  8     QGMKVLRFSSDEISRLSLPFRYALVGKFSHGYPSMQNLRRWMLAQGFRGDFSVGAINVRH  67

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQD  920
             V + F +E D+ + W+  +  ++GF M   KW+  F P  ESPIVPVW+          D
Sbjct  68    VFIKFALEEDYTKLWIKSTWFVEGFPMRVFKWTPTFNPREESPIVPVWVRLPELPIQFFD  127

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKV  740
             + A++SIA+L+G+PL+ D ST +  RPS+ARVCVE+N+   L  +I +  G+     Q V
Sbjct  128   REALFSIAHLLGTPLRTDVSTATLVRPSVARVCVEINLLEPLQTEIGLGIGTEV-IIQPV  186

Query  739   TNEYIPPYCSGCRNTQGHNLHQ--EPHR  662
               E +P YC  C++  GH+  +  E HR
Sbjct  187   IYERLPKYCGACKHL-GHDEDECYEKHR  213



>emb|CDP20930.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 113/203 (56%), Gaps = 1/203 (0%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             YKG  +V F+  D  + +  F++ALVGKFS GRPS+ D+ K F  +      S+GL+D  
Sbjct  41    YKGEAAVVFSKADADKLAAPFQWALVGKFSHGRPSLEDIRKFFASLNLKDHVSIGLMDYR  100

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQ  923
             HVL+    E DF R W+     +  + M   +W+ +F    ES + PVW+       H  
Sbjct  101   HVLIKCMAEADFNRIWMRGIWQLGKYPMRVFRWTREFHVLRESSLAPVWVVLPALPIHYF  160

Query  922   DKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQK  743
             DK +++SI + +G PL +D++T +  RPS+ARVCVEL+V+     ++W+       F Q+
Sbjct  161   DKHSLFSILSPVGRPLFLDSATAAGTRPSLARVCVELDVAKSFTQRVWVAVEGESGFWQR  220

Query  742   VTNEYIPPYCSGCRNTQGHNLHQ  674
             +  E +P YCS C    GH+  Q
Sbjct  221   IVPENMPLYCSSCSRL-GHSQEQ  242



>emb|CDP14239.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/216 (38%), Positives = 116/216 (54%), Gaps = 5/216 (2%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             ++G P+V F+  D+   +  FR+ LVGKFSKGRP + DL K    +      ++GLLD  
Sbjct  4     HRGEPAVVFSAADIAVVAAPFRYTLVGKFSKGRPLLPDLRKFLSTLDLKDTATVGLLDAR  63

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQ  923
             HVLL F  E DF R W      + G  M   KW+  F    ES +VP+W        HL 
Sbjct  64    HVLLKFQCEADFLRVWGRSLWYVNGSPMRVFKWTSKFHVNRESSLVPIWFRLPKLPIHLF  123

Query  922   DKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQK  743
              K  ++ + + +G+PL VDA+T S +RP++ARVCVE+++   +P ++W+  G    F Q 
Sbjct  124   AKPCLFHLVSCLGTPLFVDAATSSFSRPNVARVCVEVDLLKSIPSRVWVDMGDGDGFWQV  183

Query  742   VTNEYIPPYCSGCRNTQGHNLHQ----EPHRETPKT  647
             +  E +P YCS C   QGH   Q     P    PKT
Sbjct  184   LIPENLPNYCSHCYR-QGHGEDQCRVKHPDLRLPKT  218



>ref|XP_007026454.1| Uncharacterized protein TCM_030494 [Theobroma cacao]
 gb|EOY29076.1| Uncharacterized protein TCM_030494 [Theobroma cacao]
Length=876

 Score =   152 bits (385),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 123/214 (57%), Gaps = 8/214 (4%)
 Frame = -1

Query  1303  PLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFS  1124
             P RP   YK  P+V F + +++  +Q F+FA+VGKFSK  P + ++ + F  +G   +++
Sbjct  105   PTRPTFRYKDKPAVRFFEDEIEALAQPFKFAIVGKFSK-MPRLTEIRQSFVSLGLSGVYN  163

Query  1123  LGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFE  944
             +  ++  H+L++ + E DF R W  ++  I    M   KW+ DF    ESPIVPVWI+F 
Sbjct  164   IRWMNYKHILIHLSNEQDFNRIWTKQTWFITNQKMRVFKWTPDFETDKESPIVPVWISFP  223

Query  943   GFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM---  773
                AHL +K A+  IA  IG+PL +D +T +  RPS+ARVC+E +        +WI+   
Sbjct  224   NLKAHLFEKSALLMIAKAIGNPLYIDEATANGTRPSVARVCIEYDCLKPPVDSVWIVVSK  283

Query  772   NGSY---GDFAQKVTNEYIPPYCSGCRNTQGHNL  680
              GS    G + QKV    +P YC+ C +  GHN+
Sbjct  284   RGSEDMSGGYLQKVEFAPMPEYCNHCCHV-GHNV  316



>ref|XP_011071645.1| PREDICTED: uncharacterized protein LOC105157045 [Sesamum indicum]
Length=507

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/240 (36%), Positives = 130/240 (54%), Gaps = 25/240 (10%)
 Frame = -1

Query  1345  RTFADVLSSNTDDSPLRPPGHY------------------KGMPSVSFTDQDVQQFSQKF  1220
             +TFA+VL+      P  P  H                   KG P++ FTD + +  +  F
Sbjct  70    KTFAEVLAPTRASKPATPAPHKYFPVDLPSPGIGTVLTGDKG-PTLLFTDDETEVLAAPF  128

Query  1219  RFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSL  1040
             +FALVGKFS G PS + L K     G    F++ +L+  HVL++ + E DF R WL +  
Sbjct  129   KFALVGKFSHGAPSYSILHKLIAGTGIKNKFTVSMLNTRHVLISLSCEADFSRLWLRRIW  188

Query  1039  SIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDAS  860
              I+G+ M   KW+  F P  ES IVPVW++F    AHL  K  ++++A++IG+PL++D +
Sbjct  189   YIQGYPMRVFKWTPAFTPSKESSIVPVWVSFPELPAHLFRKEVLFTVASMIGTPLQIDDA  248

Query  859   TLSHNRPSMARVCVELNVSNDLPH--QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGH  686
             TL+ ++ S AR C+EL++        QI I   +     Q++  E IP YCS C++  GH
Sbjct  249   TLNQSKLSKARACIELDLLKPRLENFQIQICGTT---IVQRIEYEDIPHYCSLCKHV-GH  304



>ref|XP_011101871.1| PREDICTED: uncharacterized protein LOC105179909 [Sesamum indicum]
Length=733

 Score =   146 bits (368),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 124/198 (63%), Gaps = 2/198 (1%)
 Frame = -1

Query  1279  KGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHH  1100
             +G P++SFT+ + ++ +  FRF+LVGKFS G P  + + +   ++G    F++ +++  H
Sbjct  79    QGRPTISFTNTETEELAAPFRFSLVGKFSHGAPPYSQMHQLIARLGIQGAFTVSMINSKH  138

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQD  920
              L++ + E D+ R WL +   ++GF M   KW+  F P  ES +VP+++ F    AHL  
Sbjct  139   TLISLSCESDYSRLWLRRIWFLQGFPMRIFKWTPTFTPTQESSVVPIFVCFPKLPAHLFH  198

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKV  740
             K A++S+A+++GSPL++DA TL+ ++ S ARVCVE+++   +  + + ++ +     QKV
Sbjct  199   KEALFSVASMVGSPLQIDALTLNKSKLSQARVCVEIDLLKPIIEE-FDLHINDVTIVQKV  257

Query  739   TNEYIPPYCSGCRNTQGH  686
               EY+P YC  C++  GH
Sbjct  258   VFEYLPKYCFLCKHV-GH  274



>ref|XP_007026457.1| Uncharacterized protein TCM_021521 [Theobroma cacao]
 gb|EOY06959.1| Uncharacterized protein TCM_021521 [Theobroma cacao]
Length=1951

 Score =   145 bits (366),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 114/204 (56%), Gaps = 7/204 (3%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  Y+  P+V+F + ++   +Q F+ ++VGKFS+  P + D+   F  IG   ++ + 
Sbjct  80    REPFWYRDRPAVAFFEDEIVALAQPFKHSMVGKFSR-MPKLNDIRAAFKGIGLVGVYEIR  138

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L++ + E D  R W+ ++  I    M   KWS DF+P  ES +VPVWI+F   
Sbjct  139   WLDYKHILIHLSNEQDLNRLWMRQAWFIANQKMRVFKWSPDFQPEKESSLVPVWISFPNL  198

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGS--  764
              AHL +K A+  IA  +G PL VD +T +  RPS+ARVCVE +       QIWI++    
Sbjct  199   RAHLYEKSALLMIAKSVGRPLFVDEATANGTRPSVARVCVEYDCQQPPLEQIWIVSRDRR  258

Query  763   ----YGDFAQKVTNEYIPPYCSGC  704
                  G F QKV    +P YC+ C
Sbjct  259   TGDITGGFQQKVDFAKLPNYCTHC  282



>ref|XP_007040951.1| Uncharacterized protein TCM_016760 [Theobroma cacao]
 gb|EOY25452.1| Uncharacterized protein TCM_016760 [Theobroma cacao]
Length=1109

 Score =   143 bits (361),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 113/212 (53%), Gaps = 8/212 (4%)
 Frame = -1

Query  1303  PLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFS  1124
             P R P  YK  P+  F + ++Q  ++ F  +LVGKFS+  P + ++   F  IG    + 
Sbjct  76    PSRDPSVYKDRPAAIFYEDEIQTLARPFSHSLVGKFSR-MPKLQEIRHAFKGIGLSGAYE  134

Query  1123  LGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFE  944
             +  +D  HVL++ + E DF R W+ +   I    M   KW+ DF    ES +VPVWI+F 
Sbjct  135   IRWMDYKHVLIHLSNEQDFNRVWVKQQWFIVNQKMRVFKWAPDFEAEKESAMVPVWISFP  194

Query  943   GFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM---  773
                AHL +K A+  IA  +G PL VD +T + +RPS+ARVCVE +       +IWI+   
Sbjct  195   NLKAHLYEKSALLLIAKTVGKPLYVDEATANGSRPSVARVCVEYDCRKQPVEEIWIVIRN  254

Query  772   ---NGSYGDFAQKVTNEYIPPYCSGCRNTQGH  686
                    G ++Q+V    +P YC  C +  GH
Sbjct  255   RETGAVTGGYSQRVEFARMPDYCGYCSHV-GH  285



>ref|XP_007017130.1| Uncharacterized protein TCM_042329 [Theobroma cacao]
 gb|EOY34749.1| Uncharacterized protein TCM_042329 [Theobroma cacao]
Length=2606

 Score =   144 bits (363),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 112/204 (55%), Gaps = 7/204 (3%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  Y+  P+V+F + ++   +Q F+ ++VGKFS+  P + D+   F  I    ++ + 
Sbjct  80    REPFWYRDRPAVAFFEDEIVALAQPFKHSMVGKFSR-MPKLNDIRAAFKGISLVGVYEIR  138

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L++ + E D  R W+ ++  I    M   KW+ DF+P  ES +VPVWI+F   
Sbjct  139   WLDYKHILIHLSNEQDLNRLWMRQAWFIANQKMRVFKWTPDFQPEKESSLVPVWISFPNL  198

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGS--  764
              AHL +K A+  IA  +G PL VD +T +  RPS+ARVCVE +       QIWI+     
Sbjct  199   RAHLYEKSALLMIAKSVGRPLFVDEATANGTRPSVARVCVEYDCQQPPLEQIWIVTRDRR  258

Query  763   ----YGDFAQKVTNEYIPPYCSGC  704
                  G F QKV    +P YC+ C
Sbjct  259   TGDITGGFQQKVDFAKLPNYCTHC  282


 Score =   136 bits (342),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 109/204 (53%), Gaps = 7/204 (3%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  +K  P+ +F + ++Q  +Q  + +LVGKFS+  P + D+   F  IG    + + 
Sbjct  1706  RDPLVFKDRPAAAFFEDEIQTLAQPLKLSLVGKFSR-MPKLQDVRSAFKGIGLTGAYEVR  1764

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  HVL++ + E D  R W  +   I    M   KW+ +F P  ES +VPVWIAF   
Sbjct  1765  WLDYKHVLIHLSNEQDCNRVWTKQVWFIANQKMRVFKWTPEFEPEKESAVVPVWIAFPNL  1824

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM--NGS  764
              AHL +K A+  IA  +G PL VD +T + +RPS+ARVC+E +       Q+WI+  N  
Sbjct  1825  KAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCIEFDCRRPPIDQVWIVVQNRE  1884

Query  763   YGD----FAQKVTNEYIPPYCSGC  704
              G     + Q+V    +P YC  C
Sbjct  1885  TGTVTSGYPQRVEFSQMPAYCDHC  1908



>ref|XP_007031319.1| Uncharacterized protein TCM_016772 [Theobroma cacao]
 gb|EOY02245.1| Uncharacterized protein TCM_016772 [Theobroma cacao]
Length=1296

 Score =   143 bits (361),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 115/211 (55%), Gaps = 8/211 (4%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  Y+  P+ SF D ++   +  F+F+++GKF++  P + ++   F  IG    +++ 
Sbjct  80    REPSWYRDRPAASFFDNEIATLALSFKFSMIGKFTR-MPKLQEIRTAFKGIGLVGAYNIR  138

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L++ + E D  R W+ ++  I    M   KW+ +F P  ES +VPVWI+F   
Sbjct  139   WLDYKHILIHLSNEHDLNRIWMKQNWFIVNKKMRVFKWTPEFHPEKESSLVPVWISFPNL  198

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGS--  764
              AH  +K  +  IA  +G PL VD +T +  RP++AR+CVE +    L  QIWI+  S  
Sbjct  199   RAHFYEKSTLMMIAKSVGRPLFVDEATANGTRPNVARICVEYDCQKSLLDQIWIVTRSRQ  258

Query  763   ----YGDFAQKVTNEYIPPYCSGCRNTQGHN  683
                  G F QKV    +P YC+ C +  GHN
Sbjct  259   TGEVTGGFIQKVEFVKMPDYCTHCCHV-GHN  288



>ref|XP_007026455.1| Uncharacterized protein TCM_021519 [Theobroma cacao]
 gb|EOY06957.1| Uncharacterized protein TCM_021519 [Theobroma cacao]
Length=667

 Score =   141 bits (355),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 109/211 (52%), Gaps = 8/211 (4%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK  P+  F + ++   ++ F   LVGKF++  P + ++   F  IG    + + 
Sbjct  74    RDPAVYKDRPAAVFYEDEICILAKPFSLCLVGKFTR-MPKLQEVRSAFKGIGLSGAYEIK  132

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  HVL++ + + DF R W  +   I G  M   KWS +F    ESP+VPVWI+F   
Sbjct  133   WLDYKHVLIHLSNDQDFNRIWTRQQWFIVGQKMRIFKWSPEFEAEKESPVVPVWISFPNL  192

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGS--  764
              AHL +K A+  IA  IG PL VD  T   +RPS+ARVCVE +       Q+WI+     
Sbjct  193   KAHLYEKSALLLIAKTIGKPLFVDEPTAKGSRPSVARVCVEYDCREPPIDQVWIVTQKRE  252

Query  763   ----YGDFAQKVTNEYIPPYCSGCRNTQGHN  683
                    +AQKV    +P YC  C +  GHN
Sbjct  253   TGMVTNGYAQKVEFSQMPDYCEHCCHV-GHN  282



>ref|XP_007010391.1| Uncharacterized protein TCM_044158 [Theobroma cacao]
 gb|EOY19201.1| Uncharacterized protein TCM_044158 [Theobroma cacao]
Length=830

 Score =   141 bits (355),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 115/212 (54%), Gaps = 8/212 (4%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK  P+ SF D ++   +Q F+F++VGKFS+    M ++   F  IG    + + 
Sbjct  74    REPFWYKDRPAASFFDDEISTLAQPFKFSMVGKFSR-MLRMQEIRVAFKGIGLIGAYEIR  132

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L+  + E D  R WL +   I    M   KWS +F+P  ES +VPVWI+F   
Sbjct  133   WLDYKHILIQLSNEHDLNRIWLKQVWFISNQKMRVFKWSPEFQPEKESSMVPVWISFPNL  192

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM-----  773
              AHL +K A+ +I   +G PL VD +T +  RPS+ARVCVE +       Q+WI+     
Sbjct  193   KAHLYEKSALSAIVKTVGRPLMVDEATANGTRPSVARVCVEFDCQQPPIDQVWIVTRNRQ  252

Query  772   NGS-YGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             +GS  G + QKV    +  +C+ C +  GH +
Sbjct  253   SGSVMGGYMQKVEFARLSEFCTHCSHV-GHGV  283



>ref|XP_007026458.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
 gb|EOY06960.1| Uncharacterized protein TCM_021522 [Theobroma cacao]
Length=3503

 Score =   140 bits (353),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 114/204 (56%), Gaps = 7/204 (3%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  +K  P+ +F + ++Q  ++ F+ +LVGKFS+  P + D+   F  IG    + + 
Sbjct  1775  RDPFVFKDRPAAAFFEDEIQTLAKPFKLSLVGKFSR-MPKLQDVRAAFKGIGLAGAYEVR  1833

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  HVL++ + E DF R W  ++  I    M   KW+ +F P  ES +VPVWI+F   
Sbjct  1834  WLDYKHVLIHLSNEQDFNRIWTKQNWFIATQKMRVFKWTPEFEPEKESAVVPVWISFPNL  1893

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM--NGS  764
              AHL +K A+  IA  +G PL VD +T + +RPS+ARVCVE +       Q+WI+  N  
Sbjct  1894  KAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCVEFDCRQPPLDQVWIVVQNRK  1953

Query  763   YGD----FAQKVTNEYIPPYCSGC  704
              G+    ++Q+V    +P YC  C
Sbjct  1954  TGEITNGYSQRVEFAQMPAYCDHC  1977


 Score =   126 bits (317),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 96/174 (55%), Gaps = 7/174 (4%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKW  1004
             P M ++ + F  IG    + +  LD  H+L++ + E DF R W  +   I    M   KW
Sbjct  2     PKMQEIRQAFKGIGLTGAYVIRWLDYKHILIHLSNEQDFNRIWTKQQWFIANQKMRVFKW  61

Query  1003  SLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
             S DF    ESPIVPVWI+F    AHL +K A+  IA  +G PL +D +T + +RPS+ARV
Sbjct  62    SPDFEAEKESPIVPVWISFPNLKAHLYEKSALLLIAKTVGKPLFIDEATSNASRPSVARV  121

Query  823   CVELNVSNDLPHQIWI-----MNGSY-GDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             CVE N  N    +IWI     + G+  G +AQKV    +P YC  C +  GH++
Sbjct  122   CVEYNCRNAPVEEIWIVIKDRVTGTVTGGYAQKVEFSKMPDYCEHCGHV-GHSV  174



>ref|XP_007031312.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
 gb|EOY02238.1| Uncharacterized protein TCM_016762 [Theobroma cacao]
Length=2214

 Score =   139 bits (351),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 110/211 (52%), Gaps = 8/211 (4%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK  P+  F + ++   ++ F   LVGKF++  P + ++   F  IG    + + 
Sbjct  74    RDPAVYKDRPAAVFYEDEICILAKPFSLCLVGKFTR-MPKLQEVRSAFKGIGLSGAYEIK  132

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  HVL++ + + DF R W  +   I G  M   KWS +F    ESP+VPVWI+F   
Sbjct  133   WLDYKHVLIHLSNDQDFNRIWTRQQWFIVGQKMRIFKWSPEFEAEKESPVVPVWISFPNL  192

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGS--  764
              AHL +K A+  IA  IG PL VD +T   +RPS+ARVCVE +       Q+WI+     
Sbjct  193   KAHLYEKSALLLIAKTIGKPLFVDEATAKGSRPSVARVCVEYDCREPPIDQVWIVTQKRE  252

Query  763   ----YGDFAQKVTNEYIPPYCSGCRNTQGHN  683
                    +AQKV    +P YC  C +  GHN
Sbjct  253   TGMVTNGYAQKVEFSQMPDYCEHCCHV-GHN  282



>ref|XP_007046403.1| Uncharacterized protein TCM_011922 [Theobroma cacao]
 gb|EOY02235.1| Uncharacterized protein TCM_011922 [Theobroma cacao]
Length=928

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 113/211 (54%), Gaps = 8/211 (4%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK  P+  F + ++   ++ F   LVGKF++  P + ++   F  IG    + + 
Sbjct  74    RNPVVYKDRPAAVFYEDEICILAKPFSLCLVGKFTR-MPKLQEVRSAFKGIGLSGAYEIK  132

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  HV+++ + + DF R W  +   I G  M   KWS +F    ESP+VPVWI+F   
Sbjct  133   WLDYKHVIIHLSNDQDFNRIWTRQQWFIVGQKMRIFKWSPEFEAEKESPVVPVWISFPNL  192

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM-----  773
              AHL +K A+  IA  IG PL VD +T   +RPS+ARVC E +      +Q+WI+     
Sbjct  193   KAHLYEKFALLLIAKTIGRPLFVDEATAKGSRPSVARVCAEYDCRKPPINQVWIVTQKRE  252

Query  772   NGSYGD-FAQKVTNEYIPPYCSGCRNTQGHN  683
              G+  + +AQKV    +P YC  C +  GHN
Sbjct  253   TGTVTNGYAQKVEFSQMPAYCDHCCHV-GHN  282



>ref|XP_007022832.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
 gb|EOY25454.1| Uncharacterized protein TCM_026877 [Theobroma cacao]
Length=2367

 Score =   136 bits (342),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 108/204 (53%), Gaps = 7/204 (3%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  +K  P+ +F + ++Q  +Q  + +LVGKFS+  P + D+   F  IG    + + 
Sbjct  109   RDPFVFKDRPAAAFYEDEIQTLAQPLKLSLVGKFSR-MPKLQDVRSAFKGIGLAGAYEVR  167

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L++   E D  R W  +   I    M   KW+ +F P  ES +VPVWIAF   
Sbjct  168   WLDYKHILIHLTNEHDCNRVWTKQVWFIANQKMRVFKWTPEFEPEKESAMVPVWIAFPNL  227

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM--NGS  764
              AHL +K A+  IA  +G PL VD +T + +RPS+ARVC+E +       Q+WI+  N  
Sbjct  228   KAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARVCIEYDCRKPPIDQVWIVVQNRE  287

Query  763   YGD----FAQKVTNEYIPPYCSGC  704
              G     + QKV    +P YC  C
Sbjct  288   TGTVTSGYPQKVEFSQMPAYCDHC  311



>ref|XP_007031313.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
 gb|EOY02239.1| Uncharacterized protein TCM_016763 [Theobroma cacao]
Length=2127

 Score =   135 bits (341),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 112/204 (55%), Gaps = 7/204 (3%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK  P+ +F + ++   +Q F+ +LVGKFS+  P + ++   F  IG    + + 
Sbjct  103   RDPFVYKDRPAAAFFEDEIHILAQPFKLSLVGKFSR-MPKLQEVRSAFKGIGLAGSYEIR  161

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L++ + E DF R W  ++  I    M   KW+ +F P  ES +VPVWI+F   
Sbjct  162   WLDYKHILIHLSNEQDFNRFWTKQAWFIANQKMRVFKWTPEFEPEKESAVVPVWISFPNL  221

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM--NGS  764
              AHL +K A+  IA  +G PL +D +T + +RPS+ARVC+E +       Q+WI+  N +
Sbjct  222   KAHLFEKSALLLIAKTVGKPLFIDEATANGSRPSVARVCIEYDCREPPVDQVWIVVQNRA  281

Query  763   YG----DFAQKVTNEYIPPYCSGC  704
              G     + QKV    +P YC  C
Sbjct  282   TGAVTSGYPQKVEFAQMPAYCDHC  305



>ref|XP_007031316.1| Uncharacterized protein TCM_016767 [Theobroma cacao]
 gb|EOY02242.1| Uncharacterized protein TCM_016767 [Theobroma cacao]
Length=1707

 Score =   128 bits (322),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 116/213 (54%), Gaps = 9/213 (4%)
 Frame = -1

Query  1345  RTFADVLSSNTDDS--PLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMA  1172
             ++F  ++++ T     P R    YK  P+V F + +++  ++ FRF++VGKFS+  P + 
Sbjct  81    KSFLSIVTAATSAVIPPTRATFRYKDKPAVRFYEDEIETLAKSFRFSIVGKFSR-TPRLV  139

Query  1171  DLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF  992
             ++ + F  +G    +++  +D  HVL++ + E DF R W  ++  I    M   K + +F
Sbjct  140   EIRQAFVGLGLSGAYNIRWMDYKHVLIHLSNEQDFNRIWTKQTWFIAKQKMRVFKGTPNF  199

Query  991   RPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVEL  812
                 ES IVPVWI+F    AHL +K A+  IA  IG+PL VD +T +  RPS+ARVC+E 
Sbjct  200   ESDKESSIVPVWISFPNLRAHLFEKSALLLIAKAIGNPLGVDEATANGTRPSVARVCIEY  259

Query  811   NVSNDLPHQIWIMNGSY------GDFAQKVTNE  731
             +        +WI+          G F QK+T +
Sbjct  260   DCLKSPIKSVWIVTSKRVLGQKSGTFKQKLTEK  292



>ref|XP_009621358.1| PREDICTED: uncharacterized protein LOC104112999 [Nicotiana tomentosiformis]
Length=274

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 110/210 (52%), Gaps = 15/210 (7%)
 Frame = -1

Query  1273  MPSVSFTDQDVQQ-FSQKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRIFSLGLLDQHH  1100
             MP++ F   D     +++ R  +VGKF + RP +  +   F ++I       +G+ D   
Sbjct  1     MPAIIFKASDYYGVMAEECRLTIVGKFLRTRPQIEKIRSKFAEKISTKGNVKIGVYDYRT  60

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQD  920
             V L+F  E DF+  W  +S+ I+G IM   KW+ DF+P V+SPIVPVW+       H   
Sbjct  61    VFLDFTNEDDFKSVWFKRSIEIEGQIMSLEKWTPDFKPDVDSPIVPVWVLLPELSFHCHT  120

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI--------MNGS  764
                +  IA  IG+PL +D +T    RP++A+V VE++++    + IW+        +NG 
Sbjct  121   WHYVKQIAGPIGTPLSMDIATDYRTRPNIAKVRVEVDLTKPKLNSIWVGSEDEQSPLNG-  179

Query  763   YGDFAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
                F Q +  E +P YC  C+   GH++ Q
Sbjct  180   ---FTQNLEYENVPKYCRHCK-LLGHSILQ  205



>ref|XP_007008705.1| Uncharacterized protein TCM_042331 [Theobroma cacao]
 gb|EOY17515.1| Uncharacterized protein TCM_042331 [Theobroma cacao]
Length=1176

 Score =   126 bits (317),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 107/211 (51%), Gaps = 8/211 (4%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK  P+  F +  +   ++ F   LVGKF++  P + ++   F  I     + + 
Sbjct  53    RDPVVYKDRPAAIFYEDKICTLAKPFSLYLVGKFTR-MPKLQEVKFAFKGIDLLGAYEIK  111

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  HV+++ + + DF R W  +   I G  M   KW L+F    ESPIVPVWI+F   
Sbjct  112   WLDYKHVIIHLSNDQDFNRIWTRQQWFIAGQKMRIFKWPLEFEAKTESPIVPVWISFPNL  171

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
              AHL +K A+  I   IG PL VD +T   +RP+MARVCV+ +       Q+WI+     
Sbjct  172   KAHLYEKFALLLIVKTIGKPLFVDEATTKGSRPTMARVCVKYDCRKLPIDQVWIVTQKRN  231

Query  757   D------FAQKVTNEYIPPYCSGCRNTQGHN  683
                    +AQKV   ++P Y   C +  GHN
Sbjct  232   TGIVTNGYAQKVEFSHMPNYWDHCCHV-GHN  261



>ref|XP_007032524.1| Uncharacterized protein TCM_018528 [Theobroma cacao]
 gb|EOY03450.1| Uncharacterized protein TCM_018528 [Theobroma cacao]
Length=590

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 104/189 (55%), Gaps = 3/189 (2%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK   +V+F +  +Q  ++ F  +LVGKF++  P +A++   F  IG    + +G
Sbjct  81    RDPVVYKDRHAVAFFEDKIQALAKPFMLSLVGKFTR-MPKLAEIRLAFKGIGLAGAYEIG  139

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L++   E DF   W  ++  I    M   K SL+     ESPIVP+WI+F   
Sbjct  140   WLDYKHILIHLFNEHDFNWIWTKQNWFIANQKMWVFKCSLEIEAEKESPIVPIWISFPKL  199

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM--NGS  764
              AHL +K  +  +A ++G PL VD +T   +RPS+AR+CVE +       Q+WI+  N  
Sbjct  200   KAHLYEKLVLLLVAKIVGKPLFVDEATTKGSRPSVARICVEYDCRKLPVDQVWIVIQNRE  259

Query  763   YGDFAQKVT  737
              G+  +K+T
Sbjct  260   TGEVTKKLT  268



>gb|KDP31715.1| hypothetical protein JCGZ_14928 [Jatropha curcas]
Length=194

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (2%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KW+ +FRP  +  IVPVWI FEG   HL DK A++ IANLIG PLKVDA+T + +R
Sbjct  1     MRVSKWTRNFRPNTDCSIVPVWILFEGLPIHLFDKAALFPIANLIGKPLKVDATTSTLSR  60

Query  841   PSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEP  668
              S+ARVCVEL++S DL +++WI NG  G F Q V+ E +P +C  C    GH +   P
Sbjct  61    RSVARVCVELDLSKDLHNRVWIDNGDLG-FFQPVSYESLPLFCPKCCRF-GHKIQSCP  116



>ref|XP_010275342.1| PREDICTED: uncharacterized protein LOC104610424 [Nelumbo nucifera]
Length=287

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/222 (32%), Positives = 115/222 (52%), Gaps = 7/222 (3%)
 Frame = -1

Query  1339  FADVLSSNTDDSPLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLK  1160
             F  VL     D PL+ P    G P+V F+++D+++     +FALVGK S GRPS+AD+ +
Sbjct  25    FLAVLDPPAVDIPLKVPSIKWGEPTVLFSEEDIEKSLSPLQFALVGKCSYGRPSLADIRE  84

Query  1159  PFDQIGFGRI---FSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFR  989
                 +G  R+     +  LD  HVLL F  E ++ R WL +++ I  F++  +KW+    
Sbjct  85    FL--VGTFRLQKDIVVTALDSRHVLLRFESEEEYLRAWLRQAIIITDFLLTFLKWTPGLE  142

Query  988   PYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELN  809
                E  +VP+W        +  + + + SI  + G  LKVD +T    R +  RVC+ ++
Sbjct  143   LGWEPLVVPLWNFLPMLPVNFYNDKYLRSIVQVAGRVLKVDPATARLTRTTAGRVCMVVD  202

Query  808   VSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             +  + P ++W+     G F QK+  E +P YC+ C    GH 
Sbjct  203   LLKENPSRVWVGLSKEG-FWQKIVYENLPKYCTFCFK-HGHG  242



>ref|XP_007036697.1| Uncharacterized protein TCM_012582 [Theobroma cacao]
 gb|EOY21198.1| Uncharacterized protein TCM_012582 [Theobroma cacao]
Length=947

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 106/200 (53%), Gaps = 7/200 (4%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK  P+ +F + ++Q+ +Q F  +++GKFS   P + ++ + F  IG    +++ 
Sbjct  99    RDPITYKDRPAAAFFEDEIQKLAQPFVHSIIGKFS-CMPKLQEIRQAFKGIGLTGAYAIR  157

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L++ + E DF   W  +   I    M   KWSLDF    ES IV VWI+F   
Sbjct  158   WLDYKHILIHLSNEQDFNWIWTKQQWFIVNQKMRVFKWSLDFEVERESSIVLVWISFPNL  217

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM-----  773
               HL +K  +  IA  +G PL +  +T + +RPS+A+VCVE +  N    ++WI+     
Sbjct  218   KVHLYEKSTLLLIAKTVGKPLFIAEATTNGSRPSVAQVCVEYDCRNAPVEEVWIVIKNRV  277

Query  772   -NGSYGDFAQKVTNEYIPPY  716
                  G +AQ+V    +P Y
Sbjct  278   TRAITGGYAQRVEFSKMPDY  297



>ref|XP_010272338.1| PREDICTED: uncharacterized protein LOC104608143 [Nelumbo nucifera]
Length=321

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/213 (33%), Positives = 111/213 (52%), Gaps = 2/213 (1%)
 Frame = -1

Query  1339  FADVLSSNTDDSPLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLK  1160
             F  +L     D PL+ P    G P+V F ++D+++     +FALVGK S G PS+  + +
Sbjct  25    FPTILDPPAVDIPLKVPSIKMGEPTVLFLEEDIEKSLSSLQFALVGKCSYGPPSLVKIRE  84

Query  1159  PF-DQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPY  983
                      +   +  LD  HVLL F  E D  R WL + + IK F++  +KW       
Sbjct  85    FLVSMFRLQKSIIVTTLDPRHVLLKFESEEDSIRVWLLEDIFIKDFLLRFLKWMPGLELG  144

Query  982   VESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVS  803
              E  +VP+WI+    L +L + + + SI  + G  +KVD +T    R + ARVC+E+++ 
Sbjct  145   WEPSMVPLWISLPMLLINLYNDKYLRSIVQVAGRVIKVDLATTHLTRTTTARVCMEVDLL  204

Query  802   NDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGC  704
              + P ++W+  G  G F QK+  E +P YC+ C
Sbjct  205   KENPSRVWVRLGKEG-FWQKIVYENLPKYCTFC  236



>ref|XP_007023857.1| Uncharacterized protein TCM_028230 [Theobroma cacao]
 gb|EOY26479.1| Uncharacterized protein TCM_028230 [Theobroma cacao]
Length=748

 Score =   115 bits (287),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 94/177 (53%), Gaps = 9/177 (5%)
 Frame = -1

Query  1192  KGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGT  1013
             + RP+  ++   F  IG    + +  LD  H+ +  + E D  R WL +   I    +  
Sbjct  87    RDRPT--EIRNAFKGIGLAGAYDIRWLDYKHIHIGLSNEQDMNRIWLKQVWFISNQKLRV  144

Query  1012  VKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSM  833
              KW+ DF+P  ES +VPVWI+F    AHL +K A+  IA  +G PL VD +T +  RPS+
Sbjct  145   FKWTKDFQPEKESSLVPVWISFPNLRAHLYEKSAVLVIAKTVGRPLFVDEATDNGTRPSL  204

Query  832   ARVCVELNVSNDLPHQIWIM-----NGSY-GDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             ARVC+E +       Q+WI+      G   G F QKV  E +P YC+ C +  GH++
Sbjct  205   ARVCIEYDCLKPPLDQVWIVMRDRRTGEITGGFMQKVDFERMPDYCTHCCHV-GHSV  260



>ref|XP_007014621.1| Uncharacterized protein TCM_039863 [Theobroma cacao]
 gb|EOY32240.1| Uncharacterized protein TCM_039863 [Theobroma cacao]
Length=548

 Score =   113 bits (283),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 89/164 (54%), Gaps = 1/164 (1%)
 Frame = -1

Query  1303  PLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFS  1124
             P R    YK  P+  F D ++Q  +  F  +LVGKF++  P + D+ + F  IG  R + 
Sbjct  40    PTRNLSTYKDRPAAMFYDDEIQILAHPFSHSLVGKFTR-MPKLQDIQQAFRGIGLLREYE  98

Query  1123  LGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFE  944
             +  +D  HVL++ + E DF   W+ +   I    M   KW+ DF    E  +VPVWI+F 
Sbjct  99    IRWMDYKHVLIHLSNEQDFNHLWVKEQWFILNQKMRVFKWTPDFEAEKELALVPVWISFP  158

Query  943   GFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVEL  812
                AHL +K A+  IA  +G PL VD +T + +R S+ARV VE 
Sbjct  159   NLRAHLYEKSALMLIAKTVGKPLYVDEATTNGSRSSVARVYVEF  202



>ref|XP_007020288.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
 gb|EOY17513.1| Uncharacterized protein TCM_036737 [Theobroma cacao]
Length=2215

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 89/166 (54%), Gaps = 6/166 (4%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKW  1004
             P + D+   F  I     + +  LD  HVL++ + E DF R W  ++  I    M   KW
Sbjct  2     PKLQDVRAAFKGIALTGAYEVRWLDYKHVLIHLSNEQDFNRIWTKQNWFIATQKMRVFKW  61

Query  1003  SLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
             + +F P  ES +VPVWI+F    AHL +K A+  IA  +G PL VD +T + +RPS+ARV
Sbjct  62    TPEFEPEKESAVVPVWISFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARV  121

Query  823   CVELNVSNDLPHQIWIM--NGSYGD----FAQKVTNEYIPPYCSGC  704
             CVE +       Q+WI+  N   G+    ++Q+V    +P YC  C
Sbjct  122   CVEYDCRKSPVDQVWIVVQNRKTGEVMNGYSQRVEFAQMPAYCDHC  167



>ref|XP_007017131.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
 gb|EOY14356.1| Uncharacterized protein TCM_033752 [Theobroma cacao]
Length=2251

 Score =   113 bits (282),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 86/166 (52%), Gaps = 6/166 (4%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKW  1004
             P + D+   F  IG    + +  LD  HVL++ + E D  R W  +   I    M   KW
Sbjct  2     PKLQDVRSAFKGIGLTGAYEVRWLDYKHVLIHLSNEQDCNRVWTKQVWFIANQKMRVFKW  61

Query  1003  SLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
             + DF P  ES +VPVWIAF    AHL +K A+  IA  +G PL VD +T + +RPS+ARV
Sbjct  62    TPDFEPEKESAVVPVWIAFPNLKAHLFEKSALLLIAKTVGKPLFVDEATANGSRPSVARV  121

Query  823   CVELNVSNDLPHQIWIM--NGSYGD----FAQKVTNEYIPPYCSGC  704
             C+E +       Q+WI+  N   G     + Q+V    +P YC  C
Sbjct  122   CIEYDCRRSPIDQVWIVVQNRETGTVTSGYPQRVEFSQMPAYCDHC  167



>ref|XP_007031317.1| Uncharacterized protein TCM_016768 [Theobroma cacao]
 gb|EOY02243.1| Uncharacterized protein TCM_016768 [Theobroma cacao]
Length=351

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 89/174 (51%), Gaps = 7/174 (4%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKW  1004
             P + ++   F  I     + +  LD  H+L+  + E D  R WL +   I    M   KW
Sbjct  86    PRINEIRMAFKGIDLVGAYEIKWLDYKHILIQLSNEHDLNRIWLKQVWFISNQKMCVFKW  145

Query  1003  SLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
             + +F+P  ES +VPVWI+F    AHL +K A+  IA  +G PL VD +T    RPS+ARV
Sbjct  146   TPNFQPEKESSLVPVWISFPNLRAHLYEKFALLVIAKTVGRPLMVDEATAKGTRPSVARV  205

Query  823   CVELNVSNDLPHQIWIM-----NGSY-GDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             C+E +       Q+WI+      GS  G + QKV    +  YCS C +  GH +
Sbjct  206   CIEYDCQKPPIDQVWIVTRDRKTGSVIGGYMQKVDFAKLLEYCSHCCHV-GHGV  258



>ref|XP_007022378.1| Uncharacterized protein TCM_032655 [Theobroma cacao]
 gb|EOY13903.1| Uncharacterized protein TCM_032655 [Theobroma cacao]
Length=217

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 91/176 (52%), Gaps = 15/176 (9%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKW  1004
             P + ++   F  IG    + +  LD  HVL++ + E +F R W  ++  I    M   KW
Sbjct  2     PKLQEVKYAFKGIGLAGAYEVRWLDYKHVLIHLSDEQNFNRIWTKQNWFIANQKMRVFKW  61

Query  1003  SLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
             + +F P  ES +VP+WI+F    AHL +K  +  IA  +G PL +D +T + +RPS+A V
Sbjct  62    TPEFEPEKESAVVPIWISFPNLKAHLFEKSTLLLIAKTVGKPLFLDEATTNGSRPSVAHV  121

Query  823   CVELNVSNDLPHQIWI----------MNGSYGDFAQKVTNEYIPPYCSGCRNTQGH  686
             CVE +    +  Q+WI          MNG    ++QKV   ++P Y   C +  GH
Sbjct  122   CVEYDCRKRMVEQVWIVVQNRETSAVMNG----YSQKVEFAHMPAYYDHCCHV-GH  172



>ref|XP_009610625.1| PREDICTED: uncharacterized protein LOC104104285 [Nicotiana tomentosiformis]
Length=306

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 106/205 (52%), Gaps = 9/205 (4%)
 Frame = -1

Query  1273  MPSVSFTDQDVQQ-FSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGR-IFSLGLLDQHH  1100
             MP+V F   D     + + R  +VGKF K RP +  +   F ++ F +    +G+ D ++
Sbjct  1     MPAVLFKASDYYGIMADECRLTIVGKFLKPRPQIDRIRSKFKELIFIKGSVKIGVYDNYN  60

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQD  920
             V L+F  E DF   W  + + I+G  M   +WS DF+P  + P+ PVW+       H+  
Sbjct  61    VFLDFTNEEDFNFFWYKRVVEIEGQQMWLQRWSPDFKPKEDLPVAPVWVLLPRLHFHMHR  120

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGD-----  755
              + +  + + +G+PL++D +T    RPSMA+V +E+++    P  +++    Y D     
Sbjct  121   WQYVKQVVSAVGTPLEMDLATRGKARPSMAKVRIEIDLLKQQPDSVYV-GQVYDDAPQKG  179

Query  754   FAQKVTNEYIPPYCSGCRNTQGHNL  680
             F QK+  E +P Y   CR  + HN+
Sbjct  180   FVQKLEYEGVPRYYKHCRKLR-HNM  203



>ref|XP_007008704.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
 gb|EOY17514.1| Uncharacterized protein TCM_042330 [Theobroma cacao]
Length=2249

 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 85/171 (50%), Gaps = 14/171 (8%)
 Frame = -1

Query  1216  FALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLS  1037
              +LVGKFS+  P + D+   F  IG    + +  LD  H+L++   E D  R W  +   
Sbjct  1     MSLVGKFSR-MPKLQDIRSAFKGIGLAGAYEVRWLDYKHILIHLTNEHDCNRVWTKQVWF  59

Query  1036  IKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDAST  857
             I    M   KW+ DF P  ES +VPVWIAF    AHL +K A+  IA  +G PL VD +T
Sbjct  60    IANQKMRVFKWTPDFEPEKESAVVPVWIAFPNLKAHLFEKSALLLIAKTVGKPLFVDEAT  119

Query  856   LSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGC  704
              + +RPS+ARVC+E +                    Q+V    +P YC  C
Sbjct  120   ANGSRPSVARVCIEYDCRRP-------------PIDQRVEFSQMPAYCDHC  157



>ref|XP_007040947.1| Uncharacterized protein TCM_016754 [Theobroma cacao]
 gb|EOY25448.1| Uncharacterized protein TCM_016754 [Theobroma cacao]
Length=868

 Score =   109 bits (273),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 89/176 (51%), Gaps = 7/176 (4%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKW  1004
             P M ++   F  IG    + L  LD  H+L++   + DF R W+ +   I    +   KW
Sbjct  2     PRMNEIRLAFKGIGLTGAYDLRWLDYKHILIHLTNQHDFNRIWIRQVWFIANQKLRVFKW  61

Query  1003  SLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
             S DF+P  ES +V VWI+F     HL +K A+  IA  +G  L  D +T + +RPS+ARV
Sbjct  62    SPDFQPEKESSLVSVWISFPNLRTHLHEKSALMIIAKAVGKLLFADEATANGSRPSVARV  121

Query  823   CVELNVSNDLPHQIWIMN------GSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
             CVE +        IWI++       + G F Q+     +P YCS C +  GH + +
Sbjct  122   CVEYDCQKQPLDHIWIVSRDQKTRAAVGGFTQRENFSKLPDYCSHCGHV-GHAISE  176



>ref|XP_009794929.1| PREDICTED: uncharacterized protein LOC104241685 [Nicotiana sylvestris]
Length=228

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 97/192 (51%), Gaps = 6/192 (3%)
 Frame = -1

Query  1234  FSQKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRIFSLGLLDQHHVLLNFNMELDFQRC  1058
              +++ ++ ++GKF + RP++  +   F  ++       +G+ D   V ++   E D +  
Sbjct  1     MTEECKYTIIGKFLRTRPNIERIRSIFAKKVSIKGEAKIGVYDFRTVFIDVTNEKDCKTV  60

Query  1057  WLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSP  878
             W  +S+ I G +M   KWS +F+P  +SPIVP+W    G   H      +  I   +G P
Sbjct  61    WFRRSIEIDGMVMWLQKWSPNFKPEEDSPIVPIWFLLLGLPFHCHTWNYVKKILGPLGVP  120

Query  877   LKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG----DFAQKVTNEYIPPYCS  710
             L +D +T    RP MA+V V+++++  L + IW+           F QK+  E +P YC 
Sbjct  121   LSMDIATNYRTRPGMAKVRVKVDLTKPLVNSIWVGQEEEAYPLKGFTQKLEYEGVPKYCK  180

Query  709   GCRNTQGHNLHQ  674
              CR   GH++ Q
Sbjct  181   HCR-ILGHSVLQ  191



>ref|XP_007042412.1| Uncharacterized protein TCM_007050 [Theobroma cacao]
 gb|EOX98243.1| Uncharacterized protein TCM_007050 [Theobroma cacao]
Length=341

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 2/156 (1%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKW  1004
             P + D+ K F  +G    +++  ++  H+L+N + E DF R W  ++  I    M   KW
Sbjct  2     PRLTDIRKSFVGLGLSGAYNVRWMNYKHILINLSNEQDFNRIWRKQTWFIANQKMRVFKW  61

Query  1003  SLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
             + DF    ES IVPVWI+F    AHL +K A+  IA  IG PL VD +T +  RPS+ARV
Sbjct  62    TPDFETEKESSIVPVWISFPNLKAHLFEKSALLLIAKAIGYPLYVDEATANGTRPSVARV  121

Query  823   CVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPY  716
             C+E +        +WI+    G   + ++  Y+  Y
Sbjct  122   CIEYDCLKAPLDSVWIVVSKRG--LEDMSGGYLQKY  155



>ref|XP_009758915.1| PREDICTED: uncharacterized protein LOC104211540 isoform X1 [Nicotiana 
sylvestris]
Length=392

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 102/209 (49%), Gaps = 7/209 (3%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQ-FSQKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRIFSLGLLD  1109
             + GMP+V F  +D     +++ +  +VGKF + RP +  +   F +          G  D
Sbjct  64    HNGMPAVIFKAKDYYGVMAEECKLTVVGKFLRTRPKIEVIRAVFMENFSLKGTVKFGAYD  123

Query  1108  QHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAH  929
             +  V ++F+ E D +  +  ++L I GF M    W+ DFRP  +SPIVPVW      L H
Sbjct  124   RRSVFIDFSDEQDCKNFYFRRALKINGFQMWLEMWTPDFRPDHDSPIVPVWFLLPELLFH  183

Query  928   LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGD--  755
                      +   +G PL +D +T    RPS A+V V+++++      +++      +  
Sbjct  184   CHSWHYAKQVLKPVGKPLSMDVATFGRTRPSTAKVRVDIDLTKPQETSVYVGQEEETNPL  243

Query  754   --FAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
               F +K+  E++P YC  C+   GH+L Q
Sbjct  244   KGFTEKIEYEHVPKYCKHCKLI-GHSLVQ  271



>ref|XP_009765415.1| PREDICTED: uncharacterized protein LOC104216966 [Nicotiana sylvestris]
Length=407

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 106/209 (51%), Gaps = 7/209 (3%)
 Frame = -1

Query  1282  YKGMPSVSF-TDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRIFSLGLLD  1109
             + GMP++ F         +++ R  +VGKF + RP +  +   F ++I       +G+ D
Sbjct  64    HNGMPAIIFKASYYYGVMAEECRLTIVGKFLRTRPQIEKIRSKFAEKITVKGNVKIGVYD  123

Query  1108  QHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAH  929
                V L+F+ E D +  W  +S+ I+  +M   +W+ DF+P  +SP+VPVW+       H
Sbjct  124   YGTVFLDFSNEDDLKSVWYRRSIEIEVQVMWLEQWTPDFKPEEDSPVVPVWVLLPDLPFH  183

Query  928   LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI----MNGSY  761
                   I  I + IG PL +D +T +  RPSMA+V +E++++    + +W+         
Sbjct  184   CHTWYYIKQILSPIGIPLTMDMATNNKTRPSMAKVRIEVDLTKPKLNSVWVGQEYETSPL  243

Query  760   GDFAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
               F QK+  E +P Y   CR   GH+L Q
Sbjct  244   KGFTQKLEYENVPKYYRHCR-LLGHSLVQ  271



>ref|XP_009784900.1| PREDICTED: uncharacterized protein LOC104233234 [Nicotiana sylvestris]
Length=381

 Score =   105 bits (261),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 110/218 (50%), Gaps = 13/218 (6%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQF--SQKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRI  1130
             L P     G P + FT  DV++F   +    A+V KFS G+P + D  + F  Q      
Sbjct  44    LCPVRFEHGEPIIEFTTDDVKEFVIEEGLHQAVVIKFSYGKPELHDFRRIFPKQFDVKGS  103

Query  1129  FSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKG----FIMGTVKWSLDFRPYVESPIVP  962
              ++G L+  H+L+ F +  D+       +  I      F   T  W++ F P +E+    
Sbjct  104   CNIGQLEFRHLLVRFELYEDYVNFVSRSTGHINSNGDEFFFRTFPWTIGFDPRIETSKAV  163

Query  961   VWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQI  782
             VWI+F     +   K+++ SIA+ +G PL +D +     RPS ARV V L++ +  P ++
Sbjct  164   VWISFPDLPPNYFAKKSLMSIASAVGKPLAIDKAMKDRTRPSAARVKVLLDLLDKHPKKV  223

Query  781   WI-----MNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
              I     + G   DF+QKV  +Y+P YC+ C++ QGH+
Sbjct  224   KISVVDKICGKSNDFSQKVIYDYLPMYCTCCKH-QGHD  260



>ref|XP_007013771.1| Uncharacterized protein TCM_038318 [Theobroma cacao]
 gb|EOY31390.1| Uncharacterized protein TCM_038318 [Theobroma cacao]
Length=203

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 89/174 (51%), Gaps = 7/174 (4%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKW  1004
             P + ++ + F  IG    +++  LD  HVL++ + E DF R W+ +   I    M   KW
Sbjct  2     PKLQEIHQAFKGIGLTGAYAIPWLDYKHVLVHLSNEQDFNRIWIKQQWFIVNKKMRVFKW  61

Query  1003  SLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
             S DF    ES IVPVWI F    AHL +K A+  IA  +G PL +D +T + +RPS+ARV
Sbjct  62    SPDFEAEKESAIVPVWIFFPNLKAHLYEKLALLLIAKTMGKPLFIDKATTNGSRPSVARV  121

Query  823   CVELNVSNDLPHQIWI------MNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
              VE +      +Q+WI      +      + Q V    +  YC  C +  GH++
Sbjct  122   YVEYDCKKASVNQVWIVVKDWVIGAVIRGYTQWVEFSKMLKYCDHCCHV-GHSV  174



>ref|XP_009801081.1| PREDICTED: uncharacterized protein LOC104246885 [Nicotiana sylvestris]
Length=209

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 83/162 (51%), Gaps = 9/162 (6%)
 Frame = -1

Query  1147  IGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI  968
             I    +  +G+ D ++V ++   E DF+  W  + + I+G  M   KWS DF+P  + PI
Sbjct  20    IALKGVAKIGVYDNYNVFIDLFNEDDFKTVWFNRIIEIEGMQMWLQKWSPDFKPEEDLPI  79

Query  967   VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
              P W+   G   H+ D   I  + + +G PL +D +T    RPSMA + VE+N+   LP 
Sbjct  80    APAWVLIPGLPFHMHDWYYIKQLLSSVGRPLALDVATFGRTRPSMANMRVEVNLLKPLPD  139

Query  787   QIWIMNGSYGD------FAQKVTNEYIPPYCSGCRNTQGHNL  680
              +++  G   D      F QK+  E +P YC  CR   GHN+
Sbjct  140   SVFV--GQEDDESPLKGFTQKLEYEEVPKYCKHCRKL-GHNM  178



>ref|XP_009783436.1| PREDICTED: uncharacterized protein LOC104232043 [Nicotiana sylvestris]
Length=339

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 111/221 (50%), Gaps = 19/221 (9%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQFSQK--FRFALVGKFSKGRPSMADLL----KPFDQIGF  1139
             L P     G P+V FT ++V  F+ +     A++ KFS G+P + +L     K FD  G+
Sbjct  50    LCPVTFEHGEPTVEFTIEEVNAFTMEEGLHQAVILKFSYGKPDLQELRQIISKQFDVKGY  109

Query  1138  GRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKG----FIMGTVKWSLDFRPYVESP  971
               I   G L+  H+L+ F++  DF +     +  IK     F   T  W++ F P  E+ 
Sbjct  110   CNI---GQLEYRHILIRFDLFEDFVQALSRSTGYIKAKGDEFFFRTFPWTIGFNPREETS  166

Query  970   IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
                VWI+     A+   KR++ SIA+ +G PL VD +T    RPS ARV V L++ +  P
Sbjct  167   RAVVWISLPDLPANFFAKRSLMSIASAVGKPLAVDKATQDRTRPSTARVKVVLDLLDKHP  226

Query  790   HQIWIM-----NGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
              +I I      +G   +  Q++  + +P YC+ C   QGH+
Sbjct  227   KRIKIHIMDKNSGKVVEHYQEIVYDNLPKYCT-CYKHQGHD  266



>ref|XP_009790478.1| PREDICTED: uncharacterized protein LOC104237944 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009790479.1| PREDICTED: uncharacterized protein LOC104237944 isoform X2 [Nicotiana 
sylvestris]
Length=681

 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 73/222 (33%), Positives = 117/222 (53%), Gaps = 21/222 (9%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQFS--QKFRFALVGKFSKGRPSMADLL----KPFDQIGF  1139
             L P     G PSV FT ++V  F+  +    A++ KFS G+P +  L     K FD  G+
Sbjct  22    LCPVTFEHGEPSVEFTIEEVNAFTIEEGLHQAVIIKFSYGKPDLQKLRQLIPKQFDVKGY  81

Query  1138  GRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSI---KG--FIMGTVKWSLDFRPYVES  974
               I   G L+ HH+L+ F++  D+ + +L +S      KG  +   T  W+L F P  E+
Sbjct  82    CNI---GQLEYHHLLVRFDLFNDYVQ-FLSRSTGYFKSKGDEYFFRTFPWTLGFNPKEET  137

Query  973   PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDL  794
              +  VWI+  GF  +   KR++ SIA+ +G PL VD +T    RPS ARV V +++ +  
Sbjct  138   SMAVVWISLPGFPPNFFAKRSLLSIASAVGKPLAVDKATQQRTRPSAARVKVIIDLLDKH  197

Query  793   PHQIWIM-----NGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             P ++ +       G Y    Q++  + +P YC+ C++ QGH+
Sbjct  198   PKKVKLQIVDRATGKYVVHYQEIVYDNLPKYCNCCKH-QGHD  238



>ref|XP_010319987.1| PREDICTED: uncharacterized protein LOC104647107 [Solanum lycopersicum]
Length=1448

 Score =   106 bits (265),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 111/207 (54%), Gaps = 14/207 (7%)
 Frame = -1

Query  1279  KGMPSVSFT-DQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFD-QIGFGRIFSLGLLDQ  1106
             +G+P+V +  D+ V+  +   +F L+GKF    P +  + K F  Q        +   + 
Sbjct  58    QGLPAVLYVKDEIVKDLASTCKFTLIGKFIYTMPKVELIRKNFILQTQLSGGVKIAHFNS  117

Query  1105  HHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHL  926
              HV ++ + ELD+   W  + ++I G +M    W+ +F+P  E+P+VP+WI+      H 
Sbjct  118   RHVYIDLDNELDYNIVWTKQRMTIAGQVMRIQAWTPNFKPDEETPLVPIWISLPELPWHC  177

Query  925   QDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIW-------IMNG  767
              +K  I S+ + IG  L +D+++++  R S ARV V+++++ D P  IW       I++G
Sbjct  178   YNKEFITSLLSPIGRVLYLDSASINKTRGSQARVKVQVDLTKDRPSHIWMGYIGEDIIDG  237

Query  766   SYGDFAQKVTNEYIPPYCSGCRNTQGH  686
              +    QK+  + IP YC  C++ QGH
Sbjct  238   RW----QKIDYDNIPDYCFYCKH-QGH  259



>ref|XP_011075252.1| PREDICTED: uncharacterized protein LOC105159763 [Sesamum indicum]
Length=476

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 96/197 (49%), Gaps = 37/197 (19%)
 Frame = -1

Query  1270  PSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLL  1091
             P++ FTD + +  +  FRFALVGKFS G PS + L K     G    F+           
Sbjct  112   PTLQFTDAETEILAAPFRFALVGKFSHGAPSYSMLHKLMAGTGIKNRFT-----------  160

Query  1090  NFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRA  911
                                 G+ M   KW+  F P  ES IVP W++F    A+L  K  
Sbjct  161   --------------------GYPMRVFKWTPTFTPSQESSIVPGWVSFPELPAYLFRKEV  200

Query  910   IYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH--QIWIMNGSYGDFAQKVT  737
             ++++A++IG+PL++D +TL+ ++ S AR C+EL++        QI I   +     Q++ 
Sbjct  201   LFTVASMIGTPLQIDDATLNQSKLSKARACIELDLLKPRLENFQIQICGTT---IVQRIE  257

Query  736   NEYIPPYCSGCRNTQGH  686
              E IP YCS C+   GH
Sbjct  258   YEDIPHYCSLCKQV-GH  273



>ref|XP_009785329.1| PREDICTED: uncharacterized protein LOC104233603 [Nicotiana sylvestris]
 ref|XP_009785330.1| PREDICTED: uncharacterized protein LOC104233603 [Nicotiana sylvestris]
Length=539

 Score =   102 bits (253),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 68/213 (32%), Positives = 108/213 (51%), Gaps = 19/213 (9%)
 Frame = -1

Query  1276  GMPSVSFTDQDVQQF--SQKFRFALVGKFSKGRPSMADLL----KPFDQIGFGRIFSLGL  1115
             G P V FT  DV++F   +    A+V KFS G+P + D      K FD  G   I   G 
Sbjct  52    GEPIVEFTTDDVKEFVIEEGLHQAVVIKFSYGKPELHDFRRIFPKQFDVKGSCNIGQSGF  111

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKG----FIMGTVKWSLDFRPYVESPIVPVWIAF  947
                 H+L+ F++  D+       +  I      F   T  W++ F P +++    VWI+F
Sbjct  112   ---RHLLVRFDLYEDYVNFVSRSTGHINSNGDEFFFRTFPWTIGFDPRIKTSKAVVWISF  168

Query  946   EGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI---  776
                  +   K+++ SI + +G PL +D +T    RPS+ARV V L++ +  P ++ I   
Sbjct  169   PDLPPNYFAKKSLISIPSAVGKPLAIDKATKDRTRPSVARVKVLLDLLDKHPKKVKISVV  228

Query  775   --MNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
               ++G + +F QKV  +Y+P YC+ C N QGH+
Sbjct  229   DKLSGKFNNFCQKVIYDYLPMYCTCC-NHQGHD  260



>ref|XP_009764067.1| PREDICTED: uncharacterized protein LOC104215844 [Nicotiana sylvestris]
Length=354

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/223 (29%), Positives = 104/223 (47%), Gaps = 12/223 (5%)
 Frame = -1

Query  1318  NTDDSPLRPPGHYKGMPSVSFTDQDVQQ-FSQKFRFALVGKFSKGRPSMADLLKPF-DQI  1145
             NT     R   H +  P V F   D     ++  ++ LV KF+ GRP +  +   F +QI
Sbjct  51    NTSTVVARQTTHNRK-PVVIFKASDYYGVMAENCKWTLVRKFTMGRPKIETIRAKFIEQI  109

Query  1144  GFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV  965
                    +G  D  H  + FN E D    +  + + I G ++   KWS DF P  E+ + 
Sbjct  110   PLKGKVRIGAYDYKHDFIEFNNETDLNTPYFQRFMGIYGALLRMFKWSPDFNPNEETSLA  169

Query  964   PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQ  785
             P+WI       H+     +  +   IG+P+K D +T++  R  MA+V VE+++   LP+ 
Sbjct  170   PIWILLPELPFHMFKWEYLKQVLEQIGTPMKEDIATIARTRSYMAKVRVEVDLMKSLPNS  229

Query  784   IWIMNGSYGDFA------QKVTNEYIPPYCSGCRNTQGHNLHQ  674
             ++I  G  GD        QK+  E +P +C  C+   GH+  +
Sbjct  230   VFI--GIEGDTTRLKGKDQKLEYEGVPTFCKTCK-LYGHDYER  269



>ref|XP_009801511.1| PREDICTED: uncharacterized protein LOC104247246 [Nicotiana sylvestris]
Length=304

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 116/218 (53%), Gaps = 15/218 (7%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQFS--QKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRI  1130
             L P     G   + FT ++V+QF+  +    A++ KFS G+P + DL K    Q     +
Sbjct  50    LNPVKFVHGELIIEFTMEEVKQFTIEEGLHQAVIMKFSYGKPDVHDLYKLIPKQYDIKGM  109

Query  1129  FSLGLLDQHHVLLNFNMELDFQRCWLWKSLSI---KG--FIMGTVKWSLDFRPYVESPIV  965
              ++G L+  H+L+ FN+  D+ + +L +S+     KG  F   T  W++ F P  E+   
Sbjct  110   CNIGQLEFRHILVRFNLFEDYVQ-FLSRSVGYIKDKGDEFFFRTFPWTIGFNPKEETSKS  168

Query  964   PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQ  785
              VWI+      ++  K+++ SIA+ +G PL VD  T    RPS ARV + L++ +  P +
Sbjct  169   VVWISLPDLPPNIFAKKSLLSIASAVGKPLAVDKETQDRTRPSAARVKILLDLLDKHPKR  228

Query  784   I--WIMNGSYGDFA---QKVTNEYIPPYCSGCRNTQGH  686
             +   I++ S G F    Q+V  + +P +C+ C++ QGH
Sbjct  229   VKLHIVDKSTGKFVEHYQEVVYDNLPKFCTFCKH-QGH  265



>ref|XP_009796298.1| PREDICTED: uncharacterized protein LOC104242883 [Nicotiana sylvestris]
 ref|XP_009796299.1| PREDICTED: uncharacterized protein LOC104242883 [Nicotiana sylvestris]
Length=524

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/218 (32%), Positives = 117/218 (54%), Gaps = 15/218 (7%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQFS--QKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRI  1130
             L P     G P + FT ++V QF+  +    A++ KFS G+P + +L K    Q     +
Sbjct  50    LIPVKFVHGEPIIEFTMEEVNQFTIEEGLHQAVIMKFSYGKPDVHELRKLVPKQYDIKGM  109

Query  1129  FSLGLLDQHHVLLNFNMELDFQRCWLWKSLSI---KG--FIMGTVKWSLDFRPYVESPIV  965
              ++G L+  H+L+ F++  D+ + +L +S+     KG  F   T  W++ F P  E+   
Sbjct  110   CNIGQLEFRHILVRFDLFEDYVQ-FLSRSVGYIKDKGDEFFFRTFPWTIGFNPKEETSKS  168

Query  964   PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQ  785
              VWI+F     +   K+++ SIA+ +G PL VD +T    RPS ARV V L++ +  P +
Sbjct  169   VVWISFPDLPPNFFAKKSLLSIASAVGKPLAVDKATQDQTRPSAARVKVLLDLLDKHPKR  228

Query  784   I--WIMNGSYGDFA---QKVTNEYIPPYCSGCRNTQGH  686
             +   I++ S G F    Q+V  + +P +C+ C++ QGH
Sbjct  229   VKLHIVDKSTGKFVEHYQEVVYDNLPKFCTFCKH-QGH  265



>ref|XP_007010894.1| Uncharacterized protein TCM_044962 [Theobroma cacao]
 gb|EOY19704.1| Uncharacterized protein TCM_044962 [Theobroma cacao]
Length=439

 Score = 95.1 bits (235),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 93/212 (44%), Gaps = 43/212 (20%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK   + SF + +    +Q F+F +VGKFS+  P M ++   F  IG    + + 
Sbjct  14    REPIWYKDRLTASFFEDEFYALAQPFKFTMVGKFSR-MPRMQEIRAAFKGIGLIGAYEIK  72

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L+    E D  R WL +                            VW      
Sbjct  73    WLDYKHILIQLMHEHDLNRIWLKQ----------------------------VW------  98

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMN----  770
              AHL +K A+  IA  +G PL  D +T +  RPS+A VCVE +       Q+WI+     
Sbjct  99    -AHLYEKSALLVIAKTVGRPLLADEATANGTRPSVAWVCVEYDCQKPPIEQVWIVTRDRQ  157

Query  769   -GS-YGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
              GS  G + QKV    +P YC+ C +  GH +
Sbjct  158   IGSVMGGYMQKVEFARLPEYCTHCCHV-GHGI  188



>ref|XP_007028079.1| Uncharacterized protein TCM_023221 [Theobroma cacao]
 gb|EOY08581.1| Uncharacterized protein TCM_023221 [Theobroma cacao]
Length=450

 Score = 92.4 bits (228),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 83/166 (50%), Gaps = 7/166 (4%)
 Frame = -1

Query  1222  FRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKS  1043
             F+ +++ KF+   P M ++   F  I     + +  LD  +VL+    E DF R W+ + 
Sbjct  6     FKHSVIEKFT-NMPCMQEIRMTFKGIELVGAYEIWWLDYKYVLIFLTNEHDFNRIWICQV  64

Query  1042  LSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDA  863
               I    +   KWSL F+   ES +VPVW +F     HL +K A+  IA  +  P  VD 
Sbjct  65    WFIVNKKIRVFKWSLKFQLEKESSVVPVWFSFPNLPVHLHEKSALMMIARTVDKPFFVDE  124

Query  862   STLSHNRPSMARVCVELNVSNDLPHQIWIMN------GSYGDFAQK  743
             +T + +RPS+ARVCVE +        +WI++         G F+QK
Sbjct  125   ATANRSRPSVARVCVEYDCQKPPLDHVWIVSHDRETKAMTGGFSQK  170



>ref|XP_007010246.1| Uncharacterized protein TCM_043721 [Theobroma cacao]
 gb|EOY19056.1| Uncharacterized protein TCM_043721 [Theobroma cacao]
Length=359

 Score = 91.3 bits (225),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 76/143 (53%), Gaps = 6/143 (4%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFL  935
             ++  H+L++ + E DF R W  ++  I    M   KW+ +F    E   VPVWI+F    
Sbjct  22    MNYKHILIHLSNEQDFNRIWTKQTWFIANQKMRVFKWTPEFETEKEPSTVPVWISFPNLK  81

Query  934   AHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM---NGS  764
             AHL +K A+  IA  IG+PL +D +T +  RPS+ARVC+E +        +WI+    GS
Sbjct  82    AHLFEKSALLLIAKAIGNPLWIDEATANGTRPSVARVCIEYDCLKLPVDSVWIVVSKRGS  141

Query  763   ---YGDFAQKVTNEYIPPYCSGC  704
                 G + QKV    +  YC+ C
Sbjct  142   KDMLGGYLQKVEFSPMSEYCNHC  164



>ref|XP_007010292.1| Uncharacterized protein TCM_043834 [Theobroma cacao]
 gb|EOY19102.1| Uncharacterized protein TCM_043834 [Theobroma cacao]
Length=646

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 73/133 (55%), Gaps = 0/133 (0%)
 Frame = -1

Query  1180  SMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWS  1001
             ++A++   F  IG  R++ +  LD  HVL++ + + DF R W+ +   I    +   KWS
Sbjct  3     NLANIRYAFRGIGLARVYKIRWLDYKHVLIHLSNKQDFNRIWMKQHWFIANQKIRVFKWS  62

Query  1000  LDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVC  821
              +F    ESPI+ VWI+F     HL  K  +  IA ++G PL VD +T   +R S+ARV 
Sbjct  63    PEFEAEKESPIILVWISFPNLKTHLYKKSTLVLIAKIVGKPLFVDEATARGSRSSVARVY  122

Query  820   VELNVSNDLPHQI  782
             +E +  N L  QI
Sbjct  123   IEYDCRNQLVDQI  135



>ref|XP_009767582.1| PREDICTED: uncharacterized protein LOC104218716 [Nicotiana sylvestris]
Length=257

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 98/191 (51%), Gaps = 17/191 (9%)
 Frame = -1

Query  1213  ALVGKFSKGRPSMADLL----KPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWK  1046
             A++ KFS G+P + +L     K FD  G+  +   G L+  HVL+ F++  DF +     
Sbjct  32    AVILKFSYGKPDLQELRQLIPKQFDVKGYCNV---GQLEYRHVLVRFDLFEDFVQVLSRS  88

Query  1045  SLSIKG----FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSP  878
             +  +K     F   +  W++ F P  E+P   VWI+F    A+   K+++ SIA+ +G P
Sbjct  89    TGYVKSKGDEFFFRSFPWTIGFNPREETPKSVVWISFPDLPANFFAKKSLMSIASAVGKP  148

Query  877   LKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI-----MNGSYGDFAQKVTNEYIPPYC  713
             L VD +T    RPS ARV   L++    P ++ I      +    +  Q + ++ +P YC
Sbjct  149   LAVDKATQDRTRPSTARVKALLDLLAKHPKRVRINIVDKNSMKVVEHYQDIVHDNLPKYC  208

Query  712   SGCRNTQGHNL  680
             + C N QGH++
Sbjct  209   T-CFNHQGHDV  218



>ref|XP_007052625.1| Uncharacterized protein TCM_005953 [Theobroma cacao]
 gb|EOX96782.1| Uncharacterized protein TCM_005953 [Theobroma cacao]
Length=1659

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 78/154 (51%), Gaps = 11/154 (7%)
 Frame = -1

Query  1078  ELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSI  899
             E DF R W+ ++  I    +   KWS DF+P  +S +VPVWI+F    AHL DK A+  +
Sbjct  57    EHDFNRVWIRQTWFIANQKIRVFKWSPDFQPEKKSSVVPVWISFPNLSAHLHDKSALMMV  116

Query  898   ANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGS------YGDFAQKVT  737
             A  +G PL VD +T +   PS+ARVCVE +        IWI++ +       G  +Q+V 
Sbjct  117   ARTVGKPLFVDEATANRICPSVARVCVEYDCQKPPLDHIWIVSRNRKTETMTGGLSQRVE  176

Query  736   NEYIPPYCS-----GCRNTQGHNLHQEPHRETPK  650
                +P YC      G   T+   L  +P    PK
Sbjct  177   FAKLPKYCRHYCHVGHAMTECMVLGNKPASTKPK  210



>ref|XP_009793772.1| PREDICTED: uncharacterized protein LOC104240602 [Nicotiana sylvestris]
Length=306

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 112/227 (49%), Gaps = 15/227 (7%)
 Frame = -1

Query  1324  SSNTDDSPLRPPGHYKGMPSVSFTDQDVQQFSQK--FRFALVGKFSKGRPSMADLLKPFD  1151
             +     + L+P     G+P++ FT ++ + F+++     A++ K S   P + DL     
Sbjct  70    AGQVTKTTLKPSEVVHGIPTLLFTMEEREDFAREEGLHQAIIVKVSPNAPDLQDLRTILP  129

Query  1150  QI-GFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSI-----KGFIMGTVKWSLDFR  989
             ++ G      +GLL Q  +L+  +   DF  C L +S++      K   +    W++   
Sbjct  130   KLFGVKGQCLIGLLAQRQLLIRLDHYDDFVIC-LTRSVTYFTSKEKEHQVRVFPWTIRCN  188

Query  988   PYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELN  809
             P  E+ +  VWI+F      L  +RA+ SIA  +G P+ +D +T   +RPS ARV V L+
Sbjct  189   PKEETHMAAVWISFPSLPPELFARRALMSIAATVGKPIAIDKATQLRSRPSTARVKVILD  248

Query  808   VSNDLPHQIWIM-----NGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             +    P QI +       G   +  Q+VT + +P YC+ C++ QGH+
Sbjct  249   ILEKHPEQIRLKYVDEGTGKIVEQLQQVTYDNLPLYCNHCKH-QGHD  294



>ref|XP_007046404.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
 gb|EOY02236.1| Uncharacterized protein TCM_011923 [Theobroma cacao]
Length=1954

 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 73/136 (54%), Gaps = 11/136 (8%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KWS DF+P  ES +VPVWI+F    AHL +K A+  +A  +G PL VD +T + +R
Sbjct  1     MRVFKWSPDFQPEKESSVVPVWISFPNLPAHLHEKSALMMVARTVGKPLFVDEATANRSR  60

Query  841   PSMARVCVELNVSNDLPHQIWIMNGS------YGDFAQKVTNEYIPPYCSGCRN-----T  695
             PS+ARVCVE +        +WI++ +       G  +Q+V    +P YC  C +     T
Sbjct  61    PSVARVCVEYDCQKPPLDHVWIVSRNRKTETMTGGLSQRVEFAKLPEYCQHCCHVGHAVT  120

Query  694   QGHNLHQEPHRETPKT  647
             +   L  +P    PKT
Sbjct  121   ECMVLGNKPVSTKPKT  136



>ref|XP_007019767.1| Uncharacterized protein TCM_036083 [Theobroma cacao]
 gb|EOY16992.1| Uncharacterized protein TCM_036083 [Theobroma cacao]
Length=153

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 78/146 (53%), Gaps = 13/146 (9%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFL  935
             ++  H+L++ + E DF R W  ++  I    M   KW+ +F    E   VPVWI+F    
Sbjct  1     MNYKHILIHLSNEQDFNRIWTKQTWFIANQKMRVFKWTPEFETKKEPSTVPVWISFPNLK  60

Query  934   AHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM---NGS  764
             AHL +K A+  IA  IG+PL +D +T +  RPS+ARVC+E +        +WI+    GS
Sbjct  61    AHLFEKSALLLIAKAIGNPLCIDETTANGTRPSVARVCIEYDCLKPPVDSVWIVVSKRGS  120

Query  763   Y---GDFAQKVTNEYIPPYCSGCRNT  695
                 G + QKV  E++      CRNT
Sbjct  121   KDMSGGYLQKV--EFL-----RCRNT  139



>ref|XP_009624265.1| PREDICTED: uncharacterized protein LOC104115357 [Nicotiana tomentosiformis]
Length=379

 Score = 89.0 bits (219),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 107/211 (51%), Gaps = 14/211 (7%)
 Frame = -1

Query  1276  GMPSVSFTDQDVQQFS--QKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRIFSLGLLDQ  1106
             G P V FT+ +V + +  +  ++A+VGK S G P + +L      Q G     S+GLL  
Sbjct  9     GDPVVRFTEAEVDRMNIIEGLQYAMVGKLSYGWPDIQELRTSIPSQCGIKGECSVGLLRD  68

Query  1105  HHVLLNFNMELDF-----QRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEG  941
              HVL+   +  DF     +  +  K+     + +  + +   F+   E+P+  VWI+F G
Sbjct  69    RHVLIRLTLWEDFINFTSKNAYYVKAKDGCEYQLRPLIYDAKFKVGEETPMARVWISFPG  128

Query  940   FLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIW--IMNG  767
              L     K ++ S+A+ +G PL +D +T++  RPS ARV   +++  +LP ++   I N 
Sbjct  129   LLPTYFVKESLLSLASAVGKPLYLDRATINKTRPSCARVKFLIDLLAELPQKVRMDIFNK  188

Query  766   SYGDFAQ---KVTNEYIPPYCSGCRNTQGHN  683
             + G+      K+  + +P Y   C+  QGH+
Sbjct  189   TTGEIRTEWVKIQYDKLPKYYKECK-LQGHD  218



>ref|XP_009628423.1| PREDICTED: uncharacterized protein LOC104118774 isoform X1 [Nicotiana 
tomentosiformis]
Length=417

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 123/252 (49%), Gaps = 22/252 (9%)
 Frame = -1

Query  1345  RTFADVLSSNTDDSPLRPPGHYKGMPSVSFTDQDVQQFS--QKFRFALVGKFSKGRPSMA  1172
             R  A   + N   + L+P     G P+V FT ++++QF+  +    ALV KFS  R  M 
Sbjct  100   RLLAHQTTQNPSKTTLKPIELIHGEPTVIFTTEELRQFTVEEGLHQALVLKFSFERLDMQ  159

Query  1171  DLLKPFDQIGFGRIFSL-GLLDQHHVLLNFNMELDF----QRCWLWKSLSIKGFIMGTVK  1007
             +L K   ++   +  SL G L + H+L+ F++  D+     +   +  ++ +        
Sbjct  160   ELRKLLPKLFVTKGRSLIGWLARRHILIRFDLYEDYVVAASKVVNYMLVNGENHQFRVFP  219

Query  1006  WSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMAR  827
             W+L F P  E+    VWI+       L  K+++ SIA  +G P+ ++ +T    R S AR
Sbjct  220   WTLGFIPKEETSRAFVWISLPSLPPMLFAKKSLLSIALAVGKPIAINKATQETLRLSTAR  279

Query  826   VCVELNVSNDLP-----HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGH-----NLH  677
             + VEL++ +  P     H ++ + G   +  Q+V  + +P +CS C++ QGH     +L 
Sbjct  280   IKVELDLLDKKPNRVRIHCVYEITGQIIEQYQEVVYDSLPQFCSYCKH-QGHEENSCHLL  338

Query  676   QEPH----RETP  653
             Q+ H    RE P
Sbjct  339   QQKHAFTERENP  350



>ref|XP_009799697.1| PREDICTED: uncharacterized protein LOC104245737 [Nicotiana sylvestris]
Length=293

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 63/118 (53%), Gaps = 5/118 (4%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KWS DF+P  + PIV VWI       HL     +  IA  +G+PL++D +T    R
Sbjct  1     MWLQKWSPDFKPEEDLPIVLVWILLPKLPFHLHTWPYVKQIAREVGTPLEMDVATRRKTR  60

Query  841   PSMARVCVELNVSNDLPHQIWIMNGS----YGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             PSMA V VE+++   LP+ IW+ N         F QK+  E +P YC  CR   GH+L
Sbjct  61    PSMAEVRVEVDLLKPLPNHIWVGNEDDDSPLKGFEQKLEYESVPKYCRHCRKL-GHDL  117



>ref|XP_009593540.1| PREDICTED: uncharacterized protein LOC104090193 [Nicotiana tomentosiformis]
Length=541

 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 87/170 (51%), Gaps = 8/170 (5%)
 Frame = -1

Query  1303  PLRPPGHYKGMPSVSFTDQDVQQFS--QKFRFALVGKFSKGRPSMADLLKPF-DQIGFGR  1133
             PLR   +  G P V FT+ +V + +  +  ++A+VGK S G P + +L +    Q G   
Sbjct  61    PLRRAVYLNGQPVVKFTEAEVDRMNVIEGLQYAVVGKLSYGSPEIHELRRIIPTQCGIKG  120

Query  1132  IFSLGLLDQHHVLLNFNMELDF-----QRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI  968
               ++G L   HVL+   +  DF     +  +  K+     + + T+ + + F+   E+P+
Sbjct  121   ESNIGFLRDRHVLIRLTLWQDFLDFTSKSTYYIKAKDGYEYQLRTLIYDVKFKAGEETPM  180

Query  967   VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCV  818
                WI+F G L     K  ++S+A  +G P+ +DA+T +  RPS ARV V
Sbjct  181   TMAWISFPGLLPTFFVKETLFSLATAVGRPVCLDAATTNKTRPSCARVKV  230



>ref|XP_011094921.1| PREDICTED: uncharacterized protein LOC105174492 [Sesamum indicum]
Length=171

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 6/115 (5%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KW+  F P  ES IVPVW++F    AHL  K  ++++A++I +PL++D +TL+ ++
Sbjct  1     MRVFKWTPTFTPSKESSIVPVWVSFPKLPAHLFRKEVLFTVASMIETPLQIDDATLNQSK  60

Query  841   PSMARVCVELNVSNDLPH--QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
              S AR C+EL++        QI I   +     Q++  E IP YCS C++  GH 
Sbjct  61    LSKARACIELDLLKPRLEDFQIQICGAT---IVQRIEYEDIPHYCSLCKHV-GHR  111



>ref|XP_009766914.1| PREDICTED: uncharacterized protein LOC104218184 isoform X4 [Nicotiana 
sylvestris]
Length=601

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 107/219 (49%), Gaps = 15/219 (7%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQFSQK--FRFALVGKFSKGRPSMADL--LKPFDQIGFGR  1133
             L+   +  G P+V FT ++ ++F+ +     ++V K S G P + +L  L P      GR
Sbjct  39    LKSIQYVHGEPTVCFTMEERREFAMEEGLHQSVVFKLSSGAPDLKELRNLLPKHLGTKGR  98

Query  1132  IFSLGLLDQHHVLLNFNMELDF----QRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV  965
                +G L    +LL F+   D+     R   ++S + K        W++ F P  E+ + 
Sbjct  99    CL-VGSLAPRQILLRFDQNEDYVQALARAVNYRSWNGKEHQCRVFPWTIGFNPNEETTMA  157

Query  964   PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQ  785
              VWI+       L   R++ SIA+  G P+ +D ST   +RPS  RV V L++ N  P +
Sbjct  158   VVWISLPNLSPELFAMRSLLSIASAAGKPIAIDKSTQIKSRPSTTRVKVILDLMNKHPKR  217

Query  784   IWIM-----NGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             + I      +G   +  Q++  + +P YC+ C++ QGH+
Sbjct  218   VRIQSLDKNSGKIVEVFQEIVYDNLPLYCNCCKH-QGHD  255



>ref|XP_009766911.1| PREDICTED: uncharacterized protein LOC104218184 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009766912.1| PREDICTED: uncharacterized protein LOC104218184 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009766913.1| PREDICTED: uncharacterized protein LOC104218184 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009766915.1| PREDICTED: uncharacterized protein LOC104218184 isoform X5 [Nicotiana 
sylvestris]
Length=601

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 107/219 (49%), Gaps = 15/219 (7%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQFSQK--FRFALVGKFSKGRPSMADL--LKPFDQIGFGR  1133
             L+   +  G P+V FT ++ ++F+ +     ++V K S G P + +L  L P      GR
Sbjct  39    LKSIQYVHGEPTVCFTMEERREFAMEEGLYQSVVFKLSSGAPDLKELRNLLPKHLGTKGR  98

Query  1132  IFSLGLLDQHHVLLNFNMELDF----QRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV  965
                +G L    +LL F+   D+     R   ++S + K        W++ F P  E+ + 
Sbjct  99    CL-VGSLAPRQILLRFDQNEDYVQALARAVNYRSWNGKEHQCRVFPWTIGFNPNEETTMA  157

Query  964   PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQ  785
              VWI+       L   R++ SIA+  G P+ +D ST   +RPS  RV V L++ N  P +
Sbjct  158   VVWISLPNLSPELFAMRSLLSIASAAGKPIAIDKSTQIKSRPSTTRVKVILDLMNKHPKR  217

Query  784   IWIM-----NGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             + I      +G   +  Q++  + +P YC+ C++ QGH+
Sbjct  218   VRIQSLDKNSGKIVEVFQEIVYDNLPLYCNCCKH-QGHD  255



>ref|XP_007022011.1| Uncharacterized protein TCM_032141 [Theobroma cacao]
 gb|EOY13536.1| Uncharacterized protein TCM_032141 [Theobroma cacao]
Length=345

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 64/120 (53%), Gaps = 7/120 (6%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KWS DF+   E  +VP+WI+F G  AHL +K A+  IA  +G  L VD +T + +R
Sbjct  12    MRVFKWSPDFQSEKEFSLVPIWISFPGLHAHLFEKLALLMIAKTVGRLLFVDEATANGSR  71

Query  841   PSMARVCVELNVSNDLPHQIWIMNGS------YGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             PS+A VCVE +        IWI+          G F QKV    +P YC+ C +  GH+ 
Sbjct  72    PSIAWVCVEYDCQKPPLDHIWIVTRDRQTGIVTGGFVQKVEFSKLPAYCTHCSHV-GHDF  130



>ref|XP_009779392.1| PREDICTED: uncharacterized protein LOC104228608 [Nicotiana sylvestris]
Length=232

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (51%), Gaps = 28/186 (15%)
 Frame = -1

Query  1213  ALVGKFSKGRPSMADLL----KPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWK  1046
             A++ KFS G+P + +L     K FD  G+  I   G L+  H+L+ F++  DF      +
Sbjct  8     AVILKFSYGKPDLQELRQIISKQFDVKGYCNI---GQLEYRHILIRFDLFEDF-----VQ  59

Query  1045  SLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVD  866
              LSI          S  F P  E+    VWI+     A+   KR++ SIA+ +G PL VD
Sbjct  60    PLSI----------STGFNPREETSRAVVWISLPDLPANFFAKRSLMSIASAVGKPLAVD  109

Query  865   ASTLSHNRPSMARVCVELNVSNDLPHQIWIM-----NGSYGDFAQKVTNEYIPPYCSGCR  701
              +     RPS ARV V L++ +  P +I I      +G   +  Q++  + +P YC+ C+
Sbjct  110   KAMQDRTRPSTARVKVVLDLLDKHPKRIKIHIMDKNSGKVVEHYQEIVYDNLPKYCTYCK  169

Query  700   NTQGHN  683
             + QGH+
Sbjct  170   H-QGHD  174



>ref|XP_009786979.1| PREDICTED: uncharacterized protein LOC104235009 [Nicotiana sylvestris]
Length=541

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 93/193 (48%), Gaps = 12/193 (6%)
 Frame = -1

Query  1228  QKFRFALVGKFSKGRPSMADLLKPF-DQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWL  1052
             ++  FA+VGKF+     + +L K    Q G      +GL    H+L+  +++ DF     
Sbjct  5     ERLEFAVVGKFTYDWSDLEELRKIIPQQCGVKGGCQIGLFRSKHILIRLSLQEDFVNLVS  64

Query  1051  WKSLSIK-----GFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLI  887
               +  I       ++M T+ +   FR   E+ +   WI+F   L     K  ++S+A+ +
Sbjct  65    KGAFYITCKDGYSYLMRTLIYDSRFRVNEETSLAMAWISFPNLLPTFFVKECLFSLASAV  124

Query  886   GSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIW--IMNGSYGDFAQKVTN---EYIP  722
             G P+++D +T++  RPS ARV V +++    P  +   I N   G+    V     +Y+P
Sbjct  125   GKPIQLDQATINKTRPSCARVKVLVDLKGAFPKVVHMNIENEDTGEIRSNVIEIQYDYVP  184

Query  721   PYCSGCRNTQGHN  683
              YC  C+  QGH+
Sbjct  185   KYCLECK-MQGHD  196



>ref|XP_010324834.1| PREDICTED: uncharacterized protein LOC104648709 [Solanum lycopersicum]
Length=361

 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 82/153 (54%), Gaps = 8/153 (5%)
 Frame = -1

Query  1129  FSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIA  950
               +   +  HV ++ + ELD+   W  + ++I G +M    W+  F+P  E+ +VP+WI+
Sbjct  21    LKIAHFNSRHVYIDLDNELDYNMVWTKQRMNIAGQVMRIQAWTPTFKPDEETTLVPIWIS  80

Query  949   FEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMN  770
                   H  +K  I S+ + IG  L +D+++++  R S ARV V+++++ + P  IW+  
Sbjct  81    LPELPWHCYNKEFITSLLSPIGRVLYLDSASINKTRGSQARVKVQVDLTKERPSHIWM--  138

Query  769   GSYGDFA-----QKVTNEYIPPYCSGCRNTQGH  686
             G  G+       QK+  + I  YC  C++ QGH
Sbjct  139   GYMGEDITDGRWQKIDYDNILDYCFYCKH-QGH  170



>ref|XP_011083357.1| PREDICTED: uncharacterized protein At4g02000-like [Sesamum indicum]
Length=143

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (55%), Gaps = 2/113 (2%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KW+    P  ESP  PVW+          D+ A++SIA L+G+PLK D ST +  +
Sbjct  1     MRVFKWTPTLNPREESPTFPVWVHLSELPIQFFDREALFSIALLLGTPLKTDVSTATLVQ  60

Query  841   PSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             PS+ARV VE+N+   L  +I +  G+     Q V  E +P YC  C++  GH+
Sbjct  61    PSVARVYVEINLLEPLQTKISLGIGTEV-IIQPVIYERLPKYCGACKHL-GHD  111



>ref|XP_009622058.1| PREDICTED: uncharacterized protein LOC104113559 [Nicotiana tomentosiformis]
Length=328

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 99/218 (45%), Gaps = 36/218 (17%)
 Frame = -1

Query  1303  PLRPPGHYKGMPSVSFTDQDVQQ--FSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRI  1130
             PL+      G P +++  Q+V+Q    Q  + A++GKF          +K    + + R+
Sbjct  56    PLKTVEFLHGEPVINWKKQEVKQSIIQQGLQLAVLGKFH---------MKNMPSVNYARL  106

Query  1129  FSLG----LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVP  962
               +     LL +H   L    ++   RC                KW+  ++P   +PI  
Sbjct  107   SLMEDYVHLLSKHVFYLKAQGDMWQMRC---------------TKWNPWWKPDENTPIAV  151

Query  961   VWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQI  782
              WI F     +   K  I+S+A+ +G+PL V+ +T +  RPS A+V VE+N+ +    +I
Sbjct  152   AWIRFPELPPNFFGKECIFSLASAVGNPLHVNLATQNDTRPSCAKVKVEVNLLSKFSQRI  211

Query  781   WIMNGSYGDFAQ-----KVTNEYIPPYCSGCRNTQGHN  683
              ++        +     K+  +YIP YCS C N QGHN
Sbjct  212   KLVEEEDEFGLEEFKWIKIKYDYIPKYCSAC-NKQGHN  248



>ref|XP_007045383.1| Uncharacterized protein TCM_011161 [Theobroma cacao]
 gb|EOY01215.1| Uncharacterized protein TCM_011161 [Theobroma cacao]
Length=148

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KWS DF    ES I P+WI+F    AHL +K A+  IA  +   L +D +T + +R
Sbjct  1     MRVFKWSPDFEAEKESMIAPIWISFPNLKAHLYEKSALLLIAKTVKKSLFIDEATANGSR  60

Query  841   PSMARVCVELNVSNDLPHQIWIM------NGSYGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             PS+AR C+E +       Q+WI+          G +A++V    +P YC  C +  GH++
Sbjct  61    PSVARGCMEYDCRKAPVDQVWIVVKDRVTRAVIGGYAERVEFSKMPKYCDHCCHV-GHSV  119



>ref|XP_009768438.1| PREDICTED: myb-like protein D [Nicotiana sylvestris]
Length=334

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
 Frame = -1

Query  1009  KWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             KWS DF+P  + PI PVW    G   H+     +  + + IG+P ++D +T    RPS+A
Sbjct  5     KWSPDFKPAEDLPIAPVWALLPGLPFHMHTWNYVKQVVSAIGTPFEMDLATRGRTRPSIA  64

Query  829   RVCVELNVSNDLPHQIWIM----NGSYGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             +V VE+++  D P+ +++     N     F QK+  E +P YC  CR   GHN+
Sbjct  65    KVRVEIDLLKDQPNSVYVGQIYDNAPQKGFMQKIEFEGVPKYCKFCRKL-GHNM  117



>ref|XP_009608952.1| PREDICTED: uncharacterized protein LOC104102821 [Nicotiana tomentosiformis]
Length=502

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 102/211 (48%), Gaps = 12/211 (6%)
 Frame = -1

Query  1306  SPLRPPGHYKGMPSVSFTDQDVQQFSQK--FRFALVGKFSKGRPSMADLLKPFDQ-IGFG  1136
             S L+P     G P++ F  ++ ++F+++      +V K S   P++  L     + +G  
Sbjct  48    SKLKPVEFVHGEPTLKFDMEERKEFAKEEGLHQEIVIKLSAHVPALNHLRTILAKHLGVK  107

Query  1135  RIFSLGLLDQHHVLLNFNMELDFQRCWL--WKSLSIKG--FIMGTVKWSLDFRPYVESPI  968
                 +G+L    +L+ F+   DF    +      + KG         WS+   P  E   
Sbjct  108   GQCLIGVLTPRQLLMRFDKYEDFMVSLMRTVNYFTYKGEEHQFRVFPWSIGLNPKEEMAK  167

Query  967   VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
               VWI+       L  KRA+ SIA+ IG+P+ +D +  + +RPS ARV V L++SN+LP 
Sbjct  168   AVVWISLPNLAPILFAKRAMLSIASAIGTPIAIDKAAQTRSRPSTARVKVILDLSNNLPK  227

Query  787   QIWI-----MNGSYGDFAQKVTNEYIPPYCS  710
             +I +     M G   +  Q++T + +P YC+
Sbjct  228   RIRLQQVENMTGKVVEVFQEITYDNLPAYCN  258



>ref|XP_007040952.1| Uncharacterized protein TCM_005954 [Theobroma cacao]
 gb|EOX96783.1| Uncharacterized protein TCM_005954 [Theobroma cacao]
Length=1134

 Score = 82.4 bits (202),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 64/120 (53%), Gaps = 7/120 (6%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KW+LDF    ES IV VWI+F    AHL +K A+  IA  IG+PL VD +T +  R
Sbjct  1     MRVFKWTLDFESDKESSIVQVWISFPNLRAHLFEKSALLLIAKAIGNPLGVDEATANGTR  60

Query  841   PSMARVCVELNVSNDLPHQIWIMNGSYGD------FAQKVTNEYIPPYCSGCRNTQGHNL  680
             PS+ARV +E +        +WI+    G       + QKV    +P YC+ C +  GH +
Sbjct  61    PSVARVFIEYDCLKPPIESVWIVTSKRGSEDVTGGYLQKVDFAPMPEYCNHCCHV-GHGM  119



>ref|XP_007052624.1| Uncharacterized protein TCM_005952 [Theobroma cacao]
 gb|EOX96781.1| Uncharacterized protein TCM_005952 [Theobroma cacao]
Length=445

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 1/136 (1%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             + P  YK  P+ +F + ++Q  +Q F+ +LVGKFS+    + D+   F  I     + + 
Sbjct  218   KDPFMYKDRPAAAFFEDEIQTLAQPFKRSLVGKFSR-MSKLQDVRAAFKGISLAGAYEVR  276

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  HVL++ + E DF R W  ++  I    M   KW+ +F    ES +V VWI+    
Sbjct  277   WLDYKHVLIHLSNEQDFNRIWTKQNWFIATQKMRVFKWTPEFESKKESAVVSVWISLPNL  336

Query  937   LAHLQDKRAIYSIANL  890
              AHL +K  +  IA +
Sbjct  337   KAHLFEKSTLLLIAKM  352



>ref|XP_009768788.1| PREDICTED: uncharacterized protein LOC104219761 [Nicotiana sylvestris]
Length=416

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 106/201 (53%), Gaps = 16/201 (8%)
 Frame = -1

Query  1246  DVQQFSQK--FRFALVGKFSKGRPSMADLLKPFD-QIGFGRIFSLGLLDQHHVLLNFNME  1076
             +V +F+++     A++ KFS G+P + +  K F  Q       ++GLL+  H+L+ F++ 
Sbjct  3     EVNEFTREEGLHQAVIMKFSYGKPELQEFRKIFSSQFHVQGRCNIGLLEFRHLLIRFDLY  62

Query  1075  LDFQRCWLWKS---LSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRA  911
              D+   +L +S   +  KG  F   T  W+L F P  E+ +  V I+F G   +   KR+
Sbjct  63    SDY-VLFLSRSTGYVKSKGDEFFFRTFPWTLGFNPKQETSMAVVCISFPGLAPNFFAKRS  121

Query  910   IYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI-----MNGSYGDFAQ  746
             + SIA+ +G  + VD  T    RPS ARV V L++  + P ++ +     ++G      Q
Sbjct  122   LMSIASAVGKAIAVD-KTQEKTRPSAARVKVILDLLENRPKKVKLQIVDRISGKINVHYQ  180

Query  745   KVTNEYIPPYCSGCRNTQGHN  683
             +V  + +  YC+ C++ QGH+
Sbjct  181   EVVYDNLHKYCTFCKH-QGHD  200



>ref|XP_007015656.1| Uncharacterized protein TCM_041218 [Theobroma cacao]
 gb|EOY33275.1| Uncharacterized protein TCM_041218 [Theobroma cacao]
Length=106

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M T KWSLDF P  ESPIVPVW++F  F  H   K A  +IA  IG+PL +D +T +  R
Sbjct  1     MKTFKWSLDFHPKRESPIVPVWVSFPNFKTHSFKKSATMAIAKAIGNPLYIDKATANDTR  60

Query  841   PSMAR  827
             P++AR
Sbjct  61    PNIAR  65



>ref|XP_007044276.1| Uncharacterized protein TCM_009619 [Theobroma cacao]
 gb|EOY00108.1| Uncharacterized protein TCM_009619 [Theobroma cacao]
Length=230

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 7/118 (6%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KWS +F    ES I+ VWI+F     HL ++ A+  +A ++  PL VD +T   +R
Sbjct  1     MRVFKWSPEFEAEKESLIMLVWISFPNLKVHLYEQSALLLVAKIVEKPLFVDEATAKRSR  60

Query  841   PSMARVCVELNVSNDLPHQIWIM--NGSYGD----FAQKVTNEYIPPYCSGCRNTQGH  686
             PS+ARVCVE +    L  Q+WI+  N   G+    ++Q+V    +  YC  C +  GH
Sbjct  61    PSVARVCVEYDCRKPLVDQVWIVIQNRETGEVTSIYSQRVEFSPMLDYCYHCCHV-GH  117



>ref|XP_009619610.1| PREDICTED: uncharacterized protein LOC104111582 isoform X2 [Nicotiana 
tomentosiformis]
Length=514

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 106/204 (52%), Gaps = 19/204 (9%)
 Frame = -1

Query  1249  QDVQQFS--QKFRFALVGKFSKGRPSMADLL----KPFDQIGFGRIFSLGLLDQHHVLLN  1088
             ++V +F+  +    A+V KFS G+P +  L     K FD  G     ++GLL+  HVL+ 
Sbjct  2     EEVNEFTIEEGLHQAVVVKFSYGKPELQVLRQIIPKQFDVKGS---CNIGLLEFRHVLVK  58

Query  1087  FNMELDFQRCWLWKSLSIKG----FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQD  920
             F++  D+ +     +  +K     F   T  W++ F    E+    VWI+F     +L  
Sbjct  59    FDLLEDYVQFLSRYTSYVKSNGGEFFFRTFPWTIGFNLREETSKAVVWISFPMLSPNLFA  118

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH--QIWIMNGSYG---D  755
             K+++ SI++ +G PL V  +T    RPS AR+ V L++    P   +I I++ S G   +
Sbjct  119   KKSLLSISSAVGKPLAVVKATHDRTRPSTARIKVLLDLLERHPKRVKIHIVDKSSGKSVE  178

Query  754   FAQKVTNEYIPPYCSGCRNTQGHN  683
               Q+V ++ +  YC+ C++ QGH+
Sbjct  179   HKQEVVHDNLSRYCTYCKH-QGHD  201



>ref|XP_009619609.1| PREDICTED: uncharacterized protein LOC104111582 isoform X1 [Nicotiana 
tomentosiformis]
Length=524

 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 106/204 (52%), Gaps = 19/204 (9%)
 Frame = -1

Query  1249  QDVQQFS--QKFRFALVGKFSKGRPSMADLL----KPFDQIGFGRIFSLGLLDQHHVLLN  1088
             ++V +F+  +    A+V KFS G+P +  L     K FD  G     ++GLL+  HVL+ 
Sbjct  2     EEVNEFTIEEGLHQAVVVKFSYGKPELQVLRQIIPKQFDVKGS---CNIGLLEFRHVLVK  58

Query  1087  FNMELDFQRCWLWKSLSIKG----FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQD  920
             F++  D+ +     +  +K     F   T  W++ F    E+    VWI+F     +L  
Sbjct  59    FDLLEDYVQFLSRYTSYVKSNGGEFFFRTFPWTIGFNLREETSKAVVWISFPMLSPNLFA  118

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH--QIWIMNGSYG---D  755
             K+++ SI++ +G PL V  +T    RPS AR+ V L++    P   +I I++ S G   +
Sbjct  119   KKSLLSISSAVGKPLAVVKATHDRTRPSTARIKVLLDLLERHPKRVKIHIVDKSSGKSVE  178

Query  754   FAQKVTNEYIPPYCSGCRNTQGHN  683
               Q+V ++ +  YC+ C++ QGH+
Sbjct  179   HKQEVVHDNLSRYCTYCKH-QGHD  201



>ref|XP_007020072.1| Uncharacterized protein TCM_036445 [Theobroma cacao]
 gb|EOY17297.1| Uncharacterized protein TCM_036445 [Theobroma cacao]
Length=678

 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/204 (25%), Positives = 84/204 (41%), Gaps = 51/204 (25%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  Y   P+VSF + ++   +Q+F+F++VGKFS+  P M ++   F +IG    + + 
Sbjct  71    REPLWYTDRPAVSFFEDEISALAQRFKFSMVGKFSR-MPRMQEIRATFKRIGLMGAYEIR  129

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L+    E D  R WL ++L                                  
Sbjct  130   WLDYKHILILLTNEHDLNRIWLNQTL----------------------------------  155

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSY-  761
                        +IA ++G  L VD +T +   PS+ RVC+E +    +   +WI+     
Sbjct  156   ----------LAIAKMVGRSLMVDEATTNGTCPSVVRVCIEYDCQKPIIDHVWIVTRDRQ  205

Query  760   -----GDFAQKVTNEYIPPYCSGC  704
                  G + Q V   ++   C+ C
Sbjct  206   TGLVKGGYMQIVEFAWLQENCTHC  229



>ref|XP_009760564.1| PREDICTED: uncharacterized protein LOC104212897 [Nicotiana sylvestris]
Length=260

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 7/120 (6%)
 Frame = -1

Query  1009  KWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             KW  DF+P  +SPI P+W+   G   H      +  I   +G PL +D +T    RPSMA
Sbjct  5     KWMPDFKPEEDSPIAPIWVLLSGLPFHCYTWHYVKQILGPVGLPLSMDIATDYRTRPSMA  64

Query  829   RVCVELNVSNDLPHQIWIMNGSYGD----FAQKVTNEYIPPYCSGCRNTQGHNLHQEPHR  662
             +V VE++++      +W+   +  +    F QK+  E +P YC  CR   GH++ Q  HR
Sbjct  65    KVRVEVDLTKPQLKYVWVGQENETNPLKGFMQKLEYEGVPKYCKHCRRL-GHSIIQ--HR  121



>ref|XP_009766116.1| PREDICTED: uncharacterized protein LOC104217535 [Nicotiana sylvestris]
Length=316

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/215 (25%), Positives = 94/215 (44%), Gaps = 35/215 (16%)
 Frame = -1

Query  1270  PSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLL  1091
             P V+FT ++    +Q  ++ ++G                          +G  D HHV +
Sbjct  90    PVVTFTKEENDLLAQTCKWTIIGNIK-----------------------IGAYDMHHVFI  126

Query  1090  NFNMELDFQRCWLWKSLSI-KGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKR  914
             +F+ + D         ++  +   M   KWS  F+P V+S   PV I          +  
Sbjct  127   DFDNKEDHSEVIARNYMTFGRDNTMVIQKWSASFKPDVDSSFTPVGITLPNLPWQYYEWD  186

Query  913   AIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM----NGSYGDFAQ  746
             A+  I   +G PL +D +T+S  RP+ A+V VE+N++  +  ++ +      GS     Q
Sbjct  187   ALCHILGPVGIPLIMDKATMSKTRPTTAKVRVEINLTKPIVQEVLLEFINDEGSKEMVVQ  246

Query  745   KVTNEYIPPYCSGCRNTQGHN------LHQEPHRE  659
             K+  E +P +C+ C+  +GH+      LH E  +E
Sbjct  247   KIEYESMPAFCTHCK-IRGHSDATCRILHPELKKE  280



>ref|XP_009765551.1| PREDICTED: uncharacterized protein LOC104217093, partial [Nicotiana 
sylvestris]
Length=652

 Score = 75.9 bits (185),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/218 (28%), Positives = 105/218 (48%), Gaps = 15/218 (7%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQFS--QKFRFALVGKFSKGRPSMADLLKPF-DQIGF-GR  1133
             L+P  +  G   + F+ ++ ++++  +    A+V K S G P + +L K    QIG  GR
Sbjct  70    LKPIQNAHGQLMIQFSVKEFEEYAVEEGLHQAVVMKLSYGAPELLELRKMIPAQIGIKGR  129

Query  1132  IFSLGLLDQHHVLLNFNMELDFQRCWLWKS--LSIKG--FIMGTVKWSLDFRPYVESPIV  965
                +GLL    +L+  +   DF      +   L  KG      T  W+ D+ P  E+   
Sbjct  130   CL-IGLLTVRQLLIRCDAYDDFVAIVSKQVGYLQYKGQQHQYRTFPWTQDYDPKAETSKT  188

Query  964   PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQ  785
               W++F     +L  K+ + SIA+ +G P+ +D +T +  RPS ARV V +++ +  P  
Sbjct  189   VAWVSFPDLPMNLFAKKPLLSIASAVGKPIAIDKATQTRTRPSTARVKVIIDLLDKYPKN  248

Query  784   IWIM-----NGSYGDFAQKVTNEYIPPYCSGCRNTQGH  686
             I +      +G   +  Q+   + +P YC+ C+  QGH
Sbjct  249   IKLQFIDEKSGKVIEHLQEFVFDNLPSYCNVCKR-QGH  285



>ref|XP_007019295.1| Uncharacterized protein TCM_035322 [Theobroma cacao]
 gb|EOY16520.1| Uncharacterized protein TCM_035322 [Theobroma cacao]
Length=137

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 67/136 (49%), Gaps = 2/136 (1%)
 Frame = -1

Query  1183  PSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNF--NMELDFQRCWLWKSLSIKGFIMGTV  1010
             P    + + F  IG    +++   +  H+L+N     E DF+R W +++  I    M   
Sbjct  2     PKWEVIQQVFKGIGLFGAYNIRWFNYKHILINLLNEYEYDFKRIWGYQAWFIANQKMEVF  61

Query  1009  KWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             KWSLD  P     IV VWI+F     HL +K  + +IA  I + L V+ S  +  +PSMA
Sbjct  62    KWSLDLNPEKTPSIVLVWISFPNLKLHLFEKSMLLAIAKSIENLLYVNESPANGTKPSMA  121

Query  829   RVCVELNVSNDLPHQI  782
             RV VE +  N L   I
Sbjct  122   RVYVEYDCFNPLVDSI  137



>ref|XP_009590293.1| PREDICTED: uncharacterized protein LOC104087503 [Nicotiana tomentosiformis]
Length=466

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 100/205 (49%), Gaps = 21/205 (10%)
 Frame = -1

Query  1249  QDVQQFSQK--FRFALVGKFSKGRPSMADLLK--PFDQIGFGRIFSLGLLDQHHVLLNFN  1082
             +++ QF+++     ALV K S     M  L K  P      GR   +G L + HVL+ F+
Sbjct  2     EEINQFTKEEGLHQALVIKSSYDPYDMQQLRKLLPIQFRTQGRCI-IGWLARRHVLVRFD  60

Query  1081  MELDFQRCWLWKSLSIKGFIMGTVK-------WSLDFRPYVESPIVPVWIAFEGFLAHLQ  923
                D+    L  + SI   ++  ++       W++ F P  E+    VWI+F      L 
Sbjct  61    RYDDY---VLTAAKSINYLLINGMEYQFRIFPWTIGFNPVEETSRAFVWISFLSLPPILF  117

Query  922   DKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM-----NGSYG  758
              K+++  IA+  G P+ +D +T   +RPS ARV VEL++  +LP  + +       G   
Sbjct  118   AKKSLMFIASAAGKPIAIDKATQEKSRPSTARVKVELDLLGNLPQHLKVQLVDEKTGKII  177

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHN  683
             +  QK   + +P YC+ C++ QGH+
Sbjct  178   EHVQKFVYDNLPRYCTFCKH-QGHD  201



>ref|XP_006282176.1| hypothetical protein CARUB_v10028438mg, partial [Capsella rubella]
 gb|EOA15074.1| hypothetical protein CARUB_v10028438mg, partial [Capsella rubella]
Length=454

 Score = 74.7 bits (182),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 72/151 (48%), Gaps = 7/151 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   ++ F +E ++          + G I+    W+ +F P V+  +  PVWI     
Sbjct  97    LPRRFFMVRFELEEEYLAALTGGPWRVFGSILMVQAWTPEFDPLVDEIVTTPVWIRLTNI  156

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +L  K  ++ IA  +G+PLKVD +TL+  R   AR+CVE+N++  L   I I  G Y 
Sbjct  157   PVNLYHKDILFLIARGLGNPLKVDLTTLNFERARFARICVEVNLAKPLKGTIRINGGRYF  216

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
                + +TN      CS C    GH +H  P 
Sbjct  217   VSYEGLTN-----ICSRC-GLYGHPVHACPR  241



>ref|XP_009600598.1| PREDICTED: uncharacterized protein LOC104096022 [Nicotiana tomentosiformis]
Length=201

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 55/204 (27%), Positives = 92/204 (45%), Gaps = 31/204 (15%)
 Frame = -1

Query  1246  DVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG---LLDQHHVLLNFNME  1076
             +V+Q  Q+++  L+G    G PS  ++LK          F  G   L+  H VLL+ +  
Sbjct  8     EVEQQCQRWKTTLIGYVLGGNPSFKEMLK----------FVYGVWNLVTTHTVLLHDDGY  57

Query  1075  LDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYV-------------ESPIVPVWIAFEGFL  935
               F+    ++S+  K  I+    ++ + RP V                IVP+W+   G  
Sbjct  58    FIFR----FESVEDKNLIVQNGPYTFNSRPMVLKDCDPDFQIQNESMRIVPIWVNLPGLP  113

Query  934   AHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGD  755
                  +  +  IA+L+G P+  D  T    R S AR+ VE++++  LP +I I       
Sbjct  114   VQCWAEENLGRIASLLGKPICTDKLTTECERISYARILVEMDITQPLPEEILIKKPDGRS  173

Query  754   FAQKVTNEYIPPYCSGCRNTQGHN  683
             + Q+V  E+ P +C  C N  GH+
Sbjct  174   WMQRVDFEWKPKFCLDC-NKFGHS  196



>ref|XP_007014777.1| Uncharacterized protein TCM_040289 [Theobroma cacao]
 gb|EOY32396.1| Uncharacterized protein TCM_040289 [Theobroma cacao]
Length=333

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 86/212 (41%), Gaps = 45/212 (21%)
 Frame = -1

Query  1297  RPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLG  1118
             R P  YK   + SF + ++   +Q  + ++VGKF +  P + ++   F  IG    + + 
Sbjct  6     REPFWYKDRLAESFFEDEIATLTQPLKHSMVGKFFR-MPRLNEIQAAFKGIGLVGAYKIR  64

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGF  938
              LD  H+L++   E D  R W  +                                    
Sbjct  65    WLDYKHILIHLTNEHDLNRFWTRQ------------------------------------  88

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGS--  764
              AHL  K A+  IA ++  PL VD +T + +R  + +VC+E         Q+WI+     
Sbjct  89    -AHLFQKSALIMIAKIVRRPLFVDEATTNGSRLGITQVCIEYECQKPPMDQVWIVTRDRA  147

Query  763   ----YGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
                  G F QKV    +  YCS C +  GH++
Sbjct  148   TKTVIGGFTQKVEFSKLSKYCSHCYHV-GHSV  178



>ref|XP_007032187.1| Uncharacterized protein TCM_017591 [Theobroma cacao]
 gb|EOY03113.1| Uncharacterized protein TCM_017591 [Theobroma cacao]
Length=487

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 49/92 (53%), Gaps = 6/92 (7%)
 Frame = -1

Query  961  VWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQI  782
            VWI F    A L +K A+  IA  +G PL VD +T +  RPS+ARVC+E +    L  QI
Sbjct  18   VWIVFPNLRAQLYEKSALMVIAKAVGHPLLVDEATANGTRPSIARVCIEFDCQKPLLDQI  77

Query  781  WIM-----NGSYGD-FAQKVTNEYIPPYCSGC  704
            WI+      G   D F QKV  E +  YC  C
Sbjct  78   WIVTRDRSTGEVTDGFMQKVEFERLSEYCMHC  109



>ref|XP_009765570.1| PREDICTED: uncharacterized protein LOC104217118 [Nicotiana sylvestris]
Length=305

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 5/120 (4%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   +WS DF P  +SP+ PVW+       HL     I  I + +G+P+ +D +T    R
Sbjct  1     MWLSRWSPDFTPEEDSPLAPVWVLLPKLPFHLHTWHYIKQILSPVGTPMYMDVATNGKTR  60

Query  841   PSMARVCVELNVSNDLPHQIWIMNGSYGD----FAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
             PSMA+V VE+++S      +++ + +  +      QKV  E I  YC+ CR  QGH + Q
Sbjct  61    PSMAKVRVEIDLSKPRLSHVFVGSKNATNPLHGHEQKVEYEGITKYCNHCR-LQGHEISQ  119



>ref|XP_007010225.1| Uncharacterized protein TCM_043662 [Theobroma cacao]
 gb|EOY19035.1| Uncharacterized protein TCM_043662 [Theobroma cacao]
Length=608

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 51/99 (52%), Gaps = 3/99 (3%)
 Frame = -1

Query  1069  FQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANL  890
             F  C  W    I    M   KW  DF    ES +VPVWI+F    AHL  K A+  IA  
Sbjct  106   FNLCLHW---FIANQKMWVFKWYPDFEAEKESLVVPVWISFSNLKAHLYKKLALLLIAKT  162

Query  889   IGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM  773
             IG PL V+ +    +RP++ARVCVE +    L   +WI+
Sbjct  163   IGKPLFVNKAIAKGSRPNVARVCVEYDCKKPLTDPVWIV  201



>ref|XP_007023839.1| Uncharacterized protein TCM_028132 [Theobroma cacao]
 gb|EOY26461.1| Uncharacterized protein TCM_028132 [Theobroma cacao]
Length=269

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 6/110 (5%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   +W+ DF+   ES  V VWI+F    AHL +K A++ IA ++G  L VD +  +  R
Sbjct  1     MLVFEWTPDFQSKKESSFVLVWISFSNLRAHLYEKSALFVIAKIMGRLLMVDKAIANGTR  60

Query  841   PSMARVCVELNVSNDLPHQIWIMNGSYGD------FAQKVTNEYIPPYCS  710
             PSM R+ VE N    L  Q+WI+            F QKV       YC+
Sbjct  61    PSMMRIYVEYNCPKPLVDQVWIVTRDRKTEDVTKGFMQKVEFARPSEYCT  110



>ref|XP_010687516.1| PREDICTED: uncharacterized protein LOC104901625 [Beta vulgaris 
subsp. vulgaris]
Length=228

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            I+P+W+       H     ++  I +L+G P+  D  T    R S AR+ +E++V+  +P
Sbjct  46   IIPIWVKLPNLPLHYWSSDSLSRIGSLLGMPVYADECTSKALRVSFARILIEMDVTQKIP  105

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
            ++I I + +   F QKVT +++PPYC  C    GHN
Sbjct  106  NEIQIEDPNGATFKQKVTYDWLPPYCKKCLKV-GHN  140



>ref|XP_006304881.1| hypothetical protein CARUB_v10012644mg, partial [Capsella rubella]
 gb|EOA37779.1| hypothetical protein CARUB_v10012644mg, partial [Capsella rubella]
Length=478

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 71/151 (47%), Gaps = 7/151 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   ++ F +E ++          + G I+    W+ +F P V+  +  P WI     
Sbjct  114   LPRRFFMIRFELEEEYLAALTGGPWRVFGSILMVQAWTPEFDPLVDEIVTTPFWIRLTNI  173

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +L  K  ++ IA  +G+PLKVD +TL+  R   AR+CVE+N++  L   I I  G Y 
Sbjct  174   PVNLYHKDILFLIARGLGNPLKVDLTTLNFERARFARICVEVNLAKPLKGTIMINGGRYF  233

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
                + +TN      CS C    GH +H  P 
Sbjct  234   VSYEGLTN-----ICSRC-GLYGHPVHACPR  258



>ref|XP_006382571.1| hypothetical protein POPTR_0005s034102g, partial [Populus trichocarpa]
 gb|ERP60368.1| hypothetical protein POPTR_0005s034102g, partial [Populus trichocarpa]
Length=429

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 86/192 (45%), Gaps = 5/192 (3%)
 Frame = -1

Query  1252  DQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMEL  1073
             D D+  +  ++RF+L+G F  G+      L  F    + R     + D   ++ NF+ E+
Sbjct  92    DTDMGLYKDRWRFSLIG-FIAGKFPGYTSLSSFINSSWKRNVHFSMHDSGWLIFNFDSEM  150

Query  1072  DFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSI  899
             D          S+ G   I+  +    DF    E   +PVWI F            +  +
Sbjct  151   DMLEVLNGGPYSVHGRLLILKIMPEFFDFD-TSEMLRMPVWIRFPNLPLQCWSPICLSKL  209

Query  898   ANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPP  719
             A++IG PL +D  T S +R S ARV VE ++  DLP  I I   +     Q V  E +P 
Sbjct  210   ASVIGKPLHLDTPTSSMSRLSYARVLVETDLLADLPATINISLPNGVTMTQNVLYESLPR  269

Query  718   YCSGCRNTQGHN  683
             +C  CR+  GH+
Sbjct  270   FCKQCRSL-GHS  280



>ref|XP_010484910.1| PREDICTED: uncharacterized protein LOC104763199 [Camelina sativa]
Length=326

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 102/227 (45%), Gaps = 30/227 (13%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFR-FALVGKFSKGRP------SMADLLKPFDQIGFGR  1133
             P    G P ++  ++ ++  +  +R + +V    +  P       + +L KP        
Sbjct  66    PDGANGEPVITIQNEVLEAMNGLWRQYMIVKVLGRNVPLPVLSRKLRELWKPRG------  119

Query  1132  IFSLGLLD--QHHVLLNFNMELDFQRCWL---WKSLSIKGFIMGTVKWSLDFRPYVESPI  968
               S+ +LD  +   L+ F +E ++        WK+     ++M    WS  F P  +  +
Sbjct  120   --SMTVLDLPRQFFLIRFEVEEEYLAAVSGGPWKAFG--SYVM-VQAWSPKFNPLTDEIV  174

Query  967   V-PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
               PVWI       +L  +  +  IA  +G+P++VD++TL+  R   AR+CVE+N+ N L 
Sbjct  175   TTPVWIRLSNIPFNLYHRAILMGIAGSLGTPIRVDSTTLNVERARFARICVEVNLRNPLK  234

Query  790   HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
               + I    Y    + +TN      CSGC    GH +H  P RE+ K
Sbjct  235   GSVVINGERYFVAYEGLTN-----ICSGC-GVYGHLVHGCPQRESEK  275



>ref|XP_009759333.1| PREDICTED: uncharacterized protein LOC104211895 [Nicotiana sylvestris]
Length=258

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/253 (22%), Positives = 105/253 (42%), Gaps = 40/253 (16%)
 Frame = -1

Query  1342  TFADVLSSNTDDS-----PLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPS  1178
             T A+V+  N + +        PP    G+  V    Q++ + +QK+  AL+G    G P+
Sbjct  19    TMAEVVKGNREQNMGLKLNYYPPVMKDGIKIVKLNPQEIAEQNQKWSRALIGNVIVGNPT  78

Query  1177  MADLLKPFDQI-GFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWS  1001
               ++LK   ++  +     + L +  + +  FN E D            K  I+    ++
Sbjct  79    FKEMLKFIYRVWNYVSTPQVFLHNNGYFIFKFNNEED------------KEAILKQGPYT  126

Query  1000  LDFRPYV-------------ESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDAS  860
              ++RP++              + ++P+W+ F   L        +  I + IG P+ +D  
Sbjct  127   FNYRPFILKQWDPEFQMNKEPTQLIPIWVMFPNLLIQFWAPGNLERITSCIGKPICIDKL  186

Query  859   TLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
             T    R + AR+ +E+++S  LP  I +       ++Q +  E+ P +   C    GHN 
Sbjct  187   TAQEQRIAYARILIEIDISQPLPESISLELPDGTHYSQNIEYEWKPLFYQDCLKV-GHNT  245

Query  679   --------HQEPH  665
                     H+EP 
Sbjct  246   RDCTKPAEHKEPR  258



>ref|XP_009777335.1| PREDICTED: stress response protein NST1-like [Nicotiana sylvestris]
Length=248

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 59/122 (48%), Gaps = 5/122 (4%)
 Frame = -1

Query  1027  FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSH  848
              +M   KW+ DFR   +SPI P+W+   G   H      I  I + +G PL +D +T   
Sbjct  1     MVMWLQKWTPDFRREEDSPIAPIWVLLLGLPFHCHMWYYIKQILSPVGVPLSMDLATDYR  60

Query  847   NRPSMARVCVELNVSNDLPHQIWIMNGSYGD----FAQKVTNEYIPPYCSGCRNTQGHNL  680
              R  MA+V VE+N++      +W       +    F QK+  E +P YC  CR   GH++
Sbjct  61    TRLGMAKVRVEVNLTKPRLQSVWFRQEDESNPLKGFTQKLEYEGVPKYCKHCR-ILGHSV  119

Query  679   HQ  674
              Q
Sbjct  120   VQ  121



>ref|XP_006369230.1| hypothetical protein POPTR_0001s19740g, partial [Populus trichocarpa]
 gb|ERP65799.1| hypothetical protein POPTR_0001s19740g, partial [Populus trichocarpa]
Length=521

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 86/192 (45%), Gaps = 5/192 (3%)
 Frame = -1

Query  1252  DQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMEL  1073
             D D+  +  ++RF+L+G F  G+      L  F    + R     + D   ++ NF+ E+
Sbjct  195   DTDMGLYKDRWRFSLIG-FIAGKFPGYTSLSSFINSSWKRNVHFSMHDSGWLIFNFDSEM  253

Query  1072  DFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSI  899
             D          S+ G   I+  +    DF    E   +PVWI F            +  +
Sbjct  254   DMLEVLNGGPYSVHGRLLILKIMPEFFDFD-TSEMLRMPVWIRFPNLPLRCWSPICLSKL  312

Query  898   ANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPP  719
             A++IG PL +D  T S +R S ARV VE ++  DLP  I I   +     Q V  E +P 
Sbjct  313   ASVIGKPLHLDTPTSSMSRLSYARVLVETDLLADLPAMINISLPNGVTMTQNVLYESLPR  372

Query  718   YCSGCRNTQGHN  683
             +C  CR+  GH+
Sbjct  373   FCKQCRSL-GHS  383



>ref|XP_010687419.1| PREDICTED: uncharacterized protein LOC104901529 [Beta vulgaris 
subsp. vulgaris]
Length=417

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            ++P+W+ F     H     ++  I +L+G P+  D  T    R S ARV +E++++ ++P
Sbjct  187  VIPIWVKFPNLPLHYWSDDSLSRIGSLLGVPIYADECTSKALRVSFARVLIEMDITKEIP  246

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             +I I+  +   FAQKVT + +PP+CS C +  GHN
Sbjct  247  KEIQIVEPNGVTFAQKVTYDCLPPFCSKC-SMIGHN  281



>ref|XP_009603706.1| PREDICTED: uncharacterized protein LOC104098627 [Nicotiana tomentosiformis]
Length=564

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 77/151 (51%), Gaps = 9/151 (6%)
 Frame = -1

Query  1126  SLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKG----FIMGTVKWSLDFRPYVESPIVPV  959
             ++GLL+  H+L+ F++  D+ +     +  +K     F   T  W+L F P  E+ +  V
Sbjct  13    NIGLLEYRHLLVRFDLYNDYVQLLSRSTGYVKAKGNEFFFRTFPWTLGFNPKEETSMAVV  72

Query  958   WIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIW  779
             WI+F G   ++  KR++ SIA+ +G  L VD  T    RPS  RV V L++ +    ++ 
Sbjct  73    WISFPGLPPNIFAKRSLLSIASAMGKALAVDMETQERTRPSATRVRVILDLLDKHLKKVK  132

Query  778   IMN-----GSYGDFAQKVTNEYIPPYCSGCR  701
             ++      G      Q+V  + +P YC+ C+
Sbjct  133   LLIVDRILGKTIMHYQEVVYDNLPTYCTYCK  163



>ref|XP_010463327.1| PREDICTED: uncharacterized protein LOC104743994 [Camelina sativa]
Length=851

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 70/151 (46%), Gaps = 7/151 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYV-ESPIVPVWIAFEGF  938
             L + + ++ F++E ++          + G  + T  WS +F P   E    PVWI     
Sbjct  114   LPRQYFMIRFDVEAEYMVALTGGPWRMFGSYLLTQAWSPNFDPLRDEITTTPVWIRLSNL  173

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               H   +  + +IA  +G+P+KVD +TL+  R   ARVCVE+N+   L   + +    Y 
Sbjct  174   PVHFYHRSILMAIAEGLGNPIKVDLTTLNFERARFARVCVEVNLKKPLKETVMVNGDRY-  232

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
                  V+ E +   CS C    GH +H  PH
Sbjct  233   ----FVSYEGLSAICSRC-GIYGHLVHNCPH  258



>ref|XP_009600554.1| PREDICTED: uncharacterized protein LOC104095990 [Nicotiana tomentosiformis]
Length=188

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 72/154 (47%), Gaps = 10/154 (6%)
 Frame = -1

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQD  920
             V    + E D    W   S+ I+G  M    W+ +F P  ++PIVPVWI       H   
Sbjct  31    VYFGLDNEYDHTTVWTKTSMYIQGQRMELQVWTPNFNPNEDNPIVPVWIVIPELSWHFYY  90

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI-------MNGSY  761
                +  + + IG  L +D +++   R S+A+  +++N++   PH +W+       +NG  
Sbjct  91    MEVLSVLLSPIGKVLHLDLASMQKTRGSVAKAKMQVNLTQFRPHHVWLGFDEDQDVNGDR  150

Query  760   GDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRE  659
                  +V  E +P YCS C+   GH  +  P RE
Sbjct  151   QWL--EVVYEDLPTYCSHCKYL-GHEEYSCPVRE  181



>ref|XP_006387777.1| hypothetical protein POPTR_0590s00210g [Populus trichocarpa]
 gb|ERP46691.1| hypothetical protein POPTR_0590s00210g [Populus trichocarpa]
Length=404

 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 87/202 (43%), Gaps = 5/202 (2%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             Y    S  F + D+      ++F+L+G  +   P  + L K F    +     L + D  
Sbjct  46    YTASSSCQFLETDLGMHKDLWKFSLIGFIAGKFPGYSSLSK-FVNSSWKCSVKLSMHDSG  104

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAH  929
              ++  F  E D           + G   I+  +    DF    E   +PVW+ F      
Sbjct  105   WLIFTFTSETDMFEVLSGGPYYVFGQPLILKIMPEFFDFA-TSEMVRMPVWVRFPNLPLQ  163

Query  928   LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFA  749
                   +  +A++IG P+  D ST S  R S ARV +E+++  DLP  I I+  +    +
Sbjct  164   CWSPLCLSKLASVIGKPVHSDTSTNSMTRLSYARVLIEIDLLADLPTSINIILPNGDSLS  223

Query  748   QKVTNEYIPPYCSGCRNTQGHN  683
             QKV  E +P +C  CR T+GH 
Sbjct  224   QKVMYESLPRFCKQCR-TRGHT  244



>ref|XP_010317263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101258433, 
partial [Solanum lycopersicum]
Length=1339

 Score = 72.0 bits (175),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 76/153 (50%), Gaps = 8/153 (5%)
 Frame = -1

Query  1345  RTFADVLSSNT--DDSP--LRPPGHY--KGMPSVSFTDQDVQ-QFSQKFRFALVGKFSKG  1187
             ++FA  L  N   +++P  L  P H   +G P+V   + D   + ++  ++ LVGKF+  
Sbjct  945   QSFAARLRYNQAQNETPITLNEPVHTTKQGFPAVLIDESDYYVKLAEICKYTLVGKFTNT  1004

Query  1186  RPSMADLLKPFD-QIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTV  1010
              P M  + K F  Q        +   +  HV ++ + ELD+Q  W    ++I+G  M   
Sbjct  1005  MPRMELVRKSFILQTQLMGGVKITYFNSRHVYIDLDNELDYQTVWTKLKMNIEGQAMRIQ  1064

Query  1009  KWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRA  911
              W+ DF P  E+P+VP+WI+  G   H  +K A
Sbjct  1065  AWTPDFTPEEETPVVPIWISIPGLPWHCYNKNA  1097



>ref|XP_009788948.1| PREDICTED: uncharacterized protein LOC104236667 [Nicotiana sylvestris]
Length=488

 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 62/117 (53%), Gaps = 7/117 (6%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KWS DF+P  + PIVP W+       H+ D   +  + + + +PL +DA+T+   R
Sbjct  1     MWLQKWSPDFKPEEDLPIVPAWVLLPRLPFHMHDWHYVKQLLSSVRTPLALDAATIGRTR  60

Query  841   PSMARVCVELNVSNDLPHQIWIMNGSYGD-----FAQKVTNEYIPPYCSGCRNTQGH  686
             PSMA++ VE+++   LP  +++    Y D     + QK+  E +P Y   CR   GH
Sbjct  61    PSMAKIRVEVDLLKTLPQSVFV-GQEYEDSPLKGYTQKLEYEGVPKYFKHCRKI-GH  115



>ref|XP_006282222.1| hypothetical protein CARUB_v10028495mg, partial [Capsella rubella]
 gb|EOA15120.1| hypothetical protein CARUB_v10028495mg, partial [Capsella rubella]
Length=409

 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 91/213 (43%), Gaps = 10/213 (5%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLL  1112
             P   KG P ++   + ++     +R  ++ K      ++  L +   ++   R   + +L
Sbjct  69    PNGAKGEPVITIGKEVLEVMYGLYRNCMIVKVLGRHITIDALNRKLKEMWKPR-GGMAVL  127

Query  1111  D--QHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEG  941
             D  +   ++ F++E D+          + G I+    WS DF P  +  +  PVW+    
Sbjct  128   DLPRQFFMIRFDLEEDYMAAVTGGPWRVFGSILMVKAWSPDFDPVRDDIVTTPVWVRISN  187

Query  940   FLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSY  761
                    ++ +  IA  +G PL+VD +TL   R   AR+CVE+N+   L   + I +  Y
Sbjct  188   LPVFYYHRKILMGIAEGVGKPLRVDLTTLKMERGRFARICVEVNLRESLKGTVLINDERY  247

Query  760   GDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHR  662
                 + +TN  I P C       GHN    P R
Sbjct  248   YVSYEGLTN--ICPTCG----VYGHNASSCPTR  274



>ref|XP_007028009.1| Uncharacterized protein TCM_023008 [Theobroma cacao]
 gb|EOY08511.1| Uncharacterized protein TCM_023008 [Theobroma cacao]
Length=707

 Score = 71.2 bits (173),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             M   KWS +F    ES +VPVWI+F     HL +K  +  IA  +G PL VD +T + +R
Sbjct  1     MRVFKWSPEFEAEKESAMVPVWISFPNLKTHLYEKSTLLLIAKTVGKPLYVDEATANGSR  60

Query  841   PSMARVCVELN  809
             PS+ARVC+E +
Sbjct  61    PSVARVCIEYD  71



>ref|XP_009799813.1| PREDICTED: uncharacterized protein LOC104245823 isoform X1 [Nicotiana 
sylvestris]
Length=483

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = -1

Query  1006  WSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMAR  827
             WSLDF+   E+    VWI+       L   +A+ SIA+++G P+ +D +T + +RPS AR
Sbjct  78    WSLDFKVNEETTKAVVWISLPNLPTELFAMKALLSIASVVGKPIAIDKATQTKSRPSAAR  137

Query  826   VCVELNVSNDLPHQIWI-----MNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             V V L++ + L  ++++       G   +F Q    + +P YC+ C++ QGH+
Sbjct  138   VKVILDLMDKLHDKLFLQFVDKQTGKIVEFFQDFVYDNLPLYCNCCKH-QGHD  189



>ref|XP_009798971.1| PREDICTED: uncharacterized protein LOC104245101 [Nicotiana sylvestris]
Length=146

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = -1

Query  994  FRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVE  815
            FR   E+P    WI+F G L     K  ++S+A+ +G P+ +D  T++  RPS ARV V 
Sbjct  36   FRADEETPKAMAWISFPGLLPTFFVKECLFSLASAVGKPMHLDMETINKTRPSCARVKVL  95

Query  814  LNVSNDLPHQIWI-----MNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
            +++  DLP ++ +      NG+      ++  + +P YC  C+  QGH+
Sbjct  96   VDLLADLPKKVRMDIVNEANGTTRTEWVRIQYDMLPKYCRHCK-LQGHD  143



>ref|XP_010689805.1| PREDICTED: uncharacterized protein LOC104903466 [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 64/120 (53%), Gaps = 4/120 (3%)
 Frame = -1

Query  1006  WSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             WS  F  + E   ++P+W+ F     H     ++  I +L+G P+  D  T    R S  
Sbjct  104   WSPSFNFHSEILKVIPIWVKFPNLPLHYWSGDSLSRIGSLLGIPIYADECTFKALRVSFV  163

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
             RV +E++++ ++P +I I+  S   F+QKVT ++ P +C+ C +T GHN   E  R  PK
Sbjct  164   RVLIEMDITKEIPKEIHIVEPSGMSFSQKVTYDWRPAFCTKC-STIGHNC--ENLRSNPK  220



>ref|XP_009799814.1| PREDICTED: uncharacterized protein LOC104245823 isoform X2 [Nicotiana 
sylvestris]
Length=483

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 64/113 (57%), Gaps = 6/113 (5%)
 Frame = -1

Query  1006  WSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMAR  827
             WSLDF+   E+    VWI+       L   +A+ SIA+++G P+ +D +T + +RPS AR
Sbjct  78    WSLDFKVNEETTKAVVWISLPNLPTELFAMKALLSIASVVGKPIAIDKATQTKSRPSAAR  137

Query  826   VCVELNVSNDLPHQIWI-----MNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             V V L++ + L  ++++       G   +F Q    + +P YC+ C++ QGH+
Sbjct  138   VKVILDLMDKLHDKLFLQFVDKQTGKIVEFFQDFVYDNLPLYCNYCKH-QGHD  189



>ref|XP_006301986.1| hypothetical protein CARUB_v10022467mg, partial [Capsella rubella]
 gb|EOA34884.1| hypothetical protein CARUB_v10022467mg, partial [Capsella rubella]
Length=421

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 71/153 (46%), Gaps = 13/153 (8%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWL---WKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAF  947
             L +   ++ F +E ++        WK+    G  +    WS  F P  +    +PVW+ F
Sbjct  101   LPRQFFMVRFEVEEEYLTALTGGPWKAF---GSYLMVRAWSPHFEPSRDDITTIPVWVRF  157

Query  946   EGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNG  767
                   L  +  +  +A  +G PL+VDA+TL+  RP  ARVCVE+++S  L     +   
Sbjct  158   SNLPVALYHQTILLGLAQALGKPLRVDANTLNFERPRFARVCVEVDLSQPLKRSFMVNGE  217

Query  766   SYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEP  668
              Y  F + +T+      CSGC    GH +H  P
Sbjct  218   RYFVFYEGLTS-----ICSGC-EIFGHMVHACP  244



>emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=744

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 90/204 (44%), Gaps = 10/204 (5%)
 Frame = -1

Query  1267  SVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHH--VL  1094
             +VSFT + + +  + +R  L+GK      S   L++  ++I +     + ++D  H   L
Sbjct  107   AVSFTKETLWKLREPWRNTLMGKVLGMSISRNFLVERVNRI-WKTNDKVEVIDLGHDVFL  165

Query  1093  LNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGFLAHLQDK  917
               FN   D ++        I    +   +W  DFRP       + VWI F        DK
Sbjct  166   FKFNNGNDMEKALFGGPWFILNHYLMLTRWKPDFRPSQSVFDKIMVWIRFPELPLEYYDK  225

Query  916   RAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVT  737
              A+++IA  +G P+KVD +T    R   ARVC+EL+++  L  ++W+         Q V 
Sbjct  226   EALFAIAGKVGKPIKVDYATDHMARGRYARVCIELDLAKALVSKVWVARA-----WQNVE  280

Query  736   NEYIPPYCSGCRNTQGHNLHQEPH  665
              E +   C  C    GH   Q  H
Sbjct  281   YENLSLVCFLCGKI-GHRRDQCSH  303



>ref|XP_009762468.1| PREDICTED: uncharacterized protein LOC104214497 [Nicotiana sylvestris]
Length=439

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            +P+W+   G       + ++  I  LIG  L+ DA+T    R + ARV VE+ ++++ P 
Sbjct  26   IPIWVRMVGLDVKYWGRTSLTKITGLIGKSLRTDAATTKRERLTYARVLVEVKLNHEYPT  85

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEP  668
             IW  N +     QK+  E+ P  C  CRN  GH L++ P
Sbjct  86   SIWFENEAGKIVEQKIHYEWKPVMCEKCRNY-GHELNECP  124



>ref|XP_006279197.1| hypothetical protein CARUB_v10016517mg, partial [Capsella rubella]
 gb|EOA12095.1| hypothetical protein CARUB_v10016517mg, partial [Capsella rubella]
Length=457

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 67/157 (43%), Gaps = 7/157 (4%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   ++ F  E ++          + G  +    WS DF P  +  +  PVW+     
Sbjct  110   LPRQFFMIRFEREEEYLAALTGGPWRVFGSHLMVQAWSSDFNPLRDDIVTTPVWVRLSNL  169

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                   +  +  IA+ +G P+KVD +TL+  R   ARVCVE+N+S  +   + I    Y 
Sbjct  170   PVFFYHQDILLGIASGLGKPIKVDVTTLNFERARFARVCVEINLSKPVKGSVMINGDRY-  228

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPKT  647
                  V  E +   CSGC    GH +H  P R   K 
Sbjct  229   ----YVAYEGLSNICSGC-GVYGHLVHNCPRRVLEKV  260



>ref|XP_010418769.1| PREDICTED: uncharacterized protein LOC104704363 [Camelina sativa]
Length=371

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 68/154 (44%), Gaps = 7/154 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   ++ F  E ++          + G  +    W+L F P  +  +  PVW+     
Sbjct  93    LPRQFFMVRFTQEDEYMGALTGGPWRVFGNYLMVQNWTLAFDPLKDEIVTTPVWVRLLNI  152

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                   +  +  IA+ +G PLKVD +TL+ +R   ARVCVE+N+S  L   + I    Y 
Sbjct  153   PVSFYHQSILMGIASSLGKPLKVDTTTLNFSRARFARVCVEVNLSRPLKGTVLINGEQY-  211

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRET  656
                  V  E +   CS C    GH +H  P RET
Sbjct  212   ----FVAYEGLDRICSSC-GLYGHFVHSCPTRET  240



>ref|XP_010682918.1| PREDICTED: uncharacterized protein LOC104897680 [Beta vulgaris 
subsp. vulgaris]
Length=452

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 103/231 (45%), Gaps = 26/231 (11%)
 Frame = -1

Query  1336  ADVLSSNTDDSP-LRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKF--SKGRPS----  1178
             A  LSS   D P L  P    G+  V F+ + + Q  + +   L+GK      RPS    
Sbjct  59    AVYLSSMEWDEPELEAPS---GVNVVQFSKEKLSQLRKPWGLTLMGKCLGISVRPSFITQ  115

Query  1177  -MADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWS  1001
              +  + KP    G   +  LG   +   L  F+++ D++R        +    +   +W 
Sbjct  116   RVRSMWKPR---GTLEVIDLG---KDTYLFRFSLQDDYERALFGGPWYVLDHYLMVTQWQ  169

Query  1000  LDFRPYVESPI--VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMAR  827
              +FRP   +P   + VWI          DK A+++IA+ +G P++VD +T    R   AR
Sbjct  170   PNFRP-THNPFGSMAVWIHLPELPVEYYDKEALFAIASKLGKPIRVDYATNHITRARYAR  228

Query  826   VCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
             +C+E+N+S  +  +IWI     G+  Q +  E +   C  C    GH  +Q
Sbjct  229   ICIEINLSKPIISKIWI-----GNQWQVILYENLHSLCFVCGGI-GHQKNQ  273



>ref|XP_010690660.1| PREDICTED: uncharacterized protein LOC104904165 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 89/207 (43%), Gaps = 22/207 (11%)
 Frame = -1

Query  1267  SVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLL--------KPFDQIGFGRIFSLGLL  1112
             +VSF+ + +Q   + +R  L+ K   G P   + L        K  D++    +  LG  
Sbjct  111   AVSFSKEKLQSLREPWRNTLMAKVL-GMPINRNFLVDRVNRMWKTKDRL---EVIDLG--  164

Query  1111  DQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGFL  935
              Q   LL F+   D +R        I    +   KW  DFRP   S   + VWI F    
Sbjct  165   -QGIFLLKFHNSDDMERALYGSPWFILNHYLMLTKWKPDFRPSSSSFDKIMVWIRFPELP  223

Query  934   AHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGD  755
                 +K A+++IA  +G P+KVD +T +  R   ARVC+EL +S  L  ++W+       
Sbjct  224   LEYYEKDALFAIAEKVGKPIKVDYATDTVVRGRYARVCIELELSKALVTRVWVAKA----  279

Query  754   FAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
               Q V  E +   C  C    GH   Q
Sbjct  280   -WQTVEYENLDLVCFKCGRI-GHRQDQ  304



>ref|XP_010695085.1| PREDICTED: uncharacterized protein LOC104907793 [Beta vulgaris 
subsp. vulgaris]
Length=390

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            I+P+W+       H     ++  I +L+G P+  D  T    R S AR+ +E++V+  LP
Sbjct  163  IIPLWVKLPNLPLHYWSGDSLSRIGSLLGKPVYADECTSKALRVSFARILIEMDVTKKLP  222

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             +I I   +   F QKV+ +++PPYC  C    GHN
Sbjct  223  SEIQIEEPNGATFTQKVSYDWLPPYCKKCLKV-GHN  257



>ref|XP_009604423.1| PREDICTED: uncharacterized protein LOC104099212 [Nicotiana tomentosiformis]
Length=628

 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 107/229 (47%), Gaps = 19/229 (8%)
 Frame = -1

Query  1324  SSNTDDSPLRPPGHYKGMPSVSFTDQDVQQFSQK--FRFALVGKFSKGRP---SMADLLK  1160
             ++N +   L+P     G+P++ F+  +  +F+++     A+V K S   P   ++ +LL 
Sbjct  35    AANLNKKLLKPIEVIHGIPTIQFSLDERMEFAKEEGLHQAVVVKLSSNAPDVSTLRNLLP  94

Query  1159  PFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVK-----WSLD  995
              F   G      +G L    +L+  +   DF    L +S++   +  G  +     WS+ 
Sbjct  95    KF--FGIKGQALIGQLAPRQLLIRIDQHDDFVNS-LGRSVNYFKYNDGEHQIIVFPWSVG  151

Query  994   FRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVE  815
             F    E     VWI+       L   +A+ SIA+ +G P+ +D +T + +R S ARV   
Sbjct  152   FNVKEEPTKAVVWISLPNLPTELFAMKALLSIASAVGKPIAIDKATQTKSRASTARVKAI  211

Query  814   LNVSNDLPHQIWI-----MNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             L++   LPH++ +       G   +  Q    + +P YC+ C++ QGH+
Sbjct  212   LDLMGKLPHKLRLQFLDKQMGRMVEVFQDFVYDNLPLYCNHCKH-QGHD  259



>ref|XP_006375666.1| hypothetical protein POPTR_0014s19100g, partial [Populus trichocarpa]
 gb|ERP53463.1| hypothetical protein POPTR_0014s19100g, partial [Populus trichocarpa]
Length=374

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/211 (25%), Positives = 94/211 (45%), Gaps = 6/211 (3%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             Y    S    D D+      ++F L+G  ++  P  A LL  F +  +    +  + D  
Sbjct  121   YVSSASCQLQDTDIGDPIPIWKFCLIGYVTRKFPGYAALLN-FIRKNWKHKSNFTMHDSG  179

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAH  929
              ++  FN EL+           I G   I+  +    DF+P+ +   +P W+ F      
Sbjct  180   WLIFAFNSELEMLDILSSGPYFIFGRPLILKVMPEFFDFQPF-DMARMPTWVRFPNLPLC  238

Query  928   LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFA  749
                   +  IA ++G P+  D  T +  R   AR+ +E+++  DLP  + ++  +   F+
Sbjct  239   CWTPICLSKIAIMVGKPIHCDVPTANMTRLLYARILIEIDLLQDLPAAVNVILPNGTPFS  298

Query  748   QKVTNEYIPPYCSGCRNTQGHNLHQEPHRET  656
             Q++T E  P +C  CR   GH+++   +RET
Sbjct  299   QQITYESFPCFCMKCR-VIGHSINAC-NRET  327



>ref|XP_010670298.1| PREDICTED: uncharacterized protein LOC104887379 [Beta vulgaris 
subsp. vulgaris]
Length=427

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            I+P+W+       H     ++  I +L+G P+  D  T    R S AR+ +E++V+  LP
Sbjct  203  IIPLWVKLPNLPLHYWSGDSLSRIGSLLGRPVYADECTSKALRVSFARILIEMDVTKTLP  262

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             +I I   +   F QKV+ +++PPYC  C    GHN
Sbjct  263  TEIQIEEPNGATFTQKVSYDWLPPYCKKCLKV-GHN  297



>ref|XP_010686891.1| PREDICTED: uncharacterized protein LOC104901048 [Beta vulgaris 
subsp. vulgaris]
Length=203

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 3/97 (3%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            +VP+WI   G       +R+++ IA L+G  +K+D +T + +R S ARV VE+++   LP
Sbjct  10   MVPIWIKMGGLSIKYWGERSLFKIAGLVGRAVKMDEATKTKDRLSYARVMVEVSMKQQLP  69

Query  790  HQIWIMNGSYGDFA-QKVTNEYIPPYCSGCRNTQGHN  683
              I   N  YG    QK+  E+ P  C  C    GHN
Sbjct  70   DSISFCN-EYGKMVEQKIEYEWRPVVCKKCSGV-GHN  104



>ref|XP_009341595.1| PREDICTED: uncharacterized protein LOC103933633 [Pyrus x bretschneideri]
Length=572

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 109/244 (45%), Gaps = 25/244 (10%)
 Frame = -1

Query  1345  RTFADVLS----SNTDDSPLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKF--SKG-  1187
             RTFA +++    S+ + S L  P     +  V  ++   Q+  +  R  L+G+    KG 
Sbjct  106   RTFAAIVTNGAESSVNLSQLPSPAVRGDVTYVKISEDLYQEQLRSCRTNLIGRLLLKKGT  165

Query  1186  --------RPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIK  1031
                     + ++A L KP +       + L  L + +  L+F+ E D +R W   + +++
Sbjct  166   MPMKTEFLKSALASLWKPHNS------WKLVPLGKGYFDLHFSNEEDVRRVWGGGTCTLQ  219

Query  1030  GFIMGTVKWSLDFRPYVESPIV--PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDAST  857
               +    +W  DF+     P     VWI   G        R +  IA  +G+PL++D +T
Sbjct  220   FGLFRLSQWQPDFKLGDALPQTHAQVWIKIYGLSQEYWHPRILMEIARGVGTPLQLDHAT  279

Query  856   LSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLH  677
                     AR+ V++++S DLP  I +    +G F+  +  E +PP C  C    GHN +
Sbjct  280   REKLYGYYARILVDVDLSADLPSSIMVEREQHG-FSVDIIYENLPPTCGHC-GVIGHNAN  337

Query  676   QEPH  665
             +  H
Sbjct  338   KCRH  341



>ref|XP_010314948.1| PREDICTED: uncharacterized protein LOC104645283 [Solanum lycopersicum]
Length=793

 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 97/209 (46%), Gaps = 11/209 (5%)
 Frame = -1

Query  1294  PPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIF--SL  1121
             PP    G   V    ++VQ+   K++FAL+  +  G     +++  +  + + +    +L
Sbjct  133   PPQIVNGETMVQLEGKEVQEEEAKWKFALIA-YVVGECPGYNVMNRYIMMNWSKAGKPTL  191

Query  1120  GLLDQHHVLLNF-NMELDFQRCWLWKSLSIKGFIMGTVKWSLDF---RPYVESPIVPVWI  953
              L ++ + ++ F NME D          +I    +   +W  DF   + ++    +P+W+
Sbjct  192   FLHEEGYFIVKFQNME-DMNEILFSGPYTINNRPIILKQWCSDFDFGKEFLAE--IPLWV  248

Query  952   AFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM  773
              F   L +     ++  IA+ IG PL  D  T    R S AR+ +E++V+  +P QI + 
Sbjct  249   KFPRLLLNCWGAGSLSRIASAIGVPLFADECTTKQTRISYARMLIEVDVTKAIPQQITVA  308

Query  772   NGSYGDFAQKVTNEYIPPYCSGCRNTQGH  686
             + +   F Q V  E+ P YC  C+   GH
Sbjct  309   DPNGRTFVQDVVMEWKPLYCHKCQKI-GH  336



>ref|XP_010668455.1| PREDICTED: uncharacterized protein LOC104885464, partial [Beta 
vulgaris subsp. vulgaris]
Length=385

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 56/108 (52%), Gaps = 3/108 (3%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            I+P+W+     L H     ++  I +L+G P+  D  T    R S AR+ +E++V+  LP
Sbjct  158  IIPLWVKLPNLLLHYWSGDSLSRIESLLGKPVYADECTSKALRVSFARILIEMDVTKKLP  217

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPKT  647
             +I I   +   F QKV+ +++PPYC  C    G+N   E     PKT
Sbjct  218  SEIQIDEPNGATFTQKVSYDWLPPYCKKCLKV-GNNC--EAGGSKPKT  262



>ref|XP_006361065.1| PREDICTED: putative NPIP-like protein LOC613037-like [Solanum 
tuberosum]
Length=499

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 54/97 (56%), Gaps = 6/97 (6%)
 Frame = -1

Query  961  VWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQI  782
             WI+F         + A++S+A+ +G PL VD +T    RPS ARV VE+N+   LP +I
Sbjct  2    AWISFPSLPCQYFARNALFSMASAVGQPLDVDRATYDKTRPSTARVKVEVNLLRILPKRI  61

Query  781  WI-----MNGSYGDFAQKVTNEYIPPYCSGCRNTQGH  686
             +     + G   +  QK+  +Y+P YC  C++ QGH
Sbjct  62   RVQFNNLVTGEITNVWQKIRYDYVPYYCKRCKH-QGH  97



>ref|XP_007022714.1| Uncharacterized protein TCM_033530 [Theobroma cacao]
 gb|EOY14239.1| Uncharacterized protein TCM_033530 [Theobroma cacao]
Length=816

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 58/112 (52%), Gaps = 1/112 (1%)
 Frame = -1

Query  1303  PLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFS  1124
             P R P  YK  P+  F   ++Q  ++ F  ++VGKF++  P + D+ + F  IG    + 
Sbjct  135   PTRNPCTYKDRPAAMFFKDEIQILARPFSHSIVGKFTR-TPRLQDVQQAFKGIGLSGAYE  193

Query  1123  LGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI  968
             +  +D  HVL++ + E DF R W+ +   I    M   KW+ DF+   ES +
Sbjct  194   IWWMDYKHVLIHLSNEQDFNRLWVKQQWFILNQKMRVFKWTPDFQAEKESAV  245



>ref|XP_006295777.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella]
 gb|EOA28675.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella]
Length=451

 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/211 (25%), Positives = 96/211 (45%), Gaps = 10/211 (5%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIG--FGRIFSLG  1118
             P    G P ++  ++ +      ++  ++ K    +  +A L +   ++    GR++ + 
Sbjct  54    PNGRTGEPEITIGEEVISVMHGLWKNCMIVKVLGRQIPVAVLNRKLKELWKPSGRMYVMD  113

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEG  941
             L  +H  ++ F +E ++          + G  +   +WS +F P  +  +  PVW+    
Sbjct  114   L-PRHFFMVRFELEEEYLNALTGGPWRVFGNYLMVQQWSPNFDPLKDDIVTTPVWVRLMN  172

Query  940   FLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSY  761
                    K  + +IA  +G+PL+VD +TLS  R   ARVCVE+N+S  L   + ++NG +
Sbjct  173   IPVWYYHKSILMAIAEGVGTPLRVDLTTLSLERARFARVCVEVNLSEPLKGTL-LINGEW  231

Query  760   GDFAQKVTNEYIPPYCSGCRNTQGHNLHQEP  668
                A     E +   CS C    GH +H  P
Sbjct  232   FFVAY----EGLTRICSSC-GLYGHLVHACP  257



>ref|XP_009770244.1| PREDICTED: uncharacterized protein LOC104220969 [Nicotiana sylvestris]
Length=315

 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/194 (24%), Positives = 86/194 (44%), Gaps = 5/194 (3%)
 Frame = -1

Query  1255  TDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNME  1076
              +Q+ Q +       ++G           + + +  +G   +F   L D+ + ++ F   
Sbjct  122   VEQETQNWKSDLIVYIIGDIPGYNYMKNYVAQNWAIVGEPEVF---LHDEGYYIIKFQSV  178

Query  1075  LDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQDKRAIYSI  899
              D          +I    +    WS DF    E  I +P+W+ F     +    +++ SI
Sbjct  179   ADMNEILYSGPYTINNRPIVIKPWSPDFDLKTEFLIEIPIWVKFPKLPINCWGAKSLSSI  238

Query  898   ANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPP  719
             A+ IG+PL  D+ T    R S AR+ +E+NV+  LP ++ +M+ +   F Q V  ++ P 
Sbjct  239   ASTIGTPLYADSCTAKQTRISFARILIEVNVTKPLPDEVEVMDPTGRFFQQPVLYDWKPN  298

Query  718   YCSGCRNTQGHNLH  677
             +C  C    GH+ +
Sbjct  299   FCEKCMKI-GHDCN  311



>ref|XP_010685587.1| PREDICTED: uncharacterized protein LOC104899978 [Beta vulgaris 
subsp. vulgaris]
Length=441

 Score = 67.4 bits (163),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 61/123 (50%), Gaps = 3/123 (2%)
 Frame = -1

Query  1015  TVK-WSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNR  842
             TVK WS  F  + E   IVP+W+ F     H     ++  I +L+G P+  D  T +  +
Sbjct  54    TVKQWSPSFNFHSEVLKIVPIWVKFPNLPLHCWSSDSLSRIGSLLGVPIYADECTSNALQ  113

Query  841   PSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHR  662
              S ARV +E++V+  +P++I +   +   F QKV  + + PYC  C    GHN      R
Sbjct  114   VSFARVLIEMDVTKRVPNEIHVEEPNGTTFTQKVVYDLLSPYCGKCLKV-GHNCETSMGR  172

Query  661   ETP  653
               P
Sbjct  173   SEP  175



>ref|XP_010682589.1| PREDICTED: uncharacterized protein LOC104897413 [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 66/146 (45%), Gaps = 2/146 (1%)
 Frame = -1

Query  1111  DQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGFL  935
             ++   ++  N + D  R  L       G  M   KW   F  + E   +VPVW+ F    
Sbjct  118   EEGFFIVKLNGKEDRDRILLTGPHLFYGKAMIVKKWCATFNFHEEILKVVPVWVKFPNLP  177

Query  934   AHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGD  755
                    ++  I +++G PL  D  T    R S ARV VE++V+  L  ++ + + +   
Sbjct  178   LSCWGGDSLSRIGSILGVPLFADECTRKGLRISFARVLVEVDVTQKLQEEVRVEDPNGKC  237

Query  754   FAQKVTNEYIPPYCSGCRNTQGHNLH  677
             F QKV  E++PPYC  C    GHN  
Sbjct  238   FCQKVVYEWLPPYCKKCCKV-GHNCE  262



>ref|XP_006296651.1| hypothetical protein CARUB_v10015577mg, partial [Capsella rubella]
 gb|EOA29549.1| hypothetical protein CARUB_v10015577mg, partial [Capsella rubella]
Length=476

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 66/152 (43%), Gaps = 7/152 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   ++ F+ E ++          + G  +    WS DF P  +  +  PVW+     
Sbjct  114   LPRQCFMIRFDREDEYHAALTGGPWKVFGSYLLVQDWSPDFNPLRDDIVTTPVWVRLSNI  173

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                   +  +  IA+ +G P+KVD +TL   R   ARVCVE+N+S  L   + I    Y 
Sbjct  174   PVIFYQEDILLGIASGLGKPVKVDLTTLHIERARFARVCVEVNLSKPLKGSVMINGERY-  232

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHR  662
                  V  E +   CSGC    GH +H  P R
Sbjct  233   ----YVAYEGMSNICSGC-GVFGHLVHNCPRR  259



>ref|XP_010423120.1| PREDICTED: uncharacterized protein LOC104708268 [Camelina sativa]
Length=301

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 70/157 (45%), Gaps = 7/157 (4%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   L+ F  E+++          + G  +    W+ +F P V+  +  PVW+     
Sbjct  126   LPRQFFLVRFGSEVEYLAALTGGPWRVFGSYLMVQAWTPEFDPLVDEIVTTPVWVRVSNL  185

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +   +  + S++  +G P+KVD +TL+  R   AR+CVE+N+   L   I I  G Y 
Sbjct  186   TYNFYHRAILMSLSKGLGRPIKVDLTTLNFERGRFARICVEVNLKKPLKGSILINGGHYF  245

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPKT  647
                + +TN      CS C    GH +H  P +    T
Sbjct  246   VSYEGLTN-----ICSLC-GLFGHVVHNCPTKSVEMT  276



>ref|XP_008350100.1| PREDICTED: uncharacterized protein LOC103413411 [Malus domestica]
Length=405

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 70/145 (48%), Gaps = 4/145 (3%)
 Frame = -1

Query  1093  LNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRP--YVESPIVPVWIAFEGFLAHLQD  920
             L+F+ E D +R W   + +++  +    +W  DF+P   +      VWI   G       
Sbjct  34    LHFSSEEDMRRVWGGGTCTLQFGLFRLSQWQPDFKPGDVLPQTHAQVWIKIYGLSQEYWH  93

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKV  740
              R +  IA  +G+PL++D +T        AR+ V++++S DLP  I +    +G F+  +
Sbjct  94    PRILMEIARGVGTPLQLDHATREKLYGYYARILVDVDLSADLPSTIMVEREQHG-FSVDI  152

Query  739   TNEYIPPYCSGCRNTQGHNLHQEPH  665
               E +PP C  C    GHN ++  H
Sbjct  153   IYENLPPTCGHC-GVIGHNTNKCRH  176



>ref|XP_006296775.1| hypothetical protein CARUB_v10015820mg [Capsella rubella]
 gb|EOA29673.1| hypothetical protein CARUB_v10015820mg [Capsella rubella]
Length=503

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 66/152 (43%), Gaps = 7/152 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   ++ F+ E ++          + G  +    WS DF P  +  +  PVW+     
Sbjct  114   LPRQCFMIRFDREDEYHAALTGGPWKVFGSYLLVQDWSPDFNPLRDDIVTTPVWVRLSNI  173

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                   +  +  IA+ +G P+KVD +TL   R   ARVCVE+N+S  L   + I    Y 
Sbjct  174   PVIFYQEDILLGIASGLGKPVKVDLTTLHIERARFARVCVEVNLSKPLKGSVMINGERY-  232

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHR  662
                  V  E +   CSGC    GH +H  P R
Sbjct  233   ----YVAYEGMSNICSGC-GVFGHLVHNCPRR  259



>ref|XP_010667206.1| PREDICTED: uncharacterized protein LOC104884282 [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 63/120 (53%), Gaps = 2/120 (2%)
 Frame = -1

Query  1006  WSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             WS +F  + E   ++P+W+ F         + ++  I +++G PL  D  T    R S A
Sbjct  78    WSANFNFHEEILKVIPIWVKFPNLPLKCWGEDSLSRIGSVLGVPLYADECTSKCLRVSFA  137

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
             RV +E++V+ DL  +I + +     F QKV+ +++PP+C  C+   GHN   +   + P+
Sbjct  138   RVLIEIDVTQDLVKEIEVEDPYGVVFKQKVSFDWLPPFCKKCQKV-GHNCGNQSQVKGPE  196



>ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago truncatula]
 gb|ABE91952.1| Zinc finger, CCHC-type [Medicago truncatula]
Length=504

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 97/215 (45%), Gaps = 13/215 (6%)
 Frame = -1

Query  1273  MPSVSFTDQDVQQFSQKFRFALVGKF---SKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             +P +    Q  Q+    ++ ALV K    S G  +M D L+   ++  G  F +   D  
Sbjct  70    LPKIYIEPQTFQELCTPWKDALVVKLLGKSLGYNTMKDRLQKIWKLQGG--FDIMDNDNG  127

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF-RPYVESPIVPVWIAFEGFLAHL  926
               ++ F+   D ++        I    +    W+ +F  P  +     VW+ F G     
Sbjct  128   FFMVKFDQAADKEKVITGGPWLIFDHCLAVTHWTPEFASPNAKVDRTVVWVRFPGLNLVY  187

Query  925   QDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQ  746
              D+  + ++A+ +G P+KVD +TL   R   ARVCVE++++  +  +IW+ NG +     
Sbjct  188   YDESFLLAMASALGRPIKVDTNTLKVERGKFARVCVEIDLTVPVVGKIWV-NGHW----Y  242

Query  745   KVTNEYIPPYCS--GCRNTQGHNLHQEPHRETPKT  647
             KV  E +   C+  GC    G N  ++P    P++
Sbjct  243   KVQYEGLHLICTNCGCYGHLGRNCMEKPSTFDPRS  277



>ref|XP_009765697.1| PREDICTED: uncharacterized protein LOC104217212 [Nicotiana sylvestris]
Length=466

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/224 (24%), Positives = 105/224 (47%), Gaps = 15/224 (7%)
 Frame = -1

Query  1306  SPLRPPGHYKGMPSVSFTDQDVQQFSQK--FRFALVGKFSKGRPSMADLLKPFDQI-GFG  1136
             + L+P     G+P++ F+  + ++F+++     A++ K S   P++  L     +I G  
Sbjct  48    TSLKPFEIVHGVPTIQFSMDEREEFAKEEGLHQAVMIKLSSDAPNLQILRSILPKIFGIK  107

Query  1135  RIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSI-----KGFIMGTVKWSLDFRPYVESP  971
                  G L    +L+  +   D+  C L ++++      +        WS+ + P  E+ 
Sbjct  108   GNCLFGSLAPQKILIRCDQHEDYVAC-LARAVNYFQHNGREHQYRVFPWSVGYNPNQETS  166

Query  970   IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
              V +WI+       L  ++ + SIA  IG P+ +  +T   +RP  ARV V +++ + LP
Sbjct  167   KVAIWISLPNLSPELFARKPLLSIAAAIGKPIAIYKATQVRSRPITARVKVIIDLLDKLP  226

Query  790   HQIW-----IMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
              +I      +  G   +  Q++  + +P YC  C++ QGH  +Q
Sbjct  227   EKIRLQYFDVKTGKIVEDYQEIIYDNLPSYCGHCKH-QGHEENQ  269



>ref|XP_010324142.1| PREDICTED: uncharacterized protein LOC104648514 [Solanum lycopersicum]
Length=232

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            VP+W+   G   +   K A+  IA ++G+PLK D +T+  +R + ARV +E+ ++ + P 
Sbjct  45   VPIWVRLVGLDINYWGKSALTKIAGMVGNPLKADMATIQKDRLTYARVLIEMPLTKEYPK  104

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
             I   N       QKV  E+ P  C  C+N  GH++ +
Sbjct  105  DIMFENEMGKIVHQKVEYEWKPILCMKCKNF-GHDISE  141



>ref|XP_009355139.1| PREDICTED: uncharacterized protein LOC103946202 [Pyrus x bretschneideri]
Length=572

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/244 (25%), Positives = 108/244 (44%), Gaps = 25/244 (10%)
 Frame = -1

Query  1345  RTFADVLSSNTDDS----PLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKF--SKG-  1187
             RTFA ++++ ++ S     L  P     +  V  ++   Q+  +  R  L+G+    KG 
Sbjct  106   RTFAAIVTNGSESSVNLSQLPSPTVRGDVTYVKISEDLYQEQLRSCRTNLIGRLLLKKGT  165

Query  1186  --------RPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIK  1031
                     + ++A L KP +       + L  L + +  L+F+ E D +R W   + +++
Sbjct  166   MPMKTEFLKSALASLWKPHNS------WKLVPLGKGYFDLHFSNEEDVRRVWGGGTCTLQ  219

Query  1030  GFIMGTVKWSLDFR--PYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDAST  857
                    +W  DF+    +      VWI   G        R +  IA  +G+PL++D +T
Sbjct  220   FGRFRLSQWQPDFKLGDVLPQTHAQVWIKIYGLSQEYWHPRILMEIARGVGTPLQLDHAT  279

Query  856   LSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLH  677
                     AR+ V++++S DLP  I +    +G F+  +  E +PP C  C    GHN +
Sbjct  280   REKLYGYYARILVDVDLSADLPSSIMVEREQHG-FSADIIYEILPPTCGHC-GVIGHNRN  337

Query  676   QEPH  665
             +  H
Sbjct  338   KCRH  341



>ref|XP_009613478.1| PREDICTED: uncharacterized protein LOC104106604 [Nicotiana tomentosiformis]
Length=174

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 10/150 (7%)
 Frame = -1

Query  1093  LNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKR  914
             +N  M L  +R    + + I+G IM    W   F P  +SPIVP+W+       H    +
Sbjct  1     MNMIMSLSTKR----QFMYIQGQIMNLEVWIPIFNPAEDSPIVPIWVVILELPWHFYCMK  56

Query  913   AIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQ----  746
              +  + + IG  L +D ++    R S+A+V ++++++   PH +W       D  +    
Sbjct  57    ILRGLLSPIGKALHLDLASFQKIRGSVAKVKMQIDLTKSRPHHVWFEFDYKQDENRDGQW  116

Query  745   -KVTNEYIPPYCSGCRNTQGHNLHQEPHRE  659
              +V  E IP YC  C++   HN+   P R+
Sbjct  117   LEVQYENIPEYCLYCKHL-AHNIQDCPVRQ  145



>ref|XP_009605272.1| PREDICTED: uncharacterized protein LOC104099852 [Nicotiana tomentosiformis]
Length=178

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = -1

Query  994  FRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVE  815
            F+   E+P    WI F G L     K  ++S+A+ +G PL +D +T++  RPS ARV V 
Sbjct  37   FKVGEETPKAMAWILFPGLLPTFFVKECLFSLASAVGKPLHLDMATINKTRPSCARVKVL  96

Query  814  LNVSNDLPHQIW--IMNGSYGDFA---QKVTNEYIPPYCSGCRNTQGHN  683
            +++  +LP  I   I N + G+      K+  + +P YC  C+  QGH+
Sbjct  97   VDLLAELPKNIRMDIENEATGETRIEWVKIQYDMLPKYCKTCK-LQGHD  144



>ref|XP_007023504.1| Uncharacterized protein TCM_027547 [Theobroma cacao]
 gb|EOY26126.1| Uncharacterized protein TCM_027547 [Theobroma cacao]
Length=319

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 59/131 (45%), Gaps = 30/131 (23%)
 Frame = -1

Query  1210  LVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIK  1031
             +VGKF++  P M ++   F  IG    + +G LD  H+L+  + E D  R W        
Sbjct  1     MVGKFTQ-IPKMQEIRDTFIGIGPVGAYEIGWLDYKHILIWLSNEHDLNRIW--------  51

Query  1030  GFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLS  851
                                    +WI+F    AHL +K A+  IA ++G PL VD +T +
Sbjct  52    ---------------------NLLWISFPNLRAHLYEKSALLVIAKIVGRPLMVDEATAN  90

Query  850   HNRPSMARVCV  818
               RP+MA+ C 
Sbjct  91    RTRPNMAKYCT  101



>ref|XP_007037027.1| Uncharacterized protein TCM_013236 [Theobroma cacao]
 gb|EOY21528.1| Uncharacterized protein TCM_013236 [Theobroma cacao]
Length=175

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 7/89 (8%)
 Frame = -1

Query  928  LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI-----MNGS  764
            + +K A+  IA  IG PL +D +T + +RPS+ARVCVE +   D   Q+WI     ++G+
Sbjct  3    MYEKSALLLIAKTIGKPLYIDEATATRSRPSVARVCVEYDCRKDPVEQVWIVVKDRVSGT  62

Query  763  Y-GDFAQKVTNEYIPPYCSGCRNTQGHNL  680
              G + Q+V    IP YC  C +  GH +
Sbjct  63   VTGCYMQRVEFSKIPEYCGHCCHV-GHAV  90



>ref|XP_003615067.1| hypothetical protein MTR_5g063260 [Medicago truncatula]
Length=532

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 78/146 (53%), Gaps = 18/146 (12%)
 Frame = -1

Query  1045  SLSIKGFIMGTVKWSLDFRPYV-ESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKV  869
             S ++K  I+    W+ DF P V ++    VW+   G        + +++IA+ +G+PL  
Sbjct  142   SWNLKPGILKLFAWTHDFNPSVIQNSTAQVWVPIYGLSQEYWRPKILFAIASSVGTPLCT  201

Query  868   DASTLSHNRPSM-------ARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCS  710
             DA T   ++P+M       ARV V++++SNDL +++ +    Y  F + +  + +P +CS
Sbjct  202   DAVT---SKPAMDRTFGHFARVLVDMDLSNDLKYKVLVERKGYAFFVE-LGYDNLPAFCS  257

Query  709   GCRNTQGHNLHQ-----EPHRETPKT  647
              C+ T GHN+ +     EP ++  +T
Sbjct  258   NCKIT-GHNIEKCRKVNEPSKQARQT  282



>ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago truncatula]
Length=513

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 92/206 (45%), Gaps = 13/206 (6%)
 Frame = -1

Query  1273  MPSVSFTDQDVQQFSQKFRFALVGKF---SKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             +P +       Q+    ++ ALV K    + G  +M D L+   ++  G  F +   D  
Sbjct  67    LPKIYLEPTTFQELCTPWKDALVVKLLGKNLGYNTMKDRLQRIWKLQSG--FEIMDNDNG  124

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF-RPYVESPIVPVWIAFEGFLAHL  926
               ++ F+ E D ++        I    +    WS +F  P        VW+ F G     
Sbjct  125   FYMVKFDQEADKEKVVTGGPWMIFDHCLAVTHWSPEFASPEARVERTVVWVRFPGLNLVY  184

Query  925   QDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQ  746
              D+  + ++A+ IG P+KVD +TL   R   ARVCVE++++  +  +IW+ NG +     
Sbjct  185   YDESFLLAMASAIGRPIKVDTNTLKVERGKFARVCVEIDLTVPVVGKIWV-NGHW----Y  239

Query  745   KVTNEYIPPYCS--GCRNTQGHNLHQ  674
             K+  E +   C+  GC    G N +Q
Sbjct  240   KIQYEGLHLICTNCGCYGHLGRNCNQ  265



>ref|XP_006375692.1| hypothetical protein POPTR_0014s19680g, partial [Populus trichocarpa]
 gb|ERP53489.1| hypothetical protein POPTR_0014s19680g, partial [Populus trichocarpa]
Length=421

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 89/195 (46%), Gaps = 7/195 (4%)
 Frame = -1

Query  1258  FTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNM  1079
              + +D  +    ++  L+G ++ GR     +L  +    +    +L + D   ++  F+ 
Sbjct  169   LSPEDFGELRDIWKLCLIG-YTIGRTPGYTILGKYMANAWNCNATLHIHDSGWLIFQFSS  227

Query  1078  ELDFQRCWLWKSLSIKG--FIMGTVKWSLDF-RPYVESPIVPVWIAFEGFLAHLQDKRAI  908
               D  R       S++G   ++  +    DF +P + S  VPVW+              +
Sbjct  228   ASDMGRVLRRGPYSVQGKPLVLKPMPPYFDFGKPDMSS--VPVWVRLLNLPLECWSPACL  285

Query  907   YSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEY  728
               I+++IG  ++ D  TLS +R S ARV VE+ +++DLPH I +         QKV  EY
Sbjct  286   SKISSVIGKHIRCDDLTLSMSRVSFARVMVEVTLTDDLPHSISLSMPDGTIINQKVIYEY  345

Query  727   IPPYCSGCRNTQGHN  683
              P +CS C  T GH 
Sbjct  346   KPRFCSFCCIT-GHT  359



>ref|XP_008779956.1| PREDICTED: uncharacterized protein LOC103699731, partial [Phoenix 
dactylifera]
Length=533

 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 65/146 (45%), Gaps = 3/146 (2%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRP-YVESPIVPVWIAFEGF  938
             +   +  L F    D +   L     I G ++   +W  DF P  +E   V VW+   G 
Sbjct  75    MASGYFALRFRSVEDREAMLLRGPWVIAGQLLAVERWQPDFVPGRMEVNRVWVWLRLPGL  134

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                   K +I+ IAN  G P++VDA T    R   ARV VE+N S  +   ++I  G  G
Sbjct  135   PLEYWRKESIWEIANEAGVPIEVDAFTEDRRRMGYARVKVEVNASLPVRPGVFI-RGKEG  193

Query  757   DFAQKVTNEYIPPYCSGC-RNTQGHN  683
                Q  T E +PP CS C R   G N
Sbjct  194   KLWQSFTYESLPPVCSYCGRLGHGGN  219



>ref|XP_007158338.1| hypothetical protein PHAVU_002G144100g [Phaseolus vulgaris]
 gb|ESW30332.1| hypothetical protein PHAVU_002G144100g [Phaseolus vulgaris]
Length=130

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = -1

Query  958  WIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIW  779
            WI    F       RAI+SI   +G+P  +D ST+  NR   AR+ V++++ + LP  IW
Sbjct  44   WIQIYKFPLEYWRPRAIFSIIRGLGTPFSLDESTMKKNRGMFARILVDIDMLSPLPDHIW  103

Query  778  IMNGSYGDFAQKVTNEYIPPYCS  710
            +   +Y  F   V  E++PP+CS
Sbjct  104  VERPNY-TFVAGVEYEWLPPFCS  125



>ref|XP_006295613.1| hypothetical protein CARUB_v10024726mg, partial [Capsella rubella]
 gb|EOA28511.1| hypothetical protein CARUB_v10024726mg, partial [Capsella rubella]
Length=489

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 64/147 (44%), Gaps = 7/147 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   ++ F +E ++          + G  +    WS DF P     +  PVWI     
Sbjct  111   LPRQFFVVRFELEEEYMAALTGGPWKMFGSYLMVQAWSPDFDPLRNDIVTTPVWIRLSNI  170

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +L     +  IA  +G PL+VD  TL  +R   ARVCVE+N+S  L   + +    Y 
Sbjct  171   PMNLYHSSILMIIAEGLGKPLRVDMQTLKFDRARFARVCVEVNLSQPLKGTVLVNEERY-  229

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLH  677
                  V+ E +   CSGC    GH +H
Sbjct  230   ----YVSYEGLTNICSGC-GMYGHLVH  251



>ref|XP_006380553.1| hypothetical protein POPTR_0007s09200g [Populus trichocarpa]
 gb|ERP58350.1| hypothetical protein POPTR_0007s09200g [Populus trichocarpa]
Length=311

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 67/144 (47%), Gaps = 3/144 (2%)
 Frame = -1

Query  1129  FSLGLLDQHHVLLNFNMELDFQRCWLWKSLSI--KGFIMGTVKWSLDFRPYVESPIVPVW  956
              +L L D   ++   + E D  +       SI  K  ++  +    DF   V S  +PVW
Sbjct  9     VTLNLHDSGWLVFRLSCEADMLKVLRRGPYSIQDKPLVIKPMPLYFDFGKPVMS-YMPVW  67

Query  955   IAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI  776
             + F            +  I+N+IG P++ D  TLS +R S ARV +E+++S DLP  I +
Sbjct  68    VRFPNLPLECWSHACLSKISNVIGKPIRCDDLTLSMSRVSFARVMIEVDLSADLPRSISL  127

Query  775   MNGSYGDFAQKVTNEYIPPYCSGC  704
                      Q+V  EY P +CS C
Sbjct  128   SMPDGTIIKQRVIYEYKPRFCSHC  151



>ref|XP_009775461.1| PREDICTED: uncharacterized protein LOC104225384 [Nicotiana sylvestris]
Length=184

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 52/107 (49%), Gaps = 2/107 (2%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            ++P+WI F G L      +A+  +A+++G PL  D  T      S ARV VE ++S  LP
Sbjct  12   VIPLWITFPGLLLRFWFTKALSKLASVVGKPLYTDKITAEMENVSYARVLVETDISQPLP  71

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
                 M    G   Q++  E+ P YC  C    GHN ++   +E  K
Sbjct  72   DSF-EMQTKRGVIIQQIEYEWKPKYCCECIRF-GHNSNECWLKEVQK  116



>ref|XP_009770480.1| PREDICTED: uncharacterized protein LOC104221176 [Nicotiana sylvestris]
Length=146

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = -1

Query  910  IYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWI----MNGSYGDFAQK  743
            +  + + IG+PL++D +T    RPSMA+V VE++   + P+ +++     N    DF QK
Sbjct  7    VKQVVSAIGTPLEMDLATRGRTRPSMAKVRVEIDQLKNQPYSVYVGQIYKNAPQKDFVQK  66

Query  742  VTNEYIPPYCSGCRNTQGHNL  680
            +  E IP YC  CR T GHN+
Sbjct  67   LEFEGIPKYCKFCR-TLGHNM  86



>ref|XP_006301503.1| hypothetical protein CARUB_v10021929mg, partial [Capsella rubella]
 gb|EOA34401.1| hypothetical protein CARUB_v10021929mg, partial [Capsella rubella]
Length=477

 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 54/116 (47%), Gaps = 7/116 (6%)
 Frame = -1

Query  1006  WSLDFRPYVESPIV-PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             WS DF P  +  +  PVW+           +  +  IA+ +G P+KVD +TL   R   A
Sbjct  151   WSPDFNPLRDDIVTTPVWVRLSNIPVIFYQEDILLGIASGLGKPVKVDLTTLHIERARFA  210

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHR  662
             R+CVE+N+S  L   + I    Y      V  E +   CSGC    GH +H  P R
Sbjct  211   RICVEVNLSKPLKGSVMISGERY-----YVAYEGMSNICSGC-GVFGHLVHNCPRR  260



>ref|XP_006371236.1| hypothetical protein POPTR_0019s07150g [Populus trichocarpa]
 gb|ERP49033.1| hypothetical protein POPTR_0019s07150g [Populus trichocarpa]
Length=509

 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/202 (25%), Positives = 91/202 (45%), Gaps = 5/202 (2%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             +    S  F D D++ + + ++F+L+G  +   P    + K +    +    +  + D  
Sbjct  253   FTATSSCHFLDSDLRGYKELWQFSLIGFIAGKFPGYTSISK-YVHSTWKCNVNFSMHDSG  311

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV--PVWIAFEGFLAH  929
              ++  F  ELD           + G+++  +K   D+  +  S ++  PVW+ F      
Sbjct  312   WLIFKFTSELDMLAVLNGGPYHVFGWLL-ILKHMPDYFDFDTSDMIRLPVWVKFPNLSLQ  370

Query  928   LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFA  749
                   +  +A++IG P+  D  T S  R S ARV VE+++  DLP  I I   +    +
Sbjct  371   CWSPLCLSKLASVIGKPVHADTPTASMTRLSYARVLVEVDLLADLPSLINITLPNGVSKS  430

Query  748   QKVTNEYIPPYCSGCRNTQGHN  683
             Q V  E +P +C  C+ T GH+
Sbjct  431   QVVLYESLPRFCKQCK-TLGHS  451



>ref|XP_003630108.1| hypothetical protein MTR_8g091870 [Medicago truncatula]
Length=423

 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 88/194 (45%), Gaps = 11/194 (6%)
 Frame = -1

Query  1273  MPSVSFTDQDVQQFSQKFRFALVGKFSK---GRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             +P V    Q  Q+    ++ ALV K  +   G  +M + L    +   G  F +   D  
Sbjct  18    LPKVYLEPQIFQELCTPWKDALVVKLLRKNLGYNTMKERLHKVWKTQGG--FEIMDNDNG  75

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF-RPYVESPIVPVWIAFEGFLAHL  926
               ++ F+   D ++        I    M    WS +F  P  +     VW+ F G     
Sbjct  76    FYMVKFDQTSDKEKVITGGPWMIFDHCMVVAHWSPEFASPNAKVERTVVWVRFPGLNLVY  135

Query  925   QDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQ  746
              D+  + ++A+ IG P+KVD +TL+  R   ARVCVE++++  +  +IW+ NG +     
Sbjct  136   YDENFLLAMASAIGRPIKVDTNTLNVERGKFARVCVEIDLTAPVVGKIWV-NGHW----Y  190

Query  745   KVTNEYIPPYCSGC  704
             K+  E++   C+ C
Sbjct  191   KIQYEWLHLICTNC  204



>ref|XP_011101696.1| PREDICTED: uncharacterized protein LOC105179751 [Sesamum indicum]
Length=273

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            VPVWI        L  +  + ++A+ IG  L  DA T +  R + ARVCV L+VS+ LP 
Sbjct  74   VPVWIKLRHLPVELWTEEGLSTVASGIGKSLYPDAITRACMRLNFARVCVMLDVSSSLPK  133

Query  787  QIWIM--NGSYGDFAQKVTNEY--IPPYCSGCRNTQGH  686
             I IM  N   G+   K+  EY  IPP C+ C  T GH
Sbjct  134  HIIIMTPNEERGETPCKIDVEYEWIPPKCTNCM-TLGH  170



>ref|XP_006301940.1| hypothetical protein CARUB_v10022418mg, partial [Capsella rubella]
 gb|EOA34838.1| hypothetical protein CARUB_v10022418mg, partial [Capsella rubella]
Length=493

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 66/151 (44%), Gaps = 7/151 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGF  938
             L +   ++ F  E ++          + G  +    WS DF P     + +PVWI     
Sbjct  127   LPRQFFVVRFEFEEEYMAALTGGPWKMFGSYLMVQAWSPDFDPLRHDIVTMPVWIRLSNI  186

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +L     +  IA  +G P++VD +TL  +R   ARVCVE+++S  L   + I    Y 
Sbjct  187   PMNLYHSSILMIIAEGLGKPIRVDLTTLKFDRARFARVCVEVDLSQPLKGTVLINEERY-  245

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
                  V+ E +   CSGC    GH +H  P 
Sbjct  246   ----YVSYEGLTNICSGC-GMYGHLVHTCPR  271



>ref|XP_006292963.1| hypothetical protein CARUB_v10019240mg, partial [Capsella rubella]
 gb|EOA25861.1| hypothetical protein CARUB_v10019240mg, partial [Capsella rubella]
Length=405

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 66/150 (44%), Gaps = 7/150 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYV-ESPIVPVWIAFEGF  938
             L +   ++ F+ME ++          + G  +    WS DF P   E    PVW+     
Sbjct  82    LPRQFFMVRFDMEEEYMEALTGGPWKVFGSYLMVQDWSPDFDPMRDEITTTPVWVRLSNI  141

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                   ++ +  IA  +G PLKVD +T + +R   ARVCVE+N+   L   I + +  + 
Sbjct  142   PMLFYHRQILMGIAEGLGKPLKVDLTTQNLDRARFARVCVEVNLKKPLKGTIMVNDERF-  200

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEP  668
                  V+ E +   CS C    GH +H  P
Sbjct  201   ----FVSYEGLSSICSAC-GLYGHLVHACP  225



>ref|XP_003614993.1| hypothetical protein MTR_5g062140 [Medicago truncatula]
Length=449

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 73/151 (48%), Gaps = 7/151 (5%)
 Frame = -1

Query  1087  FNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQDKRA  911
             F  ++D +  W   ++++K  ++   +WS DF  + +      VWI           ++ 
Sbjct  49    FATKMDMRTVWAAGTINLKPGVLRLFEWSKDFNIHTQRNTHAQVWIRLLELPQEYWMEQT  108

Query  910   IYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNE  731
             +  IA+ IG+PL +D  T        AR+ V+++ S  L H+I +    Y  F  +V  E
Sbjct  109   LREIASAIGTPLLIDKVTSKRLFGHYARILVDMDFSRKLFHEIEVERQGYS-FTLEVAYE  167

Query  730   YIPPYCSGCRNTQGHNLHQ----EPHRETPK  650
             ++P +CS C+N  GH++       P +ET K
Sbjct  168   WLPDFCSHCQNI-GHDVTACRWLYPRKETKK  197



>ref|XP_010693979.1| PREDICTED: uncharacterized protein LOC104906849 [Beta vulgaris 
subsp. vulgaris]
Length=404

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 63/141 (45%), Gaps = 2/141 (1%)
 Frame = -1

Query  1096  LLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGFLAHLQD  920
             ++  N + D  R  L       G  M   KW   F  + E   +VPVW+ F         
Sbjct  151   IVKLNGKEDRDRILLTGPHLFYGKAMIVKKWCATFNFHEEILKVVPVWVKFPNLPLSYWG  210

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKV  740
               ++ SI ++ G PL  D  T    R S ARV VE++V+  L  ++ + + +   F QKV
Sbjct  211   GDSLSSIGSIKGVPLFADECTSKGLRISFARVLVEIDVTQKLQEEVRVEDPNGKCFCQKV  270

Query  739   TNEYIPPYCSGCRNTQGHNLH  677
               E +PP+C  C    GHN  
Sbjct  271   VYECLPPFCKKCSKV-GHNCE  290



>ref|XP_009125818.1| PREDICTED: uncharacterized protein LOC103850783 [Brassica rapa]
Length=503

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 68/151 (45%), Gaps = 9/151 (6%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV--PVWIAFEG  941
             L + + ++ F  E D+            G  +    W+ +F P V++ I   PVW+    
Sbjct  115   LPRQYFMIRFGEEEDYMNALTGGPWRAFGSYLMVQAWNPEFDP-VKNDITTTPVWVRISD  173

Query  940   FLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSY  761
                +   K  ++ IA  +G P++VDA+T +  R   ARVCVE+N+   L   I +    +
Sbjct  174   LPVNFYHKAILFGIAKGVGKPIRVDATTSNLERARFARVCVEVNLKKPLKGSIMVNGARF  233

Query  760   GDFAQKVTNEYIPPYCSGCRNTQGHNLHQEP  668
                   V+ E +   CSGC    GH +H  P
Sbjct  234   -----YVSYEGLSNICSGC-GLYGHMIHTCP  258



>ref|XP_006285413.1| hypothetical protein CARUB_v10006824mg [Capsella rubella]
 gb|EOA18311.1| hypothetical protein CARUB_v10006824mg [Capsella rubella]
Length=446

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 64/151 (42%), Gaps = 7/151 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L +   ++ F  E ++          + G  +    WS DF P  +  +  PVWI     
Sbjct  91    LPRQCFMIRFEREEEYLAALTGGPWKVFGSYLLVQDWSPDFNPLRDDIVTTPVWIRVSNI  150

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                   +  +  IA+ +G P+KVD +TL   R   ARVCVE+N+S  L   + I    Y 
Sbjct  151   PVIYYHEDILLGIASGLGKPVKVDLTTLQIERARFARVCVEVNLSKPLKGSVMINGERY-  209

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
                  V  E +   CSGC    GH +H  P 
Sbjct  210   ----YVAYESLSNICSGC-GVFGHLVHNCPR  235



>ref|XP_007010751.1| Uncharacterized protein TCM_044700 [Theobroma cacao]
 gb|EOY19561.1| Uncharacterized protein TCM_044700 [Theobroma cacao]
Length=164

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (54%), Gaps = 3/99 (3%)
 Frame = -1

Query  1345  RTFADVLSSNTDD--SPLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMA  1172
             ++F  ++S        P R P  YK  P+ +F + ++Q  +Q F+ +LVGKFS+  P + 
Sbjct  63    KSFLSIISKRKPPVVPPTRDPFVYKDRPAAAFFEDEIQTLAQPFKTSLVGKFSR-MPKLL  121

Query  1171  DLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCW  1055
             ++   F  IG    + +  LD  HVL++ + E DF R W
Sbjct  122   EVRSAFKGIGLAGAYEVRWLDYKHVLIHLSNEQDFNRIW  160



>ref|XP_006285575.1| hypothetical protein CARUB_v10007019mg [Capsella rubella]
 gb|EOA18473.1| hypothetical protein CARUB_v10007019mg [Capsella rubella]
Length=311

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 80/191 (42%), Gaps = 9/191 (5%)
 Frame = -1

Query  1213  ALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLD--QHHVLLNFNMELDFQRCWLWKSL  1040
             A +  F K R  +  L K        R  ++ +LD  +   ++ F +E ++    +    
Sbjct  66    AAMSDFWKQRMFVKVLGKNISIAAMSRREAMHVLDMPRQFFMVRFEIEKEYLEALIGGPW  125

Query  1039  SIKGFIMGTVKWSLDFRP-YVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDA  863
                G  M    WSLDF P + E    P WI     L     K  +  +A  +G PLK+  
Sbjct  126   RAFGSYMMVRAWSLDFDPLWHEIMTTPAWIRVSNILVIFYQKTILMGMARGLGRPLKLYL  185

Query  862   STLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             +T++  R   AR+CVE+++   L  +I I    Y      V+ E +   CSG     GH 
Sbjct  186   NTMNIERARFARICVEVDLRKPLKGKIMINGDRYF-----VSYEGLNLICSGY-GVYGHL  239

Query  682   LHQEPHRETPK  650
             +H  P R   K
Sbjct  240   VHSCPRRAPEK  250



>ref|XP_006286623.1| hypothetical protein CARUB_v10002432mg, partial [Capsella rubella]
 gb|EOA19521.1| hypothetical protein CARUB_v10002432mg, partial [Capsella rubella]
Length=450

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 76/172 (44%), Gaps = 13/172 (8%)
 Frame = -1

Query  1177  MADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSL  998
             + +LLKP      G ++ + L  Q   L+ F+ + D+          + G I+    W+ 
Sbjct  96    LRELLKPS-----GGMYVVDLPKQFF-LVRFDNKADYLAAVTGGPWRLFGSILMVQAWTP  149

Query  997   DFRPYVESPIV-PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVC  821
             +F P  +  +  PVW+       +L  K  +  ++  +G PL+VD +TL  NR   ARVC
Sbjct  150   EFDPLKDEIVTTPVWVRISSLPVNLYHKVILSKVSGALGKPLRVDMTTLQLNRARFARVC  209

Query  820   VELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
             VE+N+   L   + +    Y      V  E +   CS C    GH ++  P 
Sbjct  210   VEVNLKKPLKGSVLVNGERYA-----VAYEGLSTICSSC-GIYGHLVNNCPR  255



>ref|XP_006595286.1| PREDICTED: uncharacterized protein LOC102660169 [Glycine max]
Length=224

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 1/96 (1%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            ++P+WI       HL  +R+I  IA+++G P+  D  T    R S ARV VE++++    
Sbjct  8    VLPIWITLPQLPLHLWGERSISKIASVVGKPITTDECTAKKLRISYARVLVEVDITQKPI  67

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
              + IM+       QK+  E+ P YC  C    GH+
Sbjct  68   ETVDIMDHKGKLVEQKIEYEWRPMYCQSCLKI-GHD  102



>ref|XP_011075697.1| PREDICTED: uncharacterized protein LOC105160128 [Sesamum indicum]
Length=199

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 50/98 (51%), Gaps = 5/98 (5%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            VPVWI        L   + + ++A+ IG PL  DA T +  R   A VCV L+VS+ LP 
Sbjct  11   VPVWIRLRHLPVELWTVKGLSTVASGIGRPLYPDAITRACTRLDFAHVCVMLDVSSKLPK  70

Query  787  QIWIM--NGSYGDFAQKVTNEY--IPPYCSGCRNTQGH  686
             I IM      G+   K+  EY  +PP C+ C  T GH
Sbjct  71   HIIIMMPKEEGGEITCKIDVEYEWLPPKCTSC-MTLGH  107



>ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220238, partial [Cucumis 
sativus]
Length=169

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 2/102 (2%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            VPVWI        L     +  +A+ IG PL VD +T    R S AR+CVELNV + +P 
Sbjct  51   VPVWIKLGRIPLELWTDAGLVVVASAIGKPLSVDLATKERCRLSYARICVELNVDSTMPI  110

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHR  662
            +I  +N    +F   VT E+ P  C+ C ++ GH+    P +
Sbjct  111  EI-TVNLRGEEFIVPVTYEWKPRKCNLC-HSFGHSQSTCPKK  150



>gb|AEL30359.1| RNA-directed DNA polymerase [Arachis hypogaea]
Length=1613

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 91/200 (46%), Gaps = 12/200 (6%)
 Frame = -1

Query  1270  PSVSFTDQDVQQFSQKFRFALVGKF---SKGRPSMADLLKPFDQIGFGRIFSLGLLDQHH  1100
             PSVSFT +     ++ ++ A+V K      G  ++   L+   +I  G  F L  +   +
Sbjct  74    PSVSFTKEAKSCLAEPYKEAIVIKVLDKHYGYTALMHKLRIVWRIKGG--FDLLDVGFGY  131

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGFLAHLQ  923
              L  F++  D ++  L     I G  +    W +DFRP  +S     VWI   G      
Sbjct  132   FLAKFDIATDREKVILGGPWLIDGHYVAVKPWDVDFRPCEKSFGSTLVWIQVSGLPIWCY  191

Query  922   DKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQK  743
              ++A+  IA+ IG P+KVD +T    R   AR CV++N+   +   I +   +Y     +
Sbjct  192   QEQAMLRIASAIGIPVKVDLATKLAERGKYARACVQINLELPVIKHIIVEGVTY-----E  246

Query  742   VTNEYIPPYCSGCRNTQGHN  683
             V  E +P  C+ C    GH+
Sbjct  247   VEYESLPLICATCAR-YGHD  265



>ref|XP_006378909.1| hypothetical protein POPTR_0009s00490g, partial [Populus trichocarpa]
 gb|ERP56706.1| hypothetical protein POPTR_0009s00490g, partial [Populus trichocarpa]
Length=443

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 85/198 (43%), Gaps = 8/198 (4%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             +  + S    + D+       RF L+G  +   P  A LL  F    +       + D  
Sbjct  80    FAHLESCHLNEADLGAAMPMLRFCLIGYVAGKFPGYASLLH-FISKHWQHKARFTMHDSG  138

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAH  929
              ++  FN EL+           + G   I+  +    DF+   +   +P W+        
Sbjct  139   WLIFAFNSELEMLETLSAGPYFVFGRPLILKIMPEFFDFQAN-DMTKLPTWVKLPNLPLR  197

Query  928   LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH--QIWIMNGSYGD  755
                   +  I ++IG P+  D  T + +R S AR+ VE+++  +LPH  Q+ + NG+   
Sbjct  198   CWTPLCLSKIGSMIGKPIHCDIPTATMSRLSYARILVEVDLLQELPHAVQVVLPNGTL--  255

Query  754   FAQKVTNEYIPPYCSGCR  701
              +Q+VT E +P +C+ CR
Sbjct  256   LSQQVTYESLPRFCTRCR  273



>ref|XP_010436519.1| PREDICTED: uncharacterized protein LOC104720287 [Camelina sativa]
Length=255

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 89/206 (43%), Gaps = 4/206 (2%)
 Frame = -1

Query  1276  GMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQ--H  1103
             G   V   +  VQ+   +++  ++G+F    PS   L    + I   +   + +  Q   
Sbjct  13    GELCVKIPNMVVQRNQNRWKDFIIGQFHGNLPSKGALYAILNGIWSRKRRDITISKQGPK  72

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYV-ESPIVPVWIAFEGFLAHL  926
              VL+    E   +R    +   I+G  M    W  D  P + E    PVW+ F G     
Sbjct  73    SVLIRIPCEETRKRVLAQRVWHIEGQSMFVADWEPDLSPVMPELTEAPVWLEFRGVPPQF  132

Query  925   QDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQ  746
               + A+  IA L+G P+    ST++     +A+V   +N++  LP  +     +   F  
Sbjct  133   FSQEALEYIAGLVGHPVFCHPSTINLTDLEVAKVFTIVNITKPLPEAVNAQFETGETFRI  192

Query  745   KVTNEYIPPYCSGCRNTQGHNLHQEP  668
              V++ ++PP C+ C+   GH++ + P
Sbjct  193   VVSSPWLPPICAFCQGV-GHSIKRCP  217



>ref|XP_009761559.1| PREDICTED: uncharacterized protein LOC104213719 [Nicotiana sylvestris]
Length=558

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 5/105 (5%)
 Frame = -1

Query  1000 LDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVC  821
            +D +P  E+PI   WI F+    +   K  ++S+A  +G PL VD  T +  R + A+V 
Sbjct  21   VDLKPNEETPIAIAWIFFQDLPPNFFSKEFVFSLAREVGRPLHVDLPTQNGTRSNCAKVK  80

Query  820  VELNVSNDLPHQIWIMNGSYGDFAQ-----KVTNEYIPPYCSGCR  701
            VE+N+  +LP +I I+        +     K+  +Y+P YC  C+
Sbjct  81   VEVNLLFNLPQRIKIVEEEDESGHEESKWIKIRYDYMPKYCKSCK  125



>ref|XP_011101714.1| PREDICTED: uncharacterized protein LOC105179775 [Sesamum indicum]
Length=500

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 51/99 (52%), Gaps = 5/99 (5%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            VPVWI        L  +  + ++A+ +G PL  DA T +  R   ARVCV L+V+++LP 
Sbjct  85   VPVWIKIRHLPVELWTEEGLSTVASGVGKPLYSDAITRACTRLDFARVCVMLDVTSNLPK  144

Query  787  QIWIM----NGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             I IM    +G        V  E+IPP C  C  T GH+
Sbjct  145  HIIIMTPDEDGGESSCKVDVEYEWIPPKCKSCM-TLGHS  182



>ref|XP_007162543.1| hypothetical protein PHAVU_001G160900g, partial [Phaseolus vulgaris]
 gb|ESW34537.1| hypothetical protein PHAVU_001G160900g, partial [Phaseolus vulgaris]
Length=288

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 59/125 (47%), Gaps = 3/125 (2%)
 Frame = -1

Query  1045  SLSIKGFIMGTVKWSLDFRPY-VESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKV  869
             SL +    +    W  DF P  ++S     W+              I+SI   +G+PL +
Sbjct  137   SLKLSPGFLRLFAWPKDFVPTTMKSTKTQAWVRIYSLPLEYWRPHVIFSIIKCLGTPLVL  196

Query  868   DASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQG  689
             D +T+   R   ARV V++++ + LP  +W+    +  F   V  E++PP+CS C+   G
Sbjct  197   DENTMRKKRGMFARVLVDIDMLSPLPDHLWVERSDF-TFVAGVEYEWLPPFCSHCK-VIG  254

Query  688   HNLHQ  674
             H L Q
Sbjct  255   HELAQ  259



>ref|XP_007206965.1| hypothetical protein PRUPE_ppb019035mg [Prunus persica]
 gb|EMJ08164.1| hypothetical protein PRUPE_ppb019035mg [Prunus persica]
Length=409

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/214 (25%), Positives = 96/214 (45%), Gaps = 17/214 (8%)
 Frame = -1

Query  1270  PSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRI---FSLGLLDQHH  1100
             PS+ F++Q  ++  + +R +++ K   G+    + +    Q  +G I   + L  L+   
Sbjct  128   PSIRFSEQVKERLYRPWRTSIIIKL-MGKAHTYNFVLARLQHRWGMIKGPWKLIDLENGF  186

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQ  923
              ++ F +E D +         I G  +   +W   F P VE    + VW+   G      
Sbjct  187   FIVRFVLEEDMKAILCGGPWVIAGQYLVMQRWKPGFDPLVEQVTRMTVWVRIIGLHVEWF  246

Query  922   DKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQK  743
                A+  I +L+G+  KVD++T++  R   ARVCVE++++  L   + + +  YG     
Sbjct  247   RPEAMLRIGDLLGTTFKVDSNTVAQVRGKYARVCVEIDLTQPLQAFVQVEDNWYG-----  301

Query  742   VTNEYIPPYCSGCRNTQGHNLH------QEPHRE  659
             +  E I   C  C    GHN +      ++PH E
Sbjct  302   LEYEGIHLVCFAC-GCYGHNRNVCPSVIKKPHTE  334



>gb|KFK31800.1| hypothetical protein AALP_AA6G160500 [Arabis alpina]
Length=1096

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/211 (26%), Positives = 92/211 (44%), Gaps = 16/211 (8%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLL  1112
             P    G P ++  ++ +   +  ++  ++ K       +A L K   ++   ++ S+ ++
Sbjct  17    PNGVDGEPEITIGEEVLTAMNGLWKRCMIVKVLGRNIPVAVLSKKLRELWKPQV-SMFVM  75

Query  1111  D--QHHVLLNFNMELDFQRCWL---WKSLSIKGFIMGTVKWSLDFRPYV-ESPIVPVWIA  950
             D  +   ++ F  E ++ +      WK+     ++M    WS DF P   E    PVWI 
Sbjct  76    DLPRQFFMVRFGEEEEYLKALTGGPWKAFG--SYLMART-WSPDFDPMKDEIATTPVWIR  132

Query  949   FEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMN  770
                       K  +  IA  +G PLKVDA+TL+  R   ARVCVE+++S      + I  
Sbjct  133   LSNIPVKFYHKTVLMGIAKGLGKPLKVDATTLNLERARFARVCVEVDLSRPRKGYVLINK  192

Query  769   GSYGDFAQKVTNEYIPPYCSGCRNTQGHNLH  677
               Y      V+ E +   CS C    GH +H
Sbjct  193   ERY-----YVSYEGLTNICSQC-GIYGHTVH  217



>ref|XP_010467353.1| PREDICTED: uncharacterized protein LOC104747425 isoform X2 [Camelina 
sativa]
Length=351

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 70/159 (44%), Gaps = 13/159 (8%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWL---WKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAF  947
             L +   ++ F +E ++    +   WK+    G  +    WS  F P  +     PVW   
Sbjct  133   LPRQFFIIRFEVEEEYMAAVIGGPWKAF---GSYLMVQAWSPSFDPLTDDIFTTPVWNRL  189

Query  946   EGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNG  767
                  +L  +  +  IA  +G P+++D  TL+  R   AR+CVE+++ N L   + I   
Sbjct  190   SHIPFNLYHRSILLGIAGSLGKPIRIDPMTLNVERARFARICVEVDLRNPLKMSVVINGE  249

Query  766   SYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
              Y    + +TN      CSGC    GH +H  P RE  K
Sbjct  250   RYFVMYEGLTNT-----CSGC-GVYGHLVHGCPQREPEK  282



>ref|XP_009603376.1| PREDICTED: uncharacterized protein LOC104098367 [Nicotiana tomentosiformis]
Length=381

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/158 (27%), Positives = 73/158 (46%), Gaps = 9/158 (6%)
 Frame = -1

Query  1111  DQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESP-IVPVWIAFEGFL  935
             D+ + ++ F    D +        SI    +    W+ DF    E P ++P+W+ F    
Sbjct  174   DEGYYIIRFQSVADAREILCAGPYSIANNPIILKPWTPDFDFTEEFPTVMPLWVKFPKLP  233

Query  934   AHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGD  755
                    ++  IA++IG+P+  D  T    R   AR+ +ELNV+ +LP +I +M+     
Sbjct  234   MSRWGVGSLSRIASVIGTPIFADECTAKQTRVFCARMLIELNVTKELPTEIMVMDPYGKK  293

Query  754   FAQKVTNEYIPPYCS-------GCRNTQGHNLHQEPHR  662
             F Q +T ++ P YC         C N Q   + Q+P++
Sbjct  294   FLQAITYDWKPAYCDKYLVVGHKCTN-QARPVMQQPNQ  330



>ref|XP_004252199.1| PREDICTED: uncharacterized protein LOC101262390 [Solanum lycopersicum]
Length=439

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (54%), Gaps = 1/99 (1%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            +P+W+ F     +   + ++ SIA+ IG P+  D  T    R S AR+ VE+NV+  +P 
Sbjct  64   IPLWVNFPKLPLNCWGEGSLSSIASAIGLPIFADECTTKQTRISYARMLVEVNVTQSIPQ  123

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQE  671
            +I +M+     F+Q+V  E+ P YC  C+   GH    E
Sbjct  124  KITVMDPYGKTFSQEVVLEWRPQYCDKCQKI-GHVCQVE  161



>ref|XP_010694770.1| PREDICTED: uncharacterized protein LOC104907528 [Beta vulgaris 
subsp. vulgaris]
Length=286

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 64/150 (43%), Gaps = 2/150 (1%)
 Frame = -1

Query  1111  DQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGFL  935
             ++   ++  N E D  R  L         +M   KW   F  + E   +VPVW+ F    
Sbjct  48    EEGFFIVKLNTEEDRDRILLTGPHLFYEKVMIVKKWCATFNFHEEILKVVPVWVKFPNLP  107

Query  934   AHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGD  755
                    ++  I +++G P   D  T    R S  RV +E++V+  LP  + +   S   
Sbjct  108   LSCWGGDSLSRIGSVLGVPPFADECTSKGLRISFVRVLLEVDVTQKLPDTVTVEEPSGKY  167

Query  754   FAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
             F QKV  E++PP+C  C    GHN    P 
Sbjct  168   FIQKVIYEWLPPFCKKCSKV-GHNCDVIPE  196



>ref|XP_010467351.1| PREDICTED: uncharacterized protein LOC104747425 isoform X1 [Camelina 
sativa]
 ref|XP_010467352.1| PREDICTED: uncharacterized protein LOC104747425 isoform X1 [Camelina 
sativa]
Length=377

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/159 (28%), Positives = 70/159 (44%), Gaps = 13/159 (8%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWL---WKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAF  947
             L +   ++ F +E ++    +   WK+    G  +    WS  F P  +     PVW   
Sbjct  159   LPRQFFIIRFEVEEEYMAAVIGGPWKAF---GSYLMVQAWSPSFDPLTDDIFTTPVWNRL  215

Query  946   EGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNG  767
                  +L  +  +  IA  +G P+++D  TL+  R   AR+CVE+++ N L   + I   
Sbjct  216   SHIPFNLYHRSILLGIAGSLGKPIRIDPMTLNVERARFARICVEVDLRNPLKMSVVINGE  275

Query  766   SYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
              Y    + +TN      CSGC    GH +H  P RE  K
Sbjct  276   RYFVMYEGLTNT-----CSGC-GVYGHLVHGCPQREPEK  308



>ref|XP_010692626.1| PREDICTED: uncharacterized protein LOC104905715 [Beta vulgaris 
subsp. vulgaris]
Length=896

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 54/113 (48%), Gaps = 2/113 (2%)
 Frame = -1

Query  1009  KWSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSM  833
             +WS D     E   +VP WI   G       + A+  IA+LIG P++ D +T   +    
Sbjct  214   EWSADLDLLKEKVTVVPTWIRLPGLPLKYWGQVALNKIASLIGKPIRSDRATAQKDLLEY  273

Query  832   ARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
             ARV VE+N+S  +P ++W  N      +Q+V  +  P  C  C+   GH   Q
Sbjct  274   ARVLVEVNISKPMPDEVWFTNEKGIKVSQRVEYDCKPIQCEECKGI-GHTGEQ  325



>ref|XP_004243802.1| PREDICTED: uncharacterized protein LOC101261248 [Solanum lycopersicum]
Length=412

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 88/208 (42%), Gaps = 5/208 (2%)
 Frame = -1

Query  1264  VSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGF--GRIFSLGLLDQHHVLL  1091
             V     +VQ    K+++AL+       P   + +  +  + +  G    + L D+ + ++
Sbjct  2     VQLESDEVQVEEDKWKYALIAHVIGECPGF-NTMNRYGMMNWSKGEKPEVFLHDEGYYII  60

Query  1090  NFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQDKR  914
              F   +D          +I    +   +WS +F    E    +P+W+ F     +     
Sbjct  61    KFKSLIDMNEVLYSGPYTISNRPIILKQWSAEFEFGKEFLTEIPLWVNFPKLPLNCWGAG  120

Query  913   AIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTN  734
             ++  IA+ IG PL  D  T    R S AR+ +E+NV+  +P +I + + +   F Q V  
Sbjct  121   SLSRIASAIGVPLFADECTTKQTRISYARMLIEVNVTKPMPEKIVVKDPNGRTFMQDVVM  180

Query  733   EYIPPYCSGCRNTQGHNLHQEPHRETPK  650
             E+ P YC  C+   GH        E PK
Sbjct  181   EWKPVYCDKCQRI-GHQCQDTAMEEQPK  207



>ref|XP_006289412.1| hypothetical protein CARUB_v10002911mg [Capsella rubella]
 gb|EOA22310.1| hypothetical protein CARUB_v10002911mg [Capsella rubella]
Length=474

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 62/151 (41%), Gaps = 7/151 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYV-ESPIVPVWIAFEGF  938
             L +   ++ F  E ++          + G  +    WS DF P   E    PVW+     
Sbjct  97    LPRQFFMVRFESEDEYMAALTGGPWRVFGSYLMVQAWSPDFDPIRDEIETTPVWVRLSNL  156

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                      +  IA  +G P+KVD +T++  R   ARVCVE+N+   L   + I    Y 
Sbjct  157   PVSFYHTTILMGIAEGLGKPIKVDITTMNLTRARFARVCVEVNLKMPLKGTVMINEERY-  215

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
                  V+ E +   CSGC    GH +H  P 
Sbjct  216   ----YVSYEGLSTICSGC-GLYGHLVHSCPQ  241



>ref|XP_003595953.1| hypothetical protein MTR_2g064100 [Medicago truncatula]
Length=391

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 67/132 (51%), Gaps = 2/132 (2%)
 Frame = -1

Query  1093  LNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQDK  917
             LNFN   D ++ W   ++++K ++M    WS DF P  +S I   +W+ F        +K
Sbjct  147   LNFNSVEDMRQIWALGTVNLKPWLMHFYCWSKDFAPQAQSQIHAQIWVRFLNLPQEYWEK  206

Query  916   RAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVT  737
             + ++ IA+ +G+PL +D +T        ARV  ++++S +L   + +    +   +  + 
Sbjct  207   QTLFEIASGLGTPLSIDEATQHRRFGIFARVLKDVDLSENLFESVVVEREDHA-LSISIQ  265

Query  736   NEYIPPYCSGCR  701
              E  P +C+ C+
Sbjct  266   YEKYPLFCAHCK  277



>ref|XP_006369223.1| hypothetical protein POPTR_0001s19460g, partial [Populus trichocarpa]
 gb|ERP65792.1| hypothetical protein POPTR_0001s19460g, partial [Populus trichocarpa]
Length=410

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/188 (24%), Positives = 86/188 (46%), Gaps = 4/188 (2%)
 Frame = -1

Query  1258  FTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLNFNM  1079
               + D+ +    ++F L+G  +   P  + LLK F    +    +  + D   ++  F+ 
Sbjct  113   LIETDIGEHIDLWQFCLIGYVAGKFPGFSSLLK-FITNSWKHKANFTMHDSGWLIFAFSS  171

Query  1078  ELDFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIY  905
             EL+           + G  FI+  +    DF   ++   +P+W+ F            ++
Sbjct  172   ELEMLDILGGGPYFVFGRPFILKVMPEFFDFTA-IDMMHMPIWVRFPNLPLKCWSSICLF  230

Query  904   SIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYI  725
              IA++IG P+  D+ T S  R S AR+ +E+++  DLP  I ++  +    +Q+V  E +
Sbjct  231   KIASMIGKPVHCDSPTASMTRLSDARIFIEVDLLVDLPTFINLVLPNGSSLSQQVMYESL  290

Query  724   PPYCSGCR  701
             P +C  CR
Sbjct  291   PHFCKQCR  298



>ref|XP_006282338.1| hypothetical protein CARUB_v10028633mg, partial [Capsella rubella]
 gb|EOA15236.1| hypothetical protein CARUB_v10028633mg, partial [Capsella rubella]
Length=463

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 69/154 (45%), Gaps = 13/154 (8%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWL---WKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAF  947
             L +   ++ F +E ++        WK+    G  +    WS +F P  +  +  PVW+ F
Sbjct  112   LPRQFFMVRFEVEDEYLTALTGGPWKAF---GSYLMVRAWSPEFEPSRDDIVTTPVWVRF  168

Query  946   EGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNG  767
                   L  +  +  +A  +G PL+VD +TL+  R    RVCVE+++S  L     +   
Sbjct  169   SNLPVALYHQTILLGLAQALGKPLRVDTNTLNFERARFPRVCVEVDLSQPLKGSFMLNGE  228

Query  766   SYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
              Y  F + +T+      CSGC    GH +H  P 
Sbjct  229   RYFVFYEGLTS-----ICSGC-GIFGHMVHACPK  256



>ref|XP_009617694.1| PREDICTED: uncharacterized protein LOC104109986 [Nicotiana tomentosiformis]
Length=242

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/239 (24%), Positives = 107/239 (45%), Gaps = 16/239 (7%)
 Frame = -1

Query  1342  TFADVLSSN-TDDSPLR----PPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPS  1178
             T A+++ +N T +  ++    PP    G+  V    +D+ +  QK++ AL+G  + G P 
Sbjct  9     TMAEMVKNNMTQNQGMKLNFYPPVLKDGVKVVQLNHRDIDEQKQKWQSALIGYVTGGAPK  68

Query  1177  MADLLK----PFDQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWK-SLSIKGFIMGT  1013
                +L+     +  +   R+F   + D  + +  F +E D + C L   S + +   M  
Sbjct  69    FKGILQFVYGVWQFVATPRVF---MHDDGYFIFKFEIEED-KACVLQNGSYTFRNRPMIL  124

Query  1012  VKWSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPS  836
              +WS DF+   E   ++P+ +           K  +  IA+ +G P+  D+ T    R S
Sbjct  125   KQWSPDFQMQKEPLRVLPIRVCLSCLPLLYWSKENLGRIASFLGKPICTDSLTAKGERIS  184

Query  835   MARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRE  659
              AR+   ++++  L   I +   +   + QK+  E+ P  C  C    GHN  Q P ++
Sbjct  185   YARLLTGMDITQTLSEVINVEASNGSIWNQKIEYEWKPILCHKCLRF-GHNNEQCPKQK  242



>ref|XP_003609254.1| hypothetical protein MTR_4g113700 [Medicago truncatula]
Length=484

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 94/215 (44%), Gaps = 13/215 (6%)
 Frame = -1

Query  1273  MPSVSFTDQDVQQFSQKFRFALVGKF---SKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             +P +    Q  Q+    ++ ALV K    S G  +M + L+   ++  G  F +   D  
Sbjct  70    LPKIYIEPQVFQELCTTWKDALVVKLLGKSLGYTTMKERLQKTWKLQGG--FDIMDNDNG  127

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF-RPYVESPIVPVWIAFEGFLAHL  926
               ++ F+   D ++        I    +    WS +F  P  +     VW+ F G     
Sbjct  128   FYMVKFDQAADKEKVITGGPWLIFDHCLAVTHWSPEFASPNAKVDRTVVWVRFPGLNLVY  187

Query  925   QDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQ  746
              D+  + ++A  +G P+KVD +TL   R   ARVCVE++++  +  +IW+ NG +     
Sbjct  188   YDESLLLAMATTLGQPIKVDTNTLKVERGKFARVCVEIDLTVPVVGKIWV-NGHW----Y  242

Query  745   KVTNEYIPPYCS--GCRNTQGHNLHQEPHRETPKT  647
             KV  + +   C+  GC    G N   +P    P T
Sbjct  243   KVQYKGLHLICTNCGCYGHLGRNCCSKPPAAEPVT  277



>ref|XP_006299881.1| hypothetical protein CARUB_v10016088mg, partial [Capsella rubella]
 gb|EOA32779.1| hypothetical protein CARUB_v10016088mg, partial [Capsella rubella]
Length=340

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 64/150 (43%), Gaps = 7/150 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYV-ESPIVPVWIAFEGF  938
             L +   ++ F  E ++          + G  + T  WS  F P   E    PVWI     
Sbjct  114   LPRQFFMIRFEKEEEYMAALTGGPWRVFGSCLLTQAWSPSFDPLRDEITTTPVWIRLSNL  173

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +   +  +  IA  +G+P+KVD +TL   R   AR+CVE+++ N L   I I    Y 
Sbjct  174   PVNFYHQFILMGIAEGLGTPIKVDLTTLQFERARFARICVEVDLKNPLKGTILINGERY-  232

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEP  668
                  V+ E +   CS C    GH +H  P
Sbjct  233   ----FVSYEGLTTICSKC-GMYGHLVHACP  257



>gb|KHN17248.1| hypothetical protein glysoja_010707, partial [Glycine soja]
Length=554

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 85/204 (42%), Gaps = 2/204 (1%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQI-GFGRIFSLGL  1115
             P    G   ++  ++D+    + +  ALV     G  SM  + +   +   F ++ ++  
Sbjct  52    PTLVDGEIEIAIDEEDIVSEKKFWENALVMYVLGGELSMNGVKQFITKAWNFVQLPAIYY  111

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGF  938
              D  + LL FN   D     L    +++   M   +W   F    +    +P+WI     
Sbjct  112   HDDGYFLLKFNTHKDMDDVMLRGPYTVRNMPMLLREWKPGFNLKQDMLRTLPIWIQLPQL  171

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               HL   R++  I + +G P+  D  T    R S AR+ VE++V+  LP+ I I +    
Sbjct  172   PLHLWGARSLGKIGSALGKPITTDECTAKKYRVSYARILVEVDVTQKLPNDITIRDSEGK  231

Query  757   DFAQKVTNEYIPPYCSGCRNTQGH  686
                Q V  E+ P +C  C+    H
Sbjct  232   KLKQPVHYEWKPMFCDKCQKFGHH  255



>ref|XP_007022413.1| Uncharacterized protein TCM_032793 [Theobroma cacao]
 gb|EOY13938.1| Uncharacterized protein TCM_032793 [Theobroma cacao]
Length=186

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            I+P+WI+F     HL +K  +  IA  IG PL +D +T + +R S+ARVC+E +   D  
Sbjct  2    IIPIWISFPNRKTHLYEKLTLLLIAKTIGKPLFIDEATANGSRLSVARVCMEYDCKKDPI  61

Query  790  HQIWIM  773
            +Q+WIM
Sbjct  62   NQVWIM  67



>ref|XP_009596743.1| PREDICTED: uncharacterized protein LOC104092781 [Nicotiana tomentosiformis]
Length=315

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/217 (25%), Positives = 90/217 (41%), Gaps = 7/217 (3%)
 Frame = -1

Query  1342  TFADVLSSNTDDSP-----LRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPS  1178
             T ADV+  N            PP     +  V     +V++ ++K+R +L+G    G P 
Sbjct  99    TIADVVQGNRSQQQRVKLNYYPPIINDEIKVVRLNYTEVEEQNRKWRTSLIGYVIGGSPL  158

Query  1177  MADLLKPFDQI-GFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWS  1001
               +++K    I  F     + LLD+ + +  FN + D          +     M   +W 
Sbjct  159   FKEMMKFVYGIWHFATTPQVLLLDEGYFIFKFNSKEDRDLVLRNGPYTFNNRPMILKQWE  218

Query  1000  LDFRPYVESPI-VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARV  824
              DF+   E+   +PVW+ F G L        +  IA+ IG PL  D  T    R S A +
Sbjct  219   PDFQMSKEATNNIPVWVNFPGLLIQYWTVENLGRIASSIGKPLCTDKLTAQEARISYAHM  278

Query  823   CVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYC  713
              +E++VS  LP  + I           ++ ++ P +C
Sbjct  279   LIEMDVSQPLPETMLIETTDGKHKEHILSYDWQPSFC  315



>ref|XP_009617980.1| PREDICTED: uncharacterized protein LOC104110235 [Nicotiana tomentosiformis]
Length=299

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            +P+W+ F   L     + ++  IA+ IG P   D  T    R S AR+ +E+NV   LP 
Sbjct  141  LPLWVKFPNLLMSCWSRDSLIRIASAIGVPKYADECTAKQTRISFARMIIEVNVIKSLPS  200

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQE  671
            +I +M+ S   F Q V  E+   YC  C    GHN  ++
Sbjct  201  EITVMDPSGKTFQQGVIFEWKHEYCEQCLMI-GHNCDKQ  238



>emb|CAB10338.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78602.1| hypothetical protein [Arabidopsis thaliana]
Length=655

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 75/191 (39%), Gaps = 8/191 (4%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGF  938
             L +   ++ F +E D+          + G I+    WS +F P  +     PVW+     
Sbjct  129   LPRQFFMVRFEVEEDYMMALTGGPWRVLGSILMVQAWSPEFNPLRDVIETTPVWVRVANL  188

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
                      +  IA  +G P+KVD +TL   R   ARVCVE+N+ N L   + +    Y 
Sbjct  189   PVTFYHNEILLGIAAGLGKPIKVDLTTLRKERGRFARVCVEVNLKNPLKGTLVVNGERY-  247

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH-RETPKTlpqalpplpqqpmvvpPRKSWH  581
                  V+ E +   CS C    GH ++  P  R T  +                 +  + 
Sbjct  248   ----FVSYEGLQTICSLC-GIYGHTVNNCPMGRTTQGSQRSEQGMEIVSSASTQNQDGFT  302

Query  580   PVESDQDRSQG  548
              V   ++R+QG
Sbjct  303   EVRRARNRTQG  313



>emb|CDX74218.1| BnaA03g28290D [Brassica napus]
Length=515

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 99/214 (46%), Gaps = 13/214 (6%)
 Frame = -1

Query  1294  PPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQI---GFGRIFS  1124
             P  H  G P V   D+++    ++F+  +  +F    PSM  L+   + I      RIF 
Sbjct  130   PTTHVSGAPFVLIPDENIVAAKEEFKEFIFARFPGDIPSMGRLIGVVNAIWARTGPRIF-  188

Query  1123  LGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF---RPYVESPIVPVWI  953
             +  + +   LL    E   +     ++  IKG  M    WS +F   +P + S ++PV +
Sbjct  189   VHKIGEGTFLLKVANERTREHLLSRQAWMIKGCPMFVAAWSPEFTPEQPQLTSAVIPVEL  248

Query  952   AFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM  773
                 +L  L +++++  IA  +G P+ +   T       +A++ V++N+   LP +I + 
Sbjct  249   RGVPYL--LFNRQSLSRIATAVGKPVSLAPETERKENFEVAKIWVQVNLLESLPDKI-VS  305

Query  772   NGSYGDFAQ-KVTNEYIPPYCSGCRNTQGHNLHQ  674
               S G   Q  V+  ++P  C+ CR   GHN HQ
Sbjct  306   GFSNGREVQISVSYPWLPEKCTTCRKF-GHN-HQ  337



>ref|XP_010670315.1| PREDICTED: uncharacterized protein LOC104887397 [Beta vulgaris 
subsp. vulgaris]
Length=452

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 86/209 (41%), Gaps = 9/209 (4%)
 Frame = -1

Query  1294  PPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQ----IGFGRIF  1127
             PP   +G         +V + ++     ++       PS+  L +  +Q    +G  +IF
Sbjct  117   PPVVKEGKKVAKLDQIEVNKLTETLSTVVILYVVGQTPSIGTLTRFIEQQWNHVGKPKIF  176

Query  1126  SLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIA  950
                L D+ + ++ F    D           I    +    WS DF    E   +VP+W+ 
Sbjct  177   ---LHDKGYFIIKFASVDDRNEILYAGPHMINSRPIIIKAWSPDFDFQAEVLRVVPLWVR  233

Query  949   FEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMN  770
                         ++  I ++IG PL  D  T    R + AR+ +E++V+ +L   + I +
Sbjct  234   LYNLPLKHWGAESLSRIGSMIGVPLFADECTTHQQRITFARMLIEVDVTKELTKSVTIED  293

Query  769   GSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             GS     QKV  E+ P YC  C N  GH+
Sbjct  294   GSGRIIEQKVHFEWAPAYCLKCNNI-GHD  321



>ref|XP_010682177.1| PREDICTED: uncharacterized protein LOC104897068 [Beta vulgaris 
subsp. vulgaris]
Length=447

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 59/109 (54%), Gaps = 2/109 (2%)
 Frame = -1

Query  1006  WSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             WS +F  + E   ++P+W+ F     +   + ++  I +++G PL  D  T    R S A
Sbjct  78    WSANFNFHEEILKVIPIWVKFPNLPLNYWGEDSLSRIGSVLGVPLYADECTSKCLRVSFA  137

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             RV +E++V+ DL  +I + +     F Q V+ +++PP+C  C+   GHN
Sbjct  138   RVLIEIDVTQDLVKEIEVEDHYGVVFKQTVSFDWLPPFCKKCQKV-GHN  185



>ref|XP_006406430.1| hypothetical protein EUTSA_v10022289mg, partial [Eutrema salsugineum]
 gb|ESQ47883.1| hypothetical protein EUTSA_v10022289mg, partial [Eutrema salsugineum]
Length=496

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 92/214 (43%), Gaps = 31/214 (14%)
 Frame = -1

Query  1294  PPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFD------------  1151
             P  H  G+P V   D+++Q   ++F+  L  +F    PSM  ++   +            
Sbjct  183   PSQHDSGVPFVFIPDENIQAAKEEFKDFLFARFHGDTPSMGRIIGVVNAIWARNGPRIIV  242

Query  1150  -QIGFGR-IFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPY--  983
               IG G  +  + +L    ++L+ N         LW   +I GF M    WS DF P   
Sbjct  243   HNIGAGTFLLRVTVLRTRELILSRN---------LW---TIAGFPMFVAPWSPDFNPEEP  290

Query  982   -VESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNV  806
              + S +VPV   F      L +K+++  IA  IG+P+ +   T       +A+V V +N+
Sbjct  291   PLSSAVVPV--EFRDVPYLLFNKKSLGRIATAIGTPVALAPETERKQTFEVAKVYVRVNL  348

Query  805   SNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGC  704
               +LP ++     S  +    V+  ++P  C  C
Sbjct  349   LKELPRRVVSGFSSGREVLITVSYPWLPVKCQSC  382



>ref|XP_006580860.1| PREDICTED: uncharacterized protein LOC102664004 [Glycine max]
Length=344

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 87/202 (43%), Gaps = 8/202 (4%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLL  1112
             P   +G P      +D+    + +  AL+  +  GR    + +K F +  +  +    L 
Sbjct  108   PKIVEGKPIAEIEPEDIIGELKYWESALI-MYVIGRDLSMNSVKQFMEKNWSSVKLPDLF  166

Query  1111  --DQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF---RPYVESPIVPVWIAF  947
               D+ + ++ F+   D          +I    M    WS +F   R  + +  +P+WI  
Sbjct  167   YNDEGYFIMRFHSSQDKDEILSKGPYTIMNMTMLLRDWSPEFNLKRDMLRT--IPIWIKL  224

Query  946   EGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNG  767
                  +L   + +  I +++G P+  D  T    R S AR+ VE++++ ++P +I I + 
Sbjct  225   PQLPLYLWGAKTMGKIGSILGKPIVTDECTAQRLRISYARMLVEIDITQEMPKEITIADN  284

Query  766   SYGDFAQKVTNEYIPPYCSGCR  701
                +  Q V  E+ P YC  C+
Sbjct  285   EGHELIQAVEYEWKPKYCGKCK  306



>ref|XP_010682176.1| PREDICTED: uncharacterized protein LOC104897066 [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 1/102 (1%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            IVP+WI           +R+++ +   IG P+K+D ST++ NR   AR+ +E  ++ DLP
Sbjct  10   IVPIWIQLPALDLKYWGERSLFKLVAGIGKPIKLDQSTVNKNRLQFARIMIETRMNQDLP  69

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
             +I   N       Q V  E+ P  C  C    GH+  +  H
Sbjct  70   DEIVFENEKGVMMKQGVHYEWRPIRCDKCVGI-GHSTQECIH  110



>ref|XP_006286068.1| hypothetical protein CARUB_v10007601mg, partial [Capsella rubella]
 gb|EOA18966.1| hypothetical protein CARUB_v10007601mg, partial [Capsella rubella]
Length=459

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 62/147 (42%), Gaps = 7/147 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEGF  938
             L     ++ F +E ++          + G  +    WS DF P     +  PVWI     
Sbjct  111   LPHQFFVVRFELEEEYMAALTGGPWKMFGSYLMVQAWSPDFDPLRNDIVTTPVWIRLSNI  170

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +L     +  IA  +G PL+ D  TL  +R   ARVCVE+N+S  L   + +    Y 
Sbjct  171   PMNLYHSSILMIIAEGLGKPLREDMQTLKFDRARFARVCVEVNLSQPLKGTVLVNEERY-  229

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLH  677
                  V+ E +   CSGC    GH +H
Sbjct  230   ----YVSYEGLTNICSGC-GMYGHLVH  251



>ref|XP_006599769.1| PREDICTED: uncharacterized protein LOC102668549 [Glycine max]
Length=399

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 87/202 (43%), Gaps = 8/202 (4%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPF--DQIGFGRIFSLG  1118
             P   +G P      +D+    + +  AL+  +  GR    + +K F      F ++  L 
Sbjct  92    PKIVEGKPIAKIEPEDIIGELKYWESALI-MYVIGRDLSMNSVKQFMEKNWSFVKLPDLF  150

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF---RPYVESPIVPVWIAF  947
               D+ + ++ F+   D          +I    M    WS +F   R  + +  +P+WI  
Sbjct  151   YNDEGYFIMRFHSSQDKDEILSKGPYTIMNMTMLLRDWSPEFNLKRDMLRT--IPIWIKL  208

Query  946   EGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNG  767
                  +L   + +  I +++G P+  D  T    R S AR+ VE++++ ++P ++ I + 
Sbjct  209   PQLPLYLWGAKTMGKIGSILGKPIVTDECTAQRLRISYARMLVEIDITQEMPKEVTIADN  268

Query  766   SYGDFAQKVTNEYIPPYCSGCR  701
                +  Q V  E+ P YC  C+
Sbjct  269   EGHELIQAVEYEWKPKYCGKCK  290



>ref|XP_007014196.1| Uncharacterized protein TCM_039002 [Theobroma cacao]
 gb|EOY31815.1| Uncharacterized protein TCM_039002 [Theobroma cacao]
Length=436

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = -1

Query  1072  DFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIAN  893
             +F RC  ++        M T K   +F P  ES IV VWI+F    AHL +K A+   A 
Sbjct  138   NFPRCLAYRRFDKPSLKMRTFKQISEFEPKKESSIVSVWISFPNLKAHLYEKSALMMNAK  197

Query  892   LIGSPLKVDASTLSHNRPSMARVCVE  815
              IG PL VD +T +   PS+AR  +E
Sbjct  198   TIGRPLFVDEATANGTGPSVARWAIE  223



>ref|XP_007027950.1| Uncharacterized protein TCM_022902 [Theobroma cacao]
 gb|EOY08452.1| Uncharacterized protein TCM_022902 [Theobroma cacao]
Length=471

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = -1

Query  997  DFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCV  818
            +F    ES IVP+WI+F    AHL +K A+  I   IG+PL VD +T +   PS+AR C+
Sbjct  3    NFETEKESSIVPIWISFPNLKAHLFEKLALLLIVKAIGNPLYVDKATTNGTWPSVARFCI  62

Query  817  ELNVSNDLPHQIWIM  773
            E +      + +WI+
Sbjct  63   EYDCLKAPLNSVWIV  77



>ref|XP_006375696.1| hypothetical protein POPTR_0014s19730g, partial [Populus trichocarpa]
 gb|ERP53493.1| hypothetical protein POPTR_0014s19730g, partial [Populus trichocarpa]
Length=512

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 85/196 (43%), Gaps = 4/196 (2%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             +  + S    + D+   +   RF L+G  +   P  A LL  F +  +       L D  
Sbjct  150   FAHLESYHLNEVDLGAATPMLRFCLIGYVAGKFPGYASLLH-FIRKHWQHPARFTLHDSG  208

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAH  929
              ++  FN EL+           + G   I+  +    DF+   +   +P W+        
Sbjct  209   WLIFAFNSELEMLETLSAGPYFVFGRPLILKIMPEFFDFQ-ANDMTKLPTWVKLPNLPLR  267

Query  928   LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFA  749
                   +  I+++IG P+  D  T + +R S AR+ VE+++  +LP+ I ++  +    +
Sbjct  268   CWTPLCLSKISSMIGKPIHCDIPTATMSRLSYARILVEVDLLQELPNVIQVVLPNGSPLS  327

Query  748   QKVTNEYIPPYCSGCR  701
             Q+VT E +P +C  CR
Sbjct  328   QQVTYESLPRFCKRCR  343



>ref|XP_009801431.1| PREDICTED: uncharacterized protein LOC104247173 [Nicotiana sylvestris]
Length=297

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 86/213 (40%), Gaps = 20/213 (9%)
 Frame = -1

Query  1279  KGMPSVSFTDQDVQQFSQKFRFALVGKFSKGR-------PSMADLLKPFDQIGFGRIFSL  1121
             +G+ ++  T++D  +    +R++L+ K    R         +  + KP D       F L
Sbjct  87    EGIRTIHLTEEDKNRMYLPWRYSLIIKLLGKRIQHQYLKKKLQKMWKPSDN------FPL  140

Query  1120  GLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDF-RPYVESPIVPVWIAFE  944
               L   + ++ FN E +           I GF +   KW  +F   +       +WI   
Sbjct  141   IDLGSDYFIVKFNKEENMVSALQNGPRFINGFFLSLKKWEPNFVASHATQERSAIWIRLP  200

Query  943   GFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGS  764
                    D   +  I N IG+ LK+DA T +  R   AR+C+E+ +   +   I I    
Sbjct  201   QLPTEFYDAIILKKIGNTIGNLLKIDACTSAALRGRYARLCIEMKLEEPVQSCILI----  256

Query  763   YGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
              G++ Q++  E     C  C   + H +H  PH
Sbjct  257   -GNYKQEIIYEGEHILCKACGRLE-HTIHHCPH  287



>emb|CDY53602.1| BnaC09g51900D [Brassica napus]
Length=638

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 64/150 (43%), Gaps = 7/150 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGF  938
             L + + ++ F  E D+            G  +    W+ +F P  +     PVW+     
Sbjct  130   LPRQYFMIRFGEEEDYMNALTGGPWRAFGSYLMVQAWNPEFDPVKDDITTTPVWVRISDL  189

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +   K  ++ IA  +G P++VDA+T +  R   ARVC E+N+   L   I +    + 
Sbjct  190   PVNFYHKAILFGIAKGVGKPIRVDATTSNLERARFARVCGEVNLKKPLKGSIMVNGARF-  248

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEP  668
                  V+ E +   CSGC    GH +H  P
Sbjct  249   ----YVSYEGLSNICSGC-GLYGHMIHTCP  273



>ref|XP_010412659.1| PREDICTED: uncharacterized protein At4g02000-like [Camelina sativa]
Length=155

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 55/120 (46%), Gaps = 7/120 (6%)
 Frame = -1

Query  1006  WSLDFRPYVESPIVP-VWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             W+ +F P V+  +   VWI           K  + SIA  +G P+KVD +TL+  R   A
Sbjct  31    WTPEFDPLVDEIMTTLVWIRLSNIPISFYHKALLMSIAKSLGKPIKVDLTTLNFERGRFA  90

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
             R+CVELN+       I I    Y      V+ E++   CS C    GH +H  P +   +
Sbjct  91    RICVELNLKRPFKGTIMINGEQYF-----VSYEWLTNICSLC-GMFGHVVHICPRKSVAQ  144



>ref|XP_010317681.1| PREDICTED: uncharacterized protein LOC101254124 [Solanum lycopersicum]
Length=538

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 1/106 (1%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            +P+W+ F     +     ++  IA+ IG PL  D  T    R S AR+ +E+NV+  +P 
Sbjct  40   IPLWVNFPKLPLNCWGVGSLSRIASAIGVPLFADECTTKQTRISYARMLIEVNVNKPIPQ  99

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
            QI +M+ +   F Q+V  E+   YC  C+   GH        E PK
Sbjct  100  QITVMDPNGRTFMQEVLMEWKTQYCDKCQKI-GHQCQSVTQEELPK  144



>ref|XP_009792300.1| PREDICTED: uncharacterized protein LOC104239367 [Nicotiana sylvestris]
Length=294

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 59/138 (43%), Gaps = 9/138 (7%)
 Frame = -1

Query  1039  SIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDA  863
             +I G  M   +W+ DF    E  + +P WI            + +  +AN+IG PL  D 
Sbjct  45    TINGRPMILKQWTPDFDIKAEFLMEIPFWITIPNLPMSYWGNKTLSKLANVIGKPLFADE  104

Query  862   STLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
              T    R S AR+ VE NV+  LP ++ +   S      +V  E  P YC  C    GH+
Sbjct  105   CTTKQTRTSYARILVEANVTKQLPTELTVQETSGKKIQLQVEYELKPQYCINCMKI-GHD  163

Query  682   L-------HQEPHRETPK  650
                      +E +RE  K
Sbjct  164   CIVEKKVNKKEQYRERQK  181



>ref|XP_010520311.1| PREDICTED: uncharacterized protein LOC104799464 [Tarenaya hassleriana]
Length=548

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 78/192 (41%), Gaps = 15/192 (8%)
 Frame = -1

Query  1267  SVSFTDQDVQQFSQKFRFALVGK---FSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHV  1097
             S +F D+  Q + +     L+GK   +      +  L KP      GR+  + L +    
Sbjct  85    SEAFLDRITQPWKKALVVKLLGKTLSYKTMSSRLETLWKPM-----GRLTVIDL-ENEFF  138

Query  1096  LLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQD  920
             L+ F  E D+QR        I G  +    WS DF P    P  V  WI F         
Sbjct  139   LVRFQKEEDYQRALCEGPWVILGAYLTVQCWSPDFVPSQAKPSHVVAWIRFPAMPIQYYH  198

Query  919   KRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKV  740
                +  IA  IG  ++VD +T+S +R   ARV VEL++S  L     I +       Q V
Sbjct  199   AALLEIIAGNIGRVIRVDYNTVSASRGRFARVAVELDLSKPL-----ISSFEIEGLTQLV  253

Query  739   TNEYIPPYCSGC  704
               E +P  C  C
Sbjct  254   EYENLPTICFSC  265



>ref|XP_006401148.1| hypothetical protein EUTSA_v10015367mg, partial [Eutrema salsugineum]
 gb|ESQ42601.1| hypothetical protein EUTSA_v10015367mg, partial [Eutrema salsugineum]
Length=415

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 101/216 (47%), Gaps = 16/216 (7%)
 Frame = -1

Query  1294  PPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQI---GFGRIFS  1124
             P  H  G+P V   D++V+   ++F+  +  +F    P M  ++   + I      RIF 
Sbjct  128   PSEHVSGVPFVLIPDENVESAKEEFKDFIFARFHGDAPEMGRIIGVVNAIWARSGPRIFV  187

Query  1123  LGLLDQHHVLLNFNMELDFQRCWLWKSL-SIKGFIMGTVKWSLDF---RPYVESPIVPVW  956
               +    ++L   N  +  +   L +S+  I G+ M    WS DF   +P + S +VPV 
Sbjct  188   HNIGQGSYLLKVINPRV--KEVVLSRSMWHIAGYPMFVAPWSSDFDPEQPPLTSAVVPV-  244

Query  955   IAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIW-  779
               F      L +++++  IA  +G P+ +   T   +   +A+V V +++ N+LP +I  
Sbjct  245   -EFRDVPYLLFNRQSLARIATAVGKPVSLAPETERKDNFHVAKVYVRVDLRNELPKKIIS  303

Query  778   -IMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQ  674
                NG   + A  V+  ++P  C+ C    GH+ ++
Sbjct  304   GFSNGKEVEIA--VSYPWLPSKCASC-GKLGHDRNK  336



>ref|XP_009103803.1| PREDICTED: uncharacterized protein LOC103829870 [Brassica rapa]
Length=519

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 91/218 (42%), Gaps = 10/218 (5%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIG--FGRIFSLG  1118
             P    G P ++  ++ +   +  ++  ++ +      S+ +L +   ++    G +F + 
Sbjct  54    PNGEDGEPVITIGEEVLTAMNSLWKRCMIVRVLGRNVSLLNLTRKLKELWKPNGSMFVMD  113

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEG  941
             L  ++  ++ F  E ++            G  +    W+ DF P  +  +  PVW+    
Sbjct  114   L-PRNFFMVRFESEEEYMNALSGGPWRAFGSCLMVQAWNPDFDPLRDEIVTTPVWVRLSH  172

Query  940   FLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSY  761
                +L  K  +  IA  +G P+KVD +TL   R   AR+CVE+N++  L   + I    Y
Sbjct  173   IPVNLYHKTILMGIAKGLGRPIKVDLTTLKFERARFARICVEVNLNKPLKGTVVINGERY  232

Query  760   GDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPKT  647
                   V+ E I   CS C    GH  H  P +   + 
Sbjct  233   -----WVSYEGISTICSTC-GMYGHLAHACPRKSVERA  264



>ref|XP_010513494.1| PREDICTED: uncharacterized protein LOC104789504 [Camelina sativa]
Length=326

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/215 (23%), Positives = 89/215 (41%), Gaps = 10/215 (5%)
 Frame = -1

Query  1300  LRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGF--GRIF  1127
             L  P    G P V+  D+ +      ++  ++ K      S+A L +   ++    G +F
Sbjct  64    LEFPNGDDGEPVVTIGDEVLTVMKSLWKQCMIVKVLGRHVSIAVLSQKLRELWKPKGPMF  123

Query  1126  SLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIA  950
              + L  Q   ++ F  E ++          + G  +    WS +F P  +  +  PVW+ 
Sbjct  124   VMDLPRQFF-MVRFEREDEYLAALSGGPWRVFGSYLMVQAWSSEFNPLTDEIVTTPVWVH  182

Query  949   FEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMN  770
                   H   +  +  IA  +G P++VD +TL+  R   AR+CVE+++   L   + +  
Sbjct  183   LTNIPVHFYHRSILMGIAKGLGKPVRVDLTTLNFERARFARICVEVDLKKPLKGSVMVNG  242

Query  769   GSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
               +    + +TN      CS C    GH +H  P 
Sbjct  243   ERFYVLYEGLTN-----ICSLC-GLYGHLVHSCPQ  271



>ref|XP_011101716.1| PREDICTED: uncharacterized protein LOC105179778 [Sesamum indicum]
Length=238

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 55/110 (50%), Gaps = 5/110 (5%)
 Frame = -1

Query  964  PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQ  785
            PVWI              + ++A+ +G PL  DA T +  R   ARVCV ++VS +LP+ 
Sbjct  37   PVWIKLRHLPMEFWTTYGLSTVASGVGKPLYPDAITRACTRLDFARVCVMVDVSQNLPNH  96

Query  784  IWIM----NGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPKT  647
            + IM    +G        V  E++PP C  C  T GH++ + P  ++ KT
Sbjct  97   VIIMTPDEDGGETPCKVYVKYEWLPPKCLDCM-TLGHSVMECPLNKSKKT  145



>ref|XP_010695579.1| PREDICTED: uncharacterized protein LOC104908189 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 60/114 (53%), Gaps = 2/114 (2%)
 Frame = -1

Query  1021  MGTVKWSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHN  845
             M   KW+  F  + E   +VP+WI       +   + ++  I +L+G P+  D  T    
Sbjct  23    MVVKKWTATFDFHNEILKVVPIWIRLPNLPLNCWSENSLSRIGSLLGVPVYADECTTKTL  82

Query  844   RPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHN  683
             R S AR+ VE++V+ ++ ++I I + +   F QKV  +++P +C  C+   GHN
Sbjct  83    RISFARILVEIDVTKEILYEIAIEDPTGAVFKQKVVYDWLPEFCKKCQ-VIGHN  135



>ref|XP_009101980.1| PREDICTED: uncharacterized protein LOC103828133 [Brassica rapa]
Length=510

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 90/212 (42%), Gaps = 10/212 (5%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGF--GRIFSLG  1118
             P    G PS++   + ++  +  ++  ++ K      ++A L +   ++    G ++ + 
Sbjct  54    PNGEDGEPSITIGSEVLEAMNGMWKQCMIVKVLGRNVAIAALNRKLRELWSPKGAMYVMD  113

Query  1117  LLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPIV-PVWIAFEG  941
             L  Q   ++ F  E ++          I G  +    WS +F P  +  +  PVWI    
Sbjct  114   LPRQFF-MVRFEKEEEYLAALSGGPWRIFGSYLMVRAWSPEFDPLRDEIVTTPVWIRLTN  172

Query  940   FLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSY  761
                +   +  +  IA  +G P++VD +TL+  R   AR+CVE+N++  L   + I    Y
Sbjct  173   IPVNFYHRSILMGIAKGLGKPIRVDLTTLNFERARFARICVEVNLAKPLKGTVLINGERY  232

Query  760   GDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
                   V  E +   CS C    GH +H  P 
Sbjct  233   -----FVAYEGLSEICSRC-GIYGHLVHGCPR  258



>ref|XP_009766307.1| PREDICTED: uncharacterized protein LOC104217698 [Nicotiana sylvestris]
Length=348

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 87/202 (43%), Gaps = 8/202 (4%)
 Frame = -1

Query  1294  PPGHYKGMPSVSFTDQDVQQFSQKFRFALV----GKFSKGRPSMADLLKPFDQIGFGRIF  1127
             PP    G   V    +++++ ++K+  AL+    G  S+ +     + + + ++    +F
Sbjct  7     PPEIVDGNIVVKADKEEIEEQNKKWECALIIYVIGDMSRYKFMEKYIAQAWSKVNIPDLF  66

Query  1126  SLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIA  950
                L D+ + +  F+   D +        +I G +M   +W+ +F    E  + +P+W+ 
Sbjct  67    ---LHDEGYYIAKFDTIGDLKDILYGGPYTINGRLMVLKQWTPEFDIKAEVLMEIPLWVT  123

Query  949   FEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMN  770
                        + +  +A+ IG PL  D       R S AR+ VE NV+  LP ++ +  
Sbjct  124   IPNLPMSYWGNKTLSKLASAIGKPLFADECITKQIRISYARILVEANVTKKLPTEVTLQE  183

Query  769   GSYGDFAQKVTNEYIPPYCSGC  704
              S      +V  E+ P YC  C
Sbjct  184   TSGKQIQLQVEYEWKPKYCINC  205



>ref|XP_007206580.1| hypothetical protein PRUPE_ppa020297mg, partial [Prunus persica]
 gb|EMJ07779.1| hypothetical protein PRUPE_ppa020297mg, partial [Prunus persica]
Length=346

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 85/205 (41%), Gaps = 10/205 (5%)
 Frame = -1

Query  1273  MPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLL--KPFDQIGFGRIFSLGLLDQHH  1100
             +PS+ F++       + +R +++ K   GRP   + L  +   +       SL  L+ ++
Sbjct  5     IPSIIFSESIKDCLYRPWRTSVIIKLM-GRPLTYNFLHARLLQRWALKGPMSLIDLENNY  63

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQ  923
              ++ F +E D Q         I G  + T +W   F    E    +  W+   G      
Sbjct  64    FIVKFLLEEDMQYVLTGGPWQIAGQYLVTQQWKPGFNLKEERVTHMTAWVRINGLNVEYF  123

Query  922   DKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQK  743
                 +  I NLIG  +KVDA T+S  R   AR+CVEL++S  L   I +   SYG     
Sbjct  124   RPDVMGKIGNLIGHTVKVDALTMSQARGKFARICVELDLSKPLVPFIKVEGRSYG-----  178

Query  742   VTNEYIPPYCSGCRNTQGHNLHQEP  668
             V  E I   C  C    GH     P
Sbjct  179   VVYEGIKLVCFEC-GCYGHGRDNCP  202



>emb|CDX88033.1| BnaA06g26240D [Brassica napus]
Length=508

 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 54/121 (45%), Gaps = 7/121 (6%)
 Frame = -1

Query  1006  WSLDFRPYVESPIV-PVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             W+ DF P  +  +  PVW+       +   K  +  IA  +G P+KVD +TL   R   A
Sbjct  150   WTPDFDPLRDEIVTTPVWVRLSHIPVNFYHKTILMGIAKGLGRPIKVDLTTLKFERARFA  209

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
             R+CVE+N++  L   + I    Y      V+ E I   CS C    GH  H  P +   +
Sbjct  210   RICVEVNLNKPLKGTVMINGERY-----CVSYEGISTICSTC-GMYGHLAHACPRKTVER  263

Query  649   T  647
              
Sbjct  264   A  264



>ref|XP_010317841.1| PREDICTED: uncharacterized protein LOC104646245 [Solanum lycopersicum]
Length=979

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 1/106 (1%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            +P+W+ F     + +   ++  IA+ IG PL  D  T    R S  R+ +E+NV+  +P 
Sbjct  247  IPLWVNFPKLPLNCRGAGSLSRIASAIGVPLFADECTTKQTRISYTRMLIEVNVTKPIPQ  306

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
            +I +M+ +   F Q V  E+ P YC  C+   GH        + PK
Sbjct  307  KITVMDPNGRTFMQDVVMEWKPLYCDKCQKI-GHQCQSTTMEDLPK  351



>ref|XP_006376764.1| hypothetical protein POPTR_0012s06220g, partial [Populus trichocarpa]
 gb|ERP54561.1| hypothetical protein POPTR_0012s06220g, partial [Populus trichocarpa]
Length=292

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/228 (24%), Positives = 96/228 (42%), Gaps = 10/228 (4%)
 Frame = -1

Query  1321  SNTDDSPLRPPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIG  1142
             SN+   PL     Y    S    + D+++ +  +RF L+G  +   P  A LL  F    
Sbjct  39    SNSSSPPLVHFHDYTFSASYQLKETDIEEATPMWRFCLIGYVAGKFPGYAPLLH-FIGKH  97

Query  1141  FGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPI  968
             +    +  + D   ++  F+ EL+           + G   I+  +    DF+   +   
Sbjct  98    WQYKANFTMHDSGWLIFVFHYELEMPETLSSGPYFVFGRPLILKVMPEFFDFQA-SDMTK  156

Query  967   VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
             +P W+              +  +A +IG P+  D  T +  R S AR+ +E+++  +L  
Sbjct  157   LPTWVKLPNLPLRCWTPLCLSKLAGMIGKPIHCDVPTANMTRLSYARILIEVDLLQELLD  216

Query  787   QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGH-----NLHQEPHRE  659
              I ++  +   F+Q+VT E +P +C  CR   GH     N    PHR+
Sbjct  217   AIQVVLPNGTPFSQQVTYESLPRFCKRCR-VIGHSANTCNRPPVPHRK  263



>gb|KHN21001.1| hypothetical protein glysoja_009309, partial [Glycine soja]
Length=524

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 85/204 (42%), Gaps = 2/204 (1%)
 Frame = -1

Query  1291  PGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQI-GFGRIFSLGL  1115
             P    G   ++  ++D+    + +  ALV     G  SM  + +   +   F ++ ++  
Sbjct  22    PTLVDGEIEIAIDEEDIVSEKKFWENALVMYVLGGELSMNGVKQFITKAWNFVQLPAIYY  81

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGF  938
              D  + LL FN   D     L    +++   M   +W   F    +    +P+WI     
Sbjct  82    HDDGYFLLKFNTHKDMDDVMLRGPYTVRNMPMLLREWKPGFNLKQDMLRTLPIWIQLPQL  141

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               HL   R++  I + +G P+  D  T    R S AR+ VE++V+  LP+ I I +    
Sbjct  142   PLHLWGARSLGKIGSALGKPITTDECTAKKYRVSYARILVEVDVTQKLPNDITIRDSEGK  201

Query  757   DFAQKVTNEYIPPYCSGCRNTQGH  686
                Q V  E+ P +C  C+    H
Sbjct  202   KLKQPVHYEWKPMFCDKCQKFGHH  225



>ref|XP_007161440.1| hypothetical protein PHAVU_001G068900g [Phaseolus vulgaris]
 gb|ESW33434.1| hypothetical protein PHAVU_001G068900g [Phaseolus vulgaris]
Length=249

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 13/162 (8%)
 Frame = -1

Query  1111  DQHHVLLNFNMELDFQRCWLWKSL-SIKGFIMGTVKWSLDFRPYVESPIVPV--WIAFEG  941
             D+H   L+F  +L      +WK + S K   +G   +  +F    +  ++    W+    
Sbjct  80    DKHLTHLDFTKKLQL----VWKVIRSWKAIFLGKGFYEFEFSSLEDIRVLKTQTWVRIYH  135

Query  940   FLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSY  761
                     RAI+SI   IG PL +D  T+  NR   ARV V++++ +  P Q+ +    +
Sbjct  136   LPLKYWRPRAIFSITRGIGIPLSLDDHTMRKNRCLFARVFVDIDLLSPFPDQLLVERSDF  195

Query  760   GDFAQKVTNEYIPPYCS-----GCRNTQGHNLHQEPHRETPK  650
               F  +V  E++PP CS     G    Q H +H + H   P+
Sbjct  196   S-FVTEVEYEWLPPLCSYSKMIGHELAQCHVIHDQGHVFGPQ  236



>ref|XP_003599061.1| hypothetical protein MTR_3g027260 [Medicago truncatula]
Length=572

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/151 (26%), Positives = 74/151 (49%), Gaps = 3/151 (2%)
 Frame = -1

Query  1129  FSLGLLDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVE-SPIVPVWI  953
             +SL  L + +    F  E D +  W   ++++K  ++   +WS DF  Y + S    VWI
Sbjct  119   WSLLSLGRGYYEFYFASEEDLRSVWAMGTVNLKPGLLRLFEWSKDFNLYTQRSTHAQVWI  178

Query  952   AFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM  773
                         R +  IA+ IG+PL +D +T        AR+ V+++ +  L ++I + 
Sbjct  179   RLMALPQEYWMDRTLREIASAIGTPLLIDNATSKRLFGHYARILVDMDFTRKLFYEIVVE  238

Query  772   NGSYGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
                +  F+ +V  + +P +C+ C+N  GH++
Sbjct  239   REGFA-FSVEVVYDRMPDFCTNCKNI-GHHI  267



>ref|XP_008780283.1| PREDICTED: uncharacterized protein LOC103700090, partial [Phoenix 
dactylifera]
Length=261

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 60/138 (43%), Gaps = 2/138 (1%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESP-IVPVWIAFEGF  938
             + + H+L+ F  E D +   +     I G +    +W  DF P  ++   V VW+   G 
Sbjct  117   MAEEHLLVRFRSEADREAAVVDGPWMISGQLFAMARWQPDFVPGSKTVNRVVVWVRLLGL  176

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
              A   +  +I  IA   G P  VD  T    R   ARV VEL+++  L   I+I  GS  
Sbjct  177   PAEYWEGDSILEIATEAGRPAAVDGFTEQRRRLGFARVWVELDMTKSLTPGIFI-QGSTA  235

Query  757   DFAQKVTNEYIPPYCSGC  704
              F Q    E +P  C  C
Sbjct  236   TFWQAFVYESLPVVCFRC  253



>ref|XP_009759575.1| PREDICTED: uncharacterized protein LOC104212089 [Nicotiana sylvestris]
Length=166

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (54%), Gaps = 1/99 (1%)
 Frame = -1

Query  1006  WSLDFRPYVESPI-VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             WS DF    E P  +P+W+ F     +    +++  IA+++G+P+  D  T    R S A
Sbjct  22    WSEDFDFSKEFPSEIPLWVKFPNLPMNCWGSKSLSRIASVLGTPVFADECTTKQTRISFA  81

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYC  713
             R+ VE+NVS  LP +I +++     F Q V  ++ P +C
Sbjct  82    RMLVEINVSRPLPDEITVIDPKGKYFQQHVIYDWKPYFC  120



>ref|XP_010322029.1| PREDICTED: uncharacterized protein LOC104647883 [Solanum lycopersicum]
Length=463

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/212 (24%), Positives = 94/212 (44%), Gaps = 11/212 (5%)
 Frame = -1

Query  1294  PPGHYKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIF--SL  1121
             PP    G   V    ++V     K++ AL+  +  G     +++  +  + + +    +L
Sbjct  137   PPQIVNGETMVQLEGKEVLDEEAKWKCALIA-YVVGECPGYNVMNRYIMMNWSKAGKPTL  195

Query  1120  GLLDQHHVLLNF-NMELDFQRCWLWKSLSIKGFIMGTVKWSLDF---RPYVESPIVPVWI  953
              L ++ + ++ F NME D          +I    +   +W  DF   + ++    +P+W+
Sbjct  196   FLHEEGYFIVKFQNME-DMNEILFLGPYTINNRPIIVKQWCSDFDFGKEFLAE--IPLWV  252

Query  952   AFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIM  773
              F     +     ++  IA+ IG PL  D  T    R S AR+ +E++V+  +P QI + 
Sbjct  253   NFRRLPLNCWGVGSLSRIASAIGVPLFADECTTKQMRISYARMLIEVDVTKAIPQQITVA  312

Query  772   NGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLH  677
             + +   F Q+V  E+ P YC  C+   GH   
Sbjct  313   DPNGRTFLQEVVMEWKPQYCDKCQKI-GHQCQ  343



>ref|XP_010667274.1| PREDICTED: uncharacterized protein LOC104884335 [Beta vulgaris 
subsp. vulgaris]
Length=230

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/97 (30%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = -1

Query  970  IVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLP  791
            I+P+W+       +  +  ++  I +L+G PL  D  T    R S AR+ VE++V+ D  
Sbjct  19   IIPIWVKLPNLPLNCWNPDSLSRIGSLLGVPLYADECTSQQLRISFARILVEIDVTKDRQ  78

Query  790  HQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNL  680
            H I + + +     Q+V  ++ PPYC  C+   GH+ 
Sbjct  79   HTIQVEDSNGIIIQQEVRYDWWPPYCKKCQRV-GHDC  114



>ref|XP_003596392.1| hypothetical protein MTR_2g076760 [Medicago truncatula]
Length=513

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 67/139 (48%), Gaps = 3/139 (2%)
 Frame = -1

Query  1093  LNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQDK  917
               F   +D +  W   ++++K  ++   +W+ DF  + +      VWI            
Sbjct  124   FTFASNIDLRMVWASGTVNLKPGVLRLFEWTKDFNMHKQRNTHAQVWIRLMELPQEYWMD  183

Query  916   RAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVT  737
             R +  I++ IG+PL +D +T        AR+ V+++ +  + H+I +    Y  F  +V 
Sbjct  184   RTLREISSAIGTPLIIDNATTKRLYGHYARILVDMDFARKMFHEITVEREGYA-FNVEVA  242

Query  736   NEYIPPYCSGCRNTQGHNL  680
              E++P +CS C+N  GH++
Sbjct  243   YEWLPDFCSHCQNI-GHDV  260



>ref|XP_003600952.1| hypothetical protein MTR_3g071380 [Medicago truncatula]
Length=477

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/188 (23%), Positives = 84/188 (45%), Gaps = 19/188 (10%)
 Frame = -1

Query  1069  FQRCWL--WKSLSIKGFIMGTVKWSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSI  899
              + C L  WK+L +    +    WS DF+P +++     VW+   G        R  ++I
Sbjct  140   LRNCLLSVWKNLGV----LKLFAWSQDFKPNLQNNSTAQVWVRLHGLPQEYWRPRIFFAI  195

Query  898   ANLIGSPLKVDAST----LSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNE  731
             AN +G+P+  D+++    +       ARV V+++++ DL + + +    Y  F + +  E
Sbjct  196   ANSVGTPICTDSASTKPMIDRTFGQYARVLVDMDITKDLRYNVLVERKGYAFFVE-LEYE  254

Query  730   YIPPYCSGCRNTQGHNLHQEPHRETPKTlpqalpplpqqpmvvpPRKSWHPVESDQDRSQ  551
              +P YC  C+   GH++      E  +   + +       ++   +K  H +  D  ++Q
Sbjct  255   NLPDYCVHCKKI-GHDV------EICRFAIKTVQARTASKLINNEQKKVHVIARDGRKNQ  307

Query  550   GGGPAQPI  527
             G     PI
Sbjct  308   GKNVENPI  315



>ref|XP_007219945.1| hypothetical protein PRUPE_ppb019389mg [Prunus persica]
 gb|EMJ21144.1| hypothetical protein PRUPE_ppb019389mg [Prunus persica]
Length=786

 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 81/193 (42%), Gaps = 9/193 (5%)
 Frame = -1

Query  1273  MPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLD--QHH  1100
             +PS+ F+D+      + +R A++ K   GRP     L+    + +     + L+D   ++
Sbjct  81    IPSIQFSDKVKSSLYRPWRSAVIIKL-MGRPLAYTFLRSLLLLRWALKGPMSLIDLENNY  139

Query  1099  VLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGFLAHLQ  923
              ++ F  E D +         I G  +   KW   F    E    +  W+   G      
Sbjct  140   FIVKFLYEEDMRYVLTGGPWQIAGQYIVAQKWKPGFNAKEEKITHMTAWVRINGLNVEYF  199

Query  922   DKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQK  743
                 +  I NL+G+  KVDA TLS  R   AR+CVEL+++  L   I I   +YG     
Sbjct  200   RADVMEKIGNLVGATDKVDAHTLSQARGKFARICVELDLAKPLTPFIEIEGRTYG-----  254

Query  742   VTNEYIPPYCSGC  704
             V  E I   C  C
Sbjct  255   VVYEGINLVCFEC  267



>ref|XP_011102225.1| PREDICTED: uncharacterized protein LOC105180248 [Sesamum indicum]
Length=255

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 51/98 (52%), Gaps = 5/98 (5%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            VPVW+        L  +  +  +A+ +G PL  DA T +  R   ARVCV L+V++ +P 
Sbjct  159  VPVWVKLRHLSVELWTEEGLSIVASGVGKPLYPDAITRACTRLDFARVCVMLDVNSKMPK  218

Query  787  QIWIM--NGSYGDFAQKVTNEY--IPPYCSGCRNTQGH  686
             I IM  +   G+   KV  EY  +PP C+ C  T GH
Sbjct  219  HIIIMTPDEEGGELPCKVDVEYEWLPPRCTNCM-TLGH  255



>ref|XP_009790310.1| PREDICTED: uncharacterized protein LOC104237787 [Nicotiana sylvestris]
Length=128

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 6/98 (6%)
 Frame = -1

Query  958  WIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIW  779
            WI+F G L     K  + S+A ++G PL +D +  +  RPS ARV V L++  DLPH++ 
Sbjct  3    WISFPGLLPTFFVKECLLSLALVVGKPLHLDMAKKNKTRPSCARVKVLLDLLADLPHKVC  62

Query  778  --IMNGSYGDFAQKVTN---EYIPPYCSGCRNTQGHNL  680
              I N        K  N   + +P YC  C+  QGH++
Sbjct  63   IDIENDETPKTRMKGVNIKYDILPKYCKECK-IQGHDM  99



>ref|XP_006367861.1| PREDICTED: uncharacterized protein LOC102578882, partial [Solanum 
tuberosum]
Length=606

 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 63/134 (47%), Gaps = 5/134 (4%)
 Frame = -1

Query  1210  LVGKFSKGRPSMADLLKPF-DQIGFGRIFSLGLLDQHHVLLNFNMELDFQRCWLWKSLSI  1034
             ++GKFS G P + DL K    Q        +GLL   +VL+  ++  D+ +        I
Sbjct  44    MIGKFSYGWPDILDLRKLIPKQCELKGEVDIGLLCNRYVLIRASLLEDYVKLLSKPQFYI  103

Query  1033  K----GFIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVD  866
                   + M T+KW   F P  E+     WI+F     +   K  I+S+A  +G PL+VD
Sbjct  104   THNHWSYPMRTLKWDPLFDPEEETTTAIAWISFPSLPPNFFGKETIFSMAAAVGRPLQVD  163

Query  865   ASTLSHNRPSMARV  824
              +T +  +PS AR 
Sbjct  164   LATQNKTKPSCART  177



>ref|XP_006375691.1| hypothetical protein POPTR_0014s19670g [Populus trichocarpa]
 gb|ERP53488.1| hypothetical protein POPTR_0014s19670g [Populus trichocarpa]
Length=559

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/196 (23%), Positives = 80/196 (41%), Gaps = 4/196 (2%)
 Frame = -1

Query  1282  YKGMPSVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQH  1103
             +  + S    + D+       RF L+G  +   P    LL  F    +       + D  
Sbjct  196   FAHLESCHLNEADLGAAMSMLRFCLIGYVAGKFPGYVSLLH-FISKHWQHKARFTMHDSG  254

Query  1102  HVLLNFNMELDFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAH  929
              ++  FN EL+           + G   I+  +    DF+   +   +P W+        
Sbjct  255   WLIFAFNSELEMLETLSAGLYFVFGRPLILKIMPEFFDFQAN-DMTKLPTWVKLPNLPLR  313

Query  928   LQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFA  749
                   +  I N+IG P+  D  T +  R S AR+ VE+++  +LPH + ++  +    +
Sbjct  314   CWTPLCLSKIGNMIGKPIHCDIPTATMFRLSYARILVEVDLLQELPHVVQVVLPNGTPLS  373

Query  748   QKVTNEYIPPYCSGCR  701
             Q VT E +P +C+ CR
Sbjct  374   QHVTYESLPRFCTRCR  389



>ref|XP_009629264.1| PREDICTED: uncharacterized protein LOC104119453 [Nicotiana tomentosiformis]
Length=332

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (54%), Gaps = 3/97 (3%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            VP+WI   G       K A+  I +LIG+PLK D +  + ++ + ARV VE+ ++ + P 
Sbjct  70   VPIWIRLVGLDVKYWGKNALTKITSLIGTPLKADKAMNNRDKMTYARVLVEIPLNQEYPT  129

Query  787  QIWIMNGSYGDFA-QKVTNEYIPPYCSGCRNTQGHNL  680
             +   N  YG    Q V  E+ P  C+ C+N  GH++
Sbjct  130  SVMFEN-EYGRIVEQNVEYEWKPVLCAKCKNF-GHDI  164



>ref|XP_010694020.1| PREDICTED: uncharacterized protein LOC104906887 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 2/106 (2%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            VP+WI           +R ++ +   IG PLK+D ST++ +R   AR+ +E  ++ DLP 
Sbjct  189  VPIWIQLPALDLKYWGERCLFKLVAGIGKPLKLDQSTINKDRLQYARIMIETRMNQDLPE  248

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRETPK  650
            +I   N       QKV  E+ P  C  C    GH+ H+E  ++  K
Sbjct  249  EIVFENEKGVMMTQKVHYEWRPIRCDICAGI-GHS-HKECVKQKQK  292



>ref|XP_006371913.1| hypothetical protein POPTR_0018s06165g [Populus trichocarpa]
 gb|ERP49710.1| hypothetical protein POPTR_0018s06165g [Populus trichocarpa]
Length=167

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -1

Query  967  VPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPH  788
            +PVW+ F       +  + +  IA +IG PL+ D  T S +R S ARV VE+N+ +DLP+
Sbjct  4    IPVWVKFPSLSIKCRSPKCLSKIACIIGKPLRSDMLTSSMSRLSYARVLVEVNLLSDLPY  63

Query  787  QIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGH  686
             + I   +     Q+V  E +P +   CR   GH
Sbjct  64   FVDITLPNGNVLCQQVVYETLPRFYKHCR-VLGH  96



>ref|XP_010693202.1| PREDICTED: uncharacterized protein LOC104906181 [Beta vulgaris 
subsp. vulgaris]
Length=237

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (48%), Gaps = 5/124 (4%)
 Frame = -1

Query  1006  WSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             W+ DF    E   I+P+W+       +     ++  I +L+G PL  D ST    R S A
Sbjct  6     WTPDFSFKEEVLKIIPIWVKLPNLPLNCWSPDSLSRIGSLLGIPLYADESTSKQMRISFA  65

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYCSGCRNTQGHNLHQ---EPHRE  659
             R+ VE++V+ +    I + + +     Q V  ++ PP+C  C+   GHN  +   +P + 
Sbjct  66    RILVEIDVTKEKTQSIMVEDANGKIIKQDVRYDWWPPFCQKCQKI-GHNCGEKQFKPQQN  124

Query  658   TPKT  647
              PK 
Sbjct  125   KPKV  128



>ref|XP_006295894.1| hypothetical protein CARUB_v10025024mg, partial [Capsella rubella]
 gb|EOA28792.1| hypothetical protein CARUB_v10025024mg, partial [Capsella rubella]
Length=507

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 61/154 (40%), Gaps = 7/154 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYV-ESPIVPVWIAFEGF  938
             L +   L+ F +E D+          + G ++    WS  F P   E    PVW+     
Sbjct  132   LPRQFFLVRFELEDDYMGVVTGGPWRLFGSLLMFQAWSPSFNPMQDEIETTPVWVRISNL  191

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               H   K  +  IA  +G PL+ D +TL   R   ARVC+E+N+   L   + +    Y 
Sbjct  192   PVHYYHKTILMGIAEALGKPLRADLTTLQVERARFARVCIEVNLKKPLKGSVMVNGERY-  250

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPHRET  656
                   + E +   CS C    GH     P R T
Sbjct  251   ----MASYEGLNTICSSC-GIYGHLASVCPKRLT  279



>ref|XP_009787795.1| PREDICTED: uncharacterized protein LOC104235683 [Nicotiana sylvestris]
Length=304

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 1/99 (1%)
 Frame = -1

Query  1006  WSLDFRPYVES-PIVPVWIAFEGFLAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMA  830
             WS+DF  Y E    +P+W++F     +      +  IA+ +G P+  D  T S  R S  
Sbjct  138   WSVDFNFYDEVLKTIPLWVSFPNLPLNCWGNITLSRIASGLGCPIYADECTSSTVRISYV  197

Query  829   RVCVELNVSNDLPHQIWIMNGSYGDFAQKVTNEYIPPYC  713
             RV +E+++S + P  I + + S  +F Q V  +++P YC
Sbjct  198   RVLIEMDISKEFPKCIIVQDLSRKEFEQVVEYDWVPQYC  236



>ref|XP_006375671.1| hypothetical protein POPTR_0014s19170g, partial [Populus trichocarpa]
 gb|ERP53468.1| hypothetical protein POPTR_0014s19170g, partial [Populus trichocarpa]
Length=431

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 81/190 (43%), Gaps = 4/190 (2%)
 Frame = -1

Query  1267  SVSFTDQDVQQFSQKFRFALVGKFSKGRPSMADLLKPFDQIGFGRIFSLGLLDQHHVLLN  1088
             S  F D DV   +  ++F L+G      P  A L    D+  +    +  + D   ++  
Sbjct  114   SCQFKDTDVASPADLWKFCLIGFVVGKFPGYASLSHYIDR-NWKHHANFTMHDFGWLIFA  172

Query  1087  FNMELDFQRCWLWKSLSIKG--FIMGTVKWSLDFRPYVESPIVPVWIAFEGFLAHLQDKR  914
             F  E +           + G   I+  +    DF+P  ++  +P W+ F       +   
Sbjct  173   FPTEHEMLEVLGGGPYYVFGRPLILKVIPDFFDFKPN-DTTKMPTWVRFPNLRLRCRTSL  231

Query  913   AIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYGDFAQKVTN  734
              +  +A++ G P+  D  T +  R S A V +E+N+  DLP  + ++  +  + AQ+V  
Sbjct  232   CLSKLASVTGKPIHCDDPTTNMTRLSYAWVLIEVNLPRDLPSSVNVVLPNGSNIAQQVLY  291

Query  733   EYIPPYCSGC  704
             E +P +C  C
Sbjct  292   ESLPRFCKSC  301



>ref|XP_006287598.1| hypothetical protein CARUB_v10000810mg, partial [Capsella rubella]
 gb|EOA20496.1| hypothetical protein CARUB_v10000810mg, partial [Capsella rubella]
Length=493

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 65/151 (43%), Gaps = 7/151 (5%)
 Frame = -1

Query  1114  LDQHHVLLNFNMELDFQRCWLWKSLSIKGFIMGTVKWSLDFRPYVESPI-VPVWIAFEGF  938
             L +   ++ F  E ++          + G  +    WS DF P     + +PVWI     
Sbjct  127   LPRQFFVVRFEFEEEYMAALTGGPWKMFGSYLMVQAWSPDFDPLRHDIVTMPVWIRLLNI  186

Query  937   LAHLQDKRAIYSIANLIGSPLKVDASTLSHNRPSMARVCVELNVSNDLPHQIWIMNGSYG  758
               +L     +  IA  +G P++ D +TL  +R   ARVCVE+++S  L   + I    Y 
Sbjct  187   PMNLYHSSILMIIAEGLGKPIREDLTTLKFDRARFARVCVEVDLSQPLKGMVLINEERY-  245

Query  757   DFAQKVTNEYIPPYCSGCRNTQGHNLHQEPH  665
                  V+ E +   CSGC    GH +H  P 
Sbjct  246   ----YVSYEGLTNICSGC-GMYGHLVHTCPR  271



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3536207773664