BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26840_g1_i1 len=2097 path=[2075:0-2096]

Length=2097
                                                                      Score     E

gb|EYU39291.1|  hypothetical protein MIMGU_mgv1a005069mg                544   0.0      
emb|CDP01575.1|  unnamed protein product                                540   0.0      
ref|XP_009768507.1|  PREDICTED: receptor-like cytosolic serine/th...    541   0.0      
ref|XP_010312655.1|  PREDICTED: receptor-like cytosolic serine/th...    540   0.0      
ref|XP_009615440.1|  PREDICTED: receptor-like cytosolic serine/th...    536   1e-180   
ref|XP_011097466.1|  PREDICTED: receptor-like cytosolic serine/th...    535   2e-180   
ref|XP_006353160.1|  PREDICTED: receptor-like cytosolic serine/th...    535   5e-180   
ref|XP_004250155.1|  PREDICTED: receptor-like cytosolic serine/th...    533   2e-179   
ref|XP_009623354.1|  PREDICTED: receptor-like cytosolic serine/th...    529   3e-178   
ref|XP_009795660.1|  PREDICTED: receptor-like cytosolic serine/th...    528   1e-177   
ref|XP_011099971.1|  PREDICTED: receptor-like cytosolic serine/th...    520   1e-174   
ref|XP_006346753.1|  PREDICTED: receptor-like cytosolic serine/th...    516   5e-173   
ref|XP_011021858.1|  PREDICTED: receptor-like cytosolic serine/th...    497   4e-166   
ref|XP_011021857.1|  PREDICTED: receptor-like cytosolic serine/th...    497   6e-166   
ref|XP_007047766.1|  ROP binding protein kinases 1, putative            496   3e-165   
ref|XP_003635501.1|  PREDICTED: receptor-like cytosolic serine/th...    493   3e-164   
gb|EYU30928.1|  hypothetical protein MIMGU_mgv1a004754mg                494   7e-164   
ref|XP_002533520.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    488   2e-162   Ricinus communis
gb|KHG03388.1|  Receptor-like cytosolic serine/threonine-protein ...    481   2e-159   
gb|KDP29776.1|  hypothetical protein JCGZ_18711                         477   6e-158   
gb|KHN04920.1|  Receptor-like cytosolic serine/threonine-protein ...    474   6e-157   
ref|XP_010254568.1|  PREDICTED: receptor-like cytosolic serine/th...    472   4e-156   
ref|XP_006466328.1|  PREDICTED: receptor-like cytosolic serine/th...    472   4e-156   
ref|XP_010547588.1|  PREDICTED: receptor-like cytosolic serine/th...    472   5e-156   
ref|XP_003517343.1|  PREDICTED: receptor-like cytosolic serine/th...    471   7e-156   
gb|KFK28223.1|  hypothetical protein AALP_AA8G488500                    469   4e-155   
ref|XP_010462975.1|  PREDICTED: receptor-like cytosolic serine/th...    468   1e-154   
gb|KDO60539.1|  hypothetical protein CISIN_1g012765mg                   467   3e-154   
gb|KCW62037.1|  hypothetical protein EUGRSUZ_H04720                     468   3e-154   
ref|XP_006426253.1|  hypothetical protein CICLE_v10025570mg             467   4e-154   
ref|XP_010025388.1|  PREDICTED: receptor-like cytosolic serine/th...    468   4e-154   
ref|XP_010444512.1|  PREDICTED: receptor-like cytosolic serine/th...    465   2e-153   
ref|XP_010484345.1|  PREDICTED: receptor-like cytosolic serine/th...    465   2e-153   
dbj|BAA98172.1|  unnamed protein product                                461   1e-152   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201356.2|  protein kinase family protein                         462   2e-152   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25325.1|  hypothetical protein AALP_AA8G098100                    463   2e-152   
dbj|BAC43270.1|  unknown protein                                        461   7e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866677.1|  hypothetical protein ARALYDRAFT_496787             461   8e-152   
ref|XP_008236283.1|  PREDICTED: receptor-like cytosolic serine/th...    461   1e-151   
ref|XP_007205169.1|  hypothetical protein PRUPE_ppa005494mg             460   2e-151   
ref|XP_008450192.1|  PREDICTED: receptor-like cytosolic serine/th...    458   1e-150   
ref|XP_010319534.1|  PREDICTED: receptor-like cytosolic serine/th...    451   2e-150   
gb|KHN38884.1|  Receptor-like cytosolic serine/threonine-protein ...    456   5e-150   
ref|XP_006399550.1|  hypothetical protein EUTSA_v10013425mg             457   5e-150   
ref|XP_003534246.1|  PREDICTED: receptor-like cytosolic serine/th...    456   7e-150   
ref|XP_009122043.1|  PREDICTED: receptor-like cytosolic serine/th...    456   1e-149   
emb|CDX69825.1|  BnaA10g21740D                                          456   1e-149   
ref|XP_009122042.1|  PREDICTED: receptor-like cytosolic serine/th...    456   1e-149   
ref|XP_002873463.1|  hypothetical protein ARALYDRAFT_487885             454   2e-149   
ref|XP_006287662.1|  hypothetical protein CARUB_v10000873mg             454   8e-149   
ref|XP_009364240.1|  PREDICTED: receptor-like cytosolic serine/th...    453   1e-148   
emb|CDY08783.1|  BnaA06g24410D                                          452   1e-148   
ref|XP_010519128.1|  PREDICTED: receptor-like cytosolic serine/th...    452   1e-148   
emb|CDX97023.1|  BnaC09g46020D                                          453   2e-148   
ref|XP_010277525.1|  PREDICTED: receptor-like cytosolic serine/th...    452   2e-148   
ref|XP_009364239.1|  PREDICTED: receptor-like cytosolic serine/th...    453   2e-148   
gb|AAL07235.1|  putative Pto kinase interactor                          452   3e-148   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568231.1|  receptor-like cytosolic serine/threonine-protei...    452   3e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007158360.1|  hypothetical protein PHAVU_002G146300g             450   4e-148   
ref|XP_004165998.1|  PREDICTED: receptor-like cytosolic serine/th...    449   2e-147   
ref|XP_010422834.1|  PREDICTED: receptor-like cytosolic serine/th...    449   2e-147   
ref|XP_009150644.1|  PREDICTED: receptor-like cytosolic serine/th...    449   3e-147   
ref|XP_003613029.1|  Cysteine-rich receptor-like protein kinase         449   3e-147   
gb|AES95987.2|  receptor-like cytosolic Serine/Threonine-kinase         448   5e-147   
ref|XP_004133749.1|  PREDICTED: receptor-like cytosolic serine/th...    450   5e-147   
emb|CDY37833.1|  BnaAnng04940D                                          447   2e-146   
ref|XP_008362614.1|  PREDICTED: receptor-like cytosolic serine/th...    447   2e-146   
ref|XP_009125295.1|  PREDICTED: receptor-like cytosolic serine/th...    447   3e-146   
emb|CDY40103.1|  BnaC02g00270D                                          447   4e-146   
ref|XP_010491725.1|  PREDICTED: receptor-like cytosolic serine/th...    446   5e-146   
emb|CDY33949.1|  BnaC02g43880D                                          447   5e-146   
ref|XP_009130517.1|  PREDICTED: receptor-like cytosolic serine/th...    446   8e-146   
ref|XP_010453081.1|  PREDICTED: receptor-like cytosolic serine/th...    446   9e-146   
emb|CDX85756.1|  BnaA02g00570D                                          446   1e-145   
gb|KEH27731.1|  receptor-like cytosolic Serine/Threonine-kinase         444   2e-145   
emb|CAB89391.1|  Pto kinase interactor-like protein                     444   3e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338467.1|  PREDICTED: receptor-like cytosolic serine/th...    444   4e-145   
ref|XP_004288526.1|  PREDICTED: receptor-like cytosolic serine/th...    444   6e-145   
emb|CDY14578.1|  BnaC03g48810D                                          442   1e-144   
ref|XP_010547587.1|  PREDICTED: receptor-like cytosolic serine/th...    442   2e-144   
ref|XP_009364810.1|  PREDICTED: receptor-like cytosolic serine/th...    442   2e-144   
gb|KEH20107.1|  receptor-like cytosolic Serine/Threonine-kinase         442   4e-144   
ref|XP_003530605.2|  PREDICTED: receptor-like cytosolic serine/th...    440   2e-143   
ref|XP_009382115.1|  PREDICTED: receptor-like cytosolic serine/th...    441   4e-143   
ref|XP_009382123.1|  PREDICTED: receptor-like cytosolic serine/th...    440   5e-143   
ref|XP_004509705.1|  PREDICTED: receptor-like cytosolic serine/th...    439   1e-142   
ref|XP_004509768.1|  PREDICTED: receptor-like cytosolic serine/th...    436   2e-142   
ref|XP_003551310.1|  PREDICTED: receptor-like cytosolic serine/th...    436   5e-142   
ref|XP_010027963.1|  PREDICTED: receptor-like cytosolic serine/th...    436   1e-141   
ref|XP_010027964.1|  PREDICTED: receptor-like cytosolic serine/th...    436   1e-141   
ref|XP_007156465.1|  hypothetical protein PHAVU_003G288300g             434   3e-141   
gb|KHN37128.1|  Receptor-like cytosolic serine/threonine-protein ...    431   4e-141   
ref|XP_006656340.1|  PREDICTED: receptor-like cytosolic serine/th...    436   7e-141   
gb|AFW87684.1|  putative protein kinase superfamily protein             432   8e-141   
ref|XP_006656341.1|  PREDICTED: receptor-like cytosolic serine/th...    436   8e-141   
ref|XP_008805930.1|  PREDICTED: receptor-like cytosolic serine/th...    432   2e-140   
ref|NP_001151766.1|  LOC100285401                                       434   3e-140   Zea mays [maize]
ref|XP_008658716.1|  PREDICTED: LOC100285401 isoform X1                 434   4e-140   
ref|XP_010680362.1|  PREDICTED: receptor-like cytosolic serine/th...    431   1e-139   
ref|XP_010914330.1|  PREDICTED: receptor-like cytosolic serine/th...    428   3e-139   
ref|XP_010914329.1|  PREDICTED: receptor-like cytosolic serine/th...    429   4e-139   
ref|XP_006857068.1|  hypothetical protein AMTR_s00065p00072280          429   6e-139   
ref|XP_010941724.1|  PREDICTED: receptor-like cytosolic serine/th...    428   7e-139   
emb|CBI33279.3|  unnamed protein product                                422   9e-139   
ref|XP_010941723.1|  PREDICTED: receptor-like cytosolic serine/th...    428   9e-139   
ref|XP_010113449.1|  Receptor-like cytosolic serine/threonine-pro...    430   1e-138   
ref|XP_003635543.1|  PREDICTED: receptor-like cytosolic serine/th...    421   2e-138   
ref|XP_003563350.1|  PREDICTED: receptor-like cytosolic serine/th...    428   3e-138   
ref|XP_010240347.1|  PREDICTED: receptor-like cytosolic serine/th...    428   4e-138   
ref|XP_004965633.1|  PREDICTED: receptor-like cytosolic serine/th...    427   3e-137   
ref|XP_004965634.1|  PREDICTED: receptor-like cytosolic serine/th...    427   3e-137   
ref|XP_004965632.1|  PREDICTED: receptor-like cytosolic serine/th...    427   4e-137   
ref|XP_008802341.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    423   5e-137   
ref|XP_004965635.1|  PREDICTED: receptor-like cytosolic serine/th...    426   6e-137   
ref|XP_006279866.1|  hypothetical protein CARUB_v10028558mg             429   3e-136   
dbj|BAK02644.1|  predicted protein                                      423   5e-136   
emb|CCE57823.1|  ROP binding kinases 1                                  422   7e-136   
ref|XP_010519133.1|  PREDICTED: receptor-like cytosolic serine/th...    417   1e-135   
gb|EMS45538.1|  Receptor-like cytosolic serine/threonine-protein ...    417   4e-135   
dbj|BAG99344.1|  unnamed protein product                                415   4e-134   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD45880.1|  putative receptor protein kinase PERK1                 417   1e-133   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81128.1|  hypothetical protein OsI_24017                          417   1e-133   Oryza sativa Indica Group [Indian rice]
ref|NP_001058295.1|  Os06g0663900                                       417   1e-133   Oryza sativa Japonica Group [Japonica rice]
gb|EMT31498.1|  Putative LRR receptor-like serine/threonine-prote...    419   1e-133   
ref|XP_009131704.1|  PREDICTED: receptor-like cytosolic serine/th...    414   6e-133   
gb|EPS57687.1|  hypothetical protein M569_17130                         403   1e-131   
ref|XP_008805931.1|  PREDICTED: receptor-like cytosolic serine/th...    409   1e-131   
ref|XP_006845817.1|  hypothetical protein AMTR_s00019p00257180          407   2e-130   
ref|XP_002310307.2|  hypothetical protein POPTR_0007s14200g             401   1e-129   Populus trichocarpa [western balsam poplar]
ref|XP_006400444.1|  hypothetical protein EUTSA_v10013242mg             404   4e-129   
gb|KFK26129.1|  hypothetical protein AALP_AA8G207400                    403   1e-128   
ref|XP_009352175.1|  PREDICTED: receptor-like cytosolic serine/th...    401   7e-128   
ref|XP_009126290.1|  PREDICTED: receptor-like cytosolic serine/th...    400   1e-127   
ref|NP_197392.2|  protein kinase family protein                         400   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454141.1|  PREDICTED: receptor-like cytosolic serine/th...    400   1e-127   
ref|XP_006289793.1|  hypothetical protein CARUB_v10003395mg             400   2e-127   
ref|XP_008390775.1|  PREDICTED: receptor-like cytosolic serine/th...    400   2e-127   
ref|XP_010546905.1|  PREDICTED: receptor-like cytosolic serine/th...    399   5e-127   
ref|XP_002873918.1|  kinase family protein                              398   8e-127   
ref|XP_007035412.1|  Kinase superfamily protein, putative isoform 1     397   2e-126   
ref|XP_010492930.1|  PREDICTED: receptor-like cytosolic serine/th...    397   3e-126   
gb|KCW60917.1|  hypothetical protein EUGRSUZ_H03652                     396   6e-126   
ref|XP_006489205.1|  PREDICTED: receptor-like cytosolic serine/th...    394   8e-126   
ref|XP_010105676.1|  Receptor-like cytosolic serine/threonine-pro...    394   1e-125   
ref|XP_007226342.1|  hypothetical protein PRUPE_ppa022172mg             391   1e-124   
ref|XP_006594454.1|  PREDICTED: receptor-like cytosolic serine/th...    392   2e-124   
ref|XP_006594453.1|  PREDICTED: receptor-like cytosolic serine/th...    392   2e-124   
ref|XP_010024471.1|  PREDICTED: receptor-like cytosolic serine/th...    390   5e-124   
ref|XP_010024469.1|  PREDICTED: receptor-like cytosolic serine/th...    394   6e-124   
ref|XP_008223070.1|  PREDICTED: receptor-like cytosolic serine/th...    391   6e-124   
gb|KCW60916.1|  hypothetical protein EUGRSUZ_H03652                     390   6e-124   
ref|XP_006594452.1|  PREDICTED: receptor-like cytosolic serine/th...    392   8e-124   
ref|XP_010024470.1|  PREDICTED: receptor-like cytosolic serine/th...    390   2e-123   
emb|CDX88908.1|  BnaA03g07410D                                          389   2e-123   
ref|XP_011012550.1|  PREDICTED: receptor-like cytosolic serine/th...    388   2e-123   
ref|XP_010649821.1|  PREDICTED: receptor-like cytosolic serine/th...    388   3e-123   
ref|XP_003594054.1|  Somatic embryogenesis receptor kinase              386   4e-123   
ref|XP_010649820.1|  PREDICTED: receptor-like cytosolic serine/th...    387   4e-123   
ref|XP_011012531.1|  PREDICTED: receptor-like cytosolic serine/th...    389   8e-123   
ref|XP_011012532.1|  PREDICTED: receptor-like cytosolic serine/th...    389   1e-122   
ref|XP_011012530.1|  PREDICTED: receptor-like cytosolic serine/th...    389   1e-122   
emb|CDX70854.1|  BnaC03g09380D                                          386   2e-122   
ref|XP_006419738.1|  hypothetical protein CICLE_v10006445mg             384   3e-122   
ref|XP_004486085.1|  PREDICTED: receptor-like cytosolic serine/th...    386   4e-122   
ref|XP_010024468.1|  PREDICTED: receptor-like cytosolic serine/th...    389   4e-122   
ref|XP_010242571.1|  PREDICTED: autophagy-related protein 18h-like      409   4e-122   
ref|XP_002314438.2|  hypothetical protein POPTR_0010s02810g             384   6e-122   Populus trichocarpa [western balsam poplar]
gb|KHN33097.1|  Receptor-like cytosolic serine/threonine-protein ...    383   6e-122   
emb|CDY02597.1|  BnaC02g08380D                                          385   7e-122   
ref|XP_004145041.1|  PREDICTED: receptor-like cytosolic serine/th...    387   7e-122   
ref|XP_004164632.1|  PREDICTED: receptor-like cytosolic serine/th...    385   7e-122   
ref|XP_008458519.1|  PREDICTED: receptor-like cytosolic serine/th...    385   2e-121   
ref|XP_007147835.1|  hypothetical protein PHAVU_006G159100g             383   4e-121   
ref|XP_010941738.1|  PREDICTED: receptor-like cytosolic serine/th...    380   1e-120   
ref|XP_004298085.1|  PREDICTED: receptor-like cytosolic serine/th...    382   1e-120   
ref|XP_009386291.1|  PREDICTED: receptor-like cytosolic serine/th...    381   2e-120   
ref|XP_010941737.1|  PREDICTED: receptor-like cytosolic serine/th...    380   7e-120   
emb|CDY47188.1|  BnaAnng08580D                                          379   2e-119   
ref|XP_008340874.1|  PREDICTED: receptor-like cytosolic serine/th...    378   4e-119   
ref|XP_008790289.1|  PREDICTED: receptor-like cytosolic serine/th...    378   4e-119   
ref|XP_006846528.1|  hypothetical protein AMTR_s00018p00192760          379   5e-119   
ref|XP_006361909.1|  PREDICTED: receptor-like cytosolic serine/th...    374   2e-118   
ref|XP_010312381.1|  PREDICTED: receptor-like cytosolic serine/th...    374   3e-118   
ref|XP_010312379.1|  PREDICTED: receptor-like cytosolic serine/th...    374   6e-118   
ref|XP_008455275.1|  PREDICTED: receptor-like cytosolic serine/th...    374   7e-118   
ref|XP_010914352.1|  PREDICTED: receptor-like cytosolic serine/th...    374   2e-117   
ref|XP_010914353.1|  PREDICTED: receptor-like cytosolic serine/th...    373   2e-117   
ref|XP_004139200.1|  PREDICTED: receptor-like cytosolic serine/th...    371   3e-117   
ref|XP_004156435.1|  PREDICTED: receptor-like cytosolic serine/th...    371   3e-117   
ref|XP_009418073.1|  PREDICTED: receptor-like cytosolic serine/th...    370   4e-117   
gb|KFK24185.1|  hypothetical protein AALP_AAs68745U000500               369   5e-117   
gb|KGN60861.1|  hypothetical protein Csa_2G015850                       371   7e-117   
ref|XP_002270886.3|  PREDICTED: receptor-like cytosolic serine/th...    369   1e-116   Vitis vinifera
gb|KCW60918.1|  hypothetical protein EUGRSUZ_H03652                     372   1e-116   
gb|KHN37534.1|  Receptor-like cytosolic serine/threonine-protein ...    371   1e-116   
ref|XP_009772261.1|  PREDICTED: receptor-like cytosolic serine/th...    368   2e-116   
ref|XP_009772258.1|  PREDICTED: receptor-like cytosolic serine/th...    368   3e-116   
ref|XP_008449906.1|  PREDICTED: receptor-like cytosolic serine/th...    367   3e-116   
ref|XP_009335648.1|  PREDICTED: receptor-like cytosolic serine/th...    369   4e-116   
ref|XP_009626405.1|  PREDICTED: receptor-like cytosolic serine/th...    367   6e-116   
ref|XP_009626407.1|  PREDICTED: receptor-like cytosolic serine/th...    366   7e-116   
ref|XP_010693786.1|  PREDICTED: receptor-like cytosolic serine/th...    368   2e-115   
ref|XP_010539943.1|  PREDICTED: receptor-like cytosolic serine/th...    366   2e-115   
ref|XP_010070315.1|  PREDICTED: receptor-like cytosolic serine/th...    365   2e-115   
ref|XP_006433226.1|  hypothetical protein CICLE_v10001189mg             366   2e-115   
ref|XP_010660039.1|  PREDICTED: receptor-like cytosolic serine/th...    367   2e-115   
ref|XP_007199072.1|  hypothetical protein PRUPE_ppa018798mg             365   2e-115   
ref|XP_010693785.1|  PREDICTED: receptor-like cytosolic serine/th...    368   3e-115   
ref|XP_008370527.1|  PREDICTED: receptor-like cytosolic serine/th...    367   3e-115   
ref|XP_010693784.1|  PREDICTED: receptor-like cytosolic serine/th...    368   3e-115   
ref|XP_002524777.1|  ATP binding protein, putative                      367   3e-115   Ricinus communis
ref|XP_002264044.3|  PREDICTED: receptor-like cytosolic serine/th...    367   3e-115   Vitis vinifera
ref|XP_010660038.1|  PREDICTED: receptor-like cytosolic serine/th...    368   3e-115   
ref|XP_006358443.1|  PREDICTED: receptor-like cytosolic serine/th...    365   4e-115   
ref|XP_010070316.1|  PREDICTED: receptor-like cytosolic serine/th...    364   6e-115   
ref|XP_006480260.1|  PREDICTED: receptor-like cytosolic serine/th...    366   6e-115   
emb|CAN71781.1|  hypothetical protein VITISV_028676                     366   7e-115   Vitis vinifera
emb|CDP17987.1|  unnamed protein product                                366   1e-114   
gb|KDO48498.1|  hypothetical protein CISIN_1g013927mg                   363   1e-114   
ref|XP_004149635.1|  PREDICTED: receptor-like cytosolic serine/th...    363   1e-114   
gb|KDP40055.1|  hypothetical protein JCGZ_02053                         364   2e-114   
ref|XP_006444175.1|  hypothetical protein CICLE_v10020400mg             362   2e-114   
ref|XP_009626408.1|  PREDICTED: receptor-like cytosolic serine/th...    360   3e-114   
ref|XP_009589567.1|  PREDICTED: receptor-like cytosolic serine/th...    362   3e-114   
ref|XP_009589566.1|  PREDICTED: receptor-like cytosolic serine/th...    363   6e-114   
ref|XP_004247480.1|  PREDICTED: receptor-like cytosolic serine/th...    362   7e-114   
ref|XP_011079776.1|  PREDICTED: receptor-like cytosolic serine/th...    362   9e-114   
ref|XP_009760127.1|  PREDICTED: receptor-like cytosolic serine/th...    361   9e-114   
ref|XP_010112689.1|  Receptor-like cytosolic serine/threonine-pro...    360   1e-113   
ref|XP_002321047.1|  hypothetical protein POPTR_0014s13210g             360   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_009760126.1|  PREDICTED: receptor-like cytosolic serine/th...    362   2e-113   
ref|XP_011023515.1|  PREDICTED: receptor-like cytosolic serine/th...    360   2e-113   
ref|XP_009762353.1|  PREDICTED: receptor-like cytosolic serine/th...    360   2e-113   
ref|XP_008234942.1|  PREDICTED: receptor-like cytosolic serine/th...    360   3e-113   
ref|XP_011033655.1|  PREDICTED: receptor-like cytosolic serine/th...    359   3e-113   
ref|XP_011033653.1|  PREDICTED: receptor-like cytosolic serine/th...    359   4e-113   
ref|XP_007050718.1|  Kinase family protein                              359   5e-113   
emb|CDY37641.1|  BnaC04g29830D                                          358   6e-113   
ref|XP_002870457.1|  hypothetical protein ARALYDRAFT_355584             358   6e-113   
ref|XP_009124247.1|  PREDICTED: receptor-like cytosolic serine/th...    358   6e-113   
ref|XP_010025133.1|  PREDICTED: receptor-like cytosolic serine/th...    359   7e-113   
ref|XP_009124248.1|  PREDICTED: receptor-like cytosolic serine/th...    358   8e-113   
ref|XP_003553445.1|  PREDICTED: receptor-like cytosolic serine/th...    358   1e-112   
ref|XP_007030763.1|  Autophagy 18 H                                     382   1e-112   
ref|NP_198445.1|  receptor-like cytoplasmic kinase VIA5                 358   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023514.1|  PREDICTED: receptor-like cytosolic serine/th...    360   2e-112   
ref|XP_004290699.1|  PREDICTED: receptor-like cytosolic serine/th...    357   2e-112   
ref|XP_011013520.1|  PREDICTED: receptor-like cytosolic serine/th...    360   2e-112   
ref|XP_009607171.1|  PREDICTED: receptor-like cytosolic serine/th...    358   3e-112   
ref|XP_011013519.1|  PREDICTED: receptor-like cytosolic serine/th...    360   3e-112   
ref|XP_011023513.1|  PREDICTED: receptor-like cytosolic serine/th...    360   3e-112   
ref|XP_010684731.1|  PREDICTED: receptor-like cytosolic serine/th...    357   3e-112   
ref|XP_010326617.1|  PREDICTED: receptor-like cytosolic serine/th...    359   7e-112   
ref|XP_004302468.1|  PREDICTED: receptor-like cytosolic serine/th...    358   7e-112   
ref|XP_006375787.1|  hypothetical protein POPTR_0013s02930g             356   1e-111   
ref|XP_008340875.1|  PREDICTED: receptor-like cytosolic serine/th...    355   1e-111   
gb|KHG01854.1|  Receptor-like cytosolic serine/threonine-protein ...    356   1e-111   
ref|XP_004495756.1|  PREDICTED: receptor-like cytosolic serine/th...    358   1e-111   
gb|KHG16818.1|  Receptor-like cytosolic serine/threonine-protein ...    357   3e-111   
gb|KCW61724.1|  hypothetical protein EUGRSUZ_H04436                     353   2e-110   
ref|XP_010450428.1|  PREDICTED: receptor-like cytosolic serine/th...    352   2e-110   
ref|XP_006408109.1|  hypothetical protein EUTSA_v10021930mg             353   2e-110   
dbj|BAF79959.1|  receptor-like kinase                                   363   2e-110   Marchantia polymorpha
ref|XP_010440776.1|  PREDICTED: receptor-like cytosolic serine/th...    352   2e-110   
ref|XP_011082528.1|  PREDICTED: receptor-like cytosolic serine/th...    352   3e-110   
gb|EYU46634.1|  hypothetical protein MIMGU_mgv1a006736mg                352   3e-110   
ref|XP_006453346.1|  hypothetical protein CICLE_v10008604mg             350   4e-110   
gb|ADE76150.1|  unknown                                                 349   4e-110   
emb|CDP03583.1|  unnamed protein product                                350   5e-110   
ref|XP_007014242.1|  Somatic embryogenesis receptor kinase 1            350   6e-110   
ref|XP_006282623.1|  hypothetical protein CARUB_v10004896mg             351   7e-110   
gb|KDO43854.1|  hypothetical protein CISIN_1g016594mg                   350   8e-110   
ref|XP_002319033.2|  kinase family protein                              351   1e-109   Populus trichocarpa [western balsam poplar]
emb|CDY66762.1|  BnaCnng52260D                                          350   2e-109   
ref|XP_008789732.1|  PREDICTED: probable receptor-like serine/thr...    356   2e-109   
ref|XP_010913624.1|  PREDICTED: probable receptor-like serine/thr...    354   2e-109   
ref|XP_010435479.1|  PREDICTED: receptor-like cytosolic serine/th...    349   3e-109   
ref|XP_003555591.2|  PREDICTED: receptor-like cytosolic serine/th...    352   3e-109   
ref|XP_010913623.1|  PREDICTED: probable receptor-like serine/thr...    355   4e-109   
ref|XP_009108009.1|  PREDICTED: receptor-like cytosolic serine/th...    348   4e-109   
ref|XP_010684734.1|  PREDICTED: receptor-like cytosolic serine/th...    348   4e-109   
ref|XP_006300215.1|  hypothetical protein CARUB_v10016451mg             350   6e-109   
emb|CDY41754.1|  BnaA08g07090D                                          348   7e-109   
emb|CDY27793.1|  BnaA05g32020D                                          351   7e-109   
emb|CBI34325.3|  unnamed protein product                                349   9e-109   
ref|XP_009147272.1|  PREDICTED: receptor-like cytosolic serine/th...    350   1e-108   
ref|XP_010247702.1|  PREDICTED: probable receptor-like serine/thr...    346   2e-108   
ref|XP_003521228.1|  PREDICTED: receptor-like cytosolic serine/th...    347   2e-108   
ref|XP_011069925.1|  PREDICTED: probable receptor-like serine/thr...    346   3e-108   
ref|XP_008368893.1|  PREDICTED: receptor-like cytosolic serine/th...    346   4e-108   
ref|XP_008386577.1|  PREDICTED: receptor-like cytosolic serine/th...    347   4e-108   
ref|XP_010674985.1|  PREDICTED: receptor-like cytosolic serine/th...    348   5e-108   
ref|XP_010246898.1|  PREDICTED: probable receptor-like serine/thr...    353   5e-108   
ref|XP_010246897.1|  PREDICTED: probable receptor-like serine/thr...    353   6e-108   
emb|CDY40698.1|  BnaC03g34140D                                          347   6e-108   
emb|CDX74151.1|  BnaA03g28960D                                          347   7e-108   
ref|NP_187165.2|  receptor-like cytosolic serine/threonine-protei...    347   1e-107   
ref|XP_009604217.1|  PREDICTED: receptor-like cytosolic serine/th...    348   1e-107   
ref|XP_009604216.1|  PREDICTED: receptor-like cytosolic serine/th...    348   1e-107   
ref|XP_010524886.1|  PREDICTED: receptor-like cytosolic serine/th...    348   1e-107   
gb|EYU37320.1|  hypothetical protein MIMGU_mgv1a008035mg                343   2e-107   
ref|XP_010279251.1|  PREDICTED: LOW QUALITY PROTEIN: autophagy-re...    368   2e-107   
ref|XP_002972336.1|  hypothetical protein SELMODRAFT_34857              340   2e-107   
ref|XP_008223769.1|  PREDICTED: probable receptor-like serine/thr...    343   2e-107   
emb|CDY41938.1|  BnaC05g46660D                                          347   2e-107   
ref|XP_007223094.1|  hypothetical protein PRUPE_ppa007039mg             343   2e-107   
ref|XP_009134811.1|  PREDICTED: receptor-like cytosolic serine/th...    347   3e-107   
ref|XP_007162376.1|  hypothetical protein PHAVU_001G146800g             343   3e-107   
ref|XP_002971816.1|  hypothetical protein SELMODRAFT_96761              340   3e-107   
ref|XP_002884492.1|  kinase family protein                              345   3e-107   
ref|XP_002269944.1|  PREDICTED: probable receptor-like serine/thr...    343   4e-107   
ref|XP_010435478.1|  PREDICTED: receptor-like cytosolic serine/th...    343   4e-107   
ref|XP_010423838.1|  PREDICTED: receptor-like cytosolic serine/th...    347   4e-107   
ref|XP_009760982.1|  PREDICTED: receptor-like cytosolic serine/th...    347   5e-107   
ref|XP_008782089.1|  PREDICTED: probable receptor-like serine/thr...    349   5e-107   
ref|XP_006356730.1|  PREDICTED: receptor-like cytosolic serine/th...    347   5e-107   
gb|AES61303.2|  receptor-like cytosolic Serine/Threonine-kinase         344   2e-106   
ref|XP_010674984.1|  PREDICTED: receptor-like cytosolic serine/th...    344   2e-106   
gb|KHG02982.1|  hypothetical protein F383_01732                         340   2e-106   
ref|XP_011079437.1|  PREDICTED: probable receptor-like serine/thr...    347   3e-106   
ref|XP_011043948.1|  PREDICTED: probable receptor-like serine/thr...    340   3e-106   
ref|XP_010485916.1|  PREDICTED: receptor-like cytosolic serine/th...    345   4e-106   
ref|XP_003535352.2|  PREDICTED: receptor-like cytosolic serine/th...    344   5e-106   
ref|XP_006395925.1|  hypothetical protein EUTSA_v10005419mg             336   6e-106   
ref|XP_010046976.1|  PREDICTED: probable receptor-like serine/thr...    339   7e-106   
gb|KHN20194.1|  Receptor-like cytosolic serine/threonine-protein ...    343   7e-106   
ref|XP_006827856.1|  hypothetical protein AMTR_s00008p00064820          349   8e-106   
ref|XP_010464025.1|  PREDICTED: receptor-like cytosolic serine/th...    343   8e-106   
ref|XP_010323534.1|  PREDICTED: receptor-like cytosolic serine/th...    342   9e-106   
gb|EYU34283.1|  hypothetical protein MIMGU_mgv1a021069mg                345   1e-105   
ref|XP_008388607.1|  PREDICTED: receptor-like cytosolic serine/th...    342   1e-105   
ref|XP_003591052.1|  Cysteine-rich receptor-like protein kinase         343   1e-105   
ref|XP_010656799.1|  PREDICTED: probable receptor-like serine/thr...    346   1e-105   
ref|XP_010322269.1|  PREDICTED: receptor-like cytosolic serine/th...    338   1e-105   
dbj|BAK05434.1|  predicted protein                                      345   2e-105   
ref|XP_006830110.1|  hypothetical protein AMTR_s00328p00014720          338   2e-105   
ref|XP_006365273.1|  PREDICTED: receptor-like cytosolic serine/th...    341   3e-105   
gb|AES82551.2|  receptor-like cytosolic Serine/Threonine-kinase         339   3e-105   
ref|XP_011009414.1|  PREDICTED: probable receptor-like serine/thr...    337   3e-105   
ref|XP_004296444.1|  PREDICTED: probable receptor-like serine/thr...    337   6e-105   
gb|KEH43274.1|  receptor-like cytosolic Serine/Threonine-kinase         338   6e-105   
ref|XP_009772472.1|  PREDICTED: receptor-like cytosolic serine/th...    340   7e-105   
ref|XP_002444116.1|  hypothetical protein SORBIDRAFT_07g008540          344   8e-105   
ref|XP_004496060.1|  PREDICTED: receptor-like cytosolic serine/th...    337   8e-105   
gb|EMT06955.1|  Putative LRR receptor-like serine/threonine-prote...    342   9e-105   
emb|CDO98948.1|  unnamed protein product                                340   1e-104   
ref|XP_009602695.1|  PREDICTED: receptor-like cytosolic serine/th...    340   1e-104   
ref|XP_007014101.1|  LRR receptor-like serine/threonine-protein k...    343   2e-104   
ref|XP_004973093.1|  PREDICTED: probable receptor-like serine/thr...    343   2e-104   
ref|XP_006577262.1|  PREDICTED: receptor-like cytosolic serine/th...    337   2e-104   
emb|CAT79821.1|  Rop-interacting receptor-like cytoplasmic kinase 2     337   2e-104   
emb|CDP02933.1|  unnamed protein product                                351   2e-104   
ref|XP_004973092.1|  PREDICTED: probable receptor-like serine/thr...    343   2e-104   
ref|XP_001755105.1|  predicted protein                                  333   2e-104   
ref|XP_003518937.1|  PREDICTED: receptor-like cytosolic serine/th...    337   2e-104   
ref|XP_006600504.1|  PREDICTED: probable receptor-like serine/thr...    343   2e-104   
ref|XP_008246538.1|  PREDICTED: receptor-like cytosolic serine/th...    338   2e-104   
ref|XP_003550670.1|  PREDICTED: probable receptor-like serine/thr...    343   2e-104   
ref|XP_008246537.1|  PREDICTED: receptor-like cytosolic serine/th...    339   2e-104   
ref|XP_011090894.1|  PREDICTED: receptor-like cytosolic serine/th...    339   2e-104   
ref|XP_008360512.1|  PREDICTED: probable receptor-like serine/thr...    335   3e-104   
emb|CDY70924.1|  BnaAnng35550D                                          335   3e-104   
ref|XP_008366942.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    340   3e-104   
ref|XP_007035414.1|  Kinase superfamily protein isoform 3               335   3e-104   
ref|XP_002325042.1|  hypothetical protein POPTR_0018s09860g             333   4e-104   
gb|KDP43801.1|  hypothetical protein JCGZ_23009                         342   4e-104   
gb|KHN17563.1|  Putative receptor-like serine/threonine-protein k...    342   5e-104   
gb|ACF86575.1|  unknown                                                 334   5e-104   
ref|XP_008661873.1|  PREDICTED: ATP binding protein isoform X1          341   6e-104   
ref|XP_008661875.1|  PREDICTED: ATP binding protein isoform X2          341   6e-104   
gb|AFW56858.1|  putative protein kinase superfamily protein             341   6e-104   
ref|XP_006593554.1|  PREDICTED: probable receptor-like serine/thr...    341   7e-104   
ref|XP_003543756.1|  PREDICTED: probable receptor-like serine/thr...    341   7e-104   
ref|XP_009379615.1|  PREDICTED: probable receptor-like serine/thr...    334   7e-104   
ref|XP_008451864.1|  PREDICTED: probable receptor-like serine/thr...    341   8e-104   
gb|EPS72997.1|  hypothetical protein M569_01758                         333   8e-104   
ref|NP_001136568.1|  uncharacterized LOC100216690                       333   1e-103   
ref|NP_001147093.1|  ATP binding protein                                341   1e-103   
gb|KFK40270.1|  hypothetical protein AALP_AA3G353000                    334   1e-103   
ref|XP_002512317.1|  ATP binding protein, putative                      335   1e-103   
ref|XP_007144583.1|  hypothetical protein PHAVU_007G168000g             334   1e-103   
gb|EEC83194.1|  hypothetical protein OsI_28446                          340   1e-103   
ref|XP_001769435.1|  predicted protein                                  332   1e-103   
ref|NP_001061370.1|  Os08g0249100                                       340   1e-103   
ref|XP_007154747.1|  hypothetical protein PHAVU_003G144200g             333   2e-103   
ref|XP_002325078.2|  hypothetical protein POPTR_0018s10520g             340   2e-103   
ref|XP_003536371.1|  PREDICTED: receptor-like cytosolic serine/th...    334   2e-103   
gb|KDP35357.1|  hypothetical protein JCGZ_10341                         333   2e-103   
gb|KHG15349.1|  hypothetical protein F383_17411                         340   2e-103   
ref|NP_179479.1|  putative receptor-like kinase                         333   3e-103   
ref|XP_002447242.1|  hypothetical protein SORBIDRAFT_06g031130          332   3e-103   
ref|XP_006659248.1|  PREDICTED: probable receptor-like serine/thr...    339   3e-103   
ref|XP_004150333.1|  PREDICTED: probable receptor-like serine/thr...    340   4e-103   
ref|XP_010688473.1|  PREDICTED: probable receptor-like serine/thr...    332   5e-103   
ref|XP_004146324.1|  PREDICTED: probable receptor-like serine/thr...    332   5e-103   
ref|XP_010548616.1|  PREDICTED: receptor-like cytosolic serine/th...    332   6e-103   
ref|XP_008453594.1|  PREDICTED: probable receptor-like serine/thr...    332   6e-103   
ref|XP_007035413.1|  Kinase superfamily protein isoform 2               331   6e-103   
ref|XP_011043949.1|  PREDICTED: probable receptor-like serine/thr...    331   9e-103   
ref|XP_010111877.1|  Receptor-like cytosolic serine/threonine-pro...    333   1e-102   
ref|XP_009418184.1|  PREDICTED: probable receptor-like serine/thr...    338   1e-102   
ref|NP_001238599.1|  protein kinase family protein                      330   2e-102   
emb|CBI17761.3|  unnamed protein product                                345   2e-102   
ref|XP_008364350.1|  PREDICTED: probable receptor-like serine/thr...    337   2e-102   
ref|XP_009112565.1|  PREDICTED: receptor-like cytosolic serine/th...    330   3e-102   
ref|XP_009799764.1|  PREDICTED: probable receptor-like serine/thr...    336   3e-102   
ref|XP_010048688.1|  PREDICTED: probable receptor-like serine/thr...    337   4e-102   
ref|XP_010102981.1|  putative receptor-like serine/threonine-prot...    337   6e-102   
gb|KDO62429.1|  hypothetical protein CISIN_1g008650mg                   335   6e-102   
emb|CDY52583.1|  BnaCnng22680D                                          329   7e-102   
ref|XP_009799763.1|  PREDICTED: probable receptor-like serine/thr...    336   7e-102   
ref|XP_003573609.1|  PREDICTED: probable receptor-like serine/thr...    336   8e-102   
emb|CDY30299.1|  BnaA09g09780D                                          329   8e-102   
gb|EPS68618.1|  hypothetical protein M569_06148                         331   9e-102   
ref|XP_006409107.1|  hypothetical protein EUTSA_v10022722mg             328   1e-101   
ref|XP_010094220.1|  putative receptor-like serine/threonine-prot...    328   1e-101   
ref|XP_011018161.1|  PREDICTED: probable receptor-like serine/thr...    335   1e-101   
ref|XP_008803599.1|  PREDICTED: probable receptor-like serine/thr...    328   1e-101   
ref|XP_006381845.1|  hypothetical protein POPTR_0006s18770g             336   1e-101   
ref|XP_007154802.1|  hypothetical protein PHAVU_003G149100g             335   1e-101   
ref|XP_006474137.1|  PREDICTED: probable receptor-like serine/thr...    335   1e-101   
ref|XP_004960127.1|  PREDICTED: probable receptor-like serine/thr...    328   1e-101   
ref|XP_006474136.1|  PREDICTED: probable receptor-like serine/thr...    335   1e-101   
ref|XP_004507866.1|  PREDICTED: probable receptor-like serine/thr...    328   1e-101   
gb|KHN46612.1|  Receptor-like cytosolic serine/threonine-protein ...    330   1e-101   
ref|XP_007154801.1|  hypothetical protein PHAVU_003G149100g             335   2e-101   
ref|XP_009610324.1|  PREDICTED: probable receptor-like serine/thr...    328   2e-101   
ref|XP_008449911.1|  PREDICTED: receptor-like cytosolic serine/th...    328   2e-101   
ref|XP_007144767.1|  hypothetical protein PHAVU_007G183000g             331   2e-101   
gb|KEH32562.1|  receptor-like kinase                                    334   2e-101   
ref|XP_010525724.1|  PREDICTED: receptor-like cytosolic serine/th...    327   2e-101   
ref|XP_009608072.1|  PREDICTED: probable receptor-like serine/thr...    334   2e-101   
ref|XP_009384851.1|  PREDICTED: probable receptor-like serine/thr...    336   2e-101   
gb|AES92390.2|  receptor-like kinase                                    334   2e-101   
ref|XP_011012684.1|  PREDICTED: probable receptor-like serine/thr...    335   3e-101   
ref|XP_010246899.1|  PREDICTED: probable receptor-like serine/thr...    335   3e-101   
emb|CDY49301.1|  BnaA07g01660D                                          327   3e-101   
ref|XP_011012683.1|  PREDICTED: probable receptor-like serine/thr...    334   3e-101   
ref|XP_010914159.1|  PREDICTED: probable receptor-like serine/thr...    327   5e-101   
ref|XP_010414828.1|  PREDICTED: probable receptor-like serine/thr...    327   5e-101   
ref|XP_009608071.1|  PREDICTED: probable receptor-like serine/thr...    334   6e-101   
ref|XP_003610193.1|  Nodulation receptor kinase                         334   7e-101   
ref|XP_006453444.1|  hypothetical protein CICLE_v10007784mg             333   7e-101   
ref|XP_007147092.1|  hypothetical protein PHAVU_006G095700g             327   8e-101   
ref|XP_003541291.1|  PREDICTED: probable receptor-like serine/thr...    326   9e-101   
gb|KCW61725.1|  hypothetical protein EUGRSUZ_H04436                     324   1e-100   
ref|XP_002886254.1|  kinase family protein                              326   1e-100   
emb|CDP02990.1|  unnamed protein product                                325   2e-100   
ref|XP_009767226.1|  PREDICTED: probable receptor-like serine/thr...    325   2e-100   
ref|XP_009403317.1|  PREDICTED: probable receptor-like serine/thr...    325   2e-100   
ref|XP_010928966.1|  PREDICTED: probable receptor-like serine/thr...    332   3e-100   
ref|XP_008341187.1|  PREDICTED: probable receptor-like serine/thr...    332   4e-100   
ref|XP_009401300.1|  PREDICTED: probable receptor-like serine/thr...    325   6e-100   
emb|CDY49535.1|  BnaCnng17590D                                          323   9e-100   
ref|XP_003610091.1|  Receptor-like protein kinase                       323   1e-99    
ref|XP_004507811.1|  PREDICTED: probable receptor-like serine/thr...    330   1e-99    
ref|XP_003533716.1|  PREDICTED: probable receptor-like serine/thr...    322   1e-99    
ref|XP_009102214.1|  PREDICTED: receptor-like cytosolic serine/th...    323   1e-99    
ref|XP_003546407.1|  PREDICTED: probable receptor-like serine/thr...    322   2e-99    
gb|KHN45232.1|  Putative receptor-like serine/threonine-protein k...    322   3e-99    
gb|KHN05236.1|  Putative receptor-like serine/threonine-protein k...    322   3e-99    
ref|XP_008391634.1|  PREDICTED: probable receptor-like serine/thr...    322   4e-99    
emb|CAT79815.1|  Rop-interacting receptor-like cytoplasmic kinase 1     322   4e-99    
ref|XP_010323234.1|  PREDICTED: probable receptor-like serine/thr...    328   7e-99    
ref|XP_002964491.1|  hypothetical protein SELMODRAFT_64103              318   8e-99    
ref|XP_009373952.1|  PREDICTED: autophagy-related protein 18h-like      343   8e-99    
ref|XP_009379507.1|  PREDICTED: probable receptor-like serine/thr...    327   1e-98    
ref|XP_007224135.1|  hypothetical protein PRUPE_ppa015992mg             328   1e-98    
ref|XP_009401570.1|  PREDICTED: probable receptor-like serine/thr...    320   1e-98    
ref|XP_009380757.1|  PREDICTED: probable receptor-like serine/thr...    320   1e-98    
ref|XP_010548617.1|  PREDICTED: receptor-like cytosolic serine/th...    320   1e-98    
ref|XP_006365790.1|  PREDICTED: probable receptor-like serine/thr...    320   1e-98    
ref|XP_006343698.1|  PREDICTED: probable receptor-like serine/thr...    328   2e-98    
ref|XP_004242921.1|  PREDICTED: probable receptor-like serine/thr...    320   2e-98    
ref|XP_009403314.1|  PREDICTED: probable receptor-like serine/thr...    320   2e-98    
ref|XP_009339817.1|  PREDICTED: probable receptor-like serine/thr...    327   2e-98    
ref|XP_009767227.1|  PREDICTED: probable receptor-like serine/thr...    319   2e-98    
ref|XP_008777872.1|  PREDICTED: probable receptor-like serine/thr...    320   3e-98    
ref|XP_002992033.1|  hypothetical protein SELMODRAFT_134626             317   3e-98    
ref|XP_007205307.1|  hypothetical protein PRUPE_ppa006797mg             319   4e-98    
ref|XP_010483298.1|  PREDICTED: probable receptor-like serine/thr...    318   4e-98    
ref|XP_010536938.1|  PREDICTED: probable receptor-like serine/thr...    325   9e-98    
gb|EYU37057.1|  hypothetical protein MIMGU_mgv1a019230mg                320   9e-98    
ref|XP_001753490.1|  predicted protein                                  315   9e-98    
ref|XP_009767225.1|  PREDICTED: probable receptor-like serine/thr...    318   1e-97    
ref|XP_007138821.1|  hypothetical protein PHAVU_009G240100g             317   2e-97    
ref|XP_006296800.1|  hypothetical protein CARUB_v10016403mg             316   2e-97    
ref|XP_008236289.1|  PREDICTED: receptor-like cytosolic serine/th...    317   3e-97    
ref|XP_003626333.1|  Cysteine-rich receptor-like protein kinase         318   3e-97    
ref|XP_010929257.1|  PREDICTED: probable receptor-like serine/thr...    317   3e-97    
gb|KHN16156.1|  Receptor-like cytosolic serine/threonine-protein ...    317   4e-97    
gb|EEC78158.1|  hypothetical protein OsI_17722                          317   5e-97    
ref|XP_004297866.1|  PREDICTED: probable receptor-like serine/thr...    327   6e-97    
ref|XP_003580715.1|  PREDICTED: probable receptor-like serine/thr...    316   7e-97    
ref|NP_001054111.1|  Os04g0654600                                       316   8e-97    
ref|XP_010467729.1|  PREDICTED: receptor-like cytosolic serine/th...    313   1e-96    
emb|CAH66699.1|  OSIGBa0147J19.3                                        313   2e-96    
ref|XP_010443468.1|  PREDICTED: probable receptor-like serine/thr...    321   3e-96    
ref|XP_009394888.1|  PREDICTED: probable receptor-like serine/thr...    314   3e-96    
emb|CAE01551.2|  OSJNBb0022F16.6                                        313   3e-96    



>gb|EYU39291.1| hypothetical protein MIMGU_mgv1a005069mg [Erythranthe guttata]
Length=498

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/394 (68%), Positives = 327/394 (83%), Gaps = 8/394 (2%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPL---FGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT  1310
             TA+QWK +F Q+K+K+   F  +PL   +G+D+ +K+ R     +  + D IDCG+F + 
Sbjct  106   TALQWKKMFGQMKKKTPMKFSTIPLLAGYGYDLSKKAFRRPLGRNHSAADAIDCGEFVVP  165

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNFT +EL QATD+FS E ++GKGGHAEVYKG L DGQV+AVK+IIK+ K DE+++
Sbjct  166   KPSWRNFTYEELKQATDDFSPEKLIGKGGHAEVYKGLLPDGQVVAVKKIIKQQKNDEDKV  225

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
              DFLSELGIIAHI+HPN AKLIGFSAD GLHLVL++ PHGSLA +LH + E LEWKIR+K
Sbjct  226   GDFLSELGIIAHIDHPNTAKLIGFSADRGLHLVLKFSPHGSLATVLHGSDENLEWKIRYK  285

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VA+G+AEGL YLHC CQRRIIHRDITASNILL EDY  QISDFGLAKWLPEKW HHVVSP
Sbjct  286   VAIGIAEGLQYLHCDCQRRIIHRDITASNILLCEDYQPQISDFGLAKWLPEKWLHHVVSP  345

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGYMAPEYFMHG+V EKTDVFAFGVLLLELITGR+AVDSSRQSLVMWAKPLLE+NN
Sbjct  346   IEGTFGYMAPEYFMHGVVHEKTDVFAFGVLLLELITGRRAVDSSRQSLVMWAKPLLEKNN  405

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS-  413
             +KE+ADP+LG+ Y+V+EM+R+MF A  CI HLPNMRPNM +VV+VL+GE+E  V+++Q  
Sbjct  406   VKEIADPKLGEDYEVIEMKRAMFAASICIHHLPNMRPNMTRVVQVLRGEHE-AVDMKQKS  464

Query  412   ---KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                +++  +S  + D+TST+Y K L RH++L+ME
Sbjct  465   MGMRALLWDSCDLEDYTSTTYLKDLSRHMELVME  498



>emb|CDP01575.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/404 (67%), Positives = 329/404 (81%), Gaps = 10/404 (2%)
 Frame = -3

Query  1507  GGSGGGF-DPTAVQWKSIFDQIKRKSAKSFPIVPLF--GHDIIRKSRRMFFSWSRCSEDN  1337
             GG+GG   D   VQWK++FD  K++S + F +VPL   G +  +KS R     +  +E++
Sbjct  84    GGTGGSSKDGHVVQWKNLFDNFKKRSVRRFSVVPLLWVGQEFTKKSGRRKLGRNCSAEES  143

Query  1336  IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
             IDCGD  + KPSWRNF+ QEL+++TDNFSS+ ++GKGGHAEVYKG L DGQ++AVKRI K
Sbjct  144   IDCGDMIVPKPSWRNFSYQELAESTDNFSSDKLIGKGGHAEVYKGFLPDGQIVAVKRITK  203

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
             ++K DE+R+ DFLSELGIIAHINHPNAAKLIGFS D+GLHLVLQ+LPHGSLA +LH + E
Sbjct  204   KEKNDEDRVGDFLSELGIIAHINHPNAAKLIGFSVDSGLHLVLQFLPHGSLASVLHGSAE  263

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              LEWK R+KVAVGVAEGL YLHC CQRRIIHRDITASNILL EDY  QISDFGLAKWLPE
Sbjct  264   NLEWKTRYKVAVGVAEGLQYLHCECQRRIIHRDITASNILLAEDYEPQISDFGLAKWLPE  323

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             KW HHVVSPIEGTFGY+APEYFMHGIV EKTDVFAFGVLLLELITGR+AVDSSRQSLVMW
Sbjct  324   KWAHHVVSPIEGTFGYLAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSSRQSLVMW  383

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLLE+NN KELADP LG  YD  EM R+MF A +CI HLP++RP+MK+VV++LKGE E
Sbjct  384   AKPLLEKNNAKELADPCLGGKYDAAEMNRAMFTASTCIHHLPSLRPSMKRVVQLLKGEKE  443

Query  436   LKVELRQSKSVSSESL-----HIADFTSTSYRKHLDRHLQLIME  320
               +E++Q KS+   +L      + +++ T+Y K L+RH++L+ME
Sbjct  444   -ALEVKQ-KSMGGRALLLDACDLEEYSCTTYLKDLNRHMELLME  485



>ref|XP_009768507.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Nicotiana sylvestris]
Length=507

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/394 (68%), Positives = 323/394 (82%), Gaps = 10/394 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKS---RRMFFSWSRCSEDNIDCGDFSIT  1310
             + +K+ FDQ+K+KS +    + LFG   +++ K    R++        ED IDC DF + 
Sbjct  115   LSFKNFFDQMKKKSIRRLSTIQLFGGYENLLPKKNIKRKLLARIRSAEEDRIDCHDFVVP  174

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNF+  EL+QATDNF+ +N++GKGGHAEVYKG L DGQV+AVK+I K++K DE+R+
Sbjct  175   KPSWRNFSFDELAQATDNFTPDNLIGKGGHAEVYKGHLPDGQVVAVKKITKKEKNDEDRV  234

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
              DFLSELGIIAHIN+PNA KLIGFS D GLHLVLQYL HGSLA +LH   E LEWKIR+K
Sbjct  235   GDFLSELGIIAHINNPNAVKLIGFSVDGGLHLVLQYLQHGSLASVLHGREECLEWKIRYK  294

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VAVGVAEGL YLH  CQRRIIHRDITASNILLTEDY  QISDFGLAKWLPEKW HH+VSP
Sbjct  295   VAVGVAEGLRYLHSDCQRRIIHRDITASNILLTEDYEPQISDFGLAKWLPEKWAHHIVSP  354

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGYMAPEYFMHGIV EKTDVFAFGVLLLELITGR+AVDSSRQSLVMWAKP+LE+NN
Sbjct  355   IEGTFGYMAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSSRQSLVMWAKPMLEKNN  414

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS-  413
             IKELADPRLGDAYD+VEM+R+MF A +CI HLPNMRPNMK+ V++LKGENE  ++++Q  
Sbjct  415   IKELADPRLGDAYDIVEMKRAMFTASTCIHHLPNMRPNMKRAVQLLKGENE-PIDMKQKS  473

Query  412   ---KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                +S+  ++    D+++T+Y K L+RH+QL+ME
Sbjct  474   TGGRSLMLDACDFDDYSNTTYLKDLNRHMQLVME  507



>ref|XP_010312655.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Solanum lycopersicum]
Length=504

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/395 (69%), Positives = 328/395 (83%), Gaps = 10/395 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLF-GHDII---RKSRRMFFSWSRCSED-NIDCGDFSI  1313
              +++K++FDQ+KRKS +    +PL  G++ +   +  +R   S  R +E+  IDC DF +
Sbjct  111   GLRFKNLFDQMKRKSIRRLSAIPLLVGYENLLAKKNIKRKLLSRIRSAEEETIDCHDFVV  170

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
              KPSWRNF+L EL+QATDNFS +N++GKGGHAEVYKG L DGQV+AVK+I K++K DE+R
Sbjct  171   PKPSWRNFSLDELAQATDNFSPDNLIGKGGHAEVYKGHLQDGQVVAVKKITKKEKNDEDR  230

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRF  953
             + DFLSELGIIAHIN+ NAAKLIGFS D GLHLVLQYL HGSLA +LH   E LEWKIR+
Sbjct  231   VGDFLSELGIIAHINNTNAAKLIGFSVDGGLHLVLQYLHHGSLASVLHGREECLEWKIRY  290

Query  952   KVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVS  773
             KVAVGVAEGL YLHC CQRRIIHRDITASNILLTEDY  QISDFGLAKWLPEKW HH+VS
Sbjct  291   KVAVGVAEGLRYLHCDCQRRIIHRDITASNILLTEDYEPQISDFGLAKWLPEKWVHHIVS  350

Query  772   PIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQN  593
             PIEGTFGYMAPEYFMHGIV EKTDVFAFGVLLLELITGR+AVDSSRQSLVM AKPLLEQN
Sbjct  351   PIEGTFGYMAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSSRQSLVMSAKPLLEQN  410

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS  413
             N+KELADPRLGDAYDVVEM+R+MF A +CI HLPNMRPNM + V++LKGEN L ++++Q 
Sbjct  411   NVKELADPRLGDAYDVVEMKRAMFTASTCIHHLPNMRPNMIRAVQLLKGEN-LPIDMKQK  469

Query  412   ----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                 +++  ++  + D++ST+Y K L+RH+QL+ME
Sbjct  470   STGGRALMLDACDLEDYSSTTYLKDLNRHMQLVME  504



>ref|XP_009615440.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Nicotiana tomentosiformis]
Length=510

 Score =   536 bits (1382),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 267/395 (68%), Positives = 322/395 (82%), Gaps = 10/395 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKS---RRMFFSWSRCSEDNIDCGDFSI  1313
              + +K+ FDQ+K+KS +    + LFG   +++ K    R++        ED IDC DF +
Sbjct  117   GLSFKNFFDQMKKKSIRRLSTIQLFGGYENLLPKKNIKRKLLARIRSAEEDRIDCHDFVV  176

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
              KPSWRNF+  EL+QATDNF+ +N++GKGGHAEVYKG L DGQV+AVK+I K++K DE+R
Sbjct  177   PKPSWRNFSFDELAQATDNFTPDNLIGKGGHAEVYKGHLPDGQVVAVKKITKKEKNDEDR  236

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRF  953
             + DFLSELGIIAHIN+PNA KLIGFS D GLHLVLQYL HGSLA +LH   E LEWKIR+
Sbjct  237   VGDFLSELGIIAHINNPNAVKLIGFSVDGGLHLVLQYLQHGSLASVLHGREECLEWKIRY  296

Query  952   KVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVS  773
             KVAVGVAEGL YLH  CQRRIIHRDITASNILLTEDY  QISDFGLAKWLPEKW HH+VS
Sbjct  297   KVAVGVAEGLRYLHSDCQRRIIHRDITASNILLTEDYEPQISDFGLAKWLPEKWAHHIVS  356

Query  772   PIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQN  593
             PIEGTFGYMAPEYFMHGIV EKTDVFAFGVLLLELITGR+AVDSSRQSLVMWAKP+LE+N
Sbjct  357   PIEGTFGYMAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSSRQSLVMWAKPMLEKN  416

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS  413
             NIKELADPRL D YDV+EM+R+MF A +CI HLPNMRPNMK+ V++LKGENE  ++++Q 
Sbjct  417   NIKELADPRLLDTYDVIEMKRAMFTASTCIHHLPNMRPNMKRAVQLLKGENE-PIDMKQK  475

Query  412   ----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                 +S+  ++  + D+++T+Y K L+RH+QL+ME
Sbjct  476   STGGRSLMLDACDLDDYSNTTYLKDLNRHMQLVME  510



>ref|XP_011097466.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Sesamum indicum]
Length=489

 Score =   535 bits (1379),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 269/391 (69%), Positives = 323/391 (83%), Gaps = 5/391 (1%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             AV  K +F QIKR+SA S   +P+ G+DI +K+ +     +  SE++IDC +  + KPSW
Sbjct  99    AVHLKKLFGQIKRRSAMSITSIPIIGYDISKKAFKRKLGRNNSSEESIDCDELVVPKPSW  158

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNFT  EL QATDNFSS+ +LGKGGHAEVYKG L DG V+AVK+I KE+KK+E+R+ DFL
Sbjct  159   RNFTYAELKQATDNFSSDKLLGKGGHAEVYKGFLPDGHVVAVKKITKEEKKNEDRVGDFL  218

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAHI+HPN AKLIGFS+D GLHLVLQ+ PHGSL  +LH + E+L+W +R+KVA+G
Sbjct  219   TELGIIAHIDHPNTAKLIGFSSDGGLHLVLQFSPHGSLGTVLHGSGESLDWNLRYKVALG  278

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             +AEGL YLHC CQRRIIHRDITASNILL+EDY AQISDFGLAKWLPEKW HHVVSPIEGT
Sbjct  279   IAEGLKYLHCDCQRRIIHRDITASNILLSEDYDAQISDFGLAKWLPEKWLHHVVSPIEGT  338

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGYMAPEYFMHGIV EKTDVFAFGVLLLELITGR+AVDSS+QSLVMWAKPLLEQNNIKE+
Sbjct  339   FGYMAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSSQQSLVMWAKPLLEQNNIKEV  398

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE-LKVELRQS----  413
             ADPRLG+ Y V+EM+R+MF A  CI HLPNMRPNM +VV+VLKGE+E L ++ +Q     
Sbjct  399   ADPRLGENYSVIEMKRAMFAAFICIHHLPNMRPNMPRVVQVLKGEHEPLDMKNKQKSMGM  458

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             K++  ES  + D+TST+Y   L+RH +LIME
Sbjct  459   KALLWESCDLEDYTSTTYLNDLNRHKELIME  489



>ref|XP_006353160.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Solanum tuberosum]
Length=502

 Score =   535 bits (1377),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 270/395 (68%), Positives = 328/395 (83%), Gaps = 10/395 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLF-GHDII---RKSRRMFFSWSRCSED-NIDCGDFSI  1313
              +++K++FDQ+KRKS +    +PL  G++ +   +  +R   S  R +E+  IDC DF +
Sbjct  109   GLRFKNLFDQMKRKSIRRLSAIPLLIGYENLLAKKNIKRKLLSRIRSAEEETIDCHDFVV  168

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
              KPSWRNF+L EL+QAT+NFS +N++GKGGHAEVYKG L DGQV+AVK+I K++K DE+R
Sbjct  169   PKPSWRNFSLDELAQATNNFSPDNLIGKGGHAEVYKGHLQDGQVVAVKKITKKEKNDEDR  228

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRF  953
             + DFLSELGIIAHIN+ NAAKLIGFS D GLHLVLQYL HGSL+ +LH   E LEWKIR+
Sbjct  229   VGDFLSELGIIAHINNTNAAKLIGFSVDGGLHLVLQYLHHGSLSSVLHGREECLEWKIRY  288

Query  952   KVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVS  773
             KVAVGVAEGL YLHC CQRRIIHRDITASNILLTEDY  QISDFGLAKWLPEKW HH+VS
Sbjct  289   KVAVGVAEGLCYLHCDCQRRIIHRDITASNILLTEDYEPQISDFGLAKWLPEKWVHHIVS  348

Query  772   PIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQN  593
             PIEGTFGYMAPEYFMHGIV EKTDVFAFGVLLLELITGR+AVDSSRQSLVM AKP+LEQN
Sbjct  349   PIEGTFGYMAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSSRQSLVMSAKPMLEQN  408

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS  413
             N+KELADPRLGDAYDVVEM+R+MF A +CI HLPNMRPNM + V++LKGEN L ++++Q 
Sbjct  409   NVKELADPRLGDAYDVVEMKRAMFTASTCIHHLPNMRPNMIRAVQLLKGEN-LPIDMKQK  467

Query  412   ----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                 +++  ++  + D++ST+Y K L+RH+QL+ME
Sbjct  468   STGGRALMLDACDLEDYSSTTYLKDLNRHMQLVME  502



>ref|XP_004250155.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Solanum lycopersicum]
Length=510

 Score =   533 bits (1373),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 273/401 (68%), Positives = 328/401 (82%), Gaps = 16/401 (4%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLF-GHDII---RKSRRMFFSWSRCSED-NIDCGDFSI  1313
              +++K++FDQ+KRKS +    +PL  G++ +   +  +R   S  R +E+  IDC DF +
Sbjct  111   GLRFKNLFDQMKRKSIRRLSAIPLLVGYENLLAKKNIKRKLLSRIRSAEEETIDCHDFVV  170

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
              KPSWRNF+L EL+QATDNFS +N++GKGGHAEVYKG L DGQV+AVK+I K++K DE+R
Sbjct  171   PKPSWRNFSLDELAQATDNFSPDNLIGKGGHAEVYKGHLQDGQVVAVKKITKKEKNDEDR  230

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA------TETL  971
             + DFLSELGIIAHIN+ NAAKLIGFS D GLHLVLQYL HGSLA +LH         E L
Sbjct  231   VGDFLSELGIIAHINNTNAAKLIGFSVDGGLHLVLQYLHHGSLASVLHGELSISGREECL  290

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
             EWKIR+KVAVGVAEGL YLHC CQRRIIHRDITASNILLTEDY  QISDFGLAKWLPEKW
Sbjct  291   EWKIRYKVAVGVAEGLRYLHCDCQRRIIHRDITASNILLTEDYEPQISDFGLAKWLPEKW  350

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              HH+VSPIEGTFGYMAPEYFMHGIV EKTDVFAFGVLLLELITGR+AVDSSRQSLVM AK
Sbjct  351   VHHIVSPIEGTFGYMAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSSRQSLVMSAK  410

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELK  431
             PLLEQNN+KELADPRLGDAYDVVEM+R+MF A +CI HLPNMRPNM + V++LKGEN L 
Sbjct  411   PLLEQNNVKELADPRLGDAYDVVEMKRAMFTASTCIHHLPNMRPNMIRAVQLLKGEN-LP  469

Query  430   VELRQS----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             ++++Q     +++  ++  + D++ST+Y K L+RH+QL+ME
Sbjct  470   IDMKQKSTGGRALMLDACDLEDYSSTTYLKDLNRHMQLVME  510



>ref|XP_009623354.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Nicotiana tomentosiformis]
Length=474

 Score =   529 bits (1363),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 268/391 (69%), Positives = 329/391 (84%), Gaps = 7/391 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSED-NIDCGDFS-IT  1310
              V WK++FD IKR+S +    +PL G    I+ K+ R   S +R +E+ + DC D S I 
Sbjct  86    GVYWKNLFDNIKRRSMRRLSSIPLLGGYEMILPKNIRRILSKNRSAEEESTDCDDDSVIP  145

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNF+ ++L++ATDNF+ +N++G+GGHAEVYKG L DGQ++AVK+I K++K DE+++
Sbjct  146   KPSWRNFSYRDLAEATDNFNQDNLIGQGGHAEVYKGCLPDGQIVAVKKITKQEKNDEDKV  205

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
             +DFLSELGIIAHINHPNAAKLIG+SAD GL+L+LQ+LPHGS+  LLH + E LEW IR K
Sbjct  206   DDFLSELGIIAHINHPNAAKLIGYSADGGLYLILQFLPHGSIGTLLHGSEERLEWGIRHK  265

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VAVGVAEGLHYLHC CQ+RIIHRDITASNILLTEDY  QISDFGLAKWLPEKW HHVVSP
Sbjct  266   VAVGVAEGLHYLHCDCQKRIIHRDITASNILLTEDYEPQISDFGLAKWLPEKWVHHVVSP  325

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGYMAPEYFMHGIV EKTDVFAFGVLLLELITGR+AVDS R+SLVMWAKPLLE N+
Sbjct  326   IEGTFGYMAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSYRKSLVMWAKPLLENNS  385

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK  410
             IKE+ADPRLGD YDVVEM+R+MF AL+C+ +LP+MRPNMKKVV++LKGEN   VE++Q K
Sbjct  386   IKEIADPRLGDDYDVVEMKRAMFTALTCLHNLPDMRPNMKKVVQLLKGENA-PVEMKQ-K  443

Query  409   SVSSESLHIA-DFTSTSYRKHLDRHLQLIME  320
             S+   +L  + D+TST+Y + L+RH++L+ME
Sbjct  444   SMGGRALMFSEDYTSTNYLQDLNRHMELVME  474



>ref|XP_009795660.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Nicotiana sylvestris]
Length=476

 Score =   528 bits (1359),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 329/391 (84%), Gaps = 7/391 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG-HDII--RKSRRMFFSWSRCSEDNIDCGDFS-IT  1310
              V WK++FD IKR+S +    +PL G +++I  +  RR+        E++ DC D S I 
Sbjct  88    GVYWKNLFDNIKRRSMRRLSSIPLLGGYEMILPKNIRRILSKNKSAEEESSDCDDDSVIP  147

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWR F+ ++L++ATDNF+ +N++GKGGHAEVYKG L DGQ++AVK+I K++K DE+++
Sbjct  148   KPSWRKFSYRDLAEATDNFNQDNLIGKGGHAEVYKGCLPDGQIVAVKKITKQEKNDEDKV  207

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
             +DFLSELGIIAHINHPNAAKLIG+ AD GL+LVLQ+LPHGS++ LLH + E LEW+IR+K
Sbjct  208   DDFLSELGIIAHINHPNAAKLIGYGADGGLYLVLQFLPHGSISTLLHVSEERLEWEIRYK  267

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VAVGVAEGLHYLHC CQ+RIIHRDITASNILLTEDY  QISDFGLAKWLPEKW HHVVSP
Sbjct  268   VAVGVAEGLHYLHCDCQKRIIHRDITASNILLTEDYEPQISDFGLAKWLPEKWVHHVVSP  327

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGYMAPEYFMHGIV+EKTDVFAFGVLLLELITG +AVDS R+SLVMWAKPLLE N+
Sbjct  328   IEGTFGYMAPEYFMHGIVNEKTDVFAFGVLLLELITGHRAVDSYRKSLVMWAKPLLENNS  387

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK  410
             IKE+ADPRLGDAYDVVEM+R+MF AL+C+ +LP+MRP MKKVV++LKGEN   VEL+Q K
Sbjct  388   IKEIADPRLGDAYDVVEMKRAMFTALTCLHNLPDMRPYMKKVVQLLKGENA-PVELKQ-K  445

Query  409   SVSSESLHIA-DFTSTSYRKHLDRHLQLIME  320
             S+   +L  + D+TST+Y + L+RH++L+ME
Sbjct  446   SMGGRALMFSEDYTSTNYLQDLNRHMELVME  476



>ref|XP_011099971.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Sesamum indicum]
Length=485

 Score =   520 bits (1339),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 258/414 (62%), Positives = 326/414 (79%), Gaps = 15/414 (4%)
 Frame = -3

Query  1519  VTRCGGSGGGFDPTA---------VQWKSIFDQIKRKSAKSFPIVPLF-GHDIIRKSRRM  1370
             + R    GG   PT          +QWK +F Q+KR +      + L  GHD+ +++ R 
Sbjct  73    IDRTSSFGGEKSPTERRELLNNGNLQWKKLFGQVKRTTTLKLSTISLLVGHDLSKRTLRK  132

Query  1369  FFSWSRCSEDNIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGD  1190
                 +R +++  DCGDF   KPSWR+F+ +EL QATD+FS + +LGKGGHA VYKG L D
Sbjct  133   RSGRNRSTDEAADCGDFLAPKPSWRSFSYEELRQATDDFSPDKLLGKGGHAAVYKGCLAD  192

Query  1189  GQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHG  1010
             GQV+AVK+I K++K +E+R  +FLSELGIIAHI+HPNAAKLIGFSAD GLHLVLQY PHG
Sbjct  193   GQVVAVKKITKKNKNEEDRACEFLSELGIIAHIDHPNAAKLIGFSADKGLHLVLQYSPHG  252

Query  1009  SLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQI  830
             SLA +LH + E+L WKIR+KVA+GVAEGL YLH  CQRRIIHRDITASNILL+++Y AQI
Sbjct  253   SLATILHGSEESLGWKIRYKVAIGVAEGLQYLHHGCQRRIIHRDITASNILLSQNYEAQI  312

Query  829   SDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQA  650
             SDFGLAKWLPEKW H VVSPIEGTFGYMAPEYFMHG+V EKTDVFAFGVLLLELITGR+A
Sbjct  313   SDFGLAKWLPEKWAHVVVSPIEGTFGYMAPEYFMHGLVHEKTDVFAFGVLLLELITGRRA  372

Query  649   VDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMK  470
             VDSSRQSLV+WAKP LE+N++ E+ADP+LG+ Y++VEM+R+M  A +CIQHLPNMRPNMK
Sbjct  373   VDSSRQSLVIWAKPFLEKNSVSEIADPKLGETYNIVEMKRAMCTAAACIQHLPNMRPNMK  432

Query  469   KVVEVLKGENELKVELRQ----SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +VV++LKGE+E  V++R      +++  +S  + ++TST+Y K L+RH++L+ME
Sbjct  433   RVVQLLKGESE-GVDMRHRSTGERALLLDSCDLDEYTSTTYLKDLNRHMELVME  485



>ref|XP_006346753.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Solanum tuberosum]
Length=474

 Score =   516 bits (1328),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 259/388 (67%), Positives = 322/388 (83%), Gaps = 5/388 (1%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFGHD-IIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              V WK+IFDQIKR+S +    +PL G++ I+ K+ R   S +R +E+  +  D  I KPS
Sbjct  90    GVYWKNIFDQIKRRSMRRLSSIPLLGYEMILPKNIRRILSKNRSAEEEANDPD-DIPKPS  148

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNF+  EL +ATDNFS + ++G+GGHA VYKG L DGQ++AVK+I K++K DE++++DF
Sbjct  149   WRNFSYGELVEATDNFSPDKLIGQGGHANVYKGHLSDGQLVAVKKITKQEKNDEDKVDDF  208

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAHINHPNAAKLIG+S+D GL+LVLQYL HGSL  L+H + E L+W IR+KVA 
Sbjct  209   LSELGIIAHINHPNAAKLIGYSSDGGLYLVLQYLHHGSLGSLIHGSEERLDWDIRYKVAA  268

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+AEGL YLHC C +RIIHRDITASNILLTEDY  QISDFGLAKWLPEKW HHVVSPIEG
Sbjct  269   GIAEGLLYLHCECPKRIIHRDITASNILLTEDYEPQISDFGLAKWLPEKWVHHVVSPIEG  328

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGYMAPEYFMHGIV+EKTDVFAFGVLLLELITG +AVDS R+SLV+WAKPLL++NNIKE
Sbjct  329   TFGYMAPEYFMHGIVNEKTDVFAFGVLLLELITGHRAVDSYRKSLVLWAKPLLQKNNIKE  388

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVS  401
             +ADPRLGD YDVVEM+R+MF AL C+ HLP++RPNMKKVV++L+GEN   VE++Q KS+ 
Sbjct  389   IADPRLGDDYDVVEMKRAMFTALCCLHHLPDIRPNMKKVVQLLRGENA-PVEMKQ-KSMG  446

Query  400   SESLHIAD-FTSTSYRKHLDRHLQLIME  320
               +L ++D +TST Y + L+RH++L+ME
Sbjct  447   GRALMLSDEYTSTHYLQDLNRHMELVME  474



>ref|XP_011021858.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Populus euphratica]
Length=456

 Score =   497 bits (1280),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 252/396 (64%), Positives = 307/396 (78%), Gaps = 8/396 (2%)
 Frame = -3

Query  1486  DPTAVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKS-RRMFFSWSRCSEDNIDCGDFS  1316
             +   +QWK I D  K+KS + F ++PL      I RK+ RR        ++  IDC    
Sbjct  62    ESNGIQWKHILDSFKKKSVRRFSVIPLISTYETIARKNLRRKLARIQHSADVFIDCEGIM  121

Query  1315  ITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdee  1136
               KPSWRNF   EL  ATDNFSSEN++G+GGHA+VYKG L DGQV+AVK+++K +K++E+
Sbjct  122   APKPSWRNFDYLELEAATDNFSSENLIGEGGHAKVYKGCLSDGQVVAVKKLMKTEKQEED  181

Query  1135  rieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIR  956
             R+ DFLSELGIIAHINHPNAA+L+GFS D+GLHLVL++LPHGSLA +LH  ++ LEWK R
Sbjct  182   RVGDFLSELGIIAHINHPNAARLLGFSIDSGLHLVLEFLPHGSLASVLHGGSDCLEWKKR  241

Query  955   FKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVV  776
             FKVA+G+AEGL YLH  C RRIIHRDI ASNILL  ++ AQISDFGLAKWLPE W HH+V
Sbjct  242   FKVALGIAEGLQYLHHDCPRRIIHRDIKASNILLNANFEAQISDFGLAKWLPENWIHHIV  301

Query  775   SPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQ  596
              PIEGTFGY+APEYFMHGIVDEKTDVFA+GVLLLE+ITGR+AVDSSRQSLVMWAKPLLE 
Sbjct  302   FPIEGTFGYLAPEYFMHGIVDEKTDVFAYGVLLLEIITGRRAVDSSRQSLVMWAKPLLEA  361

Query  595   NNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ  416
             NN KELADPRLGD YD +EM+ +MF AL CI HLPN RP M +VV++L+GE E  VE +Q
Sbjct  362   NNAKELADPRLGDDYDPIEMKHAMFTALMCIHHLPNTRPQMIRVVQLLRGE-EAPVEFKQ  420

Query  415   S----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                  ++V  +   + D+T T+Y K L+RHLQL+ME
Sbjct  421   KTNAGRAVLLDGCDLQDYTCTTYLKDLNRHLQLVME  456



>ref|XP_011021857.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Populus euphratica]
Length=469

 Score =   497 bits (1280),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 252/396 (64%), Positives = 307/396 (78%), Gaps = 8/396 (2%)
 Frame = -3

Query  1486  DPTAVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKS-RRMFFSWSRCSEDNIDCGDFS  1316
             +   +QWK I D  K+KS + F ++PL      I RK+ RR        ++  IDC    
Sbjct  75    ESNGIQWKHILDSFKKKSVRRFSVIPLISTYETIARKNLRRKLARIQHSADVFIDCEGIM  134

Query  1315  ITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdee  1136
               KPSWRNF   EL  ATDNFSSEN++G+GGHA+VYKG L DGQV+AVK+++K +K++E+
Sbjct  135   APKPSWRNFDYLELEAATDNFSSENLIGEGGHAKVYKGCLSDGQVVAVKKLMKTEKQEED  194

Query  1135  rieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIR  956
             R+ DFLSELGIIAHINHPNAA+L+GFS D+GLHLVL++LPHGSLA +LH  ++ LEWK R
Sbjct  195   RVGDFLSELGIIAHINHPNAARLLGFSIDSGLHLVLEFLPHGSLASVLHGGSDCLEWKKR  254

Query  955   FKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVV  776
             FKVA+G+AEGL YLH  C RRIIHRDI ASNILL  ++ AQISDFGLAKWLPE W HH+V
Sbjct  255   FKVALGIAEGLQYLHHDCPRRIIHRDIKASNILLNANFEAQISDFGLAKWLPENWIHHIV  314

Query  775   SPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQ  596
              PIEGTFGY+APEYFMHGIVDEKTDVFA+GVLLLE+ITGR+AVDSSRQSLVMWAKPLLE 
Sbjct  315   FPIEGTFGYLAPEYFMHGIVDEKTDVFAYGVLLLEIITGRRAVDSSRQSLVMWAKPLLEA  374

Query  595   NNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ  416
             NN KELADPRLGD YD +EM+ +MF AL CI HLPN RP M +VV++L+GE E  VE +Q
Sbjct  375   NNAKELADPRLGDDYDPIEMKHAMFTALMCIHHLPNTRPQMIRVVQLLRGE-EAPVEFKQ  433

Query  415   S----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                  ++V  +   + D+T T+Y K L+RHLQL+ME
Sbjct  434   KTNAGRAVLLDGCDLQDYTCTTYLKDLNRHLQLVME  469



>ref|XP_007047766.1| ROP binding protein kinases 1, putative [Theobroma cacao]
 gb|EOX91923.1| ROP binding protein kinases 1, putative [Theobroma cacao]
Length=464

 Score =   496 bits (1276),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 249/396 (63%), Positives = 304/396 (77%), Gaps = 4/396 (1%)
 Frame = -3

Query  1495  GGFDPTAVQWKSIFDQIKRKSAKSFPIVPLF-GHDIIRKSRRMFFSWSRCSEDNIDCGDF  1319
             G  D + +QWK+I + IK+KS + F ++PL   ++I RK+ R   +  + SE+ +D    
Sbjct  69    GSRDSSGLQWKNIIESIKKKSVRRFSVIPLLTSYEISRKNLRRKLAKLQGSEEEVDIDCL  128

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
              + KPSW+NF   EL+ ATDNFS EN+LG+GGHAEVYKG L DGQ++AVK++ K DK+ E
Sbjct  129   PVPKPSWKNFCYSELAAATDNFSPENLLGRGGHAEVYKGHLSDGQIVAVKKLTKNDKEQE  188

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
             +R  DFLSELGIIAHINHPNAA LIGFS D G+HLVLQ+ PHGSLA +L  + E+L+WK 
Sbjct  189   DRASDFLSELGIIAHINHPNAAHLIGFSIDGGMHLVLQFSPHGSLASVLFGSPESLDWKT  248

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RFKVAVGVA+GL YLH  CQRRIIHRDI ASNILLT+DY AQISDFGLAKWLPE W HHV
Sbjct  249   RFKVAVGVADGLKYLHHDCQRRIIHRDIKASNILLTQDYEAQISDFGLAKWLPENWPHHV  308

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLEL+TGR+AVDSSRQSLV+WAKPLLE
Sbjct  309   VHPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLELLTGRRAVDSSRQSLVIWAKPLLE  368

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKV  428
              N + EL DPRL D YD  EM+R++  A  CI HL  MRP+M +VVE+LK E    E + 
Sbjct  369   SNKVNELVDPRLEDNYDPAEMKRALLTASMCINHLATMRPSMIRVVELLKNEGGPVECQQ  428

Query  427   ELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +  + K+V  +   + D+T TSY   L+RH+QL+ME
Sbjct  429   KSCRGKAVIVDGCDLQDYTRTSYLDDLNRHMQLVME  464



>ref|XP_003635501.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Vitis vinifera]
 emb|CBI29579.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   493 bits (1269),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 305/388 (79%), Gaps = 4/388 (1%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVP-LFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWR  1295
              WKS+F  +K+KS + F  +P L GH++ R S R   +  R +ED I      + KPSWR
Sbjct  85    HWKSLFGALKKKSVRRFSTIPSLAGHELSRISLRRKLARIRSAEDPISVEGMPVPKPSWR  144

Query  1294  NFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLS  1115
             +F   EL+ ATDNFSSEN++GKGGHAEVY+G L DGQ++AVK+++K++K+DEER  DFLS
Sbjct  145   SFDYAELAAATDNFSSENLIGKGGHAEVYRGCLSDGQLVAVKKLMKKEKEDEERTGDFLS  204

Query  1114  ELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGV  935
             ELGIIAHI+HPNAA+LIGF  D GLHLVLQ+ P GSLA +LH  TE+LEWKIRFKVAVGV
Sbjct  205   ELGIIAHIDHPNAARLIGFGVDGGLHLVLQFSPQGSLASVLHGTTESLEWKIRFKVAVGV  264

Query  934   AEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTF  755
             AEGL YLH  C RRIIHRDI ASNILLT+DY  QISDFGLAKWLP+KW HHVV PIEGTF
Sbjct  265   AEGLQYLHQGCHRRIIHRDIKASNILLTQDYQPQISDFGLAKWLPDKWAHHVVFPIEGTF  324

Query  754   GYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELA  575
             GY+APEYFMHGIVDEKTDVFAFGVLLLELITGR AVDSSRQSLV+WAKPLL+ N++KELA
Sbjct  325   GYLAPEYFMHGIVDEKTDVFAFGVLLLELITGRHAVDSSRQSLVIWAKPLLDANDVKELA  384

Query  574   DPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQSKSV  404
             D RLGD YD+ EM+R+M  A  CI H  +MRP M +VV++L+GE    E K +    +++
Sbjct  385   DSRLGDCYDLGEMKRAMLTASMCIHHSSSMRPEMNRVVQLLRGEGKSPEPKQKSNVGRAL  444

Query  403   SSESLHIADFTSTSYRKHLDRHLQLIME  320
               +   +AD+T TSY + L+RH++L++E
Sbjct  445   ILDDSDLADYTPTSYLRDLNRHMELVLE  472



>gb|EYU30928.1| hypothetical protein MIMGU_mgv1a004754mg [Erythranthe guttata]
Length=511

 Score =   494 bits (1271),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 253/403 (63%), Positives = 325/403 (81%), Gaps = 19/403 (5%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSA----KSFPIVPLFGHDIIRKSRRMFFSW-------SRCSE--DNI  1334
             + WK +F Q+KR S      +  ++  +G+D+ +K+              +R SE  D I
Sbjct  110   LNWKKMFGQVKRTSTVWKVSTVSMIMGYGNDLSKKTTTATSKKKKKKSEKNRVSEEEDAI  169

Query  1333  DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriike  1154
             D  DF++ KPSWRNFT +EL  ATD+FS + ++GKGGHAEVYKG L DGQ++AVK+IIK 
Sbjct  170   DVDDFAMPKPSWRNFTYEELKLATDDFSPDVLIGKGGHAEVYKGCLSDGQIVAVKKIIKV  229

Query  1153  dkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATET  974
             +K DE+++ DFLSELGI+AHI+HPNAAKLIGFS+D GL+LVLQ+ P+GSLA +LH + E+
Sbjct  230   NKNDEDKVGDFLSELGILAHIDHPNAAKLIGFSSDGGLYLVLQFSPYGSLATVLHGSVES  289

Query  973   -LEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              L+WKIR+KVA+G+AEGL YLHC CQ+RIIHRDITASNILL+EDY AQ+SDFGLAKWLP+
Sbjct  290   SLDWKIRYKVAIGIAEGLQYLHCNCQKRIIHRDITASNILLSEDYEAQVSDFGLAKWLPD  349

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             KW   VVSPIEGTFGYMAPEYFMHGIV EKTDVFAFGVLLLELITGR+AVDSSRQSLVMW
Sbjct  350   KWVQLVVSPIEGTFGYMAPEYFMHGIVHEKTDVFAFGVLLLELITGRRAVDSSRQSLVMW  409

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLLE+N++KE+ADPRLG+++D+VEM+R+MF A +CI HLP MRPNMK+VV++LKGENE
Sbjct  410   AKPLLEKNSVKEIADPRLGESFDLVEMKRAMFAASTCIHHLPTMRPNMKRVVQLLKGENE  469

Query  436   LKVELRQS----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                E++Q     +++  ++  + D+TST+Y K L+RH++L+ME
Sbjct  470   -GAEMKQKSMGGRALLLDACDLDDYTSTTYLKDLNRHMELVME  511



>ref|XP_002533520.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF28864.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=463

 Score =   488 bits (1256),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 251/393 (64%), Positives = 309/393 (79%), Gaps = 12/393 (3%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLF-GHDII-RKSRRMFFSWSRCSED---NIDCGDFSITK  1307
             QWK + D  K+KS + F ++PL   +D+I +KS +   +  + S D   ++DC    ITK
Sbjct  74    QWKQMLDAFKKKSMRRFSVIPLLTNYDLIAKKSLKRKINRIQSSADVVIDLDC--IQITK  131

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
             PSWRNF   EL  ATD+FSSEN++G+GGHA+VYKG L DGQV+AVK+I+K +K+DE RI 
Sbjct  132   PSWRNFDFAELEAATDHFSSENLIGEGGHAQVYKGCLSDGQVVAVKKIMKTEKEDENRIG  191

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
             DFLSELGIIAHINHPNAAKL+GFS D GLHLVL+YLP GSLA +L    E+LEW+ R KV
Sbjct  192   DFLSELGIIAHINHPNAAKLLGFSIDGGLHLVLEYLPQGSLASVLFGGAESLEWEKRIKV  251

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             AVG+AEGL YLH  C RRIIHRDI ASNILLTEDY AQISDFGLAKWLPE W HH+V PI
Sbjct  252   AVGIAEGLRYLHHDCHRRIIHRDIKASNILLTEDYEAQISDFGLAKWLPENWLHHIVFPI  311

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+APEYFMHGIV+EKTDVF+FGVLLLE+ITGR AVDSSRQSL MWAKPLLE+N +
Sbjct  312   EGTFGYLAPEYFMHGIVNEKTDVFSFGVLLLEIITGRHAVDSSRQSLAMWAKPLLEENQV  371

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS--  413
             KE+ADP+LG  YD VEM+R+MF A  CI HLP+MRP+M +VV++L+GE E  +E++Q   
Sbjct  372   KEVADPQLGSDYDPVEMKRAMFTASMCINHLPSMRPHMNQVVQLLRGE-EAPMEMQQKSN  430

Query  412   --KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
               ++V  +   + D+T TSY   L+RH+QL++E
Sbjct  431   AGRAVMVDGCDLQDYTCTSYLNDLNRHMQLVLE  463



>gb|KHG03388.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Gossypium arboreum]
Length=465

 Score =   481 bits (1237),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 297/395 (75%), Gaps = 3/395 (1%)
 Frame = -3

Query  1495  GGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFS  1316
             G  D   +QWK++   +K+K  +SF ++PL   +     R          E+++D     
Sbjct  71    GNKDSYGLQWKNLIGNVKKKYVRSFSLIPLLTSNDKNLRRTKLEKLHASEEEHVDINSIP  130

Query  1315  ITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdee  1136
             + KPSW+NFT  EL+ ATDNFS EN++GKGGHAEVYKG L DGQ++AVK+++K +K++E+
Sbjct  131   VPKPSWKNFTYSELAAATDNFSPENLIGKGGHAEVYKGHLSDGQIVAVKKLMKNEKQEED  190

Query  1135  rieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIR  956
             R  DFLSELGIIAHINHPNAA LIGFS D GLHLVLQ+ PHGSL+ +L  + E L+WK R
Sbjct  191   RASDFLSELGIIAHINHPNAACLIGFSVDGGLHLVLQFSPHGSLSSVLFGSPERLDWKTR  250

Query  955   FKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVV  776
             FKVA+G+A+GL YLH  CQRRIIHRDI ASNILLTEDY AQISDFGLAKWLPE W HHVV
Sbjct  251   FKVAIGIADGLKYLHYDCQRRIIHRDIKASNILLTEDYEAQISDFGLAKWLPENWPHHVV  310

Query  775   SPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQ  596
              PIEGTFGY+APEYFMHGIVDEK DVFAFGVLLLE+ITGR+AVDS+RQSLV+WAKPLL+Q
Sbjct  311   HPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITGRRAVDSARQSLVIWAKPLLQQ  370

Query  595   NNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL---KVE  425
             N +KEL DP LGD YD  EM+R+M  A  CI H  + RP M +VVE+LK +  L   +++
Sbjct  371   NEVKELVDPGLGDNYDPSEMKRTMITASMCINHSASKRPTMIRVVELLKNKESLVEGELK  430

Query  424   LRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                 + + ++SL + D++ TSY   L+RH QL+ME
Sbjct  431   CCGERGIIADSLDLQDYSRTSYLNDLNRHKQLVME  465



>gb|KDP29776.1| hypothetical protein JCGZ_18711 [Jatropha curcas]
Length=471

 Score =   477 bits (1227),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 247/393 (63%), Positives = 300/393 (76%), Gaps = 10/393 (3%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLF-GHDII-RKSRRMFFSWSRCSEDN-IDCGDFSITKPS  1301
             QWK++ D  K+KS K F ++PL   +D+I RKS +   +  + S D  I+ G  SI KPS
Sbjct  79    QWKTMLDSFKKKSMKRFSVIPLLTNYDLIARKSLKRKLTRIQNSPDMMIEWGGMSIPKPS  138

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNF   EL  ATDNFS EN++G+GGHA+VYKG L DGQV+AVK+IIK + ++   I DF
Sbjct  139   WRNFDYAELEAATDNFSFENLIGEGGHAQVYKGILPDGQVVAVKKIIKVEGEEVSSIGDF  198

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE--TLEWKIRFKV  947
             LSELGIIAHINH NAAKL+GFS D GLHL+L++LPHGSLA +LH   E   L+WK RFKV
Sbjct  199   LSELGIIAHINHANAAKLLGFSVDCGLHLILEFLPHGSLASMLHVLGEGNCLDWKKRFKV  258

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             AVG+AEGL YLH  CQRRIIHRDI ASNILL EDY AQISDFGLAKWLPE W HH+V PI
Sbjct  259   AVGIAEGLRYLHHDCQRRIIHRDIKASNILLGEDYEAQISDFGLAKWLPENWVHHIVFPI  318

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+APEYFMHGIVDEKTDVFA+GVLLLE+ITGR AVD++RQSL MWAKPLL +NN+
Sbjct  319   EGTFGYLAPEYFMHGIVDEKTDVFAYGVLLLEIITGRHAVDANRQSLAMWAKPLLRENNV  378

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKS  407
             KE+ DPRLGD YD  EM+R+M  A  CIQHLP  RP+MK+VV++L GE E   E +Q  +
Sbjct  379   KEIVDPRLGDDYDPTEMQRAMLTASMCIQHLPTDRPHMKRVVQLLTGE-EAPAEPKQKTN  437

Query  406   VSS----ESLHIADFTSTSYRKHLDRHLQLIME  320
             +      +   + D+T TSY   L+RH++L+M+
Sbjct  438   IGIPVILDGCDLQDYTCTSYLDDLNRHMELVMD  470



>gb|KHN04920.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Glycine soja]
Length=452

 Score =   474 bits (1219),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 249/390 (64%), Positives = 295/390 (76%), Gaps = 8/390 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLF--GHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             Q KS+ D  K KS +    VPL   GHDI RK      +  R +ED+ID G F  TKPSW
Sbjct  65    QLKSMIDVFKFKSVRKLTAVPLLSVGHDISRKGFTKKLARIRSAEDSIDIGAFP-TKPSW  123

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNF  +EL+ AT NFS EN++GKGGHAEVYKG L DGQVIAVKR++K +K   +R  DFL
Sbjct  124   RNFDYEELAAATGNFSYENLIGKGGHAEVYKGYLPDGQVIAVKRLMKNEKDAADRAGDFL  183

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAHINHPNA +L+GF  D GL+ VLQ  PHGSL+ LL   +E L+WKIRFKVA+G
Sbjct  184   TELGIIAHINHPNATRLVGFGVDCGLYFVLQLAPHGSLSSLLF-GSECLDWKIRFKVAIG  242

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             VAEGLHYLH  C RRIIHRDI ASNILL E++ A+ISDFGLAKWLP KW +HVV PIEGT
Sbjct  243   VAEGLHYLHKECPRRIIHRDIKASNILLNENFEAEISDFGLAKWLPSKWTNHVVFPIEGT  302

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKE  581
             FGY+APEYFMHG+VDEKTDVFAFGVLLLELITGR+AVDS SRQSLV+WAKPLL+ NN+K+
Sbjct  303   FGYLAPEYFMHGVVDEKTDVFAFGVLLLELITGRRAVDSNSRQSLVIWAKPLLDTNNVKD  362

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQSK  410
             LADPRLG+ YD+ EM+R+M  A  C+ H  + RP M +VV +LKGE    E K  L   K
Sbjct  363   LADPRLGEEYDLTEMKRTMLTASMCVHHASSKRPYMNQVVLLLKGEETIIEPKKNLVAQK  422

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             S+  E+  + D+T +SY K L+RH QLIME
Sbjct  423   SLMLEACDLEDYTCSSYLKDLNRHRQLIME  452



>ref|XP_010254568.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Nelumbo nucifera]
Length=467

 Score =   472 bits (1215),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 238/394 (60%), Positives = 293/394 (74%), Gaps = 11/394 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLF-GHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              +QWK++ D IK+KS K     P+    +  R+S     +  R + D IDCG  S+ KPS
Sbjct  77    GLQWKNLLDVIKKKSMKRLSTFPMLTSSETSRRSLSRKLARIRSAHDGIDCGGKSVPKPS  136

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WR+F+ QEL+ ATDNFSSE ++GKGGHAEVYKG L DGQ IAVKR+IK+++        F
Sbjct  137   WRSFSYQELAAATDNFSSEKLIGKGGHAEVYKGCLSDGQFIAVKRLIKKEEDRISN---F  193

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAH+NHPNAA+L+GF  + GLHL+LQY PHGSLA +LH   E+LEW  RFKVA+
Sbjct  194   LSELGIIAHVNHPNAARLLGFGVEGGLHLILQYSPHGSLASVLHGTKESLEWGTRFKVAL  253

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+AEGL+YLH  C RRIIHRDI ASNILLT+DY  QISDFGLAKWLPE+W HH+V PIEG
Sbjct  254   GIAEGLNYLHHGCHRRIIHRDIKASNILLTQDYEPQISDFGLAKWLPEQWTHHIVFPIEG  313

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             T GY++PEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDS RQSLVMWAKPLL+ N++KE
Sbjct  314   TIGYLSPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSCRQSLVMWAKPLLDANSMKE  373

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG-------ENELKVEL  422
             L DPRLGDAY++ EM+R+M  A  CI HL  MRP+M  VV+ L         E E K + 
Sbjct  374   LVDPRLGDAYNITEMQRAMSTASLCIHHLSTMRPHMNWVVKHLSEDGGVEFWEKEAKAKP  433

Query  421   RQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                +++  +   + D+TS+SY   L+RH+QL +E
Sbjct  434   LVGRALILDDCDLEDYTSSSYLNDLNRHMQLALE  467



>ref|XP_006466328.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Citrus sinensis]
Length=457

 Score =   472 bits (1214),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 244/390 (63%), Positives = 303/390 (78%), Gaps = 8/390 (2%)
 Frame = -3

Query  1468  WKSIFDQIKRKSA-KSFPIVPLF-GHDIIRKSRRMFFSWSRCSEDNI--DCGDFSITKPS  1301
             WKS+ D IK+KS  + F ++PL   +++ +K+        +  ED+   D G   I + S
Sbjct  69    WKSMIDSIKKKSVVRRFSVIPLLTNYELTKKNLWKKLGRLQIPEDDDADDGGSVPIVRHS  128

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             W+NF   EL+ ATDNF+SEN++GKGGHAEVYKG L DG+V+AVK+IIK  K+DEERI DF
Sbjct  129   WKNFDFAELAAATDNFNSENLIGKGGHAEVYKGCLPDGEVVAVKKIIKNAKEDEERISDF  188

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGI+AHINHPNAAKLIGFS +NG HLVLQ+LPHGSL+ LL  +TE LEWKIR+K+A+
Sbjct  189   LSELGIVAHINHPNAAKLIGFSTENGFHLVLQFLPHGSLSSLLFGSTECLEWKIRYKIAL  248

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+AEGL YLH  C RRIIHRDI ASNILL+EDY AQISDFGLAKWLP+ W HH+V PIEG
Sbjct  249   GIAEGLQYLHHDCHRRIIHRDIKASNILLSEDYEAQISDFGLAKWLPDNWSHHIVFPIEG  308

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGY++PEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDS RQSLV+WAKPLL+ +N KE
Sbjct  309   TFGYLSPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSRRQSLVIWAKPLLQTSNFKE  368

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE---NELKVELRQSK  410
             L DPRL DAYD+ EM+R+M  A  CI HL  MRP M +V+++L+GE    +LK +L   +
Sbjct  369   LVDPRLADAYDLAEMKRAMLTASVCIHHLSTMRPQMTRVLQLLRGEGGQTDLKPKLSARR  428

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +V  +     +++ST Y K L+RH+QL +E
Sbjct  429   TVILDGSD-EEYSSTCYLKDLNRHMQLALE  457



>ref|XP_010547588.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Tarenaya hassleriana]
Length=466

 Score =   472 bits (1214),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 299/391 (76%), Gaps = 6/391 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              +QW  + + IK+KS + F ++PL   +++ RK+ R        S+ N+ C  F + KPS
Sbjct  77    GLQWNKMIENIKKKSMRRFSVIPLLASYELSRKNFRKKLPKDPPSDYNVSCDHFLVAKPS  136

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNF+  EL+ ATD+F+ ENM+GKGGHAEVYKG L DG+++A+K++    K +EE++ +F
Sbjct  137   WRNFSYDELAAATDDFNPENMIGKGGHAEVYKGTLPDGEIVAIKKLKSNAKVEEEKVSNF  196

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAH+NHPNAA L GFS D GLH VL+Y PHGSLA  L  + E+LEWKIR+KVA+
Sbjct  197   LSELGIIAHVNHPNAAHLRGFSTDRGLHFVLEYSPHGSLASWLFGSGESLEWKIRYKVAI  256

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A+GL YLH  C RRIIHRDI ASNILLT DY AQISDFGLAKWLPE W HHVV PIEG
Sbjct  257   GIADGLSYLHHECPRRIIHRDIKASNILLTRDYEAQISDFGLAKWLPENWPHHVVFPIEG  316

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIK  584
             TFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQSLV+WAKPLLE+N+++
Sbjct  317   TFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSLVIWAKPLLEKNSVR  376

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---  413
             E+ D RLGD +D +EM+R M  A  CI H+  MRPNM +VV++L+GE+    EL++S   
Sbjct  377   EIVDTRLGDNFDSMEMKRVMLTASICIHHIATMRPNMTRVVQLLQGEDG-PAELQKSGGG  435

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             ++VS +  ++ D+T  +Y   L RH QL+ME
Sbjct  436   RAVSLDGCYLHDYTCAAYLNELTRHRQLVME  466



>ref|XP_003517343.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Glycine max]
Length=452

 Score =   471 bits (1211),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 248/390 (64%), Positives = 294/390 (75%), Gaps = 8/390 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLF--GHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             Q KS+ D  K KS +    VPL   GHDI RK      +  R +ED+ID G F  TKPSW
Sbjct  65    QLKSMIDVFKFKSVRKLTAVPLLSVGHDISRKGFTKKLARIRSAEDSIDIGAFP-TKPSW  123

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNF  +EL+ AT NFS EN++GKGGHAEVYKG L DGQVIAVKR++K +K   +R  DFL
Sbjct  124   RNFDYEELAAATGNFSYENLIGKGGHAEVYKGYLPDGQVIAVKRLMKNEKDAADRAGDFL  183

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAHINHPNA +L+GF  D GL+ VLQ  PHGSL+ LL   +E L+WKIRFKVA+G
Sbjct  184   TELGIIAHINHPNATRLVGFGVDCGLYFVLQLAPHGSLSSLLF-GSECLDWKIRFKVAIG  242

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             VAEGLHYLH  C RRIIHRDI ASNILL E++ A+ISDFGLAKWLP KW +HVV PIEGT
Sbjct  243   VAEGLHYLHKECPRRIIHRDIKASNILLNENFEAEISDFGLAKWLPSKWTNHVVFPIEGT  302

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKE  581
             FGY+APEYFMHG+VDEKTDVFAFGVLLLELITG +AVDS SRQSLV+WAKPLL+ NN+K+
Sbjct  303   FGYLAPEYFMHGVVDEKTDVFAFGVLLLELITGHRAVDSNSRQSLVIWAKPLLDTNNVKD  362

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQSK  410
             LADPRLG+ YD+ EM+R+M  A  C+ H  + RP M +VV +LKGE    E K  L   K
Sbjct  363   LADPRLGEEYDLTEMKRTMLTASMCVHHASSKRPYMNQVVLLLKGEETIIEPKKNLVAQK  422

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             S+  E+  + D+T +SY K L+RH QLIME
Sbjct  423   SLMLEACDLEDYTCSSYLKDLNRHRQLIME  452



>gb|KFK28223.1| hypothetical protein AALP_AA8G488500 [Arabis alpina]
Length=466

 Score =   469 bits (1208),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/399 (58%), Positives = 305/399 (76%), Gaps = 7/399 (2%)
 Frame = -3

Query  1495  GGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS--RRMFFSWSRCSEDNIDCG  1325
               F    +QW  + + IK+KS + F ++PL   +++ RK+  R+     S  SE+ IDCG
Sbjct  68    SSFHHHGLQWNKMIESIKKKSIRRFSVIPLLASYELTRKNMRRKQPKLTSPSSENEIDCG  127

Query  1324  DFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkk  1145
              F + KPSWRNFT +EL  AT++F+ ENM+GKGGHAEVYKG L DG+ +A+K++++  K+
Sbjct  128   QFLVVKPSWRNFTFEELVAATNDFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMRHAKE  187

Query  1144  deerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEW  965
             +EER+ DFLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA LL  A E L+W
Sbjct  188   EEERVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYSPHGSLASLLFGAEECLDW  247

Query  964   KIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGH  785
             K R+KVA+G+A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W H
Sbjct  248   KKRYKVALGIADGLSYLHNDCPRRIIHRDIKASNILLSQDYDAQISDFGLAKWLPENWPH  307

Query  784   HVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKP  608
             H+V PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMWAKP
Sbjct  308   HIVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSIVMWAKP  367

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LLE+NN++E+ DP+LG+ +D  E++R M  A  CI H   MRP+M ++ ++L+G++ L  
Sbjct  368   LLEKNNVEEIVDPKLGNDFDETELKRVMQTASMCIHHQSAMRPDMNRMAQLLRGDDRLAE  427

Query  427   ELRQ---SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + ++   S+ VS +   + D TS++Y   L RH QL+ME
Sbjct  428   QQQKSGGSRPVSLDDCDLQDHTSSTYLNDLTRHRQLLME  466



>ref|XP_010462975.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Camelina sativa]
Length=458

 Score =   468 bits (1204),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 302/399 (76%), Gaps = 13/399 (3%)
 Frame = -3

Query  1483  PTAV----QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS-RRMFFSWSRCSEDNIDCGD  1322
             PT V    QW  + D IK+KS + F ++PL   +++ RK+ RR     +  SE+  DCG 
Sbjct  62    PTNVSSFHQWNKMIDSIKKKSIRRFSVIPLLASYELTRKNMRRKQHKLTPSSENEFDCGP  121

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
                 KPSWRNFT  EL  ATDNF+ ENM+GKGGHAEVYKG L DG+ +A+K++ +  K+ 
Sbjct  122   ILFAKPSWRNFTFDELVAATDNFNPENMIGKGGHAEVYKGVLPDGETVAIKKLTRNAKEV  181

Query  1141  eerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWK  962
             EER  DFLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA LL  +   L+WK
Sbjct  182   EERASDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYSPHGSLASLLFGSEGCLDWK  241

Query  961   IRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHH  782
              R+KVA+G+A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH
Sbjct  242   KRYKVALGIADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENWPHH  301

Query  781   VVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPL  605
             +V PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQSLVMWAKPL
Sbjct  302   IVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSLVMWAKPL  361

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVE  425
             LE+N+++E+ DP+LG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+G++ L  E
Sbjct  362   LEKNSVEEIVDPQLGNDFDETEMKRVMQTASKCIHHVSTMRPDMNRLVQLLRGDDRL-AE  420

Query  424   LRQ----SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             L+Q    +++VS +   + D TS+SY   L RH QL+ME
Sbjct  421   LQQKTGGARTVSLDECDL-DHTSSSYLNDLTRHRQLLME  458



>gb|KDO60539.1| hypothetical protein CISIN_1g012765mg [Citrus sinensis]
Length=457

 Score =   467 bits (1201),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 242/390 (62%), Positives = 301/390 (77%), Gaps = 8/390 (2%)
 Frame = -3

Query  1468  WKSIFDQIKRKSA-KSFPIVPLF-GHDIIRKSRRMFFSWSRCSEDNI--DCGDFSITKPS  1301
             WKS+ D IK+KS  + F ++PL   +++ +K+        +  ED+   D G   I + S
Sbjct  69    WKSMIDSIKKKSVVRRFSVIPLLTNYELTKKNLWKKLGRLQIPEDDDADDGGSVPIVRHS  128

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             W+NF   EL+ ATDNF+SEN++GKGGHAEVYKG L DG+V+AVK+IIK  K+DEERI DF
Sbjct  129   WKNFDFAELAAATDNFNSENLIGKGGHAEVYKGCLPDGEVVAVKKIIKNAKEDEERISDF  188

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGI+AHINHPNAAKLIGFS +NG HLVLQ+LPHGSL+ LL  +TE LEW IR+K+A+
Sbjct  189   LSELGIVAHINHPNAAKLIGFSTENGFHLVLQFLPHGSLSSLLFGSTECLEWTIRYKIAL  248

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+AEGL YLH  C RRIIHRDI ASNILL+EDY AQISDFGLAKWLP+ W HH+V PIEG
Sbjct  249   GIAEGLQYLHHDCHRRIIHRDIKASNILLSEDYEAQISDFGLAKWLPDNWSHHIVFPIEG  308

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGY++PEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDS RQSLV+WAKPLL+ +N KE
Sbjct  309   TFGYLSPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSRRQSLVIWAKPLLQTSNFKE  368

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE---NELKVELRQSK  410
             L DPRL DAYD+ EM+R+M  A  CI HL  MRP M +V+++L+GE    +LK +    +
Sbjct  369   LVDPRLADAYDLAEMKRAMLTASVCIHHLSTMRPQMTRVLQLLRGEGGQTDLKPKPSARR  428

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +V  +     +++ST Y K L+RH+QL +E
Sbjct  429   TVILDGSD-EEYSSTCYLKDLNRHMQLALE  457



>gb|KCW62037.1| hypothetical protein EUGRSUZ_H04720 [Eucalyptus grandis]
Length=501

 Score =   468 bits (1205),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 241/352 (68%), Positives = 288/352 (82%), Gaps = 9/352 (3%)
 Frame = -3

Query  1354  RCSEDNIDCGDFSI--TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQV  1181
             R +ED ID G  ++  +KP+WR+F L EL  ATDNFS EN++GKGGHAEVYKGRL DG +
Sbjct  151   RSAEDGIDRGALNLPASKPTWRSFDLAELVAATDNFSPENLIGKGGHAEVYKGRLPDGLL  210

Query  1180  IAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLA  1001
             +AVKR+IK+DK++E R  DFLSELGIIAHI+HPNAA+L+G+  D GLHLVLQ+ PHGSLA
Sbjct  211   VAVKRLIKKDKEEETRTADFLSELGIIAHIDHPNAARLLGYGVDGGLHLVLQFSPHGSLA  270

Query  1000  FLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDF  821
              +LH + E+LEWKIRFKVAVGVAEGL YLH  CQRRIIHRDI ASNILLTEDY  QISDF
Sbjct  271   SVLHGSAESLEWKIRFKVAVGVAEGLKYLHYSCQRRIIHRDIKASNILLTEDYEPQISDF  330

Query  820   GLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS  641
             GLAKWLPEKW  HVV PIEGTFGY+APEYFMHGIVDEK DVFAFGVLLLELITGR+AVDS
Sbjct  331   GLAKWLPEKWAQHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLELITGRRAVDS  390

Query  640   SRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVV  461
             +RQSLVMWAKPLL+ NNI+ LADPRL DAYD+ EM+R+   A  C+  +  MRP+MKKVV
Sbjct  391   TRQSLVMWAKPLLDVNNIRGLADPRLKDAYDIAEMKRATLTASMCVHCISTMRPDMKKVV  450

Query  460   EVLKGENELKVELRQSKSVSSESL-----HIADFTSTSYRKHLDRHLQLIME  320
             ++LKGE+  + E +Q KSVS  +L      + D++ T+Y K L+RH+QL+M+
Sbjct  451   QMLKGEDGAQ-EWKQ-KSVSGRALLLDACDLEDYSCTTYLKDLNRHMQLLMQ  500



>ref|XP_006426253.1| hypothetical protein CICLE_v10025570mg [Citrus clementina]
 gb|ESR39493.1| hypothetical protein CICLE_v10025570mg [Citrus clementina]
Length=457

 Score =   467 bits (1201),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 242/390 (62%), Positives = 301/390 (77%), Gaps = 8/390 (2%)
 Frame = -3

Query  1468  WKSIFDQIKRKSA-KSFPIVPLF-GHDIIRKSRRMFFSWSRCSEDNI--DCGDFSITKPS  1301
             WKS+ D IK+KS  + F ++PL   +++ +K+        +  ED+   D G   I + S
Sbjct  69    WKSMIDSIKKKSVVRRFSVIPLLTNYELTKKNLWKKLGRLQIPEDDDADDGGSVPIVRHS  128

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             W+NF   EL+ ATDNF+SEN++GKGGHAEVYKG L DG+V+AVK+IIK  K+DEERI DF
Sbjct  129   WKNFDFAELAAATDNFNSENLIGKGGHAEVYKGCLPDGEVVAVKKIIKNAKEDEERISDF  188

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGI+AHINHPNAAKLIGFS +NG HLVLQ+LPHGSL+ LL  +TE LEW IR+K+A+
Sbjct  189   LSELGIVAHINHPNAAKLIGFSTENGFHLVLQFLPHGSLSSLLFGSTECLEWTIRYKIAL  248

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+AEGL YLH  C RRIIHRDI ASNILL+EDY AQISDFGLAKWLP+ W HH+V PIEG
Sbjct  249   GIAEGLQYLHHDCHRRIIHRDIKASNILLSEDYEAQISDFGLAKWLPDNWSHHIVFPIEG  308

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGY++PEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDS RQSLV+WAKPLL+ +N KE
Sbjct  309   TFGYLSPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSRRQSLVIWAKPLLQTSNFKE  368

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE---NELKVELRQSK  410
             L DPRL DAYD+ EM+R+M  A  CI HL  MRP M +V+++L+GE    +LK +    +
Sbjct  369   LVDPRLADAYDLAEMKRAMLTASVCIHHLSTMRPQMTRVLQLLRGEGGQTDLKPKPSARR  428

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +V  +     +++ST Y K L+RH+QL +E
Sbjct  429   TVILDGSD-EEYSSTCYLKDLNRHMQLALE  457



>ref|XP_010025388.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Eucalyptus grandis]
Length=503

 Score =   468 bits (1205),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 241/352 (68%), Positives = 288/352 (82%), Gaps = 9/352 (3%)
 Frame = -3

Query  1354  RCSEDNIDCGDFSI--TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQV  1181
             R +ED ID G  ++  +KP+WR+F L EL  ATDNFS EN++GKGGHAEVYKGRL DG +
Sbjct  153   RSAEDGIDRGALNLPASKPTWRSFDLAELVAATDNFSPENLIGKGGHAEVYKGRLPDGLL  212

Query  1180  IAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLA  1001
             +AVKR+IK+DK++E R  DFLSELGIIAHI+HPNAA+L+G+  D GLHLVLQ+ PHGSLA
Sbjct  213   VAVKRLIKKDKEEETRTADFLSELGIIAHIDHPNAARLLGYGVDGGLHLVLQFSPHGSLA  272

Query  1000  FLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDF  821
              +LH + E+LEWKIRFKVAVGVAEGL YLH  CQRRIIHRDI ASNILLTEDY  QISDF
Sbjct  273   SVLHGSAESLEWKIRFKVAVGVAEGLKYLHYSCQRRIIHRDIKASNILLTEDYEPQISDF  332

Query  820   GLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS  641
             GLAKWLPEKW  HVV PIEGTFGY+APEYFMHGIVDEK DVFAFGVLLLELITGR+AVDS
Sbjct  333   GLAKWLPEKWAQHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLELITGRRAVDS  392

Query  640   SRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVV  461
             +RQSLVMWAKPLL+ NNI+ LADPRL DAYD+ EM+R+   A  C+  +  MRP+MKKVV
Sbjct  393   TRQSLVMWAKPLLDVNNIRGLADPRLKDAYDIAEMKRATLTASMCVHCISTMRPDMKKVV  452

Query  460   EVLKGENELKVELRQSKSVSSESL-----HIADFTSTSYRKHLDRHLQLIME  320
             ++LKGE+  + E +Q KSVS  +L      + D++ T+Y K L+RH+QL+M+
Sbjct  453   QMLKGEDGAQ-EWKQ-KSVSGRALLLDACDLEDYSCTTYLKDLNRHMQLLMQ  502



>ref|XP_010444512.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Camelina sativa]
Length=458

 Score =   465 bits (1196),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 301/399 (75%), Gaps = 13/399 (3%)
 Frame = -3

Query  1483  PTAV----QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS-RRMFFSWSRCSEDNIDCGD  1322
             PT V    QW  + D IK+KS + F ++PL   +++ RK+ RR     +  SE+  DCG 
Sbjct  62    PTNVSSFYQWNKMIDSIKKKSIRRFSVIPLLASYELTRKNMRRKQHKLTPSSENEFDCGQ  121

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
                 KPSWRNFT  EL  ATDNF+ ENM+GKGGHAEVYKG L DG+ +A+K++ +  K+ 
Sbjct  122   ILFAKPSWRNFTFDELVAATDNFNPENMIGKGGHAEVYKGVLPDGETVAIKKLTRNAKEV  181

Query  1141  eerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWK  962
             EER  DFLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA +L  +   L+WK
Sbjct  182   EERASDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYSPHGSLASVLFGSEGCLDWK  241

Query  961   IRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHH  782
              R+KVA+G+A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH
Sbjct  242   KRYKVALGIADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENWPHH  301

Query  781   VVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPL  605
             +V PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQSLVMWAKPL
Sbjct  302   IVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSLVMWAKPL  361

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVE  425
             LE+ +++E+ DP+LG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+G++ L  E
Sbjct  362   LEKKSVEEIVDPQLGNDFDETEMKRVMQTASKCIHHVSTMRPDMNRLVQLLRGDDRL-AE  420

Query  424   LRQ----SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             L+Q    +++VS +   + D TS+SY   L RH QL+ME
Sbjct  421   LQQKTGGARTVSLDECDL-DHTSSSYLNDLTRHRQLLME  458



>ref|XP_010484345.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Camelina sativa]
Length=463

 Score =   465 bits (1196),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 300/399 (75%), Gaps = 13/399 (3%)
 Frame = -3

Query  1483  PTAV----QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS-RRMFFSWSRCSEDNIDCGD  1322
             PT V    QW  + D IK+KS + F ++PL   +++ RK+ RR        SE+  DCG 
Sbjct  67    PTNVSSFHQWNKMIDSIKKKSIRRFSVIPLLASYELTRKNMRRKQHKLIPSSENEFDCGQ  126

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
                 KPSWRNFT  EL  ATDNF+ ENM+GKGGHAEVY+G L DG+ +A+K++ +  K+ 
Sbjct  127   ILFAKPSWRNFTFDELVAATDNFNPENMIGKGGHAEVYRGVLPDGETVAIKKLTRNAKEV  186

Query  1141  eerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWK  962
             EER  DFLSELGIIAH+NHPNAAKL GFS+D GLH VL+Y PHGSLA LL  +   L+WK
Sbjct  187   EERASDFLSELGIIAHVNHPNAAKLRGFSSDRGLHFVLEYSPHGSLASLLFGSEGCLDWK  246

Query  961   IRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHH  782
              R+KVA+G+A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH
Sbjct  247   KRYKVALGIADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENWSHH  306

Query  781   VVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPL  605
             +V PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQSLVMWAKPL
Sbjct  307   IVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSLVMWAKPL  366

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVE  425
             LE+ +++E+ DP+LG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+G++ L  E
Sbjct  367   LEKKSVEEIVDPQLGNDFDETEMKRVMQTASKCIHHVSTMRPDMNRLVQLLRGDDRL-AE  425

Query  424   LRQ----SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             L+Q    +++VS +   + D TS+SY   L RH QL+ME
Sbjct  426   LQQKTGGARTVSLDECDL-DHTSSSYLNDLTRHRQLLME  463



>dbj|BAA98172.1| unnamed protein product [Arabidopsis thaliana]
Length=418

 Score =   461 bits (1187),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/387 (60%), Positives = 298/387 (77%), Gaps = 6/387 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWR  1295
             QW  + + IK+KS + F ++PL   +++ RK ++     S CSE++ DC    + KPSWR
Sbjct  35    QWNKMIESIKKKSIRRFSVIPLLASYELTRKKKQP--KLSPCSENDFDCDQILVAKPSWR  92

Query  1294  NFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLS  1115
             NFT  EL  ATDNF+ ENM+GKGGHAEVYKG L DG+ +A+K++ +  K+ EER+ DFLS
Sbjct  93    NFTFDELVAATDNFNPENMIGKGGHAEVYKGVLPDGETVAIKKLTRHAKEVEERVSDFLS  152

Query  1114  ELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGV  935
             ELGIIAH+NHPNAA+L GFS D GLH VL+Y  HGSLA LL  + E L+WK R+KVA+G+
Sbjct  153   ELGIIAHVNHPNAARLRGFSCDRGLHFVLEYSSHGSLASLLFGSEECLDWKKRYKVAMGI  212

Query  934   AEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTF  755
             A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH+V PIEGTF
Sbjct  213   ADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPEHWPHHIVFPIEGTF  272

Query  754   GYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKEL  578
             GY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMWAKPLLE+NN++E+
Sbjct  273   GYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTDSRQSIVMWAKPLLEKNNMEEI  332

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR-QSKSVS  401
              DP+LG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+G+++L  +    +++VS
Sbjct  333   VDPQLGNDFDETEMKRVMQTASMCIHHVSTMRPDMNRLVQLLRGDDQLAEQKPGGARTVS  392

Query  400   SESLHIADFTSTSYRKHLDRHLQLIME  320
              +   + D TS+SY   L RH QL+ME
Sbjct  393   LDDCDL-DHTSSSYLNDLTRHRQLLME  418



>ref|NP_201356.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AED98067.1| protein kinase family protein [Arabidopsis thaliana]
Length=456

 Score =   462 bits (1189),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 231/387 (60%), Positives = 298/387 (77%), Gaps = 6/387 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWR  1295
             QW  + + IK+KS + F ++PL   +++ RK ++     S CSE++ DC    + KPSWR
Sbjct  73    QWNKMIESIKKKSIRRFSVIPLLASYELTRKKKQP--KLSPCSENDFDCDQILVAKPSWR  130

Query  1294  NFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLS  1115
             NFT  EL  ATDNF+ ENM+GKGGHAEVYKG L DG+ +A+K++ +  K+ EER+ DFLS
Sbjct  131   NFTFDELVAATDNFNPENMIGKGGHAEVYKGVLPDGETVAIKKLTRHAKEVEERVSDFLS  190

Query  1114  ELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGV  935
             ELGIIAH+NHPNAA+L GFS D GLH VL+Y  HGSLA LL  + E L+WK R+KVA+G+
Sbjct  191   ELGIIAHVNHPNAARLRGFSCDRGLHFVLEYSSHGSLASLLFGSEECLDWKKRYKVAMGI  250

Query  934   AEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTF  755
             A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH+V PIEGTF
Sbjct  251   ADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPEHWPHHIVFPIEGTF  310

Query  754   GYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKEL  578
             GY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMWAKPLLE+NN++E+
Sbjct  311   GYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTDSRQSIVMWAKPLLEKNNMEEI  370

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR-QSKSVS  401
              DP+LG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+G+++L  +    +++VS
Sbjct  371   VDPQLGNDFDETEMKRVMQTASMCIHHVSTMRPDMNRLVQLLRGDDQLAEQKPGGARTVS  430

Query  400   SESLHIADFTSTSYRKHLDRHLQLIME  320
              +   + D TS+SY   L RH QL+ME
Sbjct  431   LDDCDL-DHTSSSYLNDLTRHRQLLME  456



>gb|KFK25325.1| hypothetical protein AALP_AA8G098100 [Arabis alpina]
Length=477

 Score =   463 bits (1191),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 227/388 (59%), Positives = 291/388 (75%), Gaps = 6/388 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             QW  + D IK+KS + F ++PL  +  +R  R+     S  +     C  F + KPSWRN
Sbjct  92    QWNKMIDSIKKKSIRRFTVIPLLANKNLR--RKQPPKLSPANHVRFPCDHFFMAKPSWRN  149

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             FT +EL+ ATDNF+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++E R+ DFLSE
Sbjct  150   FTYEELALATDNFNPENMIGKGGHAEVYKGVLSDGETVAIKKLMSHAKEEEARVSDFLSE  209

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             LGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA +L  + E LEWKIR+KVA+G+A
Sbjct  210   LGIIAHVNHPNAARLRGFSSDRGLHFVLEYSPHGSLATMLFGSEECLEWKIRYKVALGIA  269

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
             +GL YLH  C RRIIHRDI ASNILL  DY AQISDFGLAKWLPE W HHVV PIEGTFG
Sbjct  270   DGLSYLHNACPRRIIHRDIKASNILLNSDYEAQISDFGLAKWLPENWPHHVVFPIEGTFG  329

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKELA  575
             YMAPEYFMHG+VDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP L++N+++++ 
Sbjct  330   YMAPEYFMHGVVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLDKNSVEDIV  389

Query  574   DPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQSKSV  404
             DPRLG+ +D  EM+R M  A  CI H+  MRPNM ++V++L+GE+   EL+ +    + +
Sbjct  390   DPRLGNEFDRTEMKRVMLTASMCIHHIAKMRPNMTRLVQLLRGEDGPAELQQKQPCERIL  449

Query  403   SSESLHIADFTSTSYRKHLDRHLQLIME  320
             S  +  + D TS+SY   L RH+QL+ME
Sbjct  450   SVNACDLQDHTSSSYLNELTRHMQLLME  477



>dbj|BAC43270.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63452.1| At5g65530 [Arabidopsis thaliana]
Length=456

 Score =   461 bits (1185),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 231/387 (60%), Positives = 297/387 (77%), Gaps = 6/387 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWR  1295
             QW  + + IK+KS + F ++PL   +++ RK ++     S CSE++ DC    + KPSWR
Sbjct  73    QWNKMIESIKKKSIRRFSVIPLLASYELTRKKKQP--KLSPCSENDFDCDQILVAKPSWR  130

Query  1294  NFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLS  1115
             NFT  EL  ATDNF+ ENM+GKGGHAEVYKG L DG+ +A+K++ +  K+ EER+ DFLS
Sbjct  131   NFTFDELVAATDNFNPENMIGKGGHAEVYKGVLPDGETVAIKKLTRHAKEVEERVSDFLS  190

Query  1114  ELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGV  935
             ELGIIAH+NHPNAA+L GFS D GLH VL+Y  HGSLA LL  + E L+WK R+KVA+G+
Sbjct  191   ELGIIAHVNHPNAARLRGFSCDRGLHFVLEYSSHGSLASLLFGSEECLDWKKRYKVAMGI  250

Query  934   AEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTF  755
             A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH+V PIEGTF
Sbjct  251   ADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPEHWPHHIVFPIEGTF  310

Query  754   GYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKEL  578
             GY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMWAKPLLE+NN++E+
Sbjct  311   GYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTDSRQSIVMWAKPLLEKNNMEEI  370

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR-QSKSVS  401
              DP+LG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+G+++L  +    +++VS
Sbjct  371   VDPQLGNDFDETEMKRVMQTASMCIHHVSTMRPDMNRLVQLLRGDDQLAEQKPGGARTVS  430

Query  400   SESLHIADFTSTSYRKHLDRHLQLIME  320
              +   + D TS+SY   L RH QL ME
Sbjct  431   LDDCDL-DHTSSSYLNDLTRHRQLSME  456



>ref|XP_002866677.1| hypothetical protein ARALYDRAFT_496787 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42936.1| hypothetical protein ARALYDRAFT_496787 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   461 bits (1185),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 232/389 (60%), Positives = 298/389 (77%), Gaps = 10/389 (3%)
 Frame = -3

Query  1483  PTAV----QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDF  1319
             PT V    QW  + + IK+KS + F ++PL   +++ RK+ R     S CSE+  DC   
Sbjct  68    PTNVSSFHQWNKMIESIKKKSIRRFSVIPLLASYELTRKNMRR--KLSPCSENEFDCDQI  125

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
              +TKPSWRNFT  EL  ATDNF+ ENM+GKGGHAEVYKG L DG+ +A+K++ +  K+ E
Sbjct  126   LVTKPSWRNFTFDELVAATDNFNPENMIGKGGHAEVYKGVLPDGETVAIKKLTRHAKEVE  185

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
             ER+ DFLSELGIIAH+NHPNAA+L GFS D GLH VL+Y PHGSLA LL  + E L+WK 
Sbjct  186   ERVSDFLSELGIIAHVNHPNAARLRGFSCDRGLHFVLEYAPHGSLASLLFGSEECLDWKK  245

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             R+KVA+G+A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH+
Sbjct  246   RYKVALGIADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENWPHHI  305

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLL  602
             V PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMWAKPLL
Sbjct  306   VFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSIVMWAKPLL  365

Query  601   EQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL  422
             E+N+++E+ DP+LG+ +D +EM+R M  A  CI H+  MRP+M ++V++L+G+++L  + 
Sbjct  366   EKNSVEEIVDPQLGNDFDEIEMKRVMQTASMCIHHVSTMRPDMNRLVQLLRGDDQLAEQK  425

Query  421   R-QSKSVSSESLHIADFTSTSYRKHLDRH  338
                +++VS +   + D TS+SY   L RH
Sbjct  426   PGGARTVSLDDCDL-DHTSSSYLNDLTRH  453



>ref|XP_008236283.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Prunus mume]
Length=473

 Score =   461 bits (1185),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 239/400 (60%), Positives = 296/400 (74%), Gaps = 13/400 (3%)
 Frame = -3

Query  1480  TAVQWKS--IFDQIKRKSAKSFPIVPLFGHDI----IRKSRRMFFSWS-RCSEDNIDCGD  1322
               +QWK   +FD +K+KSA+ F  +PL G           RR+   W+    E+  D   
Sbjct  73    NGLQWKGKGMFDALKKKSARRFSTIPLLGTSYELSRRNLRRRLARIWTAEDEEEGADVDG  132

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
               +TKPSWRNF   EL+ AT NF  EN++GKGG AEVYKG L +GQ+IAVKR++K++K+ 
Sbjct  133   MIVTKPSWRNFDFAELAAATGNFKPENLVGKGGQAEVYKGLLSNGQIIAVKRLMKKEKEK  192

Query  1141  eerieD--FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             E       FL ELGIIAHI+HPNAA+L+GF  D GLHLVLQ+ PHGSLA LL  + E+++
Sbjct  193   ENEDRIGDFLGELGIIAHISHPNAARLLGFGIDGGLHLVLQFSPHGSLASLLFGSEESMD  252

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             WK+RFKVAVG+AEGL YLH  C RRIIHRDI ASNILLTEDY AQISDFGLAKWLPEKW 
Sbjct  253   WKVRFKVAVGIAEGLRYLHHECHRRIIHRDIKASNILLTEDYDAQISDFGLAKWLPEKWT  312

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HHVV PIEGTFGY++PEYFMHGIVDEKTDVFA+GVLLLELITGR+AVDS++QSLV+WAKP
Sbjct  313   HHVVFPIEGTFGYLSPEYFMHGIVDEKTDVFAYGVLLLELITGRRAVDSTQQSLVIWAKP  372

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL+ +N+KELADPRL DA+D VEM+R+M  A  CI H    RP M +VV++LKGE  +  
Sbjct  373   LLDASNVKELADPRLEDAFDPVEMKRAMVTASMCISHQSTKRPYMNRVVQILKGEGGIVD  432

Query  427   ELRQSKSVSS----ESLHIADFTSTSYRKHLDRHLQLIME  320
             +L+Q  SV      E+  + D+T ++Y   L+RH QL+M+
Sbjct  433   QLKQKSSVVRSLVLEACDLEDYTCSNYLSDLNRHRQLVMD  472



>ref|XP_007205169.1| hypothetical protein PRUPE_ppa005494mg [Prunus persica]
 gb|EMJ06368.1| hypothetical protein PRUPE_ppa005494mg [Prunus persica]
Length=458

 Score =   460 bits (1183),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 239/400 (60%), Positives = 296/400 (74%), Gaps = 13/400 (3%)
 Frame = -3

Query  1480  TAVQWKS--IFDQIKRKSAKSFPIVPLFGHDI----IRKSRRMFFSWS-RCSEDNIDCGD  1322
               +QWK   +FD +K+KSA+ F  +PL G           RR+   W+    E+  D   
Sbjct  58    NGLQWKGKGMFDALKKKSARRFSTIPLLGTSYELSRRNLRRRLARIWTAEDEEEGADVDG  117

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
               +TKPSWRNF   EL+ AT NF  EN++GKGG AEVYKG L +GQ+IAVK+++K+DK+ 
Sbjct  118   MIVTKPSWRNFDFAELAAATGNFKPENLVGKGGQAEVYKGLLSNGQIIAVKKLMKKDKEK  177

Query  1141  eerieD--FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             E       FL ELGIIAHI+HPNAA+L+GF  D GLHLVLQ+ PHGSLA LL  + E+++
Sbjct  178   ENEDRVGDFLGELGIIAHISHPNAARLLGFGIDGGLHLVLQFSPHGSLASLLFGSEESMD  237

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             WK+RFKVAVG+AEGL YLH  C RRIIHRDI ASNILLTEDY AQISDFGLAKWLPEKW 
Sbjct  238   WKVRFKVAVGIAEGLRYLHHECHRRIIHRDIKASNILLTEDYEAQISDFGLAKWLPEKWT  297

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HHVV PIEGTFGY++PEYFMHGIVDEKTDVFA+GVLLLELITGR+AVDS++QSLV+WAKP
Sbjct  298   HHVVFPIEGTFGYLSPEYFMHGIVDEKTDVFAYGVLLLELITGRRAVDSTQQSLVIWAKP  357

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL+ +N+KELADPRL DA+D VEM+R+M  A  CI H    RP M +VV++LKGE  +  
Sbjct  358   LLDASNVKELADPRLEDAFDPVEMKRAMVTASMCISHQSTKRPYMNRVVQILKGEGGIVD  417

Query  427   ELRQSKSVSS----ESLHIADFTSTSYRKHLDRHLQLIME  320
             +L+Q  SV      E+  + D+T ++Y   L+RH QL+M+
Sbjct  418   QLKQKSSVVRSLVLEACDLEDYTCSNYLSDLNRHRQLVMD  457



>ref|XP_008450192.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Cucumis melo]
Length=466

 Score =   458 bits (1178),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 237/394 (60%), Positives = 297/394 (75%), Gaps = 9/394 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKP  1304
              + WK++   IK+KS   F  +PL    ++I RK+ +   +  R +++ I   D    KP
Sbjct  74    GIPWKAMIGCIKKKSVWRFSTIPLLAASYEISRKNFKRKLARIRSADEGITSDDIPFCKP  133

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRN+   ELS AT+NFS EN+LGKGG AEVYKG L DG+++AVKR++K++K++EER  D
Sbjct  134   SWRNYGFSELSAATNNFSPENLLGKGGQAEVYKGCLSDGKIVAVKRLMKKEKENEERTAD  193

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAHINHPNAA+L+GF  ++GL+LVL+++PHGS A  L  A E+LEW IRFKVA
Sbjct  194   FLSELGIIAHINHPNAARLLGFGIESGLYLVLEFIPHGSFASALFGA-ESLEWNIRFKVA  252

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +GVAEGL+YLHC C RRIIHRDI ASNILL E+Y   ISDFGLAKWLPE W HHVV PIE
Sbjct  253   LGVAEGLNYLHCECPRRIIHRDIKASNILLAENYEPLISDFGLAKWLPENWAHHVVFPIE  312

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+APEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDSSRQSLV+WAKPLL+ N+ K
Sbjct  313   GTFGYLAPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSSRQSLVIWAKPLLDNNSFK  372

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---  413
             EL DP+LGD YD  EM R+M  A  CI H  +MRP+M +VV++LKGE+    +L+     
Sbjct  373   ELTDPKLGDDYDQTEMRRTMLAASMCINHSSSMRPHMNRVVQLLKGEDGPLDQLKHKSMD  432

Query  412   --KSVSSESLHIADFT-STSYRKHLDRHLQLIME  320
               +S   E+  + D+T +TSY   L RH +L++E
Sbjct  433   GDRSFLLEACDLEDYTNNTSYLNDLSRHRELVLE  466



>ref|XP_010319534.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1, partial [Solanum lycopersicum]
Length=311

 Score =   451 bits (1161),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 225/311 (72%), Positives = 275/311 (88%), Gaps = 3/311 (1%)
 Frame = -3

Query  1249  SENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAK  1070
             ++ ++G+GGHA+VYKGRL DGQV+AVK+I K++KKDE++++DFLSELGIIAHINHPNAAK
Sbjct  3     TDKLIGQGGHADVYKGRLSDGQVVAVKKITKQEKKDEDKVDDFLSELGIIAHINHPNAAK  62

Query  1069  LIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRI  890
             LIG+SAD GL+LVLQYL HGSL  L+H + E L+W IR+KVA G+AEGL YLHC C +RI
Sbjct  63    LIGYSADGGLYLVLQYLHHGSLGSLIHGSDERLDWDIRYKVAAGIAEGLLYLHCECPKRI  122

Query  889   IHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDE  710
             IHRDITASNILLTEDY  QISDFGLAKWLPEKW HHVVSPIEGTFGYMAPEYFMHGIV+E
Sbjct  123   IHRDITASNILLTEDYEPQISDFGLAKWLPEKWVHHVVSPIEGTFGYMAPEYFMHGIVNE  182

Query  709   KTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMER  530
             KTDVFAFGVLLLELITGR+AVDS R+SLV+WAKPLL++NNIKE+ADPRLGD YDVVEM+R
Sbjct  183   KTDVFAFGVLLLELITGRRAVDSYRKSLVLWAKPLLQKNNIKEIADPRLGDVYDVVEMKR  242

Query  529   SMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVSSESLHIA-DFTSTSYRK  353
             +MF AL C+ HLP++RPNMKKVV++L+GEN   VE++Q +S+   +L  + ++TST Y +
Sbjct  243   AMFTALCCLHHLPDIRPNMKKVVQLLRGENA-PVEMKQ-RSMGGRALMFSHEYTSTHYIQ  300

Query  352   HLDRHLQLIME  320
              L+RH++L+ME
Sbjct  301   DLNRHMELVME  311



>gb|KHN38884.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Glycine soja]
Length=453

 Score =   456 bits (1173),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 245/391 (63%), Positives = 291/391 (74%), Gaps = 9/391 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLF--GHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             Q  ++ D  K KS +    VPLF  G+DI RK      +  R +ED ID G    TKPSW
Sbjct  65    QLMTMIDVFKFKSVRKLTAVPLFAVGNDISRKGLTKKLARIRSAEDGIDIGAIP-TKPSW  123

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNF  +EL  AT +FSSEN+LGKGGHAEVYKG L DGQVIAVKR++K +K   +R  DFL
Sbjct  124   RNFDYEELVAATGDFSSENLLGKGGHAEVYKGHLPDGQVIAVKRLMKNEKDAADRAGDFL  183

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAHINHPNA +LIGF  D GL+ VLQ   HGSL+ LL   +E L+WKIR KVAVG
Sbjct  184   TELGIIAHINHPNATRLIGFGVDRGLYFVLQLASHGSLSSLLF-GSECLDWKIRSKVAVG  242

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             VA+GL YLH  C RRIIHRDI ASNILL E+Y A+ISDFGLAKWLP KW  HVV PIEGT
Sbjct  243   VADGLVYLHKECPRRIIHRDIKASNILLNENYEAEISDFGLAKWLPSKWTSHVVFPIEGT  302

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKE  581
             FGY+APEYFMHG+VDEKTDVFA+GVLLLELITGR+AVDS SRQSLV+WAKPLL+ NN+K+
Sbjct  303   FGYLAPEYFMHGVVDEKTDVFAYGVLLLELITGRRAVDSDSRQSLVIWAKPLLDTNNVKD  362

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQSK  410
             LADPRLG+ YD +EM+R+M  A  C+ H+ + RP M +VV++LKGE    E K  L   K
Sbjct  363   LADPRLGEEYDPIEMKRAMVTASRCVHHVSSKRPYMNQVVQLLKGEETIMEPKKTLVAQK  422

Query  409   SVSSESLHI-ADFTSTSYRKHLDRHLQLIME  320
             S+  E+  +  D+T +SY K L+RH QLIME
Sbjct  423   SLMLEACDLEEDYTCSSYLKDLNRHRQLIME  453



>ref|XP_006399550.1| hypothetical protein EUTSA_v10013425mg [Eutrema salsugineum]
 gb|ESQ41003.1| hypothetical protein EUTSA_v10013425mg [Eutrema salsugineum]
Length=477

 Score =   457 bits (1175),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 231/392 (59%), Positives = 299/392 (76%), Gaps = 8/392 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS-RRMFFSWSRCSEDNIDCGDFSITKP  1304
              +QW  + + IK+KS + F + PL   +++ RK+ RR     S C E+   C  F + KP
Sbjct  88    GLQWNKMIESIKKKSIRRFSVYPLVASYELTRKNLRRKQPKLSPC-ENGFPCETFFMAKP  146

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRNFT +EL+ ATD+F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++EER+ D
Sbjct  147   SWRNFTYEELAVATDDFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMSHAKEEEERVSD  206

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAH+NHPNAA+L GFS D GLH VL+Y PHGSLA +L  + E LEWKIR+KVA
Sbjct  207   FLSELGIIAHVNHPNAARLRGFSCDRGLHFVLEYSPHGSLASMLFGSEECLEWKIRYKVA  266

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+A+GL YLH VC RRIIHRDI ASNILL+ DY AQISDFGLAKWLP+ W HHVV PIE
Sbjct  267   LGIADGLSYLHNVCPRRIIHRDIKASNILLSRDYEAQISDFGLAKWLPDNWPHHVVFPIE  326

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGYMAPEYF+HGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++
Sbjct  327   GTFGYMAPEYFIHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSV  386

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQ  416
             +++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+GE+   EL+ +  +
Sbjct  387   EDIVDPRLGNEFDPTEMQRVMLTASMCIHHIATMRPDMTRLVQLLRGEDGPGELQKKPCE  446

Query  415   SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              ++VS  +  + D TS+SY   L RH QL+ME
Sbjct  447   -RAVSVNACDLQDHTSSSYLNELSRHRQLLME  477



>ref|XP_003534246.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform 1 [Glycine max]
Length=453

 Score =   456 bits (1172),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 245/391 (63%), Positives = 291/391 (74%), Gaps = 9/391 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLF--GHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             Q  ++ D  K KS +    VPLF  G+DI RK      +  R +ED ID G    TKPSW
Sbjct  65    QLMTMIDVFKFKSVRKLTAVPLFAVGNDISRKGLTKKLARIRSAEDGIDIGAIP-TKPSW  123

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNF  +EL  AT +FSSEN+LGKGGHAEVYKG L DGQVIAVKR++K +K   +R  DFL
Sbjct  124   RNFDYEELVAATGDFSSENLLGKGGHAEVYKGHLPDGQVIAVKRLMKNEKDAADRAGDFL  183

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAHINHPNA +LIGF  D GL+ VLQ   HGSL+ LL   +E L+WKIR KVAVG
Sbjct  184   TELGIIAHINHPNATRLIGFGVDRGLYFVLQLASHGSLSSLLF-GSECLDWKIRSKVAVG  242

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             VA+GL YLH  C RRIIHRDI ASNILL E+Y A+ISDFGLAKWLP KW  HVV PIEGT
Sbjct  243   VADGLVYLHKECPRRIIHRDIKASNILLNENYEAEISDFGLAKWLPSKWTSHVVFPIEGT  302

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKE  581
             FGY+APEYFMHG+VDEKTDVFA+GVLLLELITGR+AVDS SRQSLV+WAKPLL+ NN+K+
Sbjct  303   FGYLAPEYFMHGVVDEKTDVFAYGVLLLELITGRRAVDSDSRQSLVIWAKPLLDTNNVKD  362

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQSK  410
             LADPRLG+ YD +EM+R+M  A  C+ H+ + RP M +VV++LKGE    E K  L   K
Sbjct  363   LADPRLGEEYDPIEMKRAMVTASRCVHHVSSKRPYMNQVVQLLKGEETIMEPKKTLVAQK  422

Query  409   SVSSESLHI-ADFTSTSYRKHLDRHLQLIME  320
             S+  E+  +  D+T +SY K L+RH QLIME
Sbjct  423   SLMLEACDLEEDYTCSSYLKDLNRHRQLIME  453



>ref|XP_009122043.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Brassica rapa]
Length=479

 Score =   456 bits (1173),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 230/396 (58%), Positives = 300/396 (76%), Gaps = 11/396 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMF---FSWSRCSEDNIDCGDFSIT  1310
              +QW  + + IK+KS + F ++PL   +++ RK+ R     F +   SE+   C  F + 
Sbjct  85    GLQWNKMIESIKKKSIRRFTVIPLLASYELTRKNLRRKQPKFPFP-PSENGFPCERFFMP  143

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNFT +EL+ ATD+F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++E+R+
Sbjct  144   KPSWRNFTYEELAAATDDFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMSHAKEEEDRV  203

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
              DFLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSL+  L  + E LEWKIR+K
Sbjct  204   SDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPHGSLSTKLFGSEECLEWKIRYK  263

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VA+G+A+GL YLH VC RRIIHRDI ASNILL+ DY AQISDFGLAKWLPE W HHVV P
Sbjct  264   VALGIADGLSYLHNVCPRRIIHRDIKASNILLSRDYDAQISDFGLAKWLPENWDHHVVFP  323

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQN  593
             IEGTFGYMAPEYF+HGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N
Sbjct  324   IEGTFGYMAPEYFIHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKN  383

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL-KVELRQ  416
             +++++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M +VV++L+GE+   ++EL+Q
Sbjct  384   SVEDIVDPRLGNEFDPTEMKRLMLTASMCIHHIATMRPDMTRVVQLLRGEDSTAELELQQ  443

Query  415   SK----SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                   +V + +  + D TS+SY   L RH QL+ME
Sbjct  444   KPGEGGAVIANACDLQDHTSSSYLNELIRHRQLLME  479



>emb|CDX69825.1| BnaA10g21740D [Brassica napus]
Length=479

 Score =   456 bits (1172),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 230/396 (58%), Positives = 300/396 (76%), Gaps = 11/396 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMF---FSWSRCSEDNIDCGDFSIT  1310
              +QW  + + IK+KS + F ++PL   +++ RK+ R     F +   SE+   C  F + 
Sbjct  85    GLQWNKMIESIKKKSIRRFTVIPLLASYELTRKNLRRKQPKFPFP-PSENGFPCERFFMP  143

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNFT +EL+ ATD+F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++E+R+
Sbjct  144   KPSWRNFTYEELAAATDDFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMSHAKEEEDRV  203

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
              DFLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSL+  L  + E LEWKIR+K
Sbjct  204   SDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPHGSLSTKLFGSEECLEWKIRYK  263

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VA+G+A+GL YLH VC RRIIHRDI ASNILL+ DY AQISDFGLAKWLPE W HHVV P
Sbjct  264   VALGIADGLSYLHNVCPRRIIHRDIKASNILLSRDYDAQISDFGLAKWLPENWDHHVVFP  323

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQN  593
             IEGTFGYMAPEYF+HGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N
Sbjct  324   IEGTFGYMAPEYFIHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKN  383

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE-LKVELRQ  416
             +++++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M +VV++L+GE+   ++EL+Q
Sbjct  384   SVEDIVDPRLGNEFDPTEMKRVMLTASMCIHHIATMRPDMTRVVQLLRGEDSPAELELQQ  443

Query  415   SK----SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                   +V + +  + D TS+SY   L RH QL+ME
Sbjct  444   KPGEGGAVIANACDLQDHTSSSYLNELIRHRQLLME  479



>ref|XP_009122042.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Brassica rapa]
Length=491

 Score =   456 bits (1173),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 230/396 (58%), Positives = 300/396 (76%), Gaps = 11/396 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMF---FSWSRCSEDNIDCGDFSIT  1310
              +QW  + + IK+KS + F ++PL   +++ RK+ R     F +   SE+   C  F + 
Sbjct  97    GLQWNKMIESIKKKSIRRFTVIPLLASYELTRKNLRRKQPKFPFP-PSENGFPCERFFMP  155

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNFT +EL+ ATD+F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++E+R+
Sbjct  156   KPSWRNFTYEELAAATDDFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMSHAKEEEDRV  215

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
              DFLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSL+  L  + E LEWKIR+K
Sbjct  216   SDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPHGSLSTKLFGSEECLEWKIRYK  275

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VA+G+A+GL YLH VC RRIIHRDI ASNILL+ DY AQISDFGLAKWLPE W HHVV P
Sbjct  276   VALGIADGLSYLHNVCPRRIIHRDIKASNILLSRDYDAQISDFGLAKWLPENWDHHVVFP  335

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQN  593
             IEGTFGYMAPEYF+HGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N
Sbjct  336   IEGTFGYMAPEYFIHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKN  395

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL-KVELRQ  416
             +++++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M +VV++L+GE+   ++EL+Q
Sbjct  396   SVEDIVDPRLGNEFDPTEMKRLMLTASMCIHHIATMRPDMTRVVQLLRGEDSTAELELQQ  455

Query  415   SK----SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                   +V + +  + D TS+SY   L RH QL+ME
Sbjct  456   KPGEGGAVIANACDLQDHTSSSYLNELIRHRQLLME  491



>ref|XP_002873463.1| hypothetical protein ARALYDRAFT_487885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49722.1| hypothetical protein ARALYDRAFT_487885 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   454 bits (1169),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 228/390 (58%), Positives = 294/390 (75%), Gaps = 6/390 (2%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             +QW  + + IK+KS + F ++PL   +++ RK+ R        SE    C  F + KPSW
Sbjct  79    LQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKLSPSEKAFTCEAFFMAKPSW  138

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNFT +EL+ ATD F+ ENM+GKGGHAEVYKG L +G+ +A+K+++   K++EER+ DFL
Sbjct  139   RNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLLNGETVAIKKLMSHAKEEEERVSDFL  198

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             SELGIIAH+NHPNAA+L GFS+D GLH VL+Y P+GSLA +L  + E LEWKIR+KVA+G
Sbjct  199   SELGIIAHVNHPNAARLRGFSSDRGLHFVLEYSPYGSLASMLFGSEECLEWKIRYKVALG  258

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             +A+GL YLH  C RRIIHRDI ASNILL  DY AQISDFGLAKWLPE W HHVV PIEGT
Sbjct  259   IADGLSYLHNACPRRIIHRDIKASNILLNRDYEAQISDFGLAKWLPENWPHHVVFPIEGT  318

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKE  581
             FGY+APEYFMHGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++++
Sbjct  319   FGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMED  378

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK---  410
             + DPRLG+ ++  EM+R M  A  CI H+  MRP+M ++V++L+GE+    EL+Q K   
Sbjct  379   IVDPRLGNKFNPTEMQRVMLTASMCIHHIAAMRPDMTRLVQLLRGEDG-PAELQQKKGER  437

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +VS  +  + D TS+SY   L RH QL+ME
Sbjct  438   AVSVNACDLQDHTSSSYLNELSRHRQLLME  467



>ref|XP_006287662.1| hypothetical protein CARUB_v10000873mg [Capsella rubella]
 gb|EOA20560.1| hypothetical protein CARUB_v10000873mg [Capsella rubella]
Length=474

 Score =   454 bits (1167),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 227/392 (58%), Positives = 295/392 (75%), Gaps = 8/392 (2%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS--RRMFFSWSRCSEDNIDCGDFSITKP  1304
             +QW  + + IK+KS + F ++PL   +++ RK+  R+    +S     +     F + KP
Sbjct  84    LQWNRMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPAKFSPSDNSSFPSEAFFMAKP  143

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRNFT +EL+ ATD F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++EER+ D
Sbjct  144   SWRNFTYEELAAATDYFNPENMIGKGGHAEVYKGVLADGETVAIKKLMSHAKEEEERVSD  203

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA +L  + E LEWKIR+KVA
Sbjct  204   FLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYSPHGSLASMLFGSEECLEWKIRYKVA  263

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+A+GL YLH  C RRIIHRDI ASNILL +DY AQISDFGLAKWLPE W HHVV PIE
Sbjct  264   LGIADGLSYLHNACPRRIIHRDIKASNILLNQDYEAQISDFGLAKWLPENWPHHVVFPIE  323

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGY+APEYFMHGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++
Sbjct  324   GTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSM  383

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS--  413
             +++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+GE+    EL+    
Sbjct  384   EDIVDPRLGNEFDPTEMQRVMLAASMCIHHIAAMRPDMIRLVQLLRGEDG-PFELQHKAC  442

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              ++VS  +  + D TS+SY   L RH QL+ME
Sbjct  443   ERTVSVNACDLQDHTSSSYLNELTRHRQLLME  474



>ref|XP_009364240.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Pyrus x bretschneideri]
Length=473

 Score =   453 bits (1166),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/392 (59%), Positives = 290/392 (74%), Gaps = 10/392 (3%)
 Frame = -3

Query  1465  KSIFDQIKRKSAKSFPIVPLFGHDI----IRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             K +FD +K+KSA+ F  +P+ G           RR+   W+   E+       S+TKPSW
Sbjct  81    KGMFDALKKKSARRFSTIPILGASYELSRRNLRRRLARIWNADDEEEEGADGMSVTKPSW  140

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD--  1124
             RNF   EL+ AT NF  EN++GKGG AEVYKG L +G ++AVKR++K++K+ E       
Sbjct  141   RNFDYAELAAATANFKPENLIGKGGQAEVYKGFLSNGTIVAVKRLMKKEKEKENEDRVGD  200

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FL+E+GIIAHI HPNAA+L+GF  D+GLHLVLQ+ PHGSLA LL    E ++WKIRFKVA
Sbjct  201   FLAEVGIIAHIRHPNAARLLGFGIDSGLHLVLQFSPHGSLASLLFGTAECMDWKIRFKVA  260

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+AEGL YLH  C RRIIHRDI ASNILLTEDY AQISDFGLAKWLPEKW HHVV PIE
Sbjct  261   IGIAEGLRYLHHECHRRIIHRDIKASNILLTEDYEAQISDFGLAKWLPEKWTHHVVFPIE  320

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY++PEYFMHGIVDEKTDVFA+GVLLLELITGR+AVDS++QSLV WAKPLL+ +N+K
Sbjct  321   GTFGYLSPEYFMHGIVDEKTDVFAYGVLLLELITGRRAVDSTQQSLVTWAKPLLDASNMK  380

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---  413
             ELADP L DAYD +EM+R+M  A  CI H    RP M + V++LKGE+ +  +LRQ    
Sbjct  381   ELADPLLEDAYDPIEMKRAMVTASMCISHQSTRRPYMNRAVQMLKGEDGVADQLRQKSTA  440

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              +S+  ES  + D+T ++Y   L+RH QL+++
Sbjct  441   VRSLVLESCDLEDYTCSNYLSDLNRHRQLVLD  472



>emb|CDY08783.1| BnaA06g24410D [Brassica napus]
Length=456

 Score =   452 bits (1163),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 228/391 (58%), Positives = 295/391 (75%), Gaps = 7/391 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS-RRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             QW  + + IK+KS + F ++PL   +++ RK+ RR     S   ++  DC  F + KPSW
Sbjct  66    QWNKMIESIKKKSIRRFSVIPLLASYELTRKNMRRKQPKLSPLPDNVFDCDQFLVAKPSW  125

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNFT  EL  ATD F++E M+GKGGHAEVYKG L DG+++A+KR+ +   + EER+ DFL
Sbjct  126   RNFTYDELVAATDGFNAEKMIGKGGHAEVYKGVLPDGEIVAIKRLTRHANEAEERVSDFL  185

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE--TLEWKIRFKVA  944
             SELG+IAH+NHPNAAKL GFS D GLH VL+Y PHGSLA LL  ++E   L+WK R++VA
Sbjct  186   SELGMIAHVNHPNAAKLRGFSCDRGLHFVLEYAPHGSLASLLFGSSEEECLDWKKRYRVA  245

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +GVA+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH+V PIE
Sbjct  246   LGVADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENWPHHIVFPIE  305

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMWAKPLLE++++
Sbjct  306   GTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSIVMWAKPLLEKSSV  365

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLK--GENELKVELRQS  413
             +E+ DP+LG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+  G++ L    + S
Sbjct  366   EEIVDPKLGNEFDETEMKRVMQTASMCIHHVAAMRPDMNRLVQLLRGGGDDRLAETQQIS  425

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +  S +   + D TS+SY   L RH QL+ME
Sbjct  426   RRKSLDGCDLQDHTSSSYLNDLTRHRQLLME  456



>ref|XP_010519128.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Tarenaya hassleriana]
Length=448

 Score =   452 bits (1162),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 230/391 (59%), Positives = 296/391 (76%), Gaps = 6/391 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLF-GHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              +QW  + + IK+KS + F ++PL   +++ RK+       +  S  +  C  F + KPS
Sbjct  59    GLQWNKMIENIKKKSTRRFSVIPLLTSYELSRKNLWKKQPKNPPSGYDASCDHFLVAKPS  118

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNFT  EL  ATD+F+ +NM+GKGG+AEVYKG L DG+++A+K+++   K +EER+ DF
Sbjct  119   WRNFTYDELVTATDDFNPDNMIGKGGNAEVYKGTLPDGEIVAIKKLMGNAKAEEERVSDF  178

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAH+NHPNAA L GFS+D GLH VL+Y PHGSLA LL  A + L WKIR+KVA+
Sbjct  179   LSELGIIAHVNHPNAAHLRGFSSDRGLHFVLEYSPHGSLASLLFEAEKCLGWKIRYKVAL  238

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A+GL YLH  C RRIIHRDI ASNIL+T+D+ AQISDFGLAKWLPE W HHVV PIEG
Sbjct  239   GIADGLCYLHNGCPRRIIHRDIKASNILVTKDFEAQISDFGLAKWLPENWSHHVVFPIEG  298

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIK  584
             TFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQSLVMWAKPLLE+N++ 
Sbjct  299   TFGYLAPEYFMHGIVDEKTDVFAFGVLLLEVITGRRAVDTASRQSLVMWAKPLLEKNSVA  358

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---  413
              + DPRLGD +D  EM+  M  A  CI H+  MRP+M +VV++L+GE+   VE+++S   
Sbjct  359   GIVDPRLGDNFDPTEMKLVMLTASMCIHHIATMRPHMTQVVQLLRGEDG-SVEMQKSGGG  417

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             ++VS +  ++ D+T  SY   L RH QL+ME
Sbjct  418   RAVSLDGCYLQDYTCASYLNELCRHRQLVME  448



>emb|CDX97023.1| BnaC09g46020D [Brassica napus]
Length=491

 Score =   453 bits (1166),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 228/398 (57%), Positives = 295/398 (74%), Gaps = 15/398 (4%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG------HDIIRKSRRMFFSWSRCSEDNIDCGDFS  1316
              +QW  + + IK+KS + F ++PL         ++ RK  ++ F     SE+   C  F 
Sbjct  97    GLQWNKMIESIKKKSIRRFTVIPLLASYELTRKNLRRKQPKLPFP---PSENGFPCERFF  153

Query  1315  ITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdee  1136
             + KPSWRNFT +EL  ATD+F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++E+
Sbjct  154   MPKPSWRNFTYEELVAATDDFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMSHAKEEED  213

Query  1135  rieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIR  956
             R+ DFLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSL+  L  + E LEWKIR
Sbjct  214   RVSDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPHGSLSTKLFGSEECLEWKIR  273

Query  955   FKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVV  776
             +KVA+G+A+GL YLH VC RRIIHRDI ASNILL+ D+ AQISDFGLAKWLPE W HHVV
Sbjct  274   YKVALGIADGLSYLHNVCPRRIIHRDIKASNILLSRDFDAQISDFGLAKWLPENWAHHVV  333

Query  775   SPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLE  599
              PIEGTFGYMAPEYF+HGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE
Sbjct  334   FPIEGTFGYMAPEYFIHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLE  393

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-----EL  434
             +N+++++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M +VV++L+GE+     EL
Sbjct  394   KNSVEDIVDPRLGNEFDPTEMKRVMLTASMCIHHIATMRPDMTRVVQLLRGEDGPAELEL  453

Query  433   KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + +  Q  +V   +  + D TS+SY   L RH QL+ME
Sbjct  454   QQKPGQGGAVIVNACDLQDHTSSSYLNELIRHRQLLME  491



>ref|XP_010277525.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Nelumbo nucifera]
 ref|XP_010277526.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Nelumbo nucifera]
Length=466

 Score =   452 bits (1163),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/393 (58%), Positives = 298/393 (76%), Gaps = 10/393 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFGH-DIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              + W+++ + IK+KS +     P+  + ++ +K+ R   S  + +ED I C    + KPS
Sbjct  77    GLHWRNLINVIKKKSMRRLSTFPMSTNSELSKKNLRRKISQVQSAEDRIQCTSVPVAKPS  136

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WR+F+  EL+ AT+ FSSE ++GKGGHAEVYKG L DGQ++AVKR+IK++++       F
Sbjct  137   WRSFSYGELAAATNGFSSERLIGKGGHAEVYKGCLPDGQLVAVKRLIKKEEELFGD---F  193

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAHI+HPNAA+L+GF  + GLHLVLQ+ PHGSLA +LH + E L+W +RFKVA+
Sbjct  194   LSELGIIAHIDHPNAARLVGFGVEGGLHLVLQFSPHGSLASVLHGSEENLDWGVRFKVAI  253

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+AEGL+YLH  C RR+IHRDI ASNILLT+DY  QISDFGLAKWLPE+W HHVV PIEG
Sbjct  254   GIAEGLNYLHRGCNRRMIHRDIKASNILLTQDYEPQISDFGLAKWLPEQWTHHVVFPIEG  313

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGYM+PEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDSSRQSLVMWAKP+L+ +NIKE
Sbjct  314   TFGYMSPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSSRQSLVMWAKPVLDAHNIKE  373

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-ELKVELRQ----  416
             L DPRLGD+Y++ EM+R++  A  CI HL  MRP+M  VV+ L+GE+ EL+  +R+    
Sbjct  374   LVDPRLGDSYNIFEMKRAVTTASMCIHHLSAMRPHMDWVVQHLRGEDEELESFVREPEQP  433

Query  415   -SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
               +    ++  +  +T +SY   L+ H+QL +E
Sbjct  434   VGRKFLLDACDLESYTCSSYLNDLNHHMQLALE  466



>ref|XP_009364239.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Pyrus x bretschneideri]
Length=483

 Score =   453 bits (1165),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/392 (59%), Positives = 290/392 (74%), Gaps = 10/392 (3%)
 Frame = -3

Query  1465  KSIFDQIKRKSAKSFPIVPLFGHDI----IRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             K +FD +K+KSA+ F  +P+ G           RR+   W+   E+       S+TKPSW
Sbjct  91    KGMFDALKKKSARRFSTIPILGASYELSRRNLRRRLARIWNADDEEEEGADGMSVTKPSW  150

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD--  1124
             RNF   EL+ AT NF  EN++GKGG AEVYKG L +G ++AVKR++K++K+ E       
Sbjct  151   RNFDYAELAAATANFKPENLIGKGGQAEVYKGFLSNGTIVAVKRLMKKEKEKENEDRVGD  210

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FL+E+GIIAHI HPNAA+L+GF  D+GLHLVLQ+ PHGSLA LL    E ++WKIRFKVA
Sbjct  211   FLAEVGIIAHIRHPNAARLLGFGIDSGLHLVLQFSPHGSLASLLFGTAECMDWKIRFKVA  270

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+AEGL YLH  C RRIIHRDI ASNILLTEDY AQISDFGLAKWLPEKW HHVV PIE
Sbjct  271   IGIAEGLRYLHHECHRRIIHRDIKASNILLTEDYEAQISDFGLAKWLPEKWTHHVVFPIE  330

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY++PEYFMHGIVDEKTDVFA+GVLLLELITGR+AVDS++QSLV WAKPLL+ +N+K
Sbjct  331   GTFGYLSPEYFMHGIVDEKTDVFAYGVLLLELITGRRAVDSTQQSLVTWAKPLLDASNMK  390

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---  413
             ELADP L DAYD +EM+R+M  A  CI H    RP M + V++LKGE+ +  +LRQ    
Sbjct  391   ELADPLLEDAYDPIEMKRAMVTASMCISHQSTRRPYMNRAVQMLKGEDGVADQLRQKSTA  450

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              +S+  ES  + D+T ++Y   L+RH QL+++
Sbjct  451   VRSLVLESCDLEDYTCSNYLSDLNRHRQLVLD  482



>gb|AAL07235.1| putative Pto kinase interactor [Arabidopsis thaliana]
Length=467

 Score =   452 bits (1162),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 225/390 (58%), Positives = 294/390 (75%), Gaps = 6/390 (2%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             +QW  + + IK+KS + F ++PL   +++ RK+ R        SE    C  F + KPSW
Sbjct  79    LQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKLTPSESAFTCEAFFMAKPSW  138

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNFT +EL+ ATD F+ ENM+GKGGHAEVYKG L +G+ +A+K+++   K++EER+ DFL
Sbjct  139   RNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFL  198

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             SELGIIAH+NHPNAA+L GFS+D GLH VL+Y P+GSLA +L  + E LEWKIR+KVA+G
Sbjct  199   SELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALG  258

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             +A+GL YLH  C RRIIHRDI ASNILL  DY AQISDFGLAKWLPE W HHVV PIEGT
Sbjct  259   IADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGT  318

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKE  581
             FGY+APEYFMHGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++++
Sbjct  319   FGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMED  378

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---K  410
             + DPRLG+ ++  EM+R M  A  C+ H+  MRP+M ++V++L+GE+    EL+Q    +
Sbjct  379   IVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLVQLLRGEDG-PAELQQKAGER  437

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             ++S  +  + D TS+SY   L RH QL+ME
Sbjct  438   TMSVNACDLQDHTSSSYLNELRRHRQLLME  467



>ref|NP_568231.1| receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Arabidopsis thaliana]
 sp|Q8H1D6.1|RBK1_ARATH RecName: Full=Receptor-like cytosolic serine/threonine-protein 
kinase RBK1; AltName: Full=Protein ROP BINDING PROTEIN KINASES 
1 [Arabidopsis thaliana]
 gb|AAN13023.1| putative Pto kinase interactor [Arabidopsis thaliana]
 gb|AED91559.1| receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Arabidopsis thaliana]
Length=467

 Score =   452 bits (1162),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 225/390 (58%), Positives = 294/390 (75%), Gaps = 6/390 (2%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             +QW  + + IK+KS + F ++PL   +++ RK+ R        SE    C  F + KPSW
Sbjct  79    LQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKLTPSESAFTCEAFFMAKPSW  138

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNFT +EL+ ATD F+ ENM+GKGGHAEVYKG L +G+ +A+K+++   K++EER+ DFL
Sbjct  139   RNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFL  198

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             SELGIIAH+NHPNAA+L GFS+D GLH VL+Y P+GSLA +L  + E LEWKIR+KVA+G
Sbjct  199   SELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALG  258

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             +A+GL YLH  C RRIIHRDI ASNILL  DY AQISDFGLAKWLPE W HHVV PIEGT
Sbjct  259   IADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGT  318

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKE  581
             FGY+APEYFMHGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++++
Sbjct  319   FGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMED  378

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---K  410
             + DPRLG+ ++  EM+R M  A  C+ H+  MRP+M ++V++L+GE+    EL+Q    +
Sbjct  379   IVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLVQLLRGEDG-PAELQQKAGER  437

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             ++S  +  + D TS+SY   L RH QL+ME
Sbjct  438   TMSVNACDLQDHTSSSYLNELRRHRQLLME  467



>ref|XP_007158360.1| hypothetical protein PHAVU_002G146300g [Phaseolus vulgaris]
 gb|ESW30354.1| hypothetical protein PHAVU_002G146300g [Phaseolus vulgaris]
Length=435

 Score =   450 bits (1158),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 239/398 (60%), Positives = 291/398 (73%), Gaps = 10/398 (3%)
 Frame = -3

Query  1492  GFDPTAVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNIDCGDF  1319
             G +   + WKS+ D  K KS +    +PL    HDI RK      +  R +E+ ID G  
Sbjct  41    GKEGYTLPWKSMVDVFKFKSVRKLTSIPLLSVSHDISRKGLTKKLARIRSAEEGIDIGAI  100

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                KPSWRNF  +EL+ AT+NFSSEN++GKGGHAEVYKG L DGQVIAVKR++K +K   
Sbjct  101   P-AKPSWRNFDYEELATATNNFSSENLVGKGGHAEVYKGNLPDGQVIAVKRLMKNEKDAA  159

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
             +R  DFL+ELGIIAHINH NA  L+GF  D GL  VLQ  PHGSL+ LL + +E L+W  
Sbjct  160   DRAGDFLTELGIIAHINHTNATHLVGFGVDGGLFFVLQLAPHGSLSSLLFD-SEGLDWGK  218

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RFK+A+GVA+GLHYLH  C RRIIHRDI ASNILL E+Y A+ISDFGLAKWLP KW +HV
Sbjct  219   RFKIAIGVADGLHYLHKECPRRIIHRDIKASNILLNENYEAEISDFGLAKWLPNKWANHV  278

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLL  602
             V PIEGTFGY+APEYFMHGIVDE+TDVFAFGVLLLELITGR+AVDS SRQSLV WAKPLL
Sbjct  279   VFPIEGTFGYLAPEYFMHGIVDERTDVFAFGVLLLELITGRRAVDSDSRQSLVTWAKPLL  338

Query  601   EQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL  422
             + NN+K++ADPRLG+ YD  EM R M  A  C+ H  + RP M KVV++L GE  + ++L
Sbjct  339   DTNNVKDIADPRLGEEYDHQEMLRVMVTASMCVHHASSKRPFMNKVVQMLNGEESI-IDL  397

Query  421   RQS----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +Q+    KS   E+  + D+T +SY K + RH+QLIME
Sbjct  398   KQNSMAPKSQLLEACDLEDYTCSSYLKDMSRHMQLIME  435



>ref|XP_004165998.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Cucumis sativus]
Length=458

 Score =   449 bits (1156),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 297/394 (75%), Gaps = 9/394 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKP  1304
              + WK++   IK+KS   F  +PL    ++I RK+ +   +  R +++ I   D    KP
Sbjct  66    GIPWKAMIGCIKKKSVWRFSTIPLLAASYEISRKNFKRKLARIRSADEGITGDDIPFCKP  125

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRN+   ELS AT+NFS EN+LGKGG AEVYKG L DGQ++AVKR++K++K++EER  D
Sbjct  126   SWRNYGFAELSAATNNFSPENLLGKGGQAEVYKGCLSDGQIVAVKRLMKKEKENEERTAD  185

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAHINHPNAA+L+GF  ++GL+LVL+++P+GS A  L  A E LEW IRFKVA
Sbjct  186   FLSELGIIAHINHPNAARLLGFGIESGLYLVLEFIPYGSFASALFGA-EPLEWNIRFKVA  244

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +GVAEGL+YLH  C RRIIHRDI ASNILL E+Y   ISDFGLAKWLPE W HHVV PIE
Sbjct  245   LGVAEGLNYLHRECPRRIIHRDIKASNILLAENYEPLISDFGLAKWLPENWAHHVVFPIE  304

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+APEYFMHGIVDE+TDVFAFGVLLLELITGR+AVDSSRQSLV+WAKPLL+ N+ K
Sbjct  305   GTFGYLAPEYFMHGIVDERTDVFAFGVLLLELITGRRAVDSSRQSLVIWAKPLLDNNSFK  364

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---  413
             EL DP+LGD YD  EM R+M  A  CI H  +MRP+M +VV++LKGE+    +L+     
Sbjct  365   ELTDPKLGDNYDQTEMGRTMLAASMCINHSSSMRPHMNRVVQLLKGEDGPLDQLKHKSMD  424

Query  412   --KSVSSESLHIADFT-STSYRKHLDRHLQLIME  320
               +S+  E+  + D+T ++SY   L+RH +L++E
Sbjct  425   GDRSLLLEACDLEDYTNNSSYLNDLNRHRELVLE  458



>ref|XP_010422834.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Camelina sativa]
Length=470

 Score =   449 bits (1156),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 227/392 (58%), Positives = 294/392 (75%), Gaps = 8/392 (2%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDN--IDCGDFSITKP  1304
             +QW  + + IK+KS + F ++PL   +++ RK+ R        S++N       F + KP
Sbjct  80    LQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKFSPSDNNAAFPSEAFFMAKP  139

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRNFT +EL+ ATD F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++EER+ D
Sbjct  140   SWRNFTYEELAAATDYFNPENMIGKGGHAEVYKGVLADGETVAIKKLMSHAKEEEERVSD  199

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y P+GSLA  L  + E LEWKIR+KVA
Sbjct  200   FLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASWLFGSEECLEWKIRYKVA  259

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+A+GL YLH  C RRIIHRDI ASNILL +DY AQISDFGLAKWLPE W HHVV PIE
Sbjct  260   LGIADGLSYLHNACPRRIIHRDIKASNILLNQDYEAQISDFGLAKWLPENWPHHVVFPIE  319

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGY+APEYFMHGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++
Sbjct  320   GTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSM  379

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS--  413
             +++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+GE+    EL+    
Sbjct  380   EDIVDPRLGNEFDPTEMQRVMLTASMCIHHIAAMRPDMTRLVQLLRGEDG-PAELQHKAG  438

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              ++VS  +  + D TS+SY   L RH QL+ME
Sbjct  439   ERTVSVSACDLQDHTSSSYLNELTRHRQLLME  470



>ref|XP_009150644.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Brassica rapa]
Length=456

 Score =   449 bits (1155),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 227/391 (58%), Positives = 294/391 (75%), Gaps = 7/391 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS-RRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             QW  + + IK+KS + F ++PL   +++ RK+ RR     S   ++  DC  F + KPSW
Sbjct  66    QWNKMIESIKKKSIRRFSVIPLLASYELTRKNMRRKQPKLSPLPDNVFDCDQFLVAKPSW  125

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNFT  EL  ATD F++E M+GKGGHAEVYKG L DG+++A+KR+ +   + EER+ DFL
Sbjct  126   RNFTYDELVAATDGFNAEKMIGKGGHAEVYKGVLPDGEIVAIKRLTRHANEAEERVSDFL  185

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE--TLEWKIRFKVA  944
             SELG+IAH+NHPNAAKL GFS D GLH VL+Y PHGSLA LL  ++E   L+WK R++VA
Sbjct  186   SELGMIAHVNHPNAAKLRGFSCDRGLHFVLEYAPHGSLASLLFGSSEEECLDWKKRYRVA  245

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +GVA+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH+V PIE
Sbjct  246   LGVADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENWPHHIVFPIE  305

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMWAKPLLE++++
Sbjct  306   GTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSIVMWAKPLLEKSSV  365

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLK--GENELKVELRQS  413
             +E+ DP+LG+ +D  EM+R M  A  CI H+  MRP+M ++ ++L+  G++ L    + S
Sbjct  366   EEIVDPKLGNEFDETEMKRVMQTASMCIHHVAAMRPDMNRLGQLLRGGGDDRLAETQQIS  425

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +  S +   + D TS+SY   L RH QL+ME
Sbjct  426   RRKSLDGCDLQDHTSSSYLNDLTRHRQLLME  456



>ref|XP_003613029.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=456

 Score =   449 bits (1154),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 236/405 (58%), Positives = 294/405 (73%), Gaps = 11/405 (3%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFG---HDIIRKSRRMFFSWSRCSEDNI  1334
             G  G  +   +QWKS+ D  K KS +    +PL     +DI +       +  R +E++I
Sbjct  53    GKLGWKESNMMQWKSMIDVFKFKSVRRLTAIPLLAAVNNDIAKTGFPRKLARIRSAEESI  112

Query  1333  DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriike  1154
             D G    TKPSWRNF   EL+ AT++FSSEN++GKGGHAEVYKG L DGQV+AVKR++K 
Sbjct  113   DIGAIP-TKPSWRNFDYDELAAATNDFSSENLIGKGGHAEVYKGHLSDGQVVAVKRLMKN  171

Query  1153  dkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA---  983
             DK   +R  DFL+ELGIIAH+NHPNA +L+GF  D GL+ VLQ  P+GSL+ LL  A   
Sbjct  172   DKDFADRAGDFLTELGIIAHVNHPNATRLVGFGIDRGLYFVLQLAPYGSLSSLLFGAQRC  231

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
             +E LEWK R+KV +GVAEGLHYLH  C RRIIHRDI ASNILL ++Y A+ISDFGLAKWL
Sbjct  232   SECLEWKTRYKVVIGVAEGLHYLHEDCPRRIIHRDIKASNILLNDNYEAEISDFGLAKWL  291

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSL  626
             P  W HHVV PIEGTFGY+APEYFMHG+VDEKTDVFAFGVLLLELITGR+AVDS S+QSL
Sbjct  292   PNNWAHHVVFPIEGTFGYLAPEYFMHGVVDEKTDVFAFGVLLLELITGRRAVDSDSKQSL  351

Query  625   VMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
             V+WAKPLL+  N++ELADPRL + YD  EM R+M  A  C+ H  + RP MK+V ++LKG
Sbjct  352   VIWAKPLLDSKNVQELADPRLEEKYDPTEMNRAMKTASLCVHHSSSKRPFMKQVAQLLKG  411

Query  445   ENEL---KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             E  +   K     S+S+S E+  + D+T +SY K L+RH +L+ME
Sbjct  412   EEAIIDSKHHSGASRSLSLEACDLEDYTCSSYLKDLNRHRELVME  456



>gb|AES95987.2| receptor-like cytosolic Serine/Threonine-kinase [Medicago truncatula]
Length=452

 Score =   448 bits (1153),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 235/402 (58%), Positives = 293/402 (73%), Gaps = 9/402 (2%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFG---HDIIRKSRRMFFSWSRCSEDNI  1334
             G  G  +   +QWKS+ D  K KS +    +PL     +DI +       +  R +E++I
Sbjct  53    GKLGWKESNMMQWKSMIDVFKFKSVRRLTAIPLLAAVNNDIAKTGFPRKLARIRSAEESI  112

Query  1333  DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriike  1154
             D G    TKPSWRNF   EL+ AT++FSSEN++GKGGHAEVYKG L DGQV+AVKR++K 
Sbjct  113   DIGAIP-TKPSWRNFDYDELAAATNDFSSENLIGKGGHAEVYKGHLSDGQVVAVKRLMKN  171

Query  1153  dkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATET  974
             DK   +R  DFL+ELGIIAH+NHPNA +L+GF  D GL+ VLQ  P+GSL+ LL   +E 
Sbjct  172   DKDFADRAGDFLTELGIIAHVNHPNATRLVGFGIDRGLYFVLQLAPYGSLSSLLF-GSEC  230

Query  973   LEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEK  794
             LEWK R+KV +GVAEGLHYLH  C RRIIHRDI ASNILL ++Y A+ISDFGLAKWLP  
Sbjct  231   LEWKTRYKVVIGVAEGLHYLHEDCPRRIIHRDIKASNILLNDNYEAEISDFGLAKWLPNN  290

Query  793   WGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMW  617
             W HHVV PIEGTFGY+APEYFMHG+VDEKTDVFAFGVLLLELITGR+AVDS S+QSLV+W
Sbjct  291   WAHHVVFPIEGTFGYLAPEYFMHGVVDEKTDVFAFGVLLLELITGRRAVDSDSKQSLVIW  350

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLL+  N++ELADPRL + YD  EM R+M  A  C+ H  + RP MK+V ++LKGE  
Sbjct  351   AKPLLDSKNVQELADPRLEEKYDPTEMNRAMKTASLCVHHSSSKRPFMKQVAQLLKGEEA  410

Query  436   L---KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +   K     S+S+S E+  + D+T +SY K L+RH +L+ME
Sbjct  411   IIDSKHHSGASRSLSLEACDLEDYTCSSYLKDLNRHRELVME  452



>ref|XP_004133749.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Cucumis sativus]
 gb|KGN56310.1| hypothetical protein Csa_3G114500 [Cucumis sativus]
Length=498

 Score =   450 bits (1157),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 234/394 (59%), Positives = 297/394 (75%), Gaps = 9/394 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKP  1304
              + WK++   IK+KS   F  +PL    ++I RK+ +   +  R +++ I   D    KP
Sbjct  106   GIPWKAMIGCIKKKSVWRFSTIPLLAASYEISRKNFKRKLARIRSADEGITGDDIPFCKP  165

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRN+   ELS AT+NFS EN+LGKGG AEVYKG L DGQ++AVKR++K++K++EER  D
Sbjct  166   SWRNYGFAELSAATNNFSPENLLGKGGQAEVYKGCLSDGQIVAVKRLMKKEKENEERTAD  225

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAHINHPNAA+L+GF  ++GL+LVL+++P+GS A  L  A E LEW IRFKVA
Sbjct  226   FLSELGIIAHINHPNAARLLGFGIESGLYLVLEFIPYGSFASALFGA-EPLEWNIRFKVA  284

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +GVAEGL+YLH  C RRIIHRDI ASNILL E+Y   ISDFGLAKWLPE W HHVV PIE
Sbjct  285   LGVAEGLNYLHRECPRRIIHRDIKASNILLAENYEPLISDFGLAKWLPENWAHHVVFPIE  344

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+APEYFMHGIVDE+TDVFAFGVLLLELITGR+AVDSSRQSLV+WAKPLL+ N+ K
Sbjct  345   GTFGYLAPEYFMHGIVDERTDVFAFGVLLLELITGRRAVDSSRQSLVIWAKPLLDNNSFK  404

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ----  416
             EL DP+LGD YD  EM R+M  A  CI H  +MRP+M +VV++LKGE+    +L+     
Sbjct  405   ELTDPKLGDNYDQTEMGRTMLAASMCINHSSSMRPHMNRVVQLLKGEDGPLDQLKHKSMD  464

Query  415   -SKSVSSESLHIADFT-STSYRKHLDRHLQLIME  320
               +S+  E+  + D+T ++SY   L+RH +L++E
Sbjct  465   GDRSLLLEACDLEDYTNNSSYLNDLNRHRELVLE  498



>emb|CDY37833.1| BnaAnng04940D [Brassica napus]
Length=467

 Score =   447 bits (1151),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 225/393 (57%), Positives = 293/393 (75%), Gaps = 5/393 (1%)
 Frame = -3

Query  1489  FDPTAVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSI  1313
             F    +QW  + D IK+KS + F ++PL   +++ RK+ R      + S   +DC    +
Sbjct  77    FQHHGLQWNKMIDSIKKKSIRRFSVIPLLASYELTRKNMRR--KQPKLSPSPVDCDQILV  134

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
              KPSWRNF+ +EL  ATD+F+ ENM+GKGGHAEVYKG L DG+++A+KR+ +   + EER
Sbjct  135   AKPSWRNFSYEELVAATDSFNPENMIGKGGHAEVYKGVLPDGEIVAIKRLTRHANEAEER  194

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE-TLEWKIR  956
             + DFLSELG+IAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA LL  + E  L+WK R
Sbjct  195   VSDFLSELGMIAHVNHPNAARLRGFSSDRGLHFVLEYAPHGSLASLLFGSEEECLDWKKR  254

Query  955   FKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVV  776
             +KVA+GVA+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE    H+V
Sbjct  255   YKVALGVADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENCPQHIV  314

Query  775   SPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLE  599
              PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMW KPLLE
Sbjct  315   FPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTDSRQSIVMWVKPLLE  374

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
             +++++E+ DP+LG+ +D  EM R M  A  CI H+  MRP+M ++V++L+G + L     
Sbjct  375   KSSLEEIVDPKLGNDFDETEMRRVMQTASMCIHHVATMRPDMNRLVQLLRGNDRLAEPHG  434

Query  418   QSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              +++VS +   + D TS+SY   L RH QL+ME
Sbjct  435   GARTVSLDGCDLQDHTSSSYLDGLIRHRQLLME  467



>ref|XP_008362614.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Malus domestica]
Length=473

 Score =   447 bits (1151),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 230/392 (59%), Positives = 290/392 (74%), Gaps = 10/392 (3%)
 Frame = -3

Query  1465  KSIFDQIKRKSAKSFPIVPLFGHDI----IRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             K +FD +K+KSA+ F  +P+ G           RR+   W+   E+       S+TKPSW
Sbjct  81    KGMFDALKKKSARRFSTIPVLGASYELSRRNLRRRLARIWNAEDEEEEGADGMSVTKPSW  140

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD--  1124
             RNF   EL+ AT NF  EN++GKGG AEVYKG L +G ++AVKR++K++K+ E       
Sbjct  141   RNFDYAELAAATANFKPENLIGKGGQAEVYKGFLSNGTIVAVKRLMKKEKEKENEDRVGD  200

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FL+E+GIIAHI HPNAA+L+GF  D+GLHLVLQ+ PHGSLA LL    E ++WKIRFKVA
Sbjct  201   FLAEVGIIAHIRHPNAARLLGFGIDSGLHLVLQFSPHGSLASLLFGTAECMDWKIRFKVA  260

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+AEGL YLH  C RRIIHRDI ASNILLTEDY AQISDFGLAKWLPEKW HHVV PIE
Sbjct  261   IGIAEGLRYLHHDCHRRIIHRDIKASNILLTEDYEAQISDFGLAKWLPEKWTHHVVFPIE  320

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY++PEYFMHGIVDEKTDVFA+GVLLLELITGR+AVDS++QSLV+WAKPLL+ +N+K
Sbjct  321   GTFGYLSPEYFMHGIVDEKTDVFAYGVLLLELITGRRAVDSTQQSLVIWAKPLLDASNMK  380

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS---  413
             ELADP   DAYD +EM+R+M  A  CI H    RP M +VV++L GE+ +  +LRQ    
Sbjct  381   ELADPLXEDAYDPIEMKRAMVTASMCISHQSTRRPYMNRVVQMLXGEDGVADQLRQKSTA  440

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              +S+  ES  + D+T ++Y   L+RH QL+++
Sbjct  441   VRSLVLESCDLEDYTCSNYLSDLNRHRQLVLD  472



>ref|XP_009125295.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Brassica rapa]
Length=485

 Score =   447 bits (1150),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 228/391 (58%), Positives = 294/391 (75%), Gaps = 10/391 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVP-LFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
             ++QW  + + IK+KS + F ++P L  + + RK+ R        SE++     F + KPS
Sbjct  100   SLQWTKMIESIKKKSIRRFTVIPFLASYQLTRKNLRRKQPILSPSENS-----FFMAKPS  154

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNFT +EL+ AT++F+ ENM+GKGGHAEVYKG L DG+ IA+K+++  +KK+EER+ DF
Sbjct  155   WRNFTYEELAAATEDFNPENMIGKGGHAEVYKGVLPDGETIAIKKVMSHNKKEEERVSDF  214

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAH+NH NAAKL+GFS D GLH VL+Y PHGSLA +L    + LEWKIR+KVA+
Sbjct  215   LSELGIIAHVNHTNAAKLLGFSIDRGLHFVLEYSPHGSLATMLFGTKKCLEWKIRYKVAL  274

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A+GL YLH  C RRIIHRDI ASNILL+ DY AQISDFGLAKWLPE W HHVVSPIEG
Sbjct  275   GIADGLSYLHNDCPRRIIHRDIKASNILLSRDYDAQISDFGLAKWLPENWSHHVVSPIEG  334

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIK  584
             TFGYMAPEYF+HGIVDEK DVFAFGVLLLE+ITGR+AVD+ SRQS+V WAKP LE+N+++
Sbjct  335   TFGYMAPEYFIHGIVDEKIDVFAFGVLLLEIITGRRAVDTASRQSIVAWAKPFLEKNSVE  394

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQS  413
             ++ D RLG+ +D  E++R M  A  CI H+  MRP+M  +V++L GE+   EL+ +  + 
Sbjct  395   DIVDSRLGNEFDPTEVKRVMLTASMCIHHIATMRPDMTMLVQLLHGEDGPAELQQKPGER  454

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
               VS  +  + D TS+SY   L RH QL+ME
Sbjct  455   AEVSVNACDVQDHTSSSYLNELTRHRQLLME  485



>emb|CDY40103.1| BnaC02g00270D [Brassica napus]
Length=479

 Score =   447 bits (1149),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 226/392 (58%), Positives = 294/392 (75%), Gaps = 10/392 (3%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVP-LFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKP  1304
               + W  + + IK+KS + F ++P L  + + RK+ R        SE++     F + KP
Sbjct  93    NGLHWTKMIESIKKKSFRRFTVIPFLASYQLTRKNLRCKQPILSPSENS-----FFMAKP  147

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRNFT +EL+ AT++F+ ENM+GKGGHAEVYKG L DG+ +A+K+++  +KK++ER+ D
Sbjct  148   SWRNFTYEELAAATEDFNPENMIGKGGHAEVYKGVLPDGETVAIKKVMSHNKKEDERVSD  207

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAH+NH NAAKL+GFS D GLH VL+Y PHGSLA +L    E LEWKIR+KVA
Sbjct  208   FLSELGIIAHVNHTNAAKLLGFSIDRGLHFVLEYSPHGSLANMLFGTEECLEWKIRYKVA  267

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+A+GL YLH  C RRIIHRDI ASNILL+ DY AQISDFGLAKWLPE W HHVVSPIE
Sbjct  268   LGIADGLSYLHNDCPRRIIHRDIKASNILLSRDYDAQISDFGLAKWLPENWLHHVVSPIE  327

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSS-RQSLVMWAKPLLEQNNI  587
             GTFGYMAPEYF+HGIVDEK DVFAFGVLLLE+ITGR+AVD++ +QS+V WAKP L +N++
Sbjct  328   GTFGYMAPEYFIHGIVDEKIDVFAFGVLLLEIITGRRAVDTANKQSIVAWAKPFLGKNSV  387

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE---NELKVELRQ  416
             +++ DPRLG+  DV EM+R M  A +CI H+  MRP+M  +V++L+GE   +EL+ +  +
Sbjct  388   EDIVDPRLGNEIDVTEMKRVMLTASTCIHHIATMRPDMTMLVQLLRGEEGPDELQQKPGE  447

Query  415   SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                VS  +  + D TS+SY   L RH QL+ME
Sbjct  448   RAEVSVNACDVQDHTSSSYLNELTRHRQLLME  479



>ref|XP_010491725.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Camelina sativa]
Length=470

 Score =   446 bits (1148),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 226/392 (58%), Positives = 293/392 (75%), Gaps = 8/392 (2%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDN--IDCGDFSITKP  1304
             +QW  + + IK+KS + F ++PL   +++ RK+ R        S++N       F + KP
Sbjct  80    LQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKFSPSDNNAAFPSEAFFMAKP  139

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRNFT +EL+ ATD F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++EER+ D
Sbjct  140   SWRNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMSHAKEEEERVSD  199

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y P+GSLA  L  + E LEWKIR+KVA
Sbjct  200   FLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASWLFGSEECLEWKIRYKVA  259

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+A+GL YLH  C RRIIHRDI ASNILL +DY AQISDFGLAKWLPE W HHVV PIE
Sbjct  260   LGIADGLSYLHNACPRRIIHRDIKASNILLNKDYEAQISDFGLAKWLPENWPHHVVFPIE  319

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGY+APEYFMHGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++
Sbjct  320   GTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSM  379

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS--  413
             +++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+GE+    EL+    
Sbjct  380   EDIVDPRLGNEFDPTEMQRVMLTASMCIHHIAAMRPDMTRLVQLLRGEDG-PAELQHKAG  438

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              ++V   +  + D TS+SY   L RH QL+ME
Sbjct  439   ERTVRVSACDLQDHTSSSYLNELTRHRQLLME  470



>emb|CDY33949.1| BnaC02g43880D [Brassica napus]
Length=497

 Score =   447 bits (1150),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 224/395 (57%), Positives = 295/395 (75%), Gaps = 5/395 (1%)
 Frame = -3

Query  1495  GGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDF  1319
               F    +QW  + D IK+KS + F ++PL   +++ RK+ R      + S   +DC   
Sbjct  105   SSFQHHGLQWNKMIDSIKKKSIRRFSVIPLLASYELTRKNMRR--KQPKLSPSPVDCDQI  162

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
              + KPSWRNF+ +EL  ATD+F+ ENM+GKGGHAEVYKG L DG+ +A+K++++   ++E
Sbjct  163   LVAKPSWRNFSYEELVAATDSFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMRHAMEEE  222

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE-TLEWK  962
             ER+ DFLSELG+IAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA LL  + E  L+WK
Sbjct  223   ERVSDFLSELGMIAHVNHPNAARLRGFSSDRGLHFVLEYAPHGSLASLLFGSEEECLDWK  282

Query  961   IRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHH  782
              R+KVA+GVA+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE    H
Sbjct  283   KRYKVALGVADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENCPQH  342

Query  781   VVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPL  605
             +V PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMW KPL
Sbjct  343   IVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTDSRQSIVMWVKPL  402

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVE  425
             LE+++++E+ DP+LG+ +D  EM R M  A  CI H+  MRP+M ++V++L+G++ L   
Sbjct  403   LEKSSLEEIVDPKLGNDFDETEMRRVMQTASMCIHHVATMRPDMNRLVQLLRGDDRLAEP  462

Query  424   LRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                +++VS +   + D TS+SY   L RH QL+ME
Sbjct  463   HGGARTVSLDGCDLQDHTSSSYLDGLIRHRQLLME  497



>ref|XP_009130517.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Brassica rapa]
Length=467

 Score =   446 bits (1146),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 293/389 (75%), Gaps = 5/389 (1%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              +QW  + D IK+KS + F ++PL   +++ RK+ R      + S   +DC    + KPS
Sbjct  81    GLQWNKMIDSIKKKSIRRFSVIPLLASYELTRKNMRR--KQPKLSPSPVDCDQILVAKPS  138

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNFT +EL  ATD+F+ ENM+GKGGHAEVY+G L DG+ +A+K++++   ++EER+ DF
Sbjct  139   WRNFTYEELVAATDSFNPENMIGKGGHAEVYRGVLPDGETVAIKKLMRHAMEEEERVSDF  198

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE-TLEWKIRFKVA  944
             LSELG+IAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA LL  + E  L+WK R+KVA
Sbjct  199   LSELGMIAHVNHPNAARLRGFSSDRGLHFVLEYAPHGSLASLLFGSEEECLDWKKRYKVA  258

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +GVA+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE    H+V PIE
Sbjct  259   LGVADGLRYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENCPQHIVFPIE  318

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGY+APEYFMHG+VDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMW KPLLE++++
Sbjct  319   GTFGYLAPEYFMHGVVDEKTDVFAFGVLLLEIITGRRAVDTDSRQSIVMWVKPLLEKSSL  378

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKS  407
             +E+ DP+LG+ +D  EM R M  A  CI H+  MRP+M ++V++L+G + L      +++
Sbjct  379   EEIVDPKLGNDFDETEMRRVMQTASMCIHHVATMRPDMNRLVQLLRGNDRLAEPHGGART  438

Query  406   VSSESLHIADFTSTSYRKHLDRHLQLIME  320
             VS +   + D TS+SY   L RH QL+ME
Sbjct  439   VSLDGCDLQDHTSSSYLDGLIRHRQLLME  467



>ref|XP_010453081.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Camelina sativa]
Length=471

 Score =   446 bits (1146),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 225/392 (57%), Positives = 293/392 (75%), Gaps = 8/392 (2%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDN--IDCGDFSITKP  1304
             +QW  + + IK+KS + F ++PL   +++ RK+ R        S++N       F + KP
Sbjct  81    LQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKFSPSDNNAAFPSEAFFMAKP  140

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRNFT +EL+ ATD F+ ENM+GKGGHAEVYKG L DG+ +A+K+++   K++EER+ D
Sbjct  141   SWRNFTYEELAAATDYFNPENMIGKGGHAEVYKGVLPDGETVAIKKLMSHAKEEEERVSD  200

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y P+GSLA  L  + E L WKIR+KVA
Sbjct  201   FLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASWLFGSEECLAWKIRYKVA  260

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+A+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HHVV PIE
Sbjct  261   LGIADGLSYLHNACPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENWPHHVVFPIE  320

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGY+APEYFMHGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++
Sbjct  321   GTFGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSM  380

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS--  413
             +++ DPRLG+ +D  EM+R M  A  CI H+  MRP+M ++V++L+GE+    EL+    
Sbjct  381   EDIVDPRLGNEFDPTEMQRVMLTASMCIHHIAAMRPDMTRLVQLLRGEDG-PAELQHKAG  439

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              ++V   +  + D TS+SY   L RH QL+ME
Sbjct  440   ERTVXVSACDLQDHTSSSYLNELTRHRQLLME  471



>emb|CDX85756.1| BnaA02g00570D [Brassica napus]
Length=484

 Score =   446 bits (1147),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 228/391 (58%), Positives = 293/391 (75%), Gaps = 10/391 (3%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVP-LFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              +QW  + + IK+KS + F ++P L  + + RK+ R        SE++     F + KPS
Sbjct  99    GLQWTKMIESIKKKSFRRFTVIPFLASYQLTRKNLRRKQPNLSPSENS-----FFMAKPS  153

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNFT +EL+ AT++F+ ENM+GKGGHAEVYKG L DG+ IA+K+++  +KK+EER+ DF
Sbjct  154   WRNFTYEELAAATEDFNPENMIGKGGHAEVYKGVLPDGETIAIKKVMSHNKKEEERVSDF  213

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAH+NH NAAKL+GFS D GLH VL+Y PHGSLA +L    + LEWKIR+KVA+
Sbjct  214   LSELGIIAHVNHTNAAKLLGFSIDRGLHFVLEYSPHGSLATMLFGTKKCLEWKIRYKVAL  273

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A+GL YLH  C RRIIHRDI ASNILL+ DY AQISDFGLAKWLPE W HHVVSPIEG
Sbjct  274   GIADGLSYLHNDCPRRIIHRDIKASNILLSRDYDAQISDFGLAKWLPENWSHHVVSPIEG  333

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIK  584
             TFGYMAPEYF+HGIVDEK DVFAFGVLLLE+ITGR+AVD+ SRQS+V WAKP LE+N+++
Sbjct  334   TFGYMAPEYFIHGIVDEKIDVFAFGVLLLEIITGRRAVDTASRQSIVAWAKPFLEKNSVE  393

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQS  413
             ++ D RLG+ +D  E++R M  A  CI H+  MRP+M  +V++L GE+   EL+ +  + 
Sbjct  394   DIVDSRLGNEFDPTEVKRVMLTASMCIHHIATMRPDMTMLVQLLHGEDGPAELQQKPGER  453

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
               VS  +  + D TS+SY   L RH QL+ME
Sbjct  454   AEVSVNACDVQDHTSSSYLNELTRHRQLLME  484



>gb|KEH27731.1| receptor-like cytosolic Serine/Threonine-kinase [Medicago truncatula]
Length=447

 Score =   444 bits (1141),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 233/402 (58%), Positives = 290/402 (72%), Gaps = 14/402 (3%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFG---HDIIRKSRRMFFSWSRCSEDNI  1334
             G  G  +   +QWKS+ D  K KS +    +PL     +DI +       +  R +E++I
Sbjct  53    GKLGWKESNMMQWKSMIDVFKFKSVRRLTAIPLLAAVNNDIAKTGFPRKLARIRSAEESI  112

Query  1333  DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriike  1154
             D G    TKPSWRNF   EL+ AT++FSSEN++GKGGHAEVYKG L DGQV+AVKR++K 
Sbjct  113   DIGAIP-TKPSWRNFDYDELAAATNDFSSENLIGKGGHAEVYKGHLSDGQVVAVKRLMKN  171

Query  1153  dkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATET  974
             DK   +R  DFL+ELGIIAH+NHPNA +L+GF  D GL+ VLQ  P+GSL+ LL      
Sbjct  172   DKDFADRAGDFLTELGIIAHVNHPNATRLVGFGIDRGLYFVLQLAPYGSLSSLL------  225

Query  973   LEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEK  794
              EWK R+KV +GVAEGLHYLH  C RRIIHRDI ASNILL ++Y A+ISDFGLAKWLP  
Sbjct  226   FEWKTRYKVVIGVAEGLHYLHEDCPRRIIHRDIKASNILLNDNYEAEISDFGLAKWLPNN  285

Query  793   WGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMW  617
             W HHVV PIEGTFGY+APEYFMHG+VDEKTDVFAFGVLLLELITGR+AVDS S+QSLV+W
Sbjct  286   WAHHVVFPIEGTFGYLAPEYFMHGVVDEKTDVFAFGVLLLELITGRRAVDSDSKQSLVIW  345

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLL+  N++ELADPRL + YD  EM R+M  A  C+ H  + RP MK+V ++LKGE  
Sbjct  346   AKPLLDSKNVQELADPRLEEKYDPTEMNRAMKTASLCVHHSSSKRPFMKQVAQLLKGEEA  405

Query  436   L---KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +   K     S+S+S E+  + D+T +SY K L+RH +L+ME
Sbjct  406   IIDSKHHSGASRSLSLEACDLEDYTCSSYLKDLNRHRELVME  447



>emb|CAB89391.1| Pto kinase interactor-like protein [Arabidopsis thaliana]
Length=464

 Score =   444 bits (1141),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 221/387 (57%), Positives = 289/387 (75%), Gaps = 3/387 (1%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             +QW  + + IK+KS + F ++PL   +++ RK+ R        SE    C  F + KPSW
Sbjct  79    LQWNKMIESIKKKSMRRFSVIPLLASYELTRKNLRRKQPKLTPSESAFTCEAFFMAKPSW  138

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNFT +EL+ ATD F+ ENM+GKGGHAEVYKG L +G+ +A+K+++   K++EER+ DFL
Sbjct  139   RNFTYEELAVATDYFNPENMIGKGGHAEVYKGVLINGETVAIKKLMSHAKEEEERVSDFL  198

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             SELGIIAH+NHPNAA+L GFS+D GLH VL+Y P+GSLA +L  + E LEWKIR+KVA+G
Sbjct  199   SELGIIAHVNHPNAARLRGFSSDRGLHFVLEYAPYGSLASMLFGSEECLEWKIRYKVALG  258

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             +A+GL YLH  C RRIIHRDI ASNILL  DY AQISDFGLAKWLPE W HHVV PIEGT
Sbjct  259   IADGLSYLHNACPRRIIHRDIKASNILLNHDYEAQISDFGLAKWLPENWPHHVVFPIEGT  318

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIKE  581
             FGY+APEYFMHGIVDEK DVFAFGVLLLE+IT R+AVD+ SRQS+V WAKP LE+N++++
Sbjct  319   FGYLAPEYFMHGIVDEKIDVFAFGVLLLEIITSRRAVDTASRQSIVAWAKPFLEKNSMED  378

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVS  401
             + DPRLG+ ++  EM+R M  A  C+ H+  MRP+M +++    G  EL+ +  + +++S
Sbjct  379   IVDPRLGNMFNPTEMQRVMLTASMCVHHIAAMRPDMTRLLRGEDGPAELQQKAGE-RTMS  437

Query  400   SESLHIADFTSTSYRKHLDRHLQLIME  320
               +  + D TS+SY   L RH QL+ME
Sbjct  438   VNACDLQDHTSSSYLNELRRHRQLLME  464



>ref|XP_008338467.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Malus domestica]
Length=475

 Score =   444 bits (1142),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 227/394 (58%), Positives = 294/394 (75%), Gaps = 12/394 (3%)
 Frame = -3

Query  1465  KSIFDQIKRKSAKSFPIVPLFGHDI----IRKSRRMFFSWSRCSEDNIDCG--DFSITKP  1304
             K +FD +K+KSA+ F  +P+             RR+   WS   E+  + G  + S+TKP
Sbjct  81    KGMFDALKKKSARRFSTIPILAASYELSRRNLRRRLARIWSTEEEEEEEEGADEMSVTKP  140

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWRNF   EL+ AT NF  +N++GKGG AEVYKG L +G V+AVKR++K+D + E     
Sbjct  141   SWRNFDYAELAAATGNFKPDNLIGKGGQAEVYKGFLYNGTVVAVKRLMKKDNEKENEDRV  200

Query  1123  --FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FL+ELGIIAHI HPNAA+L+GF  D GLHLVLQ+ PHGSLA LL   +E ++WKIRFK
Sbjct  201   GDFLAELGIIAHIRHPNAARLLGFGIDGGLHLVLQFSPHGSLASLLFGTSECMDWKIRFK  260

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G+A+GL YLH  C RRIIHRDI ASNILLTEDY AQISDFGLAKWLPEKW HHVV P
Sbjct  261   IAIGIAQGLRYLHHECHRRIIHRDIKASNILLTEDYEAQISDFGLAKWLPEKWTHHVVFP  320

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGY++PEYFMHGIVDEKTDVFA+GVLLLEL++GR+AVDS++QSLV+WAKPLL+ +N
Sbjct  321   IEGTFGYLSPEYFMHGIVDEKTDVFAYGVLLLELLSGRRAVDSTQQSLVIWAKPLLDASN  380

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS-  413
             +K+LADPRL DAYD +EM+R+M  A  CI H    RP M +VV++LKGE+ +  +LR+  
Sbjct  381   MKKLADPRLEDAYDPIEMKRAMVTASMCISHQSTKRPYMNRVVQILKGEDGVADQLRKKS  440

Query  412   ---KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                +S+  E+  + D+T ++Y   L+R+ QL+++
Sbjct  441   TAVRSLVLEACDLEDYTCSNYLTDLNRYRQLVLD  474



>ref|XP_004288526.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Fragaria vesca subsp. vesca]
Length=500

 Score =   444 bits (1143),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 300/405 (74%), Gaps = 18/405 (4%)
 Frame = -3

Query  1480  TAVQW---KSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRC---------SEDN  1337
               +QW   K +FD +K+KSA+ F ++P+ G+     SR++    +R            + 
Sbjct  95    NGMQWNKGKEMFDALKKKSARRFSMIPMLGNSYEFSSRKLRKRLARIWSTDDDDEEERER  154

Query  1336  IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
              DC  +   KPSWRNF   EL+ AT +F  +N++GKGG AEVYKG L +G+++AVKR++K
Sbjct  155   EDCEGYLALKPSWRNFDYAELAAATADFKPDNLIGKGGQAEVYKGILNNGEIVAVKRLMK  214

Query  1156  edkkdeerie--DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
             ++K+ E+     DFL+ELG+IAHI+HPNAAKL+GF  D GLHLVLQY PHGSLA LL  +
Sbjct  215   KEKEVEKEDRIGDFLAELGVIAHISHPNAAKLLGFGIDGGLHLVLQYSPHGSLASLLFAS  274

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
              + +EWKIRFKVAVGVAEGL YLH  C RRIIHRDI ASNILL+ED+ AQISDFGLAKWL
Sbjct  275   EKHMEWKIRFKVAVGVAEGLQYLHHDCHRRIIHRDIKASNILLSEDFEAQISDFGLAKWL  334

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLV  623
             PEKW HHVV PIEGTFGY++PEYFMHGIVDEKTDVFA+GVLLLE+ITGR+AVD+S+QSLV
Sbjct  335   PEKWTHHVVFPIEGTFGYLSPEYFMHGIVDEKTDVFAYGVLLLEIITGRRAVDNSQQSLV  394

Query  622   MWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             +WAKPLL+  N+KELADPRL   YD VE++R+M VA  CI+H    RP M +VV++L+GE
Sbjct  395   IWAKPLLDSGNMKELADPRLEGNYDPVEIKRAMLVASMCIRHQSTKRPYMTRVVKILEGE  454

Query  442   N----ELKVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +    +LK +  Q +S   ++  + D+T ++Y   L+RH +L+M+
Sbjct  455   DPNGEQLKQKSTQVRSQVLDACDLEDYTCSNYLSDLNRHRELVMD  499



>emb|CDY14578.1| BnaC03g48810D [Brassica napus]
Length=450

 Score =   442 bits (1137),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 227/391 (58%), Positives = 293/391 (75%), Gaps = 7/391 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS-RRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             QW  + + IK+KS + F ++PL   +++ RK+ RR     S   ++  DC  F + KPSW
Sbjct  60    QWNKMIESIKKKSIRRFSVIPLLASYELTRKNMRRKQPKLSPLPDNVFDCDQFLVAKPSW  119

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             RNFT  EL  ATD F+SENM+GKGGHAEVYKG L DG+++A+KR+ +   + EER+ DFL
Sbjct  120   RNFTYDELVAATDGFNSENMIGKGGHAEVYKGVLPDGEIVAIKRLTRHANEAEERVSDFL  179

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE--TLEWKIRFKVA  944
             SELG+IAH+NHPNAAKL GFS D GLH VL+Y PHGSLA LL  ++E   L+WK R++VA
Sbjct  180   SELGMIAHVNHPNAAKLRGFSCDRGLHFVLEYAPHGSLASLLFGSSEEECLDWKKRYRVA  239

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +GVA+GL YLH  C RRIIHRDI ASNILL++DY AQISDFGLAKWLPE W HH++ PIE
Sbjct  240   LGVADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQISDFGLAKWLPENWPHHILFPIE  299

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNI  587
             GTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQS+VMWAKPLLE++++
Sbjct  300   GTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSIVMWAKPLLEKSSV  359

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ--S  413
             +E+ DP+L + +D  EM+R M  A  CI H+  MRP+M ++ ++L G  + ++   Q  S
Sbjct  360   EEIVDPKLANEFDETEMKRVMQTASMCIHHVAAMRPDMNRLGQLLLGGGDDRLAETQQIS  419

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             +  S +   + D TS+SY   L RH QL+ME
Sbjct  420   RRKSVDGCDLQDHTSSSYLNDLTRHRQLLME  450



>ref|XP_010547587.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Tarenaya hassleriana]
Length=480

 Score =   442 bits (1138),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 214/340 (63%), Positives = 266/340 (78%), Gaps = 2/340 (1%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              +QW  + + IK+KS + F ++PL   +++ RK+ R        S+ N+ C  F + KPS
Sbjct  77    GLQWNKMIENIKKKSMRRFSVIPLLASYELSRKNFRKKLPKDPPSDYNVSCDHFLVAKPS  136

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNF+  EL+ ATD+F+ ENM+GKGGHAEVYKG L DG+++A+K++    K +EE++ +F
Sbjct  137   WRNFSYDELAAATDDFNPENMIGKGGHAEVYKGTLPDGEIVAIKKLKSNAKVEEEKVSNF  196

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAH+NHPNAA L GFS D GLH VL+Y PHGSLA  L  + E+LEWKIR+KVA+
Sbjct  197   LSELGIIAHVNHPNAAHLRGFSTDRGLHFVLEYSPHGSLASWLFGSGESLEWKIRYKVAI  256

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A+GL YLH  C RRIIHRDI ASNILLT DY AQISDFGLAKWLPE W HHVV PIEG
Sbjct  257   GIADGLSYLHHECPRRIIHRDIKASNILLTRDYEAQISDFGLAKWLPENWPHHVVFPIEG  316

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIK  584
             TFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQSLV+WAKPLLE+N+++
Sbjct  317   TFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRRAVDTASRQSLVIWAKPLLEKNSVR  376

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKV  464
             E+ D RLGD +D +EM+R M  A  CI H+  MRPNM +V
Sbjct  377   EIVDTRLGDNFDSMEMKRVMLTASICIHHIATMRPNMTRV  416



>ref|XP_009364810.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Pyrus x bretschneideri]
Length=474

 Score =   442 bits (1137),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 226/393 (58%), Positives = 292/393 (74%), Gaps = 11/393 (3%)
 Frame = -3

Query  1465  KSIFDQIKRKSAKSFPIVPLFGHDI----IRKSRRMFFSWSRCSEDNIDCGD-FSITKPS  1301
             K +FD +K+KSA+ F  +P+             RR+   WS   E+  +  D  S+ KPS
Sbjct  81    KGMFDALKKKSARRFSTIPILAASYELSRRNLRRRLARIWSTEEEEEEEGADEMSVAKPS  140

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD-  1124
             WRNF   EL+ AT NF  EN++GKGG AEVYKG L +G V+AVKR++K+D + E      
Sbjct  141   WRNFDYAELAAATGNFKPENLIGKGGQAEVYKGFLYNGTVVAVKRLMKKDNEKENEDRVG  200

Query  1123  -FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FL+ELGIIAHI HPNAA+L+GF  D GLHLVLQ+ PHGSLA LL   +E ++WK+RFK+
Sbjct  201   DFLAELGIIAHIRHPNAARLLGFGIDGGLHLVLQFSPHGSLASLLFGTSECMDWKVRFKI  260

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G+A+GL YLH  C RRIIHRDI ASNILLTEDY AQISDFGLAKWLPEKW HHVV PI
Sbjct  261   AIGIAQGLRYLHHECHRRIIHRDIKASNILLTEDYEAQISDFGLAKWLPEKWTHHVVFPI  320

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY++PEYFMHGIVDEKTDVFA+GVLLLEL++GR+AVDS++QSLV+WAKPLL+ +N+
Sbjct  321   EGTFGYLSPEYFMHGIVDEKTDVFAYGVLLLELLSGRRAVDSTQQSLVIWAKPLLDASNM  380

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS--  413
             K+LADPRL DAYD +EM+R+M  A  CI H    RP M +VV++LKGE+ +  +LR+   
Sbjct  381   KKLADPRLEDAYDPIEMKRAMVTASMCISHQSTKRPFMNRVVQILKGEDGVADQLRKKST  440

Query  412   --KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
               +S+  E+  + D+T ++Y   L+R+ QL+++
Sbjct  441   AVRSLVLEACDLEDYTCSNYLTDLNRYRQLVLD  473



>gb|KEH20107.1| receptor-like cytosolic Serine/Threonine-kinase [Medicago truncatula]
Length=481

 Score =   442 bits (1136),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 295/399 (74%), Gaps = 18/399 (5%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSED---NIDCGDFS---  1316
             QWK++ D ++ KS + F  +PL    ++I RK+ R   +  R + D   NI    F    
Sbjct  85    QWKAMIDALRFKSVRRFSSIPLLAASYEISRKNLRNKLARKRTANDEDENIFDAAFDLDG  144

Query  1315  ITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdee  1136
             ITKPSWRNF+ ++L  ATDNF+ ENM+GKGGHAEVYKGRL DG V+AVKR++  +K+  +
Sbjct  145   ITKPSWRNFSYEDLVAATDNFNPENMIGKGGHAEVYKGRLPDGMVVAVKRLMNNEKEAGD  204

Query  1135  rie-DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
             R   DFLSELGIIAHINHPNA +LIGF  D GL+ VLQ+ PHGSL+ LL   +E L W I
Sbjct  205   RAAGDFLSELGIIAHINHPNATRLIGFGIDRGLYFVLQFAPHGSLSSLLF-GSECLAWNI  263

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RFKVAVGVA+GL YLH  C RRIIHRDI ASNILL  D  A+ISDFGLAKWLP+KW HHV
Sbjct  264   RFKVAVGVAKGLQYLHQDCPRRIIHRDIKASNILLNNDDEAEISDFGLAKWLPDKWAHHV  323

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLL  602
             V PIEGTFGY+APEYFMHG+VDEKTDVFAFGVLLLEL+TGR+AVDS S+QSLV+WAKPLL
Sbjct  324   VFPIEGTFGYLAPEYFMHGLVDEKTDVFAFGVLLLELLTGRRAVDSNSKQSLVIWAKPLL  383

Query  601   EQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL  422
             +   +KE+ADPRLG+ YD +EM+  M  A  CI H+ + RP M +V+ +LKGE E+ ++L
Sbjct  384   DAKQVKEIADPRLGEQYDPIEMKLVMATASRCIHHMSSKRPFMDQVLLLLKGE-EVAMDL  442

Query  421   RQSKSVSSESL-----HIADFTSTSYRKHLDRHLQLIME  320
              Q K+++  SL      + D+T ++Y   L+RH QLIME
Sbjct  443   TQ-KTIAPRSLLLDACDLEDYTCSNYLNDLNRHKQLIME  480



>ref|XP_003530605.2| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Glycine max]
Length=481

 Score =   440 bits (1131),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 240/409 (59%), Positives = 298/409 (73%), Gaps = 17/409 (4%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFS--WSRCSEDN  1337
             GS G     + QW+++ D ++ KS + F  +PL    ++I RKS R   +       ED+
Sbjct  76    GSPGLGQKHSQQWRAMIDVLRFKSVRRFSTIPLLAASYEISRKSLRNKLARILPANEEDD  135

Query  1336  -----IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAV  1172
                  ID  D S TKPSWRNF+  +L+ ATD+FS  N+LGKGGHAEVYKG L DGQV+AV
Sbjct  136   DLNLGIDIDDIS-TKPSWRNFSYADLAAATDDFSPVNLLGKGGHAEVYKGCLADGQVVAV  194

Query  1171  kriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLL  992
             KR+++ +K+ E +  DFL+ELGIIAHINHPNA +LIGF  DNGL+ VLQ  PHGSL+ LL
Sbjct  195   KRLMRNEKEIEGKAGDFLTELGIIAHINHPNATRLIGFGIDNGLYFVLQLAPHGSLSSLL  254

Query  991   HNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLA  812
                +E LEWKIRFKVAVGVA+GL YLH  C RRIIHRDI ASNILL ++  A+ISDFGLA
Sbjct  255   F-GSECLEWKIRFKVAVGVAKGLQYLHHDCPRRIIHRDIKASNILLNQNNEAEISDFGLA  313

Query  811   KWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SR  635
             KWLP+KW HHVV PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDS SR
Sbjct  314   KWLPDKWAHHVVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSNSR  373

Query  634   QSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEV  455
             +SLV+WAKPLLE   I+++ DPRL   YD+ EM+ +M  A  CI H+ + RP M +VV++
Sbjct  374   ESLVIWAKPLLEAKLIEQMVDPRLELKYDLAEMKCAMVTASMCIHHMSSKRPYMNQVVQL  433

Query  454   LKGENELKVELRQSKSVSSESL----HIADFTSTSYRKHLDRHLQLIME  320
             LKGE E+ +EL Q+ S     L     + D+T ++Y   L+RH QL+ME
Sbjct  434   LKGE-EVPIELTQNSSAPRSHLIDACDLEDYTCSNYLTDLNRHKQLLME  481



>ref|XP_009382115.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=525

 Score =   441 bits (1133),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 221/403 (55%), Positives = 290/403 (72%), Gaps = 11/403 (3%)
 Frame = -3

Query  1498  GGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG--  1325
             G   +  +VQW+++      +  +S   +  F     R S R      R S+D  + G  
Sbjct  123   GTRLESHSVQWRNLIAGFIMRKKRSMTRLSTFPPATGRSSLRRALERIRSSKDGTESGRI  182

Query  1324  --DFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
               +  + +PSWR+F  +EL+ ATD FS + ++GKGGHAEVYKG LGDGQ++AVKR+IK +
Sbjct  183   VVEVKMARPSWRSFAYEELAAATDGFSPDKLVGKGGHAEVYKGCLGDGQLVAVKRLIKRE  242

Query  1150  kkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETL  971
              ++E   + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA LLH + E L
Sbjct  243   SEEERIGD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASLLHGSKEAL  301

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
             +W++RF++A G+AEGL YLH  CQRRIIHRDI ASNILLTED+  QISDFGLAKWLP+KW
Sbjct  302   DWRVRFQIAAGIAEGLRYLHEGCQRRIIHRDIKASNILLTEDFQPQISDFGLAKWLPDKW  361

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              HHVV PIEGTFGY+APEYFMHG+V+EKTDVFAFGVLLLELITGR+A+DSSRQSLV+WA+
Sbjct  362   NHHVVFPIEGTFGYLAPEYFMHGVVNEKTDVFAFGVLLLELITGRRAIDSSRQSLVIWAR  421

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL-  434
             PLL+ N++K+L DP L D+YD  E+ R++ VA +CI HL   RP M +VV +L+GE  L 
Sbjct  422   PLLDANSVKQLVDPSLEDSYDAKELARALQVASACIHHLSTSRPTMNEVVRLLRGEEGLM  481

Query  433   -----KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                  +   + ++    ++  + D+TS+ Y   L RH QL +E
Sbjct  482   EIIGKESNYKVARPPLIDTCDMDDYTSSRYLNDLHRHKQLALE  524



>ref|XP_009382123.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=524

 Score =   440 bits (1132),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 221/403 (55%), Positives = 290/403 (72%), Gaps = 11/403 (3%)
 Frame = -3

Query  1498  GGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG--  1325
             G   +  +VQW+++      +  +S   +  F     R S R      R S+D  + G  
Sbjct  122   GTRLESHSVQWRNLIAGFIMRKKRSMTRLSTFPPATGRSSLRRALERIRSSKDGTESGRI  181

Query  1324  --DFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
               +  + +PSWR+F  +EL+ ATD FS + ++GKGGHAEVYKG LGDGQ++AVKR+IK +
Sbjct  182   VVEVKMARPSWRSFAYEELAAATDGFSPDKLVGKGGHAEVYKGCLGDGQLVAVKRLIKRE  241

Query  1150  kkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETL  971
              ++E   + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA LLH + E L
Sbjct  242   SEEERIGD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASLLHGSKEAL  300

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
             +W++RF++A G+AEGL YLH  CQRRIIHRDI ASNILLTED+  QISDFGLAKWLP+KW
Sbjct  301   DWRVRFQIAAGIAEGLRYLHEGCQRRIIHRDIKASNILLTEDFQPQISDFGLAKWLPDKW  360

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              HHVV PIEGTFGY+APEYFMHG+V+EKTDVFAFGVLLLELITGR+A+DSSRQSLV+WA+
Sbjct  361   NHHVVFPIEGTFGYLAPEYFMHGVVNEKTDVFAFGVLLLELITGRRAIDSSRQSLVIWAR  420

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL-  434
             PLL+ N++K+L DP L D+YD  E+ R++ VA +CI HL   RP M +VV +L+GE  L 
Sbjct  421   PLLDANSVKQLVDPSLEDSYDAKELARALQVASACIHHLSTSRPTMNEVVRLLRGEEGLM  480

Query  433   -----KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                  +   + ++    ++  + D+TS+ Y   L RH QL +E
Sbjct  481   EIIGKESNYKVARPPLIDTCDMDDYTSSRYLNDLHRHKQLALE  523



>ref|XP_004509705.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Cicer arietinum]
Length=492

 Score =   439 bits (1128),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 233/398 (59%), Positives = 295/398 (74%), Gaps = 17/398 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNIDCGDFSI-----  1313
             QW+++ D ++ KS + F  +PL    ++I RK+ R   +  R   D+ +  D S+     
Sbjct  98    QWRNMIDALRIKSVRRFSSIPLLAASYEISRKNLRNKLARVRTDNDDENGFDCSLDLDGI  157

Query  1312  -TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdee  1136
              TKP+WRNF+ ++L  ATDNF+ ENM+GKGGHAEVYK  L DG+V+AVKR+++ +K+  +
Sbjct  158   PTKPTWRNFSYEDLVAATDNFNPENMIGKGGHAEVYKACLPDGKVVAVKRLMRNEKEAGD  217

Query  1135  rieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIR  956
             +  DFLSELGIIAHINHPNA +LIGF  D GL+ VLQ+  HGSL+ LL   +E LEWKIR
Sbjct  218   KAGDFLSELGIIAHINHPNATRLIGFGIDRGLYFVLQFASHGSLSSLLF-GSECLEWKIR  276

Query  955   FKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVV  776
             FKVA+GVA+GL YLH  C RRIIHRDI ASNILL  +  A+ISDFGLAKWLP+KW HHVV
Sbjct  277   FKVALGVAKGLQYLHQDCPRRIIHRDIKASNILLNHNGEAEISDFGLAKWLPDKWAHHVV  336

Query  775   SPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLE  599
              PIEGTFGY+APEYFMHG+VDEKTDVFAFGVLLLEL+TGR+AVDS SRQSLV+WAKPLL+
Sbjct  337   FPIEGTFGYLAPEYFMHGLVDEKTDVFAFGVLLLELMTGRRAVDSNSRQSLVIWAKPLLD  396

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
                +KE+ADPRL D YD +EM  +M  A  CI H+ + RP M +VV +LKGE E+ V+L 
Sbjct  397   AKQVKEIADPRLEDQYDPIEMMCAMATASMCIHHVSSKRPYMNQVVLLLKGE-EVAVDLT  455

Query  418   QSKSVSSESL-----HIADFTSTSYRKHLDRHLQLIME  320
             Q KS++  SL      + D+T ++Y   L+RH QLIME
Sbjct  456   Q-KSIAPRSLLLDACDLEDYTCSNYLNDLNRHKQLIME  492



>ref|XP_004509768.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform X1 [Cicer arietinum]
 ref|XP_004509769.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform X2 [Cicer arietinum]
Length=456

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 236/400 (59%), Positives = 290/400 (73%), Gaps = 11/400 (3%)
 Frame = -3

Query  1495  GGFDPTAVQWKSIFDQIKRKSAKSFPIVPLF---GHDIIRKSRRMFFSWSRCSEDNIDCG  1325
             GG +    QWKS+ D  K KS K    +P+     H+I +KS     +  R +E++ID G
Sbjct  60    GGKETQVQQWKSMVDVFKFKSVKKLTAIPMLVAVSHEITKKSLNKKLARIRSAEESIDIG  119

Query  1324  DFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkk  1145
                 TKPSWRNF   EL+ AT++FS +N++GKGGHAEVYKG L DGQV+AVKR++K DK 
Sbjct  120   AIP-TKPSWRNFEYAELAAATNDFSDDNLVGKGGHAEVYKGNLSDGQVVAVKRLMKNDKD  178

Query  1144  deerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEW  965
               +R  DFL+ELGIIAHINHPNA +L+GF  D GL+ VLQ  P+GSL+      +E LEW
Sbjct  179   FADRAGDFLTELGIIAHINHPNATRLVGFGIDRGLYFVLQLAPYGSLS-SSLFGSECLEW  237

Query  964   KIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGH  785
             K R+KVA+GVAEGL+YLH  C RRIIHRDI ASNILL E+Y A+ISDFGLAKWLP  W  
Sbjct  238   KARYKVAIGVAEGLNYLHQDCPRRIIHRDIKASNILLNENYEAEISDFGLAKWLPNSWTQ  297

Query  784   HVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKP  608
             HVV PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLELIT R+AVDS SRQSLV+WAKP
Sbjct  298   HVVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLELITSRRAVDSDSRQSLVIWAKP  357

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL+ NN+KELADPRL + YD  EM+R M  A  CI H    RP M + V++LKGE E  V
Sbjct  358   LLDSNNVKELADPRLEENYDPTEMKRVMSTASLCIHHSSAKRPFMNQAVQLLKGE-EAIV  416

Query  427   ELRQ----SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + +Q    SKSV   +  + +++ ++Y K L+RH +L+ME
Sbjct  417   DSKQNSAASKSVIVGACDLEEYSCSNYLKDLNRHRELVME  456



>ref|XP_003551310.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like [Glycine max]
Length=484

 Score =   436 bits (1122),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 236/394 (60%), Positives = 292/394 (74%), Gaps = 12/394 (3%)
 Frame = -3

Query  1468  WKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCS--EDNIDCG---DFSIT  1310
             W+++ D ++ KS + F  +PL    ++I RKS R   +  R +  +D+ D G   D   T
Sbjct  92    WRAMIDVLRFKSVRRFSTIPLLAASYEISRKSLRNKLARIRPANEDDDFDGGINIDGIST  151

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNF+  +L+ ATD+FS EN+LGKGGHAEVYKG L DGQV+AVKRI++ +K+ E+R 
Sbjct  152   KPSWRNFSYADLAVATDDFSPENLLGKGGHAEVYKGYLADGQVVAVKRIMRNEKEAEDRA  211

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
              DFL+ELGIIAHINHPNA +LIGF  DNGL+ VLQ  PHGSL+ LL   +E LEWKIRFK
Sbjct  212   GDFLTELGIIAHINHPNATRLIGFGIDNGLYFVLQLAPHGSLSSLLF-GSECLEWKIRFK  270

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VAVGVA+GL YLH  C RRIIHRDI ASNILL E+  A+ISDFGLAKWL +K  HHVV P
Sbjct  271   VAVGVAKGLQYLHHDCPRRIIHRDIKASNILLNENNEAEISDFGLAKWLADKCDHHVVFP  330

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQN  593
             IEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDS SR+SLV WAKPLL+  
Sbjct  331   IEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSNSRESLVKWAKPLLDAK  390

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE---NELKVEL  422
              I+E+ DPRL D YD+ EM+  M  A  CI H+ + RP M +VV++LKGE   NEL    
Sbjct  391   LIEEIVDPRLEDKYDLAEMKCVMATASLCIHHMSSKRPYMNQVVQLLKGEKVPNELNQNS  450

Query  421   RQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                +S+  ++  + D+T ++Y   L+RH QL+ME
Sbjct  451   SAPRSLLIDACDLEDYTCSNYLNDLNRHKQLLME  484



>ref|XP_010027963.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Eucalyptus grandis]
 gb|KCW54618.1| hypothetical protein EUGRSUZ_I00565 [Eucalyptus grandis]
Length=490

 Score =   436 bits (1120),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/333 (64%), Positives = 265/333 (80%), Gaps = 3/333 (1%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNF   EL+ ATD+FS EN++GKGGHAEVY+GRL DGQ +AVKR+ K++K + +RI
Sbjct  158   KPSWRNFDYSELAAATDDFSPENLIGKGGHAEVYRGRLPDGQTVAVKRLGKKEKDEVDRI  217

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
              DFLSELGI+AH+NHPN A+L+GF  + GL+ VL++ P+GSLA LLH +T  ++W  RFK
Sbjct  218   GDFLSELGIVAHVNHPNTARLLGFGIEGGLYFVLRFSPNGSLASLLHGSTGVVDWTTRFK  277

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +AVGVAEGL YLH  C RRIIHRDI ASNILL EDY  QISDFGLAKWLPEKW HHV+ P
Sbjct  278   IAVGVAEGLQYLHHHCPRRIIHRDIKASNILLNEDYEPQISDFGLAKWLPEKWVHHVIFP  337

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGT GY+APEYFMHGIVDEKTDVFAFGVLLLEL+TGR+AVDS RQSLVMWAKPLL+ NN
Sbjct  338   IEGTIGYLAPEYFMHGIVDEKTDVFAFGVLLLELMTGRRAVDSCRQSLVMWAKPLLDANN  397

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELR  419
             I +L DPRLG+AYD VEM+R++  A  CI HL  MRP+M +VV++L+GE+   E K    
Sbjct  398   ITDLVDPRLGEAYDEVEMKRALLTASMCIHHLSTMRPSMNQVVKILRGEDGTLEWKHASV  457

Query  418   QSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              S+++   +    D++  +Y   L+RH+QL++E
Sbjct  458   SSRTLLLNACDAEDYSCATYLDDLNRHMQLVLE  490



>ref|XP_010027964.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Eucalyptus grandis]
Length=488

 Score =   436 bits (1120),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/333 (64%), Positives = 265/333 (80%), Gaps = 3/333 (1%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSWRNF   EL+ ATD+FS EN++GKGGHAEVY+GRL DGQ +AVKR+ K++K + +RI
Sbjct  156   KPSWRNFDYSELAAATDDFSPENLIGKGGHAEVYRGRLPDGQTVAVKRLGKKEKDEVDRI  215

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
              DFLSELGI+AH+NHPN A+L+GF  + GL+ VL++ P+GSLA LLH +T  ++W  RFK
Sbjct  216   GDFLSELGIVAHVNHPNTARLLGFGIEGGLYFVLRFSPNGSLASLLHGSTGVVDWTTRFK  275

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +AVGVAEGL YLH  C RRIIHRDI ASNILL EDY  QISDFGLAKWLPEKW HHV+ P
Sbjct  276   IAVGVAEGLQYLHHHCPRRIIHRDIKASNILLNEDYEPQISDFGLAKWLPEKWVHHVIFP  335

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGT GY+APEYFMHGIVDEKTDVFAFGVLLLEL+TGR+AVDS RQSLVMWAKPLL+ NN
Sbjct  336   IEGTIGYLAPEYFMHGIVDEKTDVFAFGVLLLELMTGRRAVDSCRQSLVMWAKPLLDANN  395

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELR  419
             I +L DPRLG+AYD VEM+R++  A  CI HL  MRP+M +VV++L+GE+   E K    
Sbjct  396   ITDLVDPRLGEAYDEVEMKRALLTASMCIHHLSTMRPSMNQVVKILRGEDGTLEWKHASV  455

Query  418   QSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              S+++   +    D++  +Y   L+RH+QL++E
Sbjct  456   SSRTLLLNACDAEDYSCATYLDDLNRHMQLVLE  488



>ref|XP_007156465.1| hypothetical protein PHAVU_003G288300g [Phaseolus vulgaris]
 gb|ESW28459.1| hypothetical protein PHAVU_003G288300g [Phaseolus vulgaris]
Length=479

 Score =   434 bits (1117),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 295/406 (73%), Gaps = 16/406 (4%)
 Frame = -3

Query  1498  GGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSED-----  1340
             G G D    QWK++ D ++ KS + F  +PL G  ++I R+S R   +  R + D     
Sbjct  77    GQGRDAQNQQWKTMMDVLRFKSVRRFSTIPLLGASYEISRRSLRNKLARIRPANDDDDLD  136

Query  1339  -NIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkri  1163
              +ID  D   TKPSW+NF   EL  ATD+F+ ENMLGKGGHAEVYKG L DG+++AVKR+
Sbjct  137   VSIDF-DGIPTKPSWKNFNYAELVAATDDFNPENMLGKGGHAEVYKGCLPDGRIVAVKRL  195

Query  1162  ikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
             ++ +K+ E+ + DFL+ELGIIAHIN+PNA +LIGF  D GL  VLQ  PHGSLA +L   
Sbjct  196   MRNEKEIEDTVGDFLTELGIIAHINNPNATRLIGFGIDQGLFFVLQLAPHGSLASMLF-G  254

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
              E LEW IRFKVAVGVA+GLHYLH  C RRIIHRDI ASNILL     A+ISDFGLAKWL
Sbjct  255   PECLEWNIRFKVAVGVAKGLHYLHHDCPRRIIHRDIKASNILLNHSNEAEISDFGLAKWL  314

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSL  626
             P+KW HHVV PIEGTFGY+APEYFMHGIVDEK DVFAFGVLLLELITGR+AVDS SR+SL
Sbjct  315   PDKWAHHVVFPIEGTFGYLAPEYFMHGIVDEKIDVFAFGVLLLELITGRRAVDSNSRESL  374

Query  625   VMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
             V+WAKP L+   IKE+ DPRLGD YD+ EM+  M  A  CI H+ + RP M +VV++LKG
Sbjct  375   VIWAKPFLDAKLIKEMVDPRLGDKYDLAEMKCCMATASLCIHHMSSKRPYMDQVVQLLKG  434

Query  445   ENELKVELRQS----KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             E E+ +EL Q+    +S+  ++  + D+T ++Y   L+RH QL+ME
Sbjct  435   E-EVPIELNQNSPSPRSLLVDACDLEDYTCSNYLNDLNRHRQLLME  479



>gb|KHN37128.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1, 
partial [Glycine soja]
Length=389

 Score =   431 bits (1107),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 289/392 (74%), Gaps = 17/392 (4%)
 Frame = -3

Query  1453  DQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFS--WSRCSEDN-----IDCGDFSITKPS  1301
             D ++ KS + F  +PL    ++I RKS R   +       ED+     ID  D S TKPS
Sbjct  1     DVLRFKSVRRFSTIPLLAASYEISRKSLRNKLARILPANEEDDDLNLGIDIDDIS-TKPS  59

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNF+  +L+ ATD+FS  N+LGKGGHAEVYKG L DGQV+AVKR+++ +K+ E +  DF
Sbjct  60    WRNFSYADLAAATDDFSPVNLLGKGGHAEVYKGCLADGQVVAVKRLMRNEKEIEGKAGDF  119

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             L+ELGIIAHINHPNA +LIGF  DNGL+ VLQ  PHGSL+ LL   +E LEWKIRFKVAV
Sbjct  120   LTELGIIAHINHPNATRLIGFGIDNGLYFVLQLAPHGSLSSLLF-GSECLEWKIRFKVAV  178

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             GVA+GL YLH  C RRIIHRDI ASNILL ++  A+ISDFGLAKWLP+KW HHVV PIEG
Sbjct  179   GVAKGLQYLHHDCPRRIIHRDIKASNILLNQNNEAEISDFGLAKWLPDKWAHHVVFPIEG  238

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIK  584
             TFGY+APEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDS SR+SLV+WAKPLLE   I+
Sbjct  239   TFGYLAPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSNSRESLVIWAKPLLEAKLIE  298

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSV  404
             ++ DPRL   YD+ EM+ +M  A  CI H+ + RP M +VV++LKGE E+ +EL Q+ S 
Sbjct  299   QMVDPRLELKYDLAEMKCAMVTASMCIHHMSSKRPYMNQVVQLLKGE-EVPIELTQNSSA  357

Query  403   SSESL----HIADFTSTSYRKHLDRHLQLIME  320
                 L     + D+T ++Y   L+RH QL+ME
Sbjct  358   PRSHLIDACDLEDYTCSNYLTDLNRHKQLLME  389



>ref|XP_006656340.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform X1 [Oryza brachyantha]
Length=540

 Score =   436 bits (1120),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 228/399 (57%), Positives = 278/399 (70%), Gaps = 16/399 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG--------DF  1319
             VQW+++   +  +  KS      F         + +    R S++ IDCG        + 
Sbjct  143   VQWRNLISGLILRRRKSMGRAVTFPQRSKSTGLKRYLERMRSSKNQIDCGAIAPEILPEI  202

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  +PSWR+F   EL  ATD FSSEN++GKGGHAEVYKG L DGQ +AVKR+ K   K++
Sbjct  203   SKWRPSWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKED  262

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH A   L+WK+
Sbjct  263   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGAKGALKWKV  321

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+KW HHV
Sbjct  322   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKWTHHV  381

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  382   VFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  441

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NN+KEL DP L   YD  EM   + VA  CI H  + RP MK VV  LKG+ E  +E+ 
Sbjct  442   SNNMKELVDPSLDVGYDPEEMAHILAVASMCIHHSSSSRPAMKSVVRFLKGDRE-SLEMM  500

Query  418   Q------SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             Q      +K    +S    D+T +SY   LDRH +L +E
Sbjct  501   QMQRPKLTKPPMFDSCDSEDYTRSSYLNDLDRHKKLALE  539



>gb|AFW87684.1| putative protein kinase superfamily protein [Zea mays]
Length=447

 Score =   432 bits (1111),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 278/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  KS      F      K  R +    R  ++ +DC   +       
Sbjct  52    VQWRNLISSLILRRKKSMGSAVTFPQRPKSKGLRGYLERMRSGKNQMDCSAIAPEILPQI  111

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F   EL  ATD+F SE M+GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  112   GKWRPSWRSFDYNELCAATDSFGSEKMIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  171

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH   E L+WK+
Sbjct  172   RVSD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKEPLKWKV  230

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RFK+A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+K  HHV
Sbjct  231   RFKIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKLTHHV  290

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  291   VYPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  350

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NNI+EL DP LG+ YD  EM  ++ VA  CI H    RP+MK VV  LKG+ E    +R
Sbjct  351   ANNIQELVDPSLGNEYDPEEMVYTLAVASLCIHHSSTSRPSMKSVVCFLKGDRESLELVR  410

Query  418   QSKSVSS---ESLHIADFTSTSYRKHLDRHLQLIME  320
             + K V     +S    D+T +SY   L+RH QL +E
Sbjct  411   RPKIVKPLMFDSGDSEDYTRSSYLSDLNRHKQLALE  446



>ref|XP_006656341.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform X2 [Oryza brachyantha]
Length=545

 Score =   436 bits (1120),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 228/399 (57%), Positives = 278/399 (70%), Gaps = 16/399 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG--------DF  1319
             VQW+++   +  +  KS      F         + +    R S++ IDCG        + 
Sbjct  148   VQWRNLISGLILRRRKSMGRAVTFPQRSKSTGLKRYLERMRSSKNQIDCGAIAPEILPEI  207

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  +PSWR+F   EL  ATD FSSEN++GKGGHAEVYKG L DGQ +AVKR+ K   K++
Sbjct  208   SKWRPSWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKED  267

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH A   L+WK+
Sbjct  268   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGAKGALKWKV  326

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+KW HHV
Sbjct  327   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKWTHHV  386

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  387   VFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  446

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NN+KEL DP L   YD  EM   + VA  CI H  + RP MK VV  LKG+ E  +E+ 
Sbjct  447   SNNMKELVDPSLDVGYDPEEMAHILAVASMCIHHSSSSRPAMKSVVRFLKGDRE-SLEMM  505

Query  418   Q------SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             Q      +K    +S    D+T +SY   LDRH +L +E
Sbjct  506   QMQRPKLTKPPMFDSCDSEDYTRSSYLNDLDRHKKLALE  544



>ref|XP_008805930.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Phoenix dactylifera]
Length=481

 Score =   432 bits (1111),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 227/386 (59%), Positives = 281/386 (73%), Gaps = 24/386 (6%)
 Frame = -3

Query  1408  LFGHDIIRKSRRMF-------------FSWSRCSEDNIDCGDFSIT----KPSWRNFTLQ  1280
             L G  I+RK R M                 ++  +D ++ G+ +      +PSWR+F  Q
Sbjct  96    LIGGLILRKKRCMMRLSTFPPVTAGLGLQGTQSKKDRMESGELTAEIRRGRPSWRSFDYQ  155

Query  1279  ELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGII  1100
             EL+ ATDNF+ + ++GKGGHAEVYKG L DGQ++AVKR+ K+D ++E   + FLSELGII
Sbjct  156   ELAAATDNFNPDKLIGKGGHAEVYKGCLADGQLVAVKRLTKKDNEEERVGD-FLSELGII  214

Query  1099  AHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLH  920
             AH+NHPNAA+L+GFS + GLHLVL++ PHGSLA +LH + E LEWK+RFK+A+G+AEGL 
Sbjct  215   AHVNHPNAAQLLGFSVERGLHLVLRFSPHGSLASVLHGSKEGLEWKVRFKIALGIAEGLL  274

Query  919   YLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAP  740
             YLH  CQRRIIHRD+ ASNILLTED+  QISDFGLAKWLP+ W HH+V PIEGTFGY+AP
Sbjct  275   YLHEGCQRRIIHRDMKASNILLTEDFEPQISDFGLAKWLPDNWTHHIVFPIEGTFGYLAP  334

Query  739   EYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLG  560
             EYFMHG+V+EK DVFAFGVLLLELITGR+AVDSSRQSLV+WAKPLL+ NN+KELADP LG
Sbjct  335   EYFMHGVVNEKIDVFAFGVLLLELITGRRAVDSSRQSLVIWAKPLLDTNNVKELADPSLG  394

Query  559   DAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE----LKVELRQ--SKSVSS  398
             DAYD  EM RS+ VA  CI HL   RPNM  VV +LKGE      L  ELR   ++    
Sbjct  395   DAYDPEEMRRSLLVASMCIHHLSTSRPNMNWVVRLLKGEQGYAELLGRELRPKIARPPLF  454

Query  397   ESLHIADFTSTSYRKHLDRHLQLIME  320
             ++    D+T + Y   L RH QL +E
Sbjct  455   DACDSEDYTCSRYLNDLHRHKQLALE  480



>ref|NP_001151766.1| LOC100285401 [Zea mays]
 gb|ACG44258.1| ATP binding protein [Zea mays]
 gb|AFW87683.1| putative protein kinase superfamily protein [Zea mays]
Length=562

 Score =   434 bits (1117),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 278/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  KS      F      K  R +    R  ++ +DC   +       
Sbjct  167   VQWRNLISSLILRRKKSMGSAVTFPQRPKSKGLRGYLERMRSGKNQMDCSAIAPEILPQI  226

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F   EL  ATD+F SE M+GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  227   GKWRPSWRSFDYNELCAATDSFGSEKMIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  286

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH   E L+WK+
Sbjct  287   RVSD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKEPLKWKV  345

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RFK+A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+K  HHV
Sbjct  346   RFKIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKLTHHV  405

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  406   VYPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  465

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NNI+EL DP LG+ YD  EM  ++ VA  CI H    RP+MK VV  LKG+ E    +R
Sbjct  466   ANNIQELVDPSLGNEYDPEEMVYTLAVASLCIHHSSTSRPSMKSVVCFLKGDRESLELVR  525

Query  418   QSKSVSS---ESLHIADFTSTSYRKHLDRHLQLIME  320
             + K V     +S    D+T +SY   L+RH QL +E
Sbjct  526   RPKIVKPLMFDSGDSEDYTRSSYLSDLNRHKQLALE  561



>ref|XP_008658716.1| PREDICTED: LOC100285401 isoform X1 [Zea mays]
Length=568

 Score =   434 bits (1117),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 278/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  KS      F      K  R +    R  ++ +DC   +       
Sbjct  173   VQWRNLISSLILRRKKSMGSAVTFPQRPKSKGLRGYLERMRSGKNQMDCSAIAPEILPQI  232

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F   EL  ATD+F SE M+GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  233   GKWRPSWRSFDYNELCAATDSFGSEKMIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  292

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH   E L+WK+
Sbjct  293   RVSD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKEPLKWKV  351

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RFK+A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+K  HHV
Sbjct  352   RFKIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKLTHHV  411

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  412   VYPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  471

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NNI+EL DP LG+ YD  EM  ++ VA  CI H    RP+MK VV  LKG+ E    +R
Sbjct  472   ANNIQELVDPSLGNEYDPEEMVYTLAVASLCIHHSSTSRPSMKSVVCFLKGDRESLELVR  531

Query  418   QSKSVSS---ESLHIADFTSTSYRKHLDRHLQLIME  320
             + K V     +S    D+T +SY   L+RH QL +E
Sbjct  532   RPKIVKPLMFDSGDSEDYTRSSYLSDLNRHKQLALE  567



>ref|XP_010680362.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Beta vulgaris subsp. vulgaris]
Length=490

 Score =   431 bits (1107),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 235/405 (58%), Positives = 288/405 (71%), Gaps = 16/405 (4%)
 Frame = -3

Query  1489  FDPT--AVQWKSIFDQIKRKSAK---SFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNID  1331
             F+P    VQ K   D +KRKS     S   + L    +D+  KS + F +  R +ED+ID
Sbjct  87    FNPLTYGVQIKGFLDSMKRKSGVRRFSTSTINLLSNSYDLSAKSLKKF-ARIRSAEDSID  145

Query  1330  CGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
             CG  S  KPSWRNF   EL+ ATD+FS   MLGKGGHAEVYKG L DG ++AVKR+ K+ 
Sbjct  146   CGLLSAAKPSWRNFKYSELAAATDHFSPGRMLGKGGHAEVYKGCLPDGTLVAVKRLTKKG  205

Query  1150  kkde-erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATET  974
              K+  ER  DFLSELGIIAH++HPN A+L+GF  + GL+LVLQ+ P+GS+   L   +  
Sbjct  206   DKENGERTADFLSELGIIAHVDHPNTARLLGFGVEGGLYLVLQFAPNGSVESCLQGLSGG  265

Query  973   LEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEK  794
             L+W  R K+AVGVAEGL YLH  CQRRIIHRDI ASNILL EDY   ISDFGLAKWLPEK
Sbjct  266   LDWMTRLKIAVGVAEGLSYLHHTCQRRIIHRDIKASNILLAEDYEPLISDFGLAKWLPEK  325

Query  793   WGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQ--AVDSSRQSLVM  620
             W HHVV PIEGTFGY+APEYFMHGI DEKTDVFA+GVLLLE+ITGR   AVDSSRQSLVM
Sbjct  326   WLHHVVYPIEGTFGYLAPEYFMHGIADEKTDVFAYGVLLLEIITGRHAVAVDSSRQSLVM  385

Query  619   WAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN  440
             WAKP L+ +N+KE+ADP+LGD Y+  EM+R M +A  CI H P+ R  M +VVE+L+GE 
Sbjct  386   WAKPFLDTSNMKEIADPKLGDNYNPEEMKRIMAIASMCIHHTPSKRSFMNEVVELLRGEG  445

Query  439   ELKVELRQSKSVSSESL-----HIADFTSTSYRKHLDRHLQLIME  320
                VE  + KS S  S+      + D+T ++Y + L+RH +L+ME
Sbjct  446   GPVVEEIRQKSFSQRSIMLDSCDLEDYTCSNYLQDLNRHKELVME  490



>ref|XP_010914330.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Elaeis guineensis]
Length=461

 Score =   428 bits (1101),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 217/338 (64%), Positives = 266/338 (79%), Gaps = 11/338 (3%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             +PSWR+F  QEL+ AT+NFSS+ ++GKGGHAEVYKG L DGQ++AVKR+ K+D ++E   
Sbjct  126   RPSWRSFDHQELAAATNNFSSDKLIGKGGHAEVYKGCLADGQLVAVKRLTKKDNEEERIG  185

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
             + FLSELGIIAH+NHPNAA+L+GFS + GLHLVL++ PHGSLA  LH + E LEWK+RFK
Sbjct  186   D-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLRFSPHGSLASELHGSKEGLEWKVRFK  244

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G+AEGL YLH  CQRRIIHRDI ASNILLTED+  QISDFGLAKWLP+KW HH+V P
Sbjct  245   IALGIAEGLLYLHEGCQRRIIHRDIKASNILLTEDFQPQISDFGLAKWLPDKWTHHIVFP  304

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGY+APEYFMHG+V+EK DVFAFGVLLLELITGR+AVDSSRQSLV+WAKPLL+ NN
Sbjct  305   IEGTFGYLAPEYFMHGVVNEKIDVFAFGVLLLELITGRRAVDSSRQSLVIWAKPLLDANN  364

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE--------NEL  434
             +K+LADP LGDAYD  EM R++ VA  CI HL   RP+M  VV +LKGE         EL
Sbjct  365   VKQLADPSLGDAYDAEEMRRALLVASMCIHHLSTSRPDMNWVVRLLKGEEGSAELMGREL  424

Query  433   KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + +L  ++    ++    D+T + Y   L RH QL +E
Sbjct  425   RPKL--ARPPQFDACDSEDYTCSRYLNDLHRHKQLALE  460



>ref|XP_010914329.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Elaeis guineensis]
Length=477

 Score =   429 bits (1102),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 217/338 (64%), Positives = 266/338 (79%), Gaps = 11/338 (3%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             +PSWR+F  QEL+ AT+NFSS+ ++GKGGHAEVYKG L DGQ++AVKR+ K+D ++E   
Sbjct  142   RPSWRSFDHQELAAATNNFSSDKLIGKGGHAEVYKGCLADGQLVAVKRLTKKDNEEERIG  201

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
             + FLSELGIIAH+NHPNAA+L+GFS + GLHLVL++ PHGSLA  LH + E LEWK+RFK
Sbjct  202   D-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLRFSPHGSLASELHGSKEGLEWKVRFK  260

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G+AEGL YLH  CQRRIIHRDI ASNILLTED+  QISDFGLAKWLP+KW HH+V P
Sbjct  261   IALGIAEGLLYLHEGCQRRIIHRDIKASNILLTEDFQPQISDFGLAKWLPDKWTHHIVFP  320

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGY+APEYFMHG+V+EK DVFAFGVLLLELITGR+AVDSSRQSLV+WAKPLL+ NN
Sbjct  321   IEGTFGYLAPEYFMHGVVNEKIDVFAFGVLLLELITGRRAVDSSRQSLVIWAKPLLDANN  380

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE--------NEL  434
             +K+LADP LGDAYD  EM R++ VA  CI HL   RP+M  VV +LKGE         EL
Sbjct  381   VKQLADPSLGDAYDAEEMRRALLVASMCIHHLSTSRPDMNWVVRLLKGEEGSAELMGREL  440

Query  433   KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + +L  ++    ++    D+T + Y   L RH QL +E
Sbjct  441   RPKL--ARPPQFDACDSEDYTCSRYLNDLHRHKQLALE  476



>ref|XP_006857068.1| hypothetical protein AMTR_s00065p00072280 [Amborella trichopoda]
 gb|ERN18535.1| hypothetical protein AMTR_s00065p00072280 [Amborella trichopoda]
Length=493

 Score =   429 bits (1102),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 227/391 (58%), Positives = 286/391 (73%), Gaps = 16/391 (4%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKP--  1304
              +QW+S+ + +K KS + F   P FG       +R   +W R   D  +  +  + +P  
Sbjct  113   GLQWRSLVNALKHKSMRKFSTFPPFG------GKR---NWVRI-RDTEEKEELPVLRPQA  162

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SWR F  +EL  AT+NFSSEN++GKGGHAEVYKG L DGQ++AVKR+IK +++DE   + 
Sbjct  163   SWRCFDHEELMSATNNFSSENLIGKGGHAEVYKGILVDGQLVAVKRLIKREREDERIGD-  221

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGIIAHINHPNAA LIGF  + GLHLVLQ+ PHGSL+ +LH   + LEW IR+K+A
Sbjct  222   FLSELGIIAHINHPNAAHLIGFGVEGGLHLVLQFSPHGSLSSVLHGTNQELEWGIRYKIA  281

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G+AEGL YLH  C RRIIHRDI ASNILL +D+  QISDFGLAKWLP++W HHVVSPIE
Sbjct  282   LGIAEGLMYLHEGCHRRIIHRDIKASNILLAQDFQPQISDFGLAKWLPDQWTHHVVSPIE  341

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+APEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDS  QSLVMWAKPLL+   +K
Sbjct  342   GTFGYLAPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSCLQSLVMWAKPLLDAKKMK  401

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL-KVELRQSKS  407
             ELADPRLGD Y+  +M   MF A  C+ HL   RP M +VV +LKG++ + +  ++Q K+
Sbjct  402   ELADPRLGDTYNTRQMGYIMFTASLCVHHLAISRPRMNQVVRLLKGKDLMAETFVQQPKT  461

Query  406   VSSESLHI--ADFTSTSYRKHLDRHLQLIME  320
             +    L +   D+TS+ Y   L+R+ QL +E
Sbjct  462   LVGSQLFLDGDDYTSSRYLSDLNRYKQLALE  492



>ref|XP_010941724.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Elaeis guineensis]
Length=481

 Score =   428 bits (1101),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 217/336 (65%), Positives = 262/336 (78%), Gaps = 7/336 (2%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             +PSWR+F  QEL+ ATDNFS + ++GKGGHA+VYKG L DGQV+AVKR+ K+  ++E   
Sbjct  146   RPSWRSFDYQELAAATDNFSPDKLIGKGGHAKVYKGCLADGQVVAVKRLTKKVNEEERVG  205

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
             + FLSELGIIAH+NHPNAA+L+GFS D GLHLVL++ PHGSLA +LH + E LEWK+RFK
Sbjct  206   D-FLSELGIIAHVNHPNAAQLVGFSVDGGLHLVLKFSPHGSLASVLHGSKEGLEWKVRFK  264

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G+AEGL YLH  CQRRIIHRDI ASNILLTED+  QISDFGLAKWLP+ W HH+V P
Sbjct  265   IALGIAEGLLYLHEGCQRRIIHRDIKASNILLTEDFEPQISDFGLAKWLPDNWTHHIVFP  324

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGY+APEYFMHG+V+EK+DVFAFGVLLLELITGR+AVD SRQSLV+WAKPLL  NN
Sbjct  325   IEGTFGYLAPEYFMHGVVNEKSDVFAFGVLLLELITGRRAVDFSRQSLVIWAKPLLNANN  384

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE----LKVEL  422
             +KELADP LGDAYD  EM RS+ VA  CI HL   RP+M  VV +LKGE      +  EL
Sbjct  385   VKELADPTLGDAYDPEEMRRSLLVASMCIHHLSTSRPSMNWVVRLLKGEEGYAELMGQEL  444

Query  421   RQ--SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             R   ++    ++    D+T + Y   L RH QL +E
Sbjct  445   RPKIARPPLFDACDSEDYTCSRYLNDLHRHKQLALE  480



>emb|CBI33279.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   422 bits (1084),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 212/310 (68%), Positives = 256/310 (83%), Gaps = 3/310 (1%)
 Frame = -3

Query  1240  MLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIG  1061
             ++GKGGHAEVY+G L DGQ++AVK+++K++K+ EER  DFLSELGIIAHI+HPNAA+LIG
Sbjct  1     LIGKGGHAEVYRGCLSDGQLVAVKKLMKKEKEHEERTGDFLSELGIIAHIDHPNAARLIG  60

Query  1060  FSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHR  881
             F  D GLHLVLQ+ P GSLA +LH  TE+LEWKIRFKVAVGVAEGL YLH  C RRIIHR
Sbjct  61    FGVDGGLHLVLQFSPQGSLASVLHGTTESLEWKIRFKVAVGVAEGLQYLHQGCHRRIIHR  120

Query  880   DITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTD  701
             DI ASNILLT+DY  QISDFGLAKWLP+KW HHVV PIEGTFGY+APEYFMHGIVDEKTD
Sbjct  121   DIKASNILLTQDYQPQISDFGLAKWLPDKWAHHVVFPIEGTFGYLAPEYFMHGIVDEKTD  180

Query  700   VFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMF  521
             VFAFGVLLLELITGR AVDSSRQSLV+WAKPLL+ N++KELAD RLGD YD+ EM+R+M 
Sbjct  181   VFAFGVLLLELITGRHAVDSSRQSLVIWAKPLLDANDVKELADSRLGDCYDLGEMKRAML  240

Query  520   VALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQSKSVSSESLHIADFTSTSYRKH  350
              A  CI H  +MRP M +VV++L+GE    E K +    +++  +   +AD+T TSY + 
Sbjct  241   TASMCIHHSSSMRPEMNRVVQLLRGEGKSPEPKQKSNVGRALILDDSDLADYTPTSYLRD  300

Query  349   LDRHLQLIME  320
             L+RH++L++E
Sbjct  301   LNRHMELVLE  310



>ref|XP_010941723.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Elaeis guineensis]
Length=487

 Score =   428 bits (1101),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 217/336 (65%), Positives = 262/336 (78%), Gaps = 7/336 (2%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             +PSWR+F  QEL+ ATDNFS + ++GKGGHA+VYKG L DGQV+AVKR+ K+  ++E   
Sbjct  152   RPSWRSFDYQELAAATDNFSPDKLIGKGGHAKVYKGCLADGQVVAVKRLTKKVNEEERVG  211

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
             + FLSELGIIAH+NHPNAA+L+GFS D GLHLVL++ PHGSLA +LH + E LEWK+RFK
Sbjct  212   D-FLSELGIIAHVNHPNAAQLVGFSVDGGLHLVLKFSPHGSLASVLHGSKEGLEWKVRFK  270

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G+AEGL YLH  CQRRIIHRDI ASNILLTED+  QISDFGLAKWLP+ W HH+V P
Sbjct  271   IALGIAEGLLYLHEGCQRRIIHRDIKASNILLTEDFEPQISDFGLAKWLPDNWTHHIVFP  330

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
             IEGTFGY+APEYFMHG+V+EK+DVFAFGVLLLELITGR+AVD SRQSLV+WAKPLL  NN
Sbjct  331   IEGTFGYLAPEYFMHGVVNEKSDVFAFGVLLLELITGRRAVDFSRQSLVIWAKPLLNANN  390

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE----LKVEL  422
             +KELADP LGDAYD  EM RS+ VA  CI HL   RP+M  VV +LKGE      +  EL
Sbjct  391   VKELADPTLGDAYDPEEMRRSLLVASMCIHHLSTSRPSMNWVVRLLKGEEGYAELMGQEL  450

Query  421   RQ--SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             R   ++    ++    D+T + Y   L RH QL +E
Sbjct  451   RPKIARPPLFDACDSEDYTCSRYLNDLHRHKQLALE  486



>ref|XP_010113449.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Morus notabilis]
 gb|EXC35476.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Morus notabilis]
Length=543

 Score =   430 bits (1105),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 226/406 (56%), Positives = 290/406 (71%), Gaps = 42/406 (10%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDN--IDCGDFSITKP  1304
             QWK++ + +KRKSA+ F  +P     +++ R++ R   +  R +E+   +DC  F   KP
Sbjct  158   QWKNVLELLKRKSARRFSTMPFLAASYEMSRRNLRRKLARIRSAEEGRVVDCEGFMAAKP  217

Query  1303  SWRNFTLQELSQATDNFS---------------SENMLGKGGHAEVYKGRLGDGQVIAVk  1169
             SWR+F   EL+ AT NFS               ++N++G+GG AEVYKG   DGQ++AVK
Sbjct  218   SWRSFGYAELAAATANFSPGKVDTSIESKLENFTDNLIGRGGQAEVYKGCFSDGQIVAVK  277

Query  1168  riikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLH  989
             R+IK++K++EERI DFLSELGIIAHI+HPNAA+L+GF  D G                  
Sbjct  278   RLIKKEKENEERIGDFLSELGIIAHIDHPNAARLLGFGVDGG------------------  319

Query  988   NATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAK  809
               +E LEWKIRFKVA+GVAEGL YLH  CQRRIIHRDI ASNILLT+DY AQISDFGLAK
Sbjct  320   --SEGLEWKIRFKVAIGVAEGLQYLHHNCQRRIIHRDIKASNILLTQDYEAQISDFGLAK  377

Query  808   WLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQS  629
             WLPEKW HHVV PIEGTFGY+APEYFMHGI+DEKTDVFA+GVLLLELITGR+AVDSS+QS
Sbjct  378   WLPEKWTHHVVFPIEGTFGYLAPEYFMHGIIDEKTDVFAYGVLLLELITGRRAVDSSQQS  437

Query  628   LVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLK  449
             LV+WAKP+L+ NN +ELAD RLG+ +D++EM+R M  A  CI H  + RP M +VV++LK
Sbjct  438   LVIWAKPMLDMNNFRELADARLGEGFDIIEMKRVMLTASMCIHHQSSRRPYMNRVVQLLK  497

Query  448   GEN---ELKVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              E+   ELK +    +SV  ++  + D+T ++Y   L+RH QL+ME
Sbjct  498   AEDGYQELKPKSTALRSVMLDACDLEDYTCSTYLNDLNRHRQLVME  543



>ref|XP_003635543.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1, partial [Vitis vinifera]
Length=309

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/309 (69%), Positives = 255/309 (83%), Gaps = 3/309 (1%)
 Frame = -3

Query  1237  LGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGF  1058
             +GKGGHAEVY+G L DGQ++AVK+++K++K+ EER  DFLSELGIIAHI+HPNAA+LIGF
Sbjct  1     IGKGGHAEVYRGCLSDGQLVAVKKLMKKEKEHEERTGDFLSELGIIAHIDHPNAARLIGF  60

Query  1057  SADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRD  878
               D GLHLVLQ+ P GSLA +LH  TE+LEWKIRFKVAVGVAEGL YLH  C RRIIHRD
Sbjct  61    GVDGGLHLVLQFSPQGSLASVLHGTTESLEWKIRFKVAVGVAEGLQYLHQGCHRRIIHRD  120

Query  877   ITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDV  698
             I ASNILLT+DY  QISDFGLAKWLP+KW HHVV PIEGTFGY+APEYFMHGIVDEKTDV
Sbjct  121   IKASNILLTQDYQPQISDFGLAKWLPDKWAHHVVFPIEGTFGYLAPEYFMHGIVDEKTDV  180

Query  697   FAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFV  518
             FAFGVLLLELITGR AVDSSRQSLV+WAKPLL+ N++KELAD RLGD YD+ EM+R+M  
Sbjct  181   FAFGVLLLELITGRHAVDSSRQSLVIWAKPLLDANDVKELADSRLGDCYDLGEMKRAMLT  240

Query  517   ALSCIQHLPNMRPNMKKVVEVLKGEN---ELKVELRQSKSVSSESLHIADFTSTSYRKHL  347
             A  CI H  +MRP M +VV++L+GE    E K +    +++  +   +AD+T TSY + L
Sbjct  241   ASMCIHHSSSMRPEMNRVVQLLRGEGKSPEPKQKSNVGRALILDDSDLADYTPTSYLRDL  300

Query  346   DRHLQLIME  320
             +RH++L++E
Sbjct  301   NRHMELVLE  309



>ref|XP_003563350.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Brachypodium distachyon]
Length=529

 Score =   428 bits (1101),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 221/396 (56%), Positives = 276/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  K       F         + +    R  ++ +DC   +       
Sbjct  134   VQWRNLITGLIVRRKKWMARAVTFPQRSKSTGLKRYLERIRSGKNQMDCSAIAPEIFPEI  193

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F   EL  ATD FSSEN++GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  194   EKWRPSWRSFDYDELCAATDKFSSENLIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  253

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH A   L+W  
Sbjct  254   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGAKGALKWNA  312

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGLHYLH  C R IIHRDI ASNILLTE+Y  QISDFGLAKWLP+KW HHV
Sbjct  313   RFNIALGIAEGLHYLHEGCHRHIIHRDIKASNILLTEEYQPQISDFGLAKWLPDKWTHHV  372

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  373   VFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  432

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKV  428
              NN+KEL DP L   YD  EM  ++ VA  CI H  N+RP+MK VV  LKG+    EL  
Sbjct  433   SNNMKELVDPSLDVGYDREEMALTLAVASMCIHHSSNLRPSMKSVVCFLKGDRESLELMG  492

Query  427   ELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + + +K +  +S    D+T ++Y   LDRH QL +E
Sbjct  493   KPKPTKPLMFDSCDSEDYTRSTYLHDLDRHKQLALE  528



>ref|XP_010240347.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X1 [Brachypodium distachyon]
Length=536

 Score =   428 bits (1101),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 221/396 (56%), Positives = 276/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  K       F         + +    R  ++ +DC   +       
Sbjct  141   VQWRNLITGLIVRRKKWMARAVTFPQRSKSTGLKRYLERIRSGKNQMDCSAIAPEIFPEI  200

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F   EL  ATD FSSEN++GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  201   EKWRPSWRSFDYDELCAATDKFSSENLIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  260

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH A   L+W  
Sbjct  261   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGAKGALKWNA  319

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGLHYLH  C R IIHRDI ASNILLTE+Y  QISDFGLAKWLP+KW HHV
Sbjct  320   RFNIALGIAEGLHYLHEGCHRHIIHRDIKASNILLTEEYQPQISDFGLAKWLPDKWTHHV  379

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  380   VFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  439

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKV  428
              NN+KEL DP L   YD  EM  ++ VA  CI H  N+RP+MK VV  LKG+    EL  
Sbjct  440   SNNMKELVDPSLDVGYDREEMALTLAVASMCIHHSSNLRPSMKSVVCFLKGDRESLELMG  499

Query  427   ELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + + +K +  +S    D+T ++Y   LDRH QL +E
Sbjct  500   KPKPTKPLMFDSCDSEDYTRSTYLHDLDRHKQLALE  535



>ref|XP_004965633.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform X2 [Setaria italica]
Length=568

 Score =   427 bits (1098),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 276/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  KS      F      +  R +    R  ++ +DC   +       
Sbjct  173   VQWRNLISGLILRRKKSMGRAVTFPQRSKSRGLRGYLERMRSGKNQMDCSAIAPEILPEI  232

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F  +EL  ATD FSSE ++GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  233   GKWRPSWRSFDYEELCTATDRFSSEKLIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  292

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH   E L+WK+
Sbjct  293   RVSD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKEPLKWKV  351

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP++  H V
Sbjct  352   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDQLTHLV  411

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  412   VYPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  471

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NNIKEL DP LG+ YD  EM   + VA  CI H    RP+MK VV  LKG+ E    +R
Sbjct  472   ANNIKELVDPSLGNEYDPEEMVYILAVASLCIHHSSTSRPSMKSVVCFLKGDRESLELVR  531

Query  418   QSKSVSS---ESLHIADFTSTSYRKHLDRHLQLIME  320
             + K V     +S    D+T +SY   L+RH QL +E
Sbjct  532   RPKIVKPLMFDSCDSEDYTRSSYLNDLNRHKQLALE  567



>ref|XP_004965634.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform X3 [Setaria italica]
Length=567

 Score =   427 bits (1098),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 276/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  KS      F      +  R +    R  ++ +DC   +       
Sbjct  172   VQWRNLISGLILRRKKSMGRAVTFPQRSKSRGLRGYLERMRSGKNQMDCSAIAPEILPEI  231

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F  +EL  ATD FSSE ++GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  232   GKWRPSWRSFDYEELCTATDRFSSEKLIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  291

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH   E L+WK+
Sbjct  292   RVSD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKEPLKWKV  350

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP++  H V
Sbjct  351   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDQLTHLV  410

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  411   VYPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  470

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NNIKEL DP LG+ YD  EM   + VA  CI H    RP+MK VV  LKG+ E    +R
Sbjct  471   ANNIKELVDPSLGNEYDPEEMVYILAVASLCIHHSSTSRPSMKSVVCFLKGDRESLELVR  530

Query  418   QSKSVSS---ESLHIADFTSTSYRKHLDRHLQLIME  320
             + K V     +S    D+T +SY   L+RH QL +E
Sbjct  531   RPKIVKPLMFDSCDSEDYTRSSYLNDLNRHKQLALE  566



>ref|XP_004965632.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform X1 [Setaria italica]
Length=575

 Score =   427 bits (1097),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 276/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  KS      F      +  R +    R  ++ +DC   +       
Sbjct  180   VQWRNLISGLILRRKKSMGRAVTFPQRSKSRGLRGYLERMRSGKNQMDCSAIAPEILPEI  239

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F  +EL  ATD FSSE ++GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  240   GKWRPSWRSFDYEELCTATDRFSSEKLIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  299

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH   E L+WK+
Sbjct  300   RVSD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKEPLKWKV  358

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP++  H V
Sbjct  359   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDQLTHLV  418

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  419   VYPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  478

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NNIKEL DP LG+ YD  EM   + VA  CI H    RP+MK VV  LKG+ E    +R
Sbjct  479   ANNIKELVDPSLGNEYDPEEMVYILAVASLCIHHSSTSRPSMKSVVCFLKGDRESLELVR  538

Query  418   QSKSVSS---ESLHIADFTSTSYRKHLDRHLQLIME  320
             + K V     +S    D+T +SY   L+RH QL +E
Sbjct  539   RPKIVKPLMFDSCDSEDYTRSSYLNDLNRHKQLALE  574



>ref|XP_008802341.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like cytosolic serine/threonine-protein 
kinase RBK1 [Phoenix dactylifera]
Length=461

 Score =   423 bits (1087),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 224/388 (58%), Positives = 282/388 (73%), Gaps = 28/388 (7%)
 Frame = -3

Query  1408  LFGHDIIRKSRRMF-------------FSWSRCSEDNIDCGDFSIT----KPSWRNFTLQ  1280
             L G  I+RK R M                 +   +D I+ G+ +      +PSWR+F  Q
Sbjct  76    LIGGLILRKKRSMMRLSTFPPATAGLGLQRTPSEKDRIESGEITSETGRGRPSWRSFDHQ  135

Query  1279  ELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGII  1100
             EL+ ATDNFS + ++GKGGHAEVYKG L DGQ++AVKR+ K+D ++E   + FLSELG+I
Sbjct  136   ELAAATDNFSRDKLIGKGGHAEVYKGCLADGQLVAVKRLTKKDNEEERIGD-FLSELGMI  194

Query  1099  AHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLH  920
             AH+NHPNAA+L+GFSA+ GLHLVL++ P+GSLA +LH + E LEWK+RFK+A+G+AEGL 
Sbjct  195   AHVNHPNAAQLLGFSAEGGLHLVLRFSPYGSLASVLHGSKEGLEWKVRFKIALGIAEGLL  254

Query  919   YLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAP  740
             YLH  CQRRIIHRDI ASNILLTED+  QISDFGLAKWLP+KW HH+V PIEGTFGY+AP
Sbjct  255   YLHEGCQRRIIHRDIKASNILLTEDFQPQISDFGLAKWLPDKWTHHIVFPIEGTFGYLAP  314

Query  739   EYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLG  560
             EYFMHG+V+EK DVF+FGVLLLELIT R+AVDSS+QSLV+WAKPLL+ NN+KELADP LG
Sbjct  315   EYFMHGVVNEKIDVFSFGVLLLELITRRRAVDSSQQSLVIWAKPLLDANNVKELADPSLG  374

Query  559   DAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE--------NELKVELRQSKSV  404
             DAYD  EM R++ VA  CI HL   RP+M  VV +LKGE         EL+ +L  ++  
Sbjct  375   DAYDPDEMRRALSVASMCIHHLSTSRPSMNWVVRLLKGEEGSAELVGRELRPKL--ARPP  432

Query  403   SSESLHIADFTSTSYRKHLDRHLQLIME  320
               ++    D+T + Y   L RH QL +E
Sbjct  433   LFDACDSEDYTCSKYLNDLHRHKQLALE  460



>ref|XP_004965635.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1-like isoform X4 [Setaria italica]
Length=570

 Score =   426 bits (1096),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 276/396 (70%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             VQW+++   +  +  KS      F      +  R +    R  ++ +DC   +       
Sbjct  175   VQWRNLISGLILRRKKSMGRAVTFPQRSKSRGLRGYLERMRSGKNQMDCSAIAPEILPEI  234

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F  +EL  ATD FSSE ++GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  235   GKWRPSWRSFDYEELCTATDRFSSEKLIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  294

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH   E L+WK+
Sbjct  295   RVSD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKEPLKWKV  353

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP++  H V
Sbjct  354   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDQLTHLV  413

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  414   VYPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  473

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NNIKEL DP LG+ YD  EM   + VA  CI H    RP+MK VV  LKG+ E    +R
Sbjct  474   ANNIKELVDPSLGNEYDPEEMVYILAVASLCIHHSSTSRPSMKSVVCFLKGDRESLELVR  533

Query  418   QSKSVSS---ESLHIADFTSTSYRKHLDRHLQLIME  320
             + K V     +S    D+T +SY   L+RH QL +E
Sbjct  534   RPKIVKPLMFDSCDSEDYTRSSYLNDLNRHKQLALE  569



>ref|XP_006279866.1| hypothetical protein CARUB_v10028558mg [Capsella rubella]
 gb|EOA12764.1| hypothetical protein CARUB_v10028558mg [Capsella rubella]
Length=699

 Score =   429 bits (1102),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 218/364 (60%), Positives = 267/364 (73%), Gaps = 24/364 (7%)
 Frame = -3

Query  1483  PTAV----QWKSIFDQIKRKSAKSFPIVPLFG-HDIIRKS-RRMFFSWSRCSEDNIDCGD  1322
             PT V    QW  + + IK+KS + F ++PL   +++ RK+ RR        SE+  DC  
Sbjct  65    PTNVSSFHQWNKMIESIKKKSIRRFSVIPLLATYELTRKNMRRKQPKLCPSSENEFDCNQ  124

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
               + KPSWRNFT  EL  ATDNF+ ENM+GKGGHAEVYKG L DG+ +A+K++ K  K+ 
Sbjct  125   ILVAKPSWRNFTFDELVAATDNFNPENMIGKGGHAEVYKGVLPDGETVAIKKLTKHAKEV  184

Query  1141  eerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWK  962
             EER  DFLSELGIIAH+NHPNAA+L GFS+D GLH VL+Y PHGSLA LL  + E L+WK
Sbjct  185   EERASDFLSELGIIAHVNHPNAARLRGFSSDRGLHFVLEYSPHGSLASLLFGSEECLDWK  244

Query  961   IRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGA-----------------Q  833
              R+KVA+G+A+GL YLH  C RRIIHRDI ASNILL++DY A                 Q
Sbjct  245   KRYKVALGIADGLSYLHNDCPRRIIHRDIKASNILLSQDYEAQQSNFLCVLRIRYELVLQ  304

Query  832   ISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQ  653
             ISDFGLAKWLPE W HH+V PIEGTFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+
Sbjct  305   ISDFGLAKWLPENWPHHIVFPIEGTFGYLAPEYFMHGIVDEKTDVFAFGVLLLEIITGRR  364

Query  652   AVDS-SRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPN  476
             AVD+ SRQS+VMWAKPLLE+NN++E+ DP+L + +D  EM+R M  A  CI H+  MRP+
Sbjct  365   AVDTASRQSIVMWAKPLLEKNNMEEIVDPQLRNDFDKTEMKRVMQTASMCIHHVSTMRPD  424

Query  475   MKKV  464
             M +V
Sbjct  425   MNRV  428



>dbj|BAK02644.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   423 bits (1087),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 221/396 (56%), Positives = 271/396 (68%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             +QW+++   +     K       F         + +    R  ++ +DC   +       
Sbjct  139   LQWRNLISGLILSRKKLMARAVTFPQRSKNTGLKRYLGRMRSGKNQMDCSAIAPEIFPEI  198

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F   EL  ATD FSS+N++GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  199   EKWRPSWRSFDYDELCAATDRFSSDNLIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  258

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA LLH A   L WK 
Sbjct  259   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASLLHGAKGALRWKA  317

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+GVAEGL YLH  C R IIHRDI ASNILLTEDY  QISDFGLAKWLP+K  H V
Sbjct  318   RFNIALGVAEGLFYLHEGCHRHIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKCTHQV  377

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLLE
Sbjct  378   VFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLE  437

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKV  428
              NN+K L DP L   YD+ EM  ++ VA  CI H  N+RP+MK VV  LKG+    EL  
Sbjct  438   SNNMKGLVDPSLDAGYDLEEMALTLAVASMCIHHSANLRPSMKSVVRFLKGDRESLELMG  497

Query  427   ELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + + +K    +S    D+T TSY   LD+H QL +E
Sbjct  498   KPKPTKPPMFDSCDSEDYTRTSYLNDLDKHKQLALE  533



>emb|CCE57823.1| ROP binding kinases 1 [Hordeum vulgare]
Length=543

 Score =   422 bits (1086),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 221/396 (56%), Positives = 271/396 (68%), Gaps = 12/396 (3%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSIT-----  1310
             +QW+++   +     K       F         + +    R  ++ +DC   +       
Sbjct  148   LQWRNLISGLILSRKKLMARAVTFPQRSKNTGLKRYLGRMRSGKNQMDCSAIAPEIFPEI  207

Query  1309  ---KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
                +PSWR+F   EL  ATD FSS+N++GKGGHAEVYKG+L DGQ +AVKR+ K   K++
Sbjct  208   EKWRPSWRSFDYDELCAATDRFSSDNLIGKGGHAEVYKGQLADGQFVAVKRLTKGGNKED  267

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA LLH A   L WK 
Sbjct  268   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASLLHGAKGALRWKA  326

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+GVAEGL YLH  C R IIHRDI ASNILLTEDY  QISDFGLAKWLP+K  H V
Sbjct  327   RFNIALGVAEGLFYLHEGCHRHIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKCTHQV  386

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYMAPEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLLE
Sbjct  387   VFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLE  446

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---ELKV  428
              NN+K L DP L   YD+ EM  ++ VA  CI H  N+RP+MK VV  LKG+    EL  
Sbjct  447   SNNMKGLVDPSLDAGYDLEEMALTLAVASMCIHHSANLRPSMKSVVRFLKGDRESLELMG  506

Query  427   ELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             + + +K    +S    D+T TSY   LD+H QL +E
Sbjct  507   KPKPTKPPMFDSCDSEDYTRTSYLNDLDKHKQLALE  542



>ref|XP_010519133.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Tarenaya hassleriana]
Length=398

 Score =   417 bits (1071),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/339 (62%), Positives = 261/339 (77%), Gaps = 2/339 (1%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLF-GHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
              +QW  + + IK+KS + F ++PL   +++ RK+       +  S  +  C  F + KPS
Sbjct  59    GLQWNKMIENIKKKSTRRFSVIPLLTSYELSRKNLWKKQPKNPPSGYDASCDHFLVAKPS  118

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             WRNFT  EL  ATD+F+ +NM+GKGG+AEVYKG L DG+++A+K+++   K +EER+ DF
Sbjct  119   WRNFTYDELVTATDDFNPDNMIGKGGNAEVYKGTLPDGEIVAIKKLMGNAKAEEERVSDF  178

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGIIAH+NHPNAA L GFS+D GLH VL+Y PHGSLA LL  A + L WKIR+KVA+
Sbjct  179   LSELGIIAHVNHPNAAHLRGFSSDRGLHFVLEYSPHGSLASLLFEAEKCLGWKIRYKVAL  238

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A+GL YLH  C RRIIHRDI ASNIL+T+D+ AQISDFGLAKWLPE W HHVV PIEG
Sbjct  239   GIADGLCYLHNGCPRRIIHRDIKASNILVTKDFEAQISDFGLAKWLPENWSHHVVFPIEG  298

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS-SRQSLVMWAKPLLEQNNIK  584
             TFGY+APEYFMHGIVDEKTDVFAFGVLLLE+ITGR+AVD+ SRQSLVMWAKPLLE+N++ 
Sbjct  299   TFGYLAPEYFMHGIVDEKTDVFAFGVLLLEVITGRRAVDTASRQSLVMWAKPLLEKNSVA  358

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKK  467
              + DPRLGD +D  EM+  M  A  CI H+  MRP+M +
Sbjct  359   GIVDPRLGDNFDPTEMKLVMLTASMCIHHIATMRPHMTQ  397



>gb|EMS45538.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Triticum urartu]
Length=458

 Score =   417 bits (1073),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 216/363 (60%), Positives = 262/363 (72%), Gaps = 12/363 (3%)
 Frame = -3

Query  1375  RMFFSWSRCSEDNIDCG--------DFSITKPSWRNFTLQELSQATDNFSSENMLGKGGH  1220
             + +    R  ++ +DC         +    +PSWR+F   EL  ATD FSS+N++GKGGH
Sbjct  96    KRYLGRMRSGKNQMDCSVIAPEIFPEIEKWRPSWRSFDYDELCAATDRFSSDNLIGKGGH  155

Query  1219  AEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGL  1040
             AEVYKG+L DGQ +AVKR+ K   K++   + FLSELGIIAH+NHPNAA+L+GFS + GL
Sbjct  156   AEVYKGQLADGQFVAVKRLTKGGNKEDRISD-FLSELGIIAHVNHPNAAQLLGFSVEGGL  214

Query  1039  HLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNI  860
             HLVLQ+ PHGSLA LLH A   L+WK RF +A+G+AEGL YLH  C R IIHRDI ASNI
Sbjct  215   HLVLQFSPHGSLASLLHGAKGALKWKARFNIALGIAEGLFYLHEGCHRHIIHRDIKASNI  274

Query  859   LLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVL  680
             LLTEDY  QISDFGLAKWLP+K  H VV PIEGTFGYMAPEYFMHGI++EKTDVFA+GVL
Sbjct  275   LLTEDYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVL  334

Query  679   LLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQ  500
             LLEL+TGR+AVDSSRQSLV+WAKPLLE NN+K L DP L   YD  EM  ++ VA  CI 
Sbjct  335   LLELVTGRKAVDSSRQSLVIWAKPLLESNNMKGLVDPSLDVGYDPEEMALTLAVASMCIH  394

Query  499   HLPNMRPNMKKVVEVLKGEN---ELKVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQL  329
             H  N+RP+MK VV  +KG+    EL  + R +K    +S    D+T TSY   LD+H QL
Sbjct  395   HSANLRPSMKSVVRFMKGDRESLELMGKPRPTKPPMFDSCDSEDYTRTSYLNDLDKHKQL  454

Query  328   IME  320
              +E
Sbjct  455   ALE  457



>dbj|BAG99344.1| unnamed protein product [Oryza sativa Japonica Group]
Length=446

 Score =   415 bits (1066),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 224/399 (56%), Positives = 275/399 (69%), Gaps = 16/399 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG--------DF  1319
              QW+++   +  +  KS      F         + +    R  ++ IDCG        + 
Sbjct  49    TQWRNLISGLILRRRKSMARAGTFPQRTKTTGLKRYLERMRSGKNQIDCGAIAPEILPEI  108

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  +PSWR+F   EL  ATD FSSEN++GKGGHAEVYKG L DGQ +AVKR+ K   K++
Sbjct  109   SKWRPSWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKED  168

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH     L+WK 
Sbjct  169   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKGALKWKA  227

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+KW HHV
Sbjct  228   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKWTHHV  287

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYM+PEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  288   VFPIEGTFGYMSPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  347

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NN+KEL DP L   YD  EM   + VA  CI H  + RP+MK VV  LKG+ E  +E+ 
Sbjct  348   SNNMKELVDPSLDVGYDPEEMAHILAVASMCIHHSSSSRPSMKSVVRFLKGDRE-SLEMM  406

Query  418   Q------SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             Q       K +  +S    D+T +SY   LDRH +L +E
Sbjct  407   QMQRPKLMKPLMFDSGDSEDYTRSSYLNDLDRHKKLALE  445



>dbj|BAD45880.1| putative receptor protein kinase PERK1 [Oryza sativa Japonica 
Group]
Length=555

 Score =   417 bits (1073),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 224/399 (56%), Positives = 275/399 (69%), Gaps = 16/399 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG--------DF  1319
              QW+++   +  +  KS      F         + +    R  ++ IDCG        + 
Sbjct  158   TQWRNLISGLILRRRKSMARAGTFPQRTKTTGLKRYLERMRSGKNQIDCGAIAPEILPEI  217

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  +PSWR+F   EL  ATD FSSEN++GKGGHAEVYKG L DGQ +AVKR+ K   K++
Sbjct  218   SKWRPSWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKED  277

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH     L+WK 
Sbjct  278   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKGALKWKA  336

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+KW HHV
Sbjct  337   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKWTHHV  396

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYM+PEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  397   VFPIEGTFGYMSPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  456

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NN+KEL DP L   YD  EM   + VA  CI H  + RP+MK VV  LKG+ E  +E+ 
Sbjct  457   SNNMKELVDPSLDVGYDPEEMAHILAVASMCIHHSSSSRPSMKSVVRFLKGDRE-SLEMM  515

Query  418   Q------SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             Q       K +  +S    D+T +SY   LDRH +L +E
Sbjct  516   QMQRPKLMKPLMFDSGDSEDYTRSSYLNDLDRHKKLALE  554



>gb|EEC81128.1| hypothetical protein OsI_24017 [Oryza sativa Indica Group]
Length=550

 Score =   417 bits (1072),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 224/399 (56%), Positives = 275/399 (69%), Gaps = 16/399 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG--------DF  1319
              QW+++   +  +  KS      F         + +    R  ++ IDCG        + 
Sbjct  153   TQWRNLISGLILRRRKSMARAGTFPQRTKTTGLKRYLERMRSGKNQIDCGAIAPEILPEI  212

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  +PSWR+F   EL  ATD FSSEN++GKGGHAEVYKG L DGQ +AVKR+ K   K++
Sbjct  213   SKWRPSWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKED  272

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH     L+WK 
Sbjct  273   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKGALKWKA  331

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+KW HHV
Sbjct  332   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKWTHHV  391

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYM+PEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  392   VFPIEGTFGYMSPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  451

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NN+KEL DP L   YD  EM   + VA  CI H  + RP+MK VV  LKG+ E  +E+ 
Sbjct  452   SNNMKELVDPSLDVGYDPEEMAHILAVASMCIHHSSSSRPSMKSVVRFLKGDRE-SLEMM  510

Query  418   Q------SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             Q       K +  +S    D+T +SY   LDRH +L +E
Sbjct  511   QMQRPKLMKPLMFDSGDSEDYTRSSYLNDLDRHKKLALE  549



>ref|NP_001058295.1| Os06g0663900 [Oryza sativa Japonica Group]
 dbj|BAD45878.1| putative receptor protein kinase PERK1 [Oryza sativa Japonica 
Group]
 dbj|BAF20209.1| Os06g0663900 [Oryza sativa Japonica Group]
 dbj|BAG99343.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66176.1| hypothetical protein OsJ_22271 [Oryza sativa Japonica Group]
Length=550

 Score =   417 bits (1072),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 224/399 (56%), Positives = 275/399 (69%), Gaps = 16/399 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG--------DF  1319
              QW+++   +  +  KS      F         + +    R  ++ IDCG        + 
Sbjct  153   TQWRNLISGLILRRRKSMARAGTFPQRTKTTGLKRYLERMRSGKNQIDCGAIAPEILPEI  212

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  +PSWR+F   EL  ATD FSSEN++GKGGHAEVYKG L DGQ +AVKR+ K   K++
Sbjct  213   SKWRPSWRSFDYSELCAATDKFSSENLIGKGGHAEVYKGHLADGQFVAVKRLTKGGNKED  272

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                + FLSELGIIAH+NHPNAA+L+GFS + GLHLVLQ+ PHGSLA +LH     L+WK 
Sbjct  273   RISD-FLSELGIIAHVNHPNAAQLLGFSVEGGLHLVLQFSPHGSLASVLHGTKGALKWKA  331

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             RF +A+G+AEGL YLH  C RRIIHRDI ASNILLTEDY  QISDFGLAKWLP+KW HHV
Sbjct  332   RFNIALGIAEGLLYLHEGCHRRIIHRDIKASNILLTEDYQPQISDFGLAKWLPDKWTHHV  391

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             V PIEGTFGYM+PEYFMHGI++EKTDVFA+GVLLLEL+TGR+AVDSSRQSLV+WAKPLL+
Sbjct  392   VFPIEGTFGYMSPEYFMHGIINEKTDVFAYGVLLLELVTGRKAVDSSRQSLVIWAKPLLD  451

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELR  419
              NN+KEL DP L   YD  EM   + VA  CI H  + RP+MK VV  LKG+ E  +E+ 
Sbjct  452   SNNMKELVDPSLDVGYDPEEMAHILAVASMCIHHSSSSRPSMKSVVRFLKGDRE-SLEMM  510

Query  418   Q------SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             Q       K +  +S    D+T +SY   LDRH +L +E
Sbjct  511   QMQRPKLMKPLMFDSGDSEDYTRSSYLNDLDRHKKLALE  549



>gb|EMT31498.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=611

 Score =   419 bits (1077),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/363 (60%), Positives = 262/363 (72%), Gaps = 12/363 (3%)
 Frame = -3

Query  1375  RMFFSWSRCSEDNIDCGDFSIT--------KPSWRNFTLQELSQATDNFSSENMLGKGGH  1220
             + +    R  ++ +DC   +          +PSWR+F   EL  ATD FSS+N++GKGGH
Sbjct  249   KRYLGRMRSGKNQMDCSAIAPEIFPEIEKWRPSWRSFDYDELCAATDRFSSDNLIGKGGH  308

Query  1219  AEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGL  1040
             AEVYKGRL DGQ +AVKR+ K   K++   + FLSELGIIAH+NHPNAA+L+GFS + GL
Sbjct  309   AEVYKGRLADGQFVAVKRLTKGGNKEDRISD-FLSELGIIAHVNHPNAAQLLGFSVEGGL  367

Query  1039  HLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNI  860
             HLVLQ+ PHGSLA LLH A   L+WK RF +A+G+AEGL YLH  C R IIHRDI ASNI
Sbjct  368   HLVLQFSPHGSLASLLHGAKGGLKWKARFNIALGIAEGLFYLHEGCHRHIIHRDIKASNI  427

Query  859   LLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVL  680
             LLTEDY  QISDFGLAKWLP+K  H VV PIEGTFGYMAPEYFMHGI++EKTDVFA+GVL
Sbjct  428   LLTEDYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVL  487

Query  679   LLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQ  500
             LLEL+TGR+AVDSSRQSLV+WAKPLLE NN+K L DP L   YD  EM  ++ VA  CI 
Sbjct  488   LLELVTGRKAVDSSRQSLVIWAKPLLESNNMKGLVDPSLDVGYDPEEMALTLAVASMCIH  547

Query  499   HLPNMRPNMKKVVEVLKGEN---ELKVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQL  329
             H  N+RP+MK VV  +KG+    EL  + + +K    +S    D+T TSY   LD+H QL
Sbjct  548   HSANLRPSMKSVVRFMKGDRESLELMGKPKPTKPPMFDSCDSEDYTRTSYLNDLDKHKQL  607

Query  328   IME  320
              +E
Sbjct  608   ALE  610



>ref|XP_009131704.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Brassica rapa]
Length=512

 Score =   414 bits (1064),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 204/396 (52%), Positives = 288/396 (73%), Gaps = 12/396 (3%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPI-VPLFGHDII--RKSRRMFFSWSRC-SEDNIDCGDFSI  1313
             T+ QW+  F ++ +K + + P   PL G   +  RKS+R+  +        ++D GD   
Sbjct  113   TSGQWRGRFVRLLKKGSSAMPFNTPLKGVPKLTRRKSKRIRDNMVPVLPATSLDTGDLFC  172

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
              KPSWRN++LQ++  AT+ +S EN++G+GG+AEVYKG++ DGQ++A+K++ +   ++   
Sbjct  173   FKPSWRNYSLQDIQTATNGYSRENLIGEGGYAEVYKGQMADGQIVAIKKLTRGSAEEMTM  232

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRF  953
                +LSELGII H++HPN AKLIG+  + G+HLVLQ  P+GSLA LL+ A E L W IR+
Sbjct  233   D--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLQLSPNGSLASLLYEAKEKLSWSIRY  290

Query  952   KVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVS  773
             KVA G AEGL+YLH  CQRRIIH+DI ASNILLTE++ AQISDFGLAKWLP++W HH VS
Sbjct  291   KVATGTAEGLYYLHEGCQRRIIHKDIKASNILLTENFEAQISDFGLAKWLPDQWTHHTVS  350

Query  772   PIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQN  593
              IEGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITG+QA+DS++ SLVMWAKPL+++N
Sbjct  351   KIEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGKQALDSAQHSLVMWAKPLIKEN  410

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL--KVELR  419
              IK+L DP +GD YD+ E+ER +F+A  CI      RP+M +VVE+ +G+     +++LR
Sbjct  411   KIKQLVDPVMGDDYDLEELERLVFIASLCIHQTSMNRPHMNQVVEIFRGDKGSLDQLKLR  470

Query  418   QS----KSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
             Q+    ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  471   QNSKLQRTYSEELLDNEEYNSTRYLNDINRHMETVL  506



>gb|EPS57687.1| hypothetical protein M569_17130, partial [Genlisea aurea]
Length=311

 Score =   403 bits (1036),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 249/314 (79%), Gaps = 8/314 (3%)
 Frame = -3

Query  1246  ENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKL  1067
             +N++GKGGHA+VY+GRL DGQ++AVK+I+K+ +        FLSELGIIAH++HPNA KL
Sbjct  1     DNLIGKGGHAQVYRGRLPDGQLVAVKKIVKKGEDRIGD---FLSELGIIAHVDHPNAGKL  57

Query  1066  IGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRII  887
             IGFS D+GL LVLQ+ PHGSLA  LH   E L WK+R+KVAVG+AEGL YLH  CQ+RII
Sbjct  58    IGFSTDSGLFLVLQFSPHGSLADALHGCEEILGWKLRYKVAVGIAEGLLYLHSDCQKRII  117

Query  886   HRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEK  707
             HRDITASN+LL+ D+ AQISDFGLAKWLP+ W H VVSPIEGTFGYMAPEYFMHG+V EK
Sbjct  118   HRDITASNVLLSHDHEAQISDFGLAKWLPDNWTHLVVSPIEGTFGYMAPEYFMHGVVHEK  177

Query  706   TDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERS  527
             TDVFAFGVLLLELITGR+AVDSSR+SLVMWAKP LE+N+  E+ DPRLG  YD  EMER 
Sbjct  178   TDVFAFGVLLLELITGRRAVDSSRRSLVMWAKPFLEKNDASEIMDPRLGGCYDASEMERV  237

Query  526   MFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVSSESLHI-----ADFTSTS  362
             +  A +CI+HLP++RP+M++VV +L+GENE+      S      +L +      D++STS
Sbjct  238   VSTASACIRHLPHVRPDMERVVRLLRGENEVHEAKHSSSGGGGRALMLDAYDPDDYSSTS  297

Query  361   YRKHLDRHLQLIME  320
             Y + L+RH++L M+
Sbjct  298   YLRDLNRHMELAMD  311



>ref|XP_008805931.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Phoenix dactylifera]
Length=471

 Score =   409 bits (1051),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 221/386 (57%), Positives = 272/386 (70%), Gaps = 34/386 (9%)
 Frame = -3

Query  1408  LFGHDIIRKSRRMF-------------FSWSRCSEDNIDCGDFSIT----KPSWRNFTLQ  1280
             L G  I+RK R M                 ++  +D ++ G+ +      +PSWR+F  Q
Sbjct  96    LIGGLILRKKRCMMRLSTFPPVTAGLGLQGTQSKKDRMESGELTAEIRRGRPSWRSFDYQ  155

Query  1279  ELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGII  1100
             EL+ ATDNF+           EVYKG L DGQ++AVKR+ K+D ++E   + FLSELGII
Sbjct  156   ELAAATDNFN----------PEVYKGCLADGQLVAVKRLTKKDNEEERVGD-FLSELGII  204

Query  1099  AHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLH  920
             AH+NHPNAA+L+GFS + GLHLVL++ PHGSLA +LH + E LEWK+RFK+A+G+AEGL 
Sbjct  205   AHVNHPNAAQLLGFSVERGLHLVLRFSPHGSLASVLHGSKEGLEWKVRFKIALGIAEGLL  264

Query  919   YLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAP  740
             YLH  CQRRIIHRD+ ASNILLTED+  QISDFGLAKWLP+ W HH+V PIEGTFGY+AP
Sbjct  265   YLHEGCQRRIIHRDMKASNILLTEDFEPQISDFGLAKWLPDNWTHHIVFPIEGTFGYLAP  324

Query  739   EYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLG  560
             EYFMHG+V+EK DVFAFGVLLLELITGR+AVDSSRQSLV+WAKPLL+ NN+KELADP LG
Sbjct  325   EYFMHGVVNEKIDVFAFGVLLLELITGRRAVDSSRQSLVIWAKPLLDTNNVKELADPSLG  384

Query  559   DAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE----LKVELRQ--SKSVSS  398
             DAYD  EM RS+ VA  CI HL   RPNM  VV +LKGE      L  ELR   ++    
Sbjct  385   DAYDPEEMRRSLLVASMCIHHLSTSRPNMNWVVRLLKGEQGYAELLGRELRPKIARPPLF  444

Query  397   ESLHIADFTSTSYRKHLDRHLQLIME  320
             ++    D+T + Y   L RH QL +E
Sbjct  445   DACDSEDYTCSRYLNDLHRHKQLALE  470



>ref|XP_006845817.1| hypothetical protein AMTR_s00019p00257180 [Amborella trichopoda]
 gb|ERN07492.1| hypothetical protein AMTR_s00019p00257180 [Amborella trichopoda]
Length=507

 Score =   407 bits (1046),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 218/391 (56%), Positives = 269/391 (69%), Gaps = 16/391 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             QW++ F   K+KS       P      I   +R      RC +   +  D    KPSW+N
Sbjct  125   QWRAFFSLWKQKSMNRLSSFPPMRVPKISSWKRGRL---RC-QSTSNAADLCFLKPSWKN  180

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             FTL EL  AT+NFSSEN++GKGG+AEVYKGRL  GQ++A+KR+ +  + D      FLSE
Sbjct  181   FTLSELRNATNNFSSENLIGKGGYAEVYKGRLNHGQLVAIKRLARGTQADRTGD--FLSE  238

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             LGIIAHINHPNAA L GF  + GLHLVLQ  PHGSLA LLH + +  +W +R+KVA+G A
Sbjct  239   LGIIAHINHPNAAHLFGFCVEGGLHLVLQLSPHGSLASLLHGSKQKPDWAVRYKVALGTA  298

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
             +GL YLH  C RRIIHRDI ASNILLTED+  QISDFGLAKWLP +W HH +S  EGTFG
Sbjct  299   KGLQYLHDGCPRRIIHRDIKASNILLTEDFEPQISDFGLAKWLPNQWTHHTISHFEGTFG  358

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             YMAPEYFMHGIVDEKTDVFAFGVLLLELITGR+AVDSS+QSLVMWAKPLLE +N +EL D
Sbjct  359   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRRAVDSSQQSLVMWAKPLLETSNFEELVD  418

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL-------KVELRQS  413
             P L   YD+ +M+ ++  A  C+Q++P  RP M +V+E+L GE  +       K  L+++
Sbjct  419   PCLMGVYDLEQMKCAVESASLCVQYMPIFRPCMSQVLELLVGEGNMASLEKHPKPSLQRT  478

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              S S+E   +A+    SY   L RH +L  E
Sbjct  479   FS-SAELFEVAE--GKSYMDDLTRHRKLAFE  506



>ref|XP_002310307.2| hypothetical protein POPTR_0007s14200g [Populus trichocarpa]
 gb|EEE90757.2| hypothetical protein POPTR_0007s14200g [Populus trichocarpa]
Length=383

 Score =   401 bits (1030),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 243/307 (79%), Gaps = 3/307 (1%)
 Frame = -3

Query  1486  DPTAVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKS-RRMFFSWSRCSEDNIDCGDFS  1316
             +   +QWK I D  K+KS + F ++PL      I RK+ RR        ++  ID     
Sbjct  76    ESNGIQWKQILDSFKKKSVRRFSVIPLISTYETIARKNLRRKLARIQHSADVFIDYEGIM  135

Query  1315  ITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdee  1136
               KPSWRNF   EL  ATDNFSSEN++G+GGHA+VYKG L DGQV+AVK+++K +K++E+
Sbjct  136   APKPSWRNFDYLELEAATDNFSSENLIGEGGHAKVYKGCLSDGQVVAVKKLMKTEKQEED  195

Query  1135  rieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIR  956
             R+ DFLSELGIIAHINHPNAA+L+GFS D+GLHLVL++LPHGSLA +LH  ++ LEWK R
Sbjct  196   RVGDFLSELGIIAHINHPNAARLLGFSIDSGLHLVLEFLPHGSLASVLHGGSDCLEWKKR  255

Query  955   FKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVV  776
             FKVA+G+AEGL YLH  C RRIIHRDI ASNILL  ++ AQISDFGLAKWLPE W HH+V
Sbjct  256   FKVALGIAEGLQYLHHDCPRRIIHRDIKASNILLNANFEAQISDFGLAKWLPENWIHHIV  315

Query  775   SPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQ  596
              PIEGTFGY+APEYFMHGIVDEKTDVFA+GVLLLE+ITGR+AVDSSRQSLVMWAKPLLE 
Sbjct  316   FPIEGTFGYLAPEYFMHGIVDEKTDVFAYGVLLLEIITGRRAVDSSRQSLVMWAKPLLEA  375

Query  595   NNIKELA  575
             NN KEL 
Sbjct  376   NNAKELT  382



>ref|XP_006400444.1| hypothetical protein EUTSA_v10013242mg [Eutrema salsugineum]
 gb|ESQ41897.1| hypothetical protein EUTSA_v10013242mg [Eutrema salsugineum]
Length=526

 Score =   404 bits (1039),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 207/406 (51%), Positives = 283/406 (70%), Gaps = 29/406 (7%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKR-KSAKSF-PIVPLFGHDII--RKSRRMFFSWSRCSEDN-------  1337
             P    WK  F  +K+  SA  F    PL G   +  RKS+R+         DN       
Sbjct  125   PNNGHWKGFFRLLKKGSSAMPFNTFTPLKGVPKLTRRKSKRI--------RDNMVPVLPS  176

Query  1336  --IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkri  1163
               +D GD    KPSWRNF+LQ++  AT+ FS EN++G+GG+AEVYKG++ DGQ++A+K++
Sbjct  177   AALDTGDLFYFKPSWRNFSLQDIQTATNGFSRENLIGEGGYAEVYKGQMLDGQIVAIKKL  236

Query  1162  ikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
              +   ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA LL+ A
Sbjct  237   TRGSAEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLASLLYEA  294

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
              E L W IR+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLTE++ AQISDFGLAKWL
Sbjct  295   KEKLNWSIRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTENFEAQISDFGLAKWL  354

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLV  623
             P++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITG+QA+DSS+ SLV
Sbjct  355   PDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGKQALDSSQHSLV  414

Query  622   MWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             MWAKPL++++ IK+L DP LGD YD+ E++R +F+A  CI      RP+M +VVE+L+G+
Sbjct  415   MWAKPLIKESKIKQLVDPILGDDYDLEELDRLVFIASLCIHQTSMNRPHMSQVVEILRGD  474

Query  442   NELKVELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                  +LR+       ++ S E +   ++ ST Y   + RH++ ++
Sbjct  475   KCSLDQLREQENSKLQRTYSEELMDNEEYNSTRYLNDIHRHMETVL  520



>gb|KFK26129.1| hypothetical protein AALP_AA8G207400 [Arabis alpina]
Length=511

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/407 (50%), Positives = 281/407 (69%), Gaps = 30/407 (7%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPI---VPLFGHDII--RKSRRMFFSWSRCSEDN------  1337
             PT   W+  F ++ +K + + P     PL G   +  RKS+R+         DN      
Sbjct  107   PTNHHWRRGFFRLLKKGSSAMPFNTFTPLKGVPKLTRRKSKRI--------RDNMVPVLP  158

Query  1336  ---IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkr  1166
                +D  D    KPSWRNF+LQ++  AT+ +S EN++G+GG+AEVYKG++ DGQ++A+K+
Sbjct  159   AAALDTDDLFYFKPSWRNFSLQDIQTATNGYSRENLIGEGGYAEVYKGQMADGQIVAIKK  218

Query  1165  iikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHN  986
             + +   ++      +LSELGII H++HPN A+LIG+  + G+HLVL+  P+GSLA LL+ 
Sbjct  219   LTRGSAEEMTMD--YLSELGIIVHVDHPNIARLIGYCVEGGMHLVLELSPNGSLASLLYE  276

Query  985   ATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKW  806
             A E L W IR+KVA+G AEGL YLH  CQRRIIH+DI ASNILLTE++ AQISDFGLAKW
Sbjct  277   AKEKLNWSIRYKVAMGTAEGLFYLHEGCQRRIIHKDIKASNILLTENFEAQISDFGLAKW  336

Query  805   LPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSL  626
             LP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DS++ SL
Sbjct  337   LPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSAQHSL  396

Query  625   VMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
             VMWAKPL+++  IK+L DP LGD YDV E++R +F+A  CI      RP+M +VVE+L+G
Sbjct  397   VMWAKPLIKEKKIKQLVDPILGDDYDVEELDRLVFIASLCIHQTSMNRPHMNQVVEILRG  456

Query  445   ENELKVELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
             +     +LR        ++ S E L   ++ ST Y   + RH++ ++
Sbjct  457   DKCSLDQLRDRGSSKLQRTYSEELLDNEEYNSTRYLNDIHRHMETVL  503



>ref|XP_009352175.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Pyrus x bretschneideri]
Length=513

 Score =   401 bits (1030),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 209/405 (52%), Positives = 270/405 (67%), Gaps = 22/405 (5%)
 Frame = -3

Query  1486  DPTA-VQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC------  1328
             DP A  QW+  F  +K+     FP  P  G    + +RR      R  ED I        
Sbjct  106   DPRANYQWRGFFRILKKGPQYPFPTFPPKGAQKPKLTRR---KSKRVREDFIPQINSPTL  162

Query  1327  ----GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkrii  1160
                  DF   K SW+N++L EL  AT+NFS EN++G+GG+AEVYKG L DGQ++A+KR+ 
Sbjct  163   KSFDADFCRFKSSWKNYSLLELEAATNNFSHENLIGEGGYAEVYKGTLEDGQIVAIKRLT  222

Query  1159  kedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT  980
             +  +++      FLSELG+I H++HPN AKLIG+  + G+HLVL   PHGSL+ +L+   
Sbjct  223   RGSQEEMTAD--FLSELGVIVHVDHPNIAKLIGYGVEGGMHLVLHLSPHGSLSSILYGPR  280

Query  979   ETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLP  800
             E+L+W IR+KVA G A+GL YLH  CQRRIIH+DI ASNILL ED+  QISDFGLAKWLP
Sbjct  281   ESLDWDIRYKVAFGTAKGLLYLHEGCQRRIIHKDIKASNILLAEDFEPQISDFGLAKWLP  340

Query  799   EKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVM  620
             + W HHVVS  EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS +SLVM
Sbjct  341   DSWTHHVVSKFEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSHKSLVM  400

Query  619   WAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN  440
             WAKPLL  NNIKE+ DP LGDAYD+ EM+R    A  C+      RP M ++V++L+G+ 
Sbjct  401   WAKPLLSMNNIKEIVDPCLGDAYDLKEMKRLALTASFCVHQSSMNRPQMSQIVQILEGDE  460

Query  439   ---ELKVELRQSK---SVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                E   +  +SK   + S E L   ++ ST Y    D+ L+ I+
Sbjct  461   TSLEYATKYHKSKLQRTYSEELLDADEYNSTKYLSDRDKQLEFIL  505



>ref|XP_009126290.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Brassica rapa]
Length=513

 Score =   400 bits (1029),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 283/402 (70%), Gaps = 21/402 (5%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDN---------ID  1331
             PT   W+  F ++ +K + + P    F H  ++   ++    S+  +DN         +D
Sbjct  112   PTNGHWRG-FHRLLKKGSSAMPF-NTFSH--LKGVPKLTRRKSKRIKDNMVPVLPAAALD  167

Query  1330  CGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
               D  + KPSW+N++LQ++  AT+ +S EN++G+GG+AEVYKG + DGQ++AVK++ +  
Sbjct  168   TDDLFLFKPSWKNYSLQDIQTATNGYSPENLIGEGGYAEVYKGEMADGQIVAVKKLTRGS  227

Query  1150  kkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETL  971
              ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA LL+ A + L
Sbjct  228   AEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLASLLYEAKDKL  285

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
              W IR+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLTE++ AQISDFGLAKWLP++W
Sbjct  286   SWSIRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTENFEAQISDFGLAKWLPDQW  345

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              HH VS +EGTFGY+ PE+FMHGIVDEKTDV+AFGVLLLELITG+QA+DSS+ S+VMWAK
Sbjct  346   THHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELITGKQAIDSSQHSVVMWAK  405

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELK  431
             P++++N IKEL DP LGD YD+ E++R + +A  CI      RP+M +VVE+LKG+    
Sbjct  406   PMIKENKIKELVDPILGDDYDLEELDRLVSIASLCIHQTSMNRPHMSQVVEILKGDKCSL  465

Query  430   VELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
              +L++       ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  466   DKLKEGENSKLQRTYSEELLDNEEYNSTKYLNDINRHMETVL  507



>ref|NP_197392.2| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAC42588.1| putative protein kinase [Arabidopsis thaliana]
 gb|AAO64835.1| At5g18910 [Arabidopsis thaliana]
 gb|AED92627.1| protein kinase family protein [Arabidopsis thaliana]
Length=511

 Score =   400 bits (1029),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/411 (49%), Positives = 285/411 (69%), Gaps = 30/411 (7%)
 Frame = -3

Query  1501  SGGGFDPTAVQWKSIFDQIKRKSAKSFPI---VPLFGHDII--RKSRRMFFSWSRCSEDN  1337
             S GG  P    W+  F ++ +K + + P     PL G   +  RKS+R+         DN
Sbjct  108   SSGG--PNNGHWRRGFFRLLKKGSSAMPFNTFTPLKGVPKLTRRKSKRI--------RDN  157

Query  1336  -------IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVI  1178
                    +D       KPSWRNF+L+++  AT+++S EN++G+GG+AEVYKG++ DGQ++
Sbjct  158   MVPVIPALDTDHLFYFKPSWRNFSLRDIQTATNDYSRENLIGEGGYAEVYKGQMADGQIV  217

Query  1177  AVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAF  998
             A+K++ +   ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA 
Sbjct  218   AIKKLTRGSAEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLAS  275

Query  997   LLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFG  818
             LL+ A E L W +R+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLT+++ AQISDFG
Sbjct  276   LLYEAKEKLNWSMRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTQNFEAQISDFG  335

Query  817   LAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSS  638
             LAKWLP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS
Sbjct  336   LAKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSS  395

Query  637   RQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVE  458
             + S+VMWAKPL+++N IK+L DP L D YDV E++R +F+A  CI      RP M +VVE
Sbjct  396   QHSIVMWAKPLIKENKIKQLVDPILEDDYDVEELDRLVFIASLCIHQTSMNRPQMSQVVE  455

Query  457   VLKGENELKVELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
             +L+G+     +LR+       ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  456   ILRGDKCSLDKLRERENSKLQRTYSEELLDNEEYNSTRYLNDINRHMETVL  506



>ref|XP_010454141.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Camelina sativa]
Length=520

 Score =   400 bits (1029),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 202/404 (50%), Positives = 282/404 (70%), Gaps = 29/404 (7%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPI---VPLFGHDII--RKSRRMFFSWSRCSEDN-------  1337
             T   W+  F ++ +K + + P     PL G   +  RKS+R+         DN       
Sbjct  122   TNGHWRGFF-RLFKKGSSAMPFNTFTPLKGVPKLTRRKSKRI--------RDNMVPVIPS  172

Query  1336  IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
             +D  D    KPSWRNF+LQ++  AT+ +S EN++G+GG+AEVYKG++ DGQ++A+K++ +
Sbjct  173   LDTEDLFYFKPSWRNFSLQDIQTATNCYSRENLIGEGGYAEVYKGQMADGQIVAIKKLTR  232

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
                ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA LL+   E
Sbjct  233   GSAEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLASLLYEEKE  290

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              L W +R+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLT+++ AQISDFGLAKWLP+
Sbjct  291   KLNWSMRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTQNFEAQISDFGLAKWLPD  350

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITG+QA+DSS+ SLVMW
Sbjct  351   QWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGKQALDSSQHSLVMW  410

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPL+++  IK+L DP LGD YDV E+ER +F+A  CIQ     RP M +VV++L+G+  
Sbjct  411   AKPLIKEKKIKQLVDPILGDDYDVEELERLVFIASLCIQQTSMNRPQMNQVVQILRGDKC  470

Query  436   LKVELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                +LR+       ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  471   SLDQLRERENSKLQRTYSEELLDNEEYNSTRYLNDINRHMETVL  514



>ref|XP_006289793.1| hypothetical protein CARUB_v10003395mg [Capsella rubella]
 gb|EOA22691.1| hypothetical protein CARUB_v10003395mg [Capsella rubella]
Length=520

 Score =   400 bits (1027),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 206/410 (50%), Positives = 283/410 (69%), Gaps = 29/410 (7%)
 Frame = -3

Query  1501  SGGGFDPTAVQWKSIFDQIKR-KSAKSF-PIVPLFGHDII--RKSRRMFFSWSRCSEDN-  1337
             S GG  P    WK  F  +K+  SA  F    PL G   +  RKS+R+         DN 
Sbjct  117   SSGG--PNNGHWKGFFRLLKKGSSAMPFNTFTPLKGVPKLTRRKSKRI--------RDNM  166

Query  1336  ------IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIA  1175
                   +D  D    KPSWRNF+LQ++  AT+++S EN++G+GG+AEVYKG++ DGQ++A
Sbjct  167   VPVIPALDTDDLFYFKPSWRNFSLQDIQTATNSYSRENLIGEGGYAEVYKGQMPDGQIVA  226

Query  1174  VkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFL  995
             +K++ +   ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA L
Sbjct  227   IKKLTRGSAEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLASL  284

Query  994   LHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGL  815
             L+ A E L W +R+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLT+++ AQISDFGL
Sbjct  285   LYEAKERLNWSVRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTQNFEAQISDFGL  344

Query  814   AKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSR  635
             AKWLP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS+
Sbjct  345   AKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQ  404

Query  634   QSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEV  455
              SLVMWAKPL+++   K+L DP LGD YDV E++R +F+A  CI      RP M ++V++
Sbjct  405   HSLVMWAKPLIKEKKNKQLVDPILGDDYDVEELDRLVFIASLCIHQTAMNRPQMSQIVQI  464

Query  454   LKGENELKVELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
             L+G+     +LR+       ++ S E L   ++ ST Y   + RH++ ++
Sbjct  465   LRGDKCSLDQLRERENAKLQRTYSEELLDNEEYNSTRYLNDIHRHMETVL  514



>ref|XP_008390775.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Malus domestica]
Length=524

 Score =   400 bits (1028),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 209/401 (52%), Positives = 272/401 (68%), Gaps = 16/401 (4%)
 Frame = -3

Query  1486  DPTA-VQWKSIFDQIKRKSAKSFPIVPLFGHD----IIRKSRRMFF--SWSRCSEDNIDC  1328
             DP A  QW+  F  +K+     FP  P  G        RKS+++ F    +  +  + D 
Sbjct  119   DPRANYQWRGFFRILKKGPQYPFPTFPPKGAQKPKLTRRKSKKIDFIPQINSPTLRSFDA  178

Query  1327  GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
              DF   K SW+N++L EL  AT+NFS EN++G+GG+AEVYKG L DGQ++A+KR+ +  +
Sbjct  179   -DFCRFKSSWKNYSLLELEAATNNFSHENLIGEGGYAEVYKGTLEDGQIVAIKRLTRGSQ  237

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             ++      FLSELG+I H++HPN AKLIG+  + G+HLVL   PHGSL+ +L+   E L+
Sbjct  238   EEMTAD--FLSELGVIVHVDHPNIAKLIGYGVEGGMHLVLHLSPHGSLSSILYGPRENLD  295

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W IR+KVA G A+GL YLH  CQRRIIH+DI ASNILL ED+  QISDFGLAKWLP+ W 
Sbjct  296   WDIRYKVAFGTAKGLLYLHEGCQRRIIHKDIKASNILLAEDFEPQISDFGLAKWLPDSWT  355

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HHVVS  EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS +SLVMWAKP
Sbjct  356   HHVVSKFEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSHKSLVMWAKP  415

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN---E  437
             LL  NNIKE+ DP LGDAYD+ EM+R    A  CI      RP M ++V++L+G+    E
Sbjct  416   LLSMNNIKEIVDPCLGDAYDLKEMKRLALTASFCIHQSSMNRPQMSQIVQILEGDETSLE  475

Query  436   LKVELRQSK---SVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                +  +SK   + S E L   ++ ST Y    D+ L+ I+
Sbjct  476   YATKYHKSKLQRTYSEELLDADEYNSTKYLSDRDKQLEFIL  516



>ref|XP_010546905.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Tarenaya hassleriana]
Length=507

 Score =   399 bits (1024),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 201/406 (50%), Positives = 274/406 (67%), Gaps = 13/406 (3%)
 Frame = -3

Query  1507  GGSGGGFDPTAVQWKSIFDQIKRKSA----KSFPIVPLFGHDIIRKSRRMFFSWSRC-SE  1343
             G S   F P    W+     +K+ S+     +FP +        RKS+R+          
Sbjct  95    GQSQSPFGPNNGHWRGFVRLLKKGSSAMPFNTFPPLKSIPKLTRRKSKRIRDDMVPVLPA  154

Query  1342  DNIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkri  1163
               +D  D    KP+WRNF+L ++  AT++FS EN++G+GG+AEVYKG++ DGQ++A+KR+
Sbjct  155   SALDTDDLFYFKPTWRNFSLADIQAATNSFSRENLIGEGGYAEVYKGQMPDGQIVAIKRL  214

Query  1162  ikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
              +   ++      +LSELGII H++HPN AKLIG+S + G+HLVL+  P+GSLA LL+  
Sbjct  215   TRGSAEEMTMD--YLSELGIIVHVDHPNIAKLIGYSVEGGMHLVLELSPNGSLASLLYGP  272

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
              E L W IR++VA G AEGL+YLH  CQRRIIH+DI ASNILLTE++  QISDFGLAKWL
Sbjct  273   KEKLNWGIRYRVAFGTAEGLYYLHEGCQRRIIHKDIKASNILLTENFEPQISDFGLAKWL  332

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLV  623
             P++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITG+QA+DSS+ SLV
Sbjct  333   PDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGKQALDSSQHSLV  392

Query  622   MWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             MWAKPL+ +N IK+L DP LGD YDV E+ R +F A  CI      RP M +VV++L+G+
Sbjct  393   MWAKPLITENKIKQLVDPMLGDDYDVEELSRLVFTASLCIHQSSMNRPQMSQVVQILRGD  452

Query  442   NELKVELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                   L++       ++ S E L   ++ ST Y   L RH++ ++
Sbjct  453   KSSLDGLKERQNSKLQRTYSEELLDAEEYNSTRYLNDLRRHMETVL  498



>ref|XP_002873918.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50177.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score =   398 bits (1023),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 201/405 (50%), Positives = 281/405 (69%), Gaps = 28/405 (7%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPI---VPLFGHDII--RKSRRMFFSWSRCSEDN------  1337
             P    W+  F ++ +K + + P     PL G   +  RKS+R+         DN      
Sbjct  115   PNNGHWRRGFFRLLKKGSSAMPFNTFTPLKGVPKLTRRKSKRI--------RDNMVPVIP  166

Query  1336  -IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkrii  1160
              +D  D    KPSWRNF+LQ++  AT+++S EN++G+GG+AEVYKG++ DGQ++A+K++ 
Sbjct  167   ALDTDDLFYFKPSWRNFSLQDIQTATNDYSRENLIGEGGYAEVYKGQMPDGQIVAIKKLT  226

Query  1159  kedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT  980
             +   ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA LL+ A 
Sbjct  227   RGSAEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLASLLYEAK  284

Query  979   ETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLP  800
               L W +R+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLT+++ AQISDFGLAKWLP
Sbjct  285   GKLNWSMRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTQNFEAQISDFGLAKWLP  344

Query  799   EKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVM  620
             ++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS+ S+VM
Sbjct  345   DQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQHSIVM  404

Query  619   WAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN  440
             WAKPL+++N IK+L DP L D YDV E++R +F+A  CI      RP M +VVE+L+G+ 
Sbjct  405   WAKPLIKENKIKQLVDPILEDDYDVEELDRLVFIASLCIHQTSMNRPQMSQVVEILRGDK  464

Query  439   ELKVELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                 +LR+       ++ S E L   ++ ST Y   + RH++ ++
Sbjct  465   CSLDKLRERENSKLQRTYSEELLDNEEYNSTRYLNDIHRHMETVL  509



>ref|XP_007035412.1| Kinase superfamily protein, putative isoform 1 [Theobroma cacao]
 gb|EOY06338.1| Kinase superfamily protein, putative isoform 1 [Theobroma cacao]
Length=512

 Score =   397 bits (1020),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 208/393 (53%), Positives = 275/393 (70%), Gaps = 11/393 (3%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIR-KSRRMFFSWSRCSEDNIDCGDFSITKP  1304
             T+V W+  F  +K+     F  +P     + R KS+R+           +D  +    K 
Sbjct  116   TSVHWRGFFRLLKKGPGIPFQTLPPLKPRLTRRKSKRVRDDMVPQLSSTLD-AELCCFKS  174

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             +W+NF+L EL +AT+NFS E ++G+GG+AEVYKG+L  G+++A+KR+ +   ++      
Sbjct  175   TWKNFSLSELHEATNNFSHEYLIGEGGYAEVYKGQLKSGKLVAIKRLTRGSSEEMTMD--  232

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGII H++HPN AKLIG+  + G+HLVLQ  PHGSLA LL+   E L W IRFK+A
Sbjct  233   FLSELGIIVHVDHPNIAKLIGYGVEGGMHLVLQLSPHGSLASLLYGPKEKLSWGIRFKIA  292

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             VG AEGL YLH  CQRRIIH+DI ASNILLTED+ AQISDFGLAKWLP++W HH VS +E
Sbjct  293   VGTAEGLSYLHEGCQRRIIHKDIKASNILLTEDFDAQISDFGLAKWLPDQWTHHTVSRVE  352

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+ PE+FMHGIVDEKTDV+AFGVLLLELITGRQAVDSS+QSLVMWAKPL+++N I+
Sbjct  353   GTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELITGRQAVDSSQQSLVMWAKPLIKENKIE  412

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE-NELKVELRQSKS  407
             EL DP LGDAY+V ++ R    A  CI      RP M +VV++LKG+   L++   + KS
Sbjct  413   ELVDPTLGDAYNVDQLNRVTATASMCIHQSAVNRPQMSQVVDILKGDLTCLEMLKHREKS  472

Query  406   V----SSESLHIA-DFTSTSYRKHLDRHLQLIM  323
             +     SE +H A ++ ST Y   L R +++++
Sbjct  473   ILQRTYSEEIHDAEEYNSTKYLNDL-RQMEILL  504



>ref|XP_010492930.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Camelina sativa]
Length=521

 Score =   397 bits (1020),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/345 (54%), Positives = 259/345 (75%), Gaps = 8/345 (2%)
 Frame = -3

Query  1339  NIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkrii  1160
             ++D  D    KPSWRNF+LQ++  AT+ +S EN++G+GG+AEVYKG++ DGQ++A+K++ 
Sbjct  173   SLDTEDLFYFKPSWRNFSLQDIQTATNCYSRENLIGEGGYAEVYKGQMADGQIVAIKKLT  232

Query  1159  kedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT  980
             +   ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA LL+   
Sbjct  233   RGSAEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLASLLYEDK  290

Query  979   ETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLP  800
             E L W +R+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLT+++ AQISDFGLAKWLP
Sbjct  291   EKLNWSMRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTQNFEAQISDFGLAKWLP  350

Query  799   EKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVM  620
             ++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITG+QA+DSS+ SLVM
Sbjct  351   DQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGKQALDSSQHSLVM  410

Query  619   WAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN  440
             WAKPL+++  IK+L DP LGD YDV E+ER +F+A  CI      RP M +VV++L+G+ 
Sbjct  411   WAKPLIKEKKIKQLVDPTLGDDYDVEELERLVFIASLCIHQTSINRPQMNQVVQILRGDK  470

Query  439   ELKVELRQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                 +LR+       ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  471   CSLDQLRERETSKLQRTYSEELLDNEEYNSTRYLNDINRHMETVL  515



>gb|KCW60917.1| hypothetical protein EUGRSUZ_H03652 [Eucalyptus grandis]
Length=510

 Score =   396 bits (1017),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 205/398 (52%), Positives = 272/398 (68%), Gaps = 23/398 (6%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSED---------NIDCGDF  1319
             +W+     +K+ S   F   PL    + + +RR     +R  ED         + + GD 
Sbjct  110   KWRGFLRTLKKGSPVRFHTFPL--KSVPKLTRR---KSTRIREDMVPAFHASLDTELGDL  164

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  KPSWRNFTL EL  ATDNFS +N++G+GG AEVYKG L  G+++A+KR+ +   ++ 
Sbjct  165   SYFKPSWRNFTLIELQDATDNFSRDNLIGEGGCAEVYKGMLPGGEIVAIKRLTRGSPEEM  224

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                  FLSELGII H++HPN AKLIG+  + G+HL+L   PHGSLA LL+ + E L+W I
Sbjct  225   TAD--FLSELGIIVHVDHPNIAKLIGYGVEGGMHLILHLSPHGSLASLLYGSGEKLDWGI  282

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             R+KVA+G AEGL YLH  CQRRIIH+D+ A+NILL+ED+  QISDFGLAKWLPE+W HH+
Sbjct  283   RYKVALGTAEGLMYLHEECQRRIIHKDVKAANILLSEDFEPQISDFGLAKWLPEQWSHHI  342

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             VS IEGTFGY+ PEYFMHGIVDEKTDV+A+GVLLLELITG++A+DSS++SLVMWAKPLL 
Sbjct  343   VSQIEGTFGYLPPEYFMHGIVDEKTDVYAYGVLLLELITGQKALDSSQKSLVMWAKPLLS  402

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-ELKVEL  422
              N IKE  DP LG AY+  +M+R +  A  C  H    RP M +VV +L+GE   L++  
Sbjct  403   DNRIKEFVDPSLGGAYNSEQMDRLILAASLCTHHSSIHRPQMSQVVCLLRGEQGSLELAR  462

Query  421   RQSKS-----VSSESLHIA-DFTSTSYRKHLDRHLQLI  326
              Q +        SE L+ A ++ +T Y   LDR+++++
Sbjct  463   EQDRGPLLQRTYSEELYAAEEYNATKYLNDLDRYMEIV  500



>ref|XP_006489205.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Citrus sinensis]
Length=469

 Score =   394 bits (1012),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/393 (50%), Positives = 267/393 (68%), Gaps = 20/393 (5%)
 Frame = -3

Query  1465  KSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRNFT  1286
             KS    I +   K+ P +       IR SR + F+ +          +    KP W+NF 
Sbjct  75    KSAPKNIPKSVTKNAPKLTRRKTKRIRGSRGLSFNATLVD------AELCYLKPGWKNFA  128

Query  1285  LQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELG  1106
             L EL  ATDNFS EN++G+GG+AEVYKG+L DGQ +A+KR+ +   ++      +LSELG
Sbjct  129   LSELQAATDNFSHENLIGQGGYAEVYKGQLEDGQFVAIKRLTRGSPEEMTTD--YLSELG  186

Query  1105  IIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEG  926
             II H++HPN AK+IG+  + G+HL+L+  PHGSLA LL+ + E L W IR+K+A G AEG
Sbjct  187   IIVHVDHPNIAKMIGYGVEGGMHLILELSPHGSLASLLYGSKEKLNWDIRYKIAFGTAEG  246

Query  925   LHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYM  746
             + YLH  CQRRIIH+DI A+NILLTED+  QISDFGLAKWLP+KW HH+VS IEGTFGY+
Sbjct  247   ICYLHEGCQRRIIHKDIKAANILLTEDFQPQISDFGLAKWLPDKWTHHIVSKIEGTFGYL  306

Query  745   APEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPR  566
              PE+FMHGI DEKTDV+A+GVLLLE+ITGRQA+DSS++SLVMWAKPLL+++++KEL DP 
Sbjct  307   PPEFFMHGIADEKTDVYAYGVLLLEIITGRQALDSSQKSLVMWAKPLLKKSSMKELVDPT  366

Query  565   LGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL--------RQSK  410
             LGDAY+  ++ R + +A +CI      RP M KVV+ LKG+ E   +         R  +
Sbjct  367   LGDAYNTEQLTRLLLIASACINQTSACRPQMSKVVQALKGDEEALAQFIEENQSLRRLQR  426

Query  409   SVSSESLHIADFTSTSYRK----HLDRHLQLIM  323
             + S E     +F S S  +     ++RH+++++
Sbjct  427   TFSEEFFDAEEFNSASLNELDVNDINRHMEIVL  459



>ref|XP_010105676.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
 gb|EXC05707.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
Length=479

 Score =   394 bits (1011),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/404 (51%), Positives = 271/404 (67%), Gaps = 23/404 (6%)
 Frame = -3

Query  1501  SGGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC--  1328
             + G  D  A  W+  F  +K+     F   P       RKS+R+        ED +    
Sbjct  81    TSGSDDRAATHWRGFFRLLKKGPQIKFQTFPKLTR---RKSKRI-------REDMVPPLT  130

Query  1327  ---GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
                 +    KPSW+NFTL EL  AT+NFS EN++G+GG+AEVYKG L + Q+IAVKR+ +
Sbjct  131   SLDAELYCFKPSWKNFTLSELQIATNNFSQENLIGEGGYAEVYKGELQNRQLIAVKRLTR  190

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
               +++      FLSELGII H++HPN AKLIG+  + G+HLVL   P+GSL+ +L+   E
Sbjct  191   GAQEEMTAD--FLSELGIIVHVDHPNLAKLIGYGVEGGMHLVLDLSPNGSLSSILYGPRE  248

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              L+W IR+KV +G AEGL YLH  CQRRIIH+DI ASNILL+ED+  QISDFGLAKWLP+
Sbjct  249   KLDWGIRYKVVLGTAEGLLYLHEGCQRRIIHKDIKASNILLSEDFEPQISDFGLAKWLPD  308

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W HH+VS  EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS++SLVMW
Sbjct  309   QWTHHIVSKFEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQKSLVMW  368

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-  440
             AKPLL + + KEL DP L +AYDV +M R +  A  CI      RP M +VV++LKG+  
Sbjct  369   AKPLLSKTSFKELVDPCLSNAYDVEQMSRVVLTASMCIHQSSVSRPQMSQVVQILKGDGG  428

Query  439   --ELKVELRQSK---SVSSESLHIADFTSTSYRKHLDRHLQLIM  323
               EL  + ++SK   + S E     ++ ST Y   LDRH++ ++
Sbjct  429   SLELVKQRQKSKLRRTYSEELFDAEEYNSTKYLNDLDRHMETVL  472



>ref|XP_007226342.1| hypothetical protein PRUPE_ppa022172mg, partial [Prunus persica]
 gb|EMJ27541.1| hypothetical protein PRUPE_ppa022172mg, partial [Prunus persica]
Length=460

 Score =   391 bits (1004),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 207/406 (51%), Positives = 268/406 (66%), Gaps = 23/406 (6%)
 Frame = -3

Query  1486  DPTAVQ-WKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC------  1328
             DP   Q W+  F  +K+     FP  P       + +RR      R  ED I        
Sbjct  54    DPRVNQNWRGFFRILKKGPQHPFPTFPPKSAPKPKLTRR---KSKRIREDFIPQLNSPAL  110

Query  1327  -----GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkri  1163
                   DF   K SW+N++L +L  AT+NFS EN++G+GG+AEVYKG L DGQ++A+KR+
Sbjct  111   RSSFDADFCRFKSSWKNYSLLDLQVATNNFSQENLIGEGGYAEVYKGTLEDGQIVAIKRL  170

Query  1162  ikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
              +  +++      FLSELG+I H++HPN AKLIG+  + G+HLVL   PHGSLA +L+  
Sbjct  171   TRGSQEEMTAD--FLSELGVIVHVDHPNIAKLIGYGVEGGMHLVLHLSPHGSLASILYGP  228

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
              E L+W IR+KVA+G A+GL YLH  CQRRIIH+DI ASNILL ED+  QISDFGLAKWL
Sbjct  229   RENLDWGIRYKVALGTAKGLLYLHEGCQRRIIHKDIKASNILLAEDFEPQISDFGLAKWL  288

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLV  623
             P+ W HH+VS  EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS +SLV
Sbjct  289   PDHWTHHIVSKFEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSHKSLV  348

Query  622   MWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             MWAKPLL  NNIKELADP LGDAYD+ +M+R    A  C+      RP M ++ ++L+G+
Sbjct  349   MWAKPLLSTNNIKELADPCLGDAYDLQQMKRLALTASICVHQSSMNRPQMNQIFQILEGD  408

Query  442   NEL--KVELRQSKSVS---SESLHIAD-FTSTSYRKHLDRHLQLIM  323
               +   V  RQ   +    SE L  AD + ST Y    D+ L+ ++
Sbjct  409   ESILEYVTKRQKSKLQRTYSEELFDADEYNSTKYLSDRDKQLEFVL  454



>ref|XP_006594454.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like isoform X3 [Glycine max]
Length=506

 Score =   392 bits (1007),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/412 (50%), Positives = 273/412 (66%), Gaps = 25/412 (6%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSF-PIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC  1328
             GS  G   T  QW+  F  +K+ S   F P  PL   ++ + +RR      R  ED I  
Sbjct  89    GSFAGAPNTNNQWRGFFKLLKKGSQMPFQPFHPL--KNVPKLTRR---KSKRIREDLIPS  143

Query  1327  -----------GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQV  1181
                         +F   K SW+NFTL E+  AT++FS EN++G+GG+AEVY G+L DG  
Sbjct  144   LNSPALHASFDAEFGCFKSSWKNFTLAEIQAATNDFSHENLIGEGGYAEVYLGKLEDGNF  203

Query  1180  IAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLA  1001
             +A+KR+ +  +++      FLSELGII H++HPN A+LIG+  + G+ LVLQ  PHGSL+
Sbjct  204   VAIKRLTRGCQEEMTAD--FLSELGIIVHVDHPNIARLIGYGVEGGMFLVLQLSPHGSLS  261

Query  1000  FLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDF  821
              +L+   E L W +R+K+A+G AEGL YLH  CQRRIIH+DI ASNILL+ED+  QISDF
Sbjct  262   SILYGPREKLNWNLRYKIALGTAEGLRYLHEECQRRIIHKDIKASNILLSEDFEPQISDF  321

Query  820   GLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS  641
             GLAKWLP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DS
Sbjct  322   GLAKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDS  381

Query  640   SRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVV  461
             S++SLVMWAKPLL  NNIKEL DP L DAYD  +M+     A  C+      RP+M +V 
Sbjct  382   SQKSLVMWAKPLLTANNIKELVDPVLADAYDEEQMKLVTLTASLCVDQSSIQRPDMSQVF  441

Query  460   EVLKGENE-LKVELRQSKS-----VSSESLHIADFTSTSYRKHLDRHLQLIM  323
             ++L+GE E L++   +SKS      S E     ++ ST +    DRH++ I+
Sbjct  442   DILRGEEESLRIMEERSKSKLQRTYSEELFDAEEYNSTKFLSERDRHMETIL  493



>ref|XP_006594453.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like isoform X2 [Glycine max]
Length=508

 Score =   392 bits (1006),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/412 (50%), Positives = 273/412 (66%), Gaps = 25/412 (6%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSF-PIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC  1328
             GS  G   T  QW+  F  +K+ S   F P  PL   ++ + +RR      R  ED I  
Sbjct  91    GSFAGAPNTNNQWRGFFKLLKKGSQMPFQPFHPL--KNVPKLTRR---KSKRIREDLIPS  145

Query  1327  -----------GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQV  1181
                         +F   K SW+NFTL E+  AT++FS EN++G+GG+AEVY G+L DG  
Sbjct  146   LNSPALHASFDAEFGCFKSSWKNFTLAEIQAATNDFSHENLIGEGGYAEVYLGKLEDGNF  205

Query  1180  IAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLA  1001
             +A+KR+ +  +++      FLSELGII H++HPN A+LIG+  + G+ LVLQ  PHGSL+
Sbjct  206   VAIKRLTRGCQEEMTAD--FLSELGIIVHVDHPNIARLIGYGVEGGMFLVLQLSPHGSLS  263

Query  1000  FLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDF  821
              +L+   E L W +R+K+A+G AEGL YLH  CQRRIIH+DI ASNILL+ED+  QISDF
Sbjct  264   SILYGPREKLNWNLRYKIALGTAEGLRYLHEECQRRIIHKDIKASNILLSEDFEPQISDF  323

Query  820   GLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS  641
             GLAKWLP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DS
Sbjct  324   GLAKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDS  383

Query  640   SRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVV  461
             S++SLVMWAKPLL  NNIKEL DP L DAYD  +M+     A  C+      RP+M +V 
Sbjct  384   SQKSLVMWAKPLLTANNIKELVDPVLADAYDEEQMKLVTLTASLCVDQSSIQRPDMSQVF  443

Query  460   EVLKGENE-LKVELRQSKS-----VSSESLHIADFTSTSYRKHLDRHLQLIM  323
             ++L+GE E L++   +SKS      S E     ++ ST +    DRH++ I+
Sbjct  444   DILRGEEESLRIMEERSKSKLQRTYSEELFDAEEYNSTKFLSERDRHMETIL  495



>ref|XP_010024471.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X4 [Eucalyptus grandis]
Length=504

 Score =   390 bits (1003),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 206/400 (52%), Positives = 272/400 (68%), Gaps = 25/400 (6%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSED---------NIDCGDF  1319
             +W+     +K+ S   F   PL    + + +RR     +R  ED         + + GD 
Sbjct  102   KWRGFLRTLKKGSPVRFHTFPL--KSVPKLTRR---KSTRIREDMVPAFHASLDTELGDL  156

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  KPSWRNFTL EL  ATDNFS +N++G+GG AEVYKG L  G+++A+KR+ +   ++ 
Sbjct  157   SYFKPSWRNFTLIELQDATDNFSRDNLIGEGGCAEVYKGMLPGGEIVAIKRLTRGSPEEM  216

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT--ETLEW  965
                  FLSELGII H++HPN AKLIG+  + G+HL+L   PHGSLA LL+ A   E L+W
Sbjct  217   TAD--FLSELGIIVHVDHPNIAKLIGYGVEGGMHLILHLSPHGSLASLLYVAGSGEKLDW  274

Query  964   KIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGH  785
              IR+KVA+G AEGL YLH  CQRRIIH+D+ A+NILL+ED+  QISDFGLAKWLPE+W H
Sbjct  275   GIRYKVALGTAEGLMYLHEECQRRIIHKDVKAANILLSEDFEPQISDFGLAKWLPEQWSH  334

Query  784   HVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPL  605
             H+VS IEGTFGY+ PEYFMHGIVDEKTDV+A+GVLLLELITG++A+DSS++SLVMWAKPL
Sbjct  335   HIVSQIEGTFGYLPPEYFMHGIVDEKTDVYAYGVLLLELITGQKALDSSQKSLVMWAKPL  394

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-ELKV  428
             L  N IKE  DP LG AY+  +M+R +  A  C  H    RP M +VV +L+GE   L++
Sbjct  395   LSDNRIKEFVDPSLGGAYNSEQMDRLILAASLCTHHSSIHRPQMSQVVCLLRGEQGSLEL  454

Query  427   ELRQSKS-----VSSESLHIA-DFTSTSYRKHLDRHLQLI  326
                Q +        SE L+ A ++ +T Y   LDR+++++
Sbjct  455   AREQDRGPLLQRTYSEELYAAEEYNATKYLNDLDRYMEIV  494



>ref|XP_010024469.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Eucalyptus grandis]
Length=594

 Score =   394 bits (1011),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 205/398 (52%), Positives = 272/398 (68%), Gaps = 23/398 (6%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSED---------NIDCGDF  1319
             +W+     +K+ S   F   PL    + + +RR     +R  ED         + + GD 
Sbjct  194   KWRGFLRTLKKGSPVRFHTFPL--KSVPKLTRR---KSTRIREDMVPAFHASLDTELGDL  248

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  KPSWRNFTL EL  ATDNFS +N++G+GG AEVYKG L  G+++A+KR+ +   ++ 
Sbjct  249   SYFKPSWRNFTLIELQDATDNFSRDNLIGEGGCAEVYKGMLPGGEIVAIKRLTRGSPEEM  308

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKI  959
                  FLSELGII H++HPN AKLIG+  + G+HL+L   PHGSLA LL+ + E L+W I
Sbjct  309   TAD--FLSELGIIVHVDHPNIAKLIGYGVEGGMHLILHLSPHGSLASLLYGSGEKLDWGI  366

Query  958   RFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHV  779
             R+KVA+G AEGL YLH  CQRRIIH+D+ A+NILL+ED+  QISDFGLAKWLPE+W HH+
Sbjct  367   RYKVALGTAEGLMYLHEECQRRIIHKDVKAANILLSEDFEPQISDFGLAKWLPEQWSHHI  426

Query  778   VSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLE  599
             VS IEGTFGY+ PEYFMHGIVDEKTDV+A+GVLLLELITG++A+DSS++SLVMWAKPLL 
Sbjct  427   VSQIEGTFGYLPPEYFMHGIVDEKTDVYAYGVLLLELITGQKALDSSQKSLVMWAKPLLS  486

Query  598   QNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-ELKVEL  422
              N IKE  DP LG AY+  +M+R +  A  C  H    RP M +VV +L+GE   L++  
Sbjct  487   DNRIKEFVDPSLGGAYNSEQMDRLILAASLCTHHSSIHRPQMSQVVCLLRGEQGSLELAR  546

Query  421   RQSKS-----VSSESLHIA-DFTSTSYRKHLDRHLQLI  326
              Q +        SE L+ A ++ +T Y   LDR+++++
Sbjct  547   EQDRGPLLQRTYSEELYAAEEYNATKYLNDLDRYMEIV  584



>ref|XP_008223070.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Prunus mume]
Length=523

 Score =   391 bits (1005),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 207/406 (51%), Positives = 268/406 (66%), Gaps = 23/406 (6%)
 Frame = -3

Query  1486  DPTAVQ-WKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC------  1328
             DP   Q W+  F  +K+     FP  P       + +RR      R  ED I        
Sbjct  117   DPRQNQNWRGFFRILKKGPQHPFPTFPPKSAPKPKLTRR---KSKRIREDFIPQLNSPAL  173

Query  1327  -----GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkri  1163
                   DF   K SW+N++L +L  AT+NFS EN++G+GG+AEVYKG L DGQ++A+KR+
Sbjct  174   MPSFDADFCRFKSSWKNYSLLDLQVATNNFSQENLIGEGGYAEVYKGTLEDGQIVAIKRL  233

Query  1162  ikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
              +  +++      FLSELG+I H++HPN AKLIG+  + G+HLVL   PHGSLA +L+  
Sbjct  234   TRGSQEEMTAD--FLSELGVIVHVDHPNIAKLIGYGVEGGMHLVLHLSPHGSLASILYGP  291

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
              E L+W IR+KVA G A+GL YLH  CQRRIIH+DI ASNILL ED+  QISDFGLAKWL
Sbjct  292   RENLDWGIRYKVASGTAKGLLYLHEGCQRRIIHKDIKASNILLAEDFEPQISDFGLAKWL  351

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLV  623
             P+ W HH+VS  EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS +SLV
Sbjct  352   PDHWTHHIVSKFEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSHKSLV  411

Query  622   MWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             MWAKPLL  +NIKELADP LGDAYD+ +M+R    A  C+      RP M ++V++L+G+
Sbjct  412   MWAKPLLSTDNIKELADPCLGDAYDLQQMKRLALTASICVHQSSMNRPQMNQIVQILEGD  471

Query  442   NEL--KVELRQSKSVS---SESLHIAD-FTSTSYRKHLDRHLQLIM  323
               +   V  RQ   +    SE L  AD + ST Y    D+ L+ ++
Sbjct  472   ESILEYVTKRQKSKLQRTYSEELFDADEYNSTKYLSDRDKQLEFVL  517



>gb|KCW60916.1| hypothetical protein EUGRSUZ_H03652 [Eucalyptus grandis]
Length=512

 Score =   390 bits (1003),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 206/400 (52%), Positives = 272/400 (68%), Gaps = 25/400 (6%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSED---------NIDCGDF  1319
             +W+     +K+ S   F   PL    + + +RR     +R  ED         + + GD 
Sbjct  110   KWRGFLRTLKKGSPVRFHTFPL--KSVPKLTRR---KSTRIREDMVPAFHASLDTELGDL  164

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  KPSWRNFTL EL  ATDNFS +N++G+GG AEVYKG L  G+++A+KR+ +   ++ 
Sbjct  165   SYFKPSWRNFTLIELQDATDNFSRDNLIGEGGCAEVYKGMLPGGEIVAIKRLTRGSPEEM  224

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT--ETLEW  965
                  FLSELGII H++HPN AKLIG+  + G+HL+L   PHGSLA LL+ A   E L+W
Sbjct  225   TAD--FLSELGIIVHVDHPNIAKLIGYGVEGGMHLILHLSPHGSLASLLYVAGSGEKLDW  282

Query  964   KIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGH  785
              IR+KVA+G AEGL YLH  CQRRIIH+D+ A+NILL+ED+  QISDFGLAKWLPE+W H
Sbjct  283   GIRYKVALGTAEGLMYLHEECQRRIIHKDVKAANILLSEDFEPQISDFGLAKWLPEQWSH  342

Query  784   HVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPL  605
             H+VS IEGTFGY+ PEYFMHGIVDEKTDV+A+GVLLLELITG++A+DSS++SLVMWAKPL
Sbjct  343   HIVSQIEGTFGYLPPEYFMHGIVDEKTDVYAYGVLLLELITGQKALDSSQKSLVMWAKPL  402

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-ELKV  428
             L  N IKE  DP LG AY+  +M+R +  A  C  H    RP M +VV +L+GE   L++
Sbjct  403   LSDNRIKEFVDPSLGGAYNSEQMDRLILAASLCTHHSSIHRPQMSQVVCLLRGEQGSLEL  462

Query  427   ELRQSKS-----VSSESLHIA-DFTSTSYRKHLDRHLQLI  326
                Q +        SE L+ A ++ +T Y   LDR+++++
Sbjct  463   AREQDRGPLLQRTYSEELYAAEEYNATKYLNDLDRYMEIV  502



>ref|XP_006594452.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like isoform X1 [Glycine max]
Length=570

 Score =   392 bits (1008),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 206/412 (50%), Positives = 273/412 (66%), Gaps = 25/412 (6%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSF-PIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC  1328
             GS  G   T  QW+  F  +K+ S   F P  PL   ++ + +RR      R  ED I  
Sbjct  153   GSFAGAPNTNNQWRGFFKLLKKGSQMPFQPFHPL--KNVPKLTRR---KSKRIREDLIPS  207

Query  1327  -----------GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQV  1181
                         +F   K SW+NFTL E+  AT++FS EN++G+GG+AEVY G+L DG  
Sbjct  208   LNSPALHASFDAEFGCFKSSWKNFTLAEIQAATNDFSHENLIGEGGYAEVYLGKLEDGNF  267

Query  1180  IAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLA  1001
             +A+KR+ +  +++      FLSELGII H++HPN A+LIG+  + G+ LVLQ  PHGSL+
Sbjct  268   VAIKRLTRGCQEEMTAD--FLSELGIIVHVDHPNIARLIGYGVEGGMFLVLQLSPHGSLS  325

Query  1000  FLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDF  821
              +L+   E L W +R+K+A+G AEGL YLH  CQRRIIH+DI ASNILL+ED+  QISDF
Sbjct  326   SILYGPREKLNWNLRYKIALGTAEGLRYLHEECQRRIIHKDIKASNILLSEDFEPQISDF  385

Query  820   GLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS  641
             GLAKWLP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DS
Sbjct  386   GLAKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDS  445

Query  640   SRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVV  461
             S++SLVMWAKPLL  NNIKEL DP L DAYD  +M+     A  C+      RP+M +V 
Sbjct  446   SQKSLVMWAKPLLTANNIKELVDPVLADAYDEEQMKLVTLTASLCVDQSSIQRPDMSQVF  505

Query  460   EVLKGENE-LKVELRQSKS-----VSSESLHIADFTSTSYRKHLDRHLQLIM  323
             ++L+GE E L++   +SKS      S E     ++ ST +    DRH++ I+
Sbjct  506   DILRGEEESLRIMEERSKSKLQRTYSEELFDAEEYNSTKFLSERDRHMETIL  557



>ref|XP_010024470.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X3 [Eucalyptus grandis]
Length=533

 Score =   390 bits (1002),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 206/400 (52%), Positives = 272/400 (68%), Gaps = 25/400 (6%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSED---------NIDCGDF  1319
             +W+     +K+ S   F   PL    + + +RR     +R  ED         + + GD 
Sbjct  131   KWRGFLRTLKKGSPVRFHTFPL--KSVPKLTRR---KSTRIREDMVPAFHASLDTELGDL  185

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  KPSWRNFTL EL  ATDNFS +N++G+GG AEVYKG L  G+++A+KR+ +   ++ 
Sbjct  186   SYFKPSWRNFTLIELQDATDNFSRDNLIGEGGCAEVYKGMLPGGEIVAIKRLTRGSPEEM  245

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT--ETLEW  965
                  FLSELGII H++HPN AKLIG+  + G+HL+L   PHGSLA LL+ A   E L+W
Sbjct  246   TAD--FLSELGIIVHVDHPNIAKLIGYGVEGGMHLILHLSPHGSLASLLYVAGSGEKLDW  303

Query  964   KIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGH  785
              IR+KVA+G AEGL YLH  CQRRIIH+D+ A+NILL+ED+  QISDFGLAKWLPE+W H
Sbjct  304   GIRYKVALGTAEGLMYLHEECQRRIIHKDVKAANILLSEDFEPQISDFGLAKWLPEQWSH  363

Query  784   HVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPL  605
             H+VS IEGTFGY+ PEYFMHGIVDEKTDV+A+GVLLLELITG++A+DSS++SLVMWAKPL
Sbjct  364   HIVSQIEGTFGYLPPEYFMHGIVDEKTDVYAYGVLLLELITGQKALDSSQKSLVMWAKPL  423

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-ELKV  428
             L  N IKE  DP LG AY+  +M+R +  A  C  H    RP M +VV +L+GE   L++
Sbjct  424   LSDNRIKEFVDPSLGGAYNSEQMDRLILAASLCTHHSSIHRPQMSQVVCLLRGEQGSLEL  483

Query  427   ELRQSKS-----VSSESLHIA-DFTSTSYRKHLDRHLQLI  326
                Q +        SE L+ A ++ +T Y   LDR+++++
Sbjct  484   AREQDRGPLLQRTYSEELYAAEEYNATKYLNDLDRYMEIV  523



>emb|CDX88908.1| BnaA03g07410D [Brassica napus]
Length=492

 Score =   389 bits (998),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/396 (50%), Positives = 278/396 (70%), Gaps = 32/396 (8%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPI-VPLFGHDII--RKSRRMFFSWSRC-SEDNIDCGDFSI  1313
             T+ QW+  F ++ +K + + P   PL G   +  RKS+R+  +        ++D GD   
Sbjct  113   TSGQWRGRFVRLLKKGSSAMPFNTPLKGVPKLTRRKSKRIRDNMVPVLPATSLDTGDLFC  172

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
              KPSWRN++LQ++  AT+ +S EN++G+GG+AEVYKG++ DGQ++A+K++ +   ++   
Sbjct  173   FKPSWRNYSLQDIQTATNGYSRENLIGEGGYAEVYKGQMADGQIVAIKKLTRGSAEEMTM  232

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRF  953
                +LSELGII H++HPN AKLIG+  + G+HLVLQ  P+GSLA LL+ A E L W IR+
Sbjct  233   D--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLQLSPNGSLASLLYEAKEKLSWSIRY  290

Query  952   KVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVS  773
             KVAVG AEGL+YLH  CQRRIIH+DI ASNILLTE++ AQISDFGLAKWLP++W HH VS
Sbjct  291   KVAVGTAEGLYYLHEGCQRRIIHKDIKASNILLTENFEAQISDFGLAKWLPDQWTHHTVS  350

Query  772   PIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQN  593
              IEGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITG+QA+DS++ SLVMWAKPL+++N
Sbjct  351   KIEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGKQALDSAQHSLVMWAKPLIKEN  410

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL--KVELR  419
              IK+L DP +GD YD+ E+ER                     VVE+ +G+     +++LR
Sbjct  411   KIKQLVDPVMGDDYDLEELER--------------------LVVEIFRGDKGSLDQLKLR  450

Query  418   QS----KSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
             Q+    ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  451   QNSKLQRTYSEELLDNEEYNSTRYLNDINRHMETVL  486



>ref|XP_011012550.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2, partial [Populus euphratica]
Length=482

 Score =   388 bits (997),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 249/337 (74%), Gaps = 4/337 (1%)
 Frame = -3

Query  1327  GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
             G+F   K SW+NF+L EL  ATD FS EN++G+GG+AEVYKG+L DGQ +A+KR+ +   
Sbjct  113   GEFCHFKSSWKNFSLSELHTATDTFSQENLIGEGGYAEVYKGKLEDGQFVAIKRLTRGSP  172

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             +D      FLSELGII H++HPN AK+IG+  + G+HLVL+   +GSLA LL+   E L+
Sbjct  173   EDMTVD--FLSELGIIVHVDHPNIAKVIGYGVEGGMHLVLELSANGSLASLLYGPKEKLD  230

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W+IR+K+A+G A GL YLH  CQRRIIH+DI ASNILLTED   QISDFGLAKWLPE+W 
Sbjct  231   WRIRYKIALGTASGLLYLHEECQRRIIHKDIKASNILLTEDLEPQISDFGLAKWLPEEWS  290

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HH +S IEGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS+ SLVMWAKP
Sbjct  291   HHTLSKIEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQHSLVMWAKP  350

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL  N+I+EL DP L DAYD  +M+R    A  CI   P+ RP M  VV VL+G+     
Sbjct  351   LLLNNSIEELVDPILADAYDSEQMDRLACTASMCIHQSPSERPQMSHVVRVLQGDESSFE  410

Query  427   ELRQSKSVSS-ESLHIADFT-STSYRKHLDRHLQLIM  323
             EL+Q +   S E L+ AD   ST Y + L++ +++++
Sbjct  411   ELKQRQRTPSIEDLYDADENDSTEYLRDLNQQMEVVL  447



>ref|XP_010649821.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Vitis vinifera]
Length=485

 Score =   388 bits (996),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 206/395 (52%), Positives = 268/395 (68%), Gaps = 11/395 (3%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIR-KSRRMFFSWSRCSEDNIDCGDFSITK  1307
             +A  W       K+ SA     +P  G   + R KSRR   S       ++D G   + K
Sbjct  93    SASNWHRFSQLFKKGSAMGLQTLPSLGIRKLSRSKSRRARGSMIPALYPSLDAG-LCLMK  151

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
             PSW+ F+L EL  ATDNFS +N++G+GG+AEVYKG+L DGQ +A+KRII+   ++     
Sbjct  152   PSWKAFSLSELETATDNFSHKNLIGEGGYAEVYKGQLQDGQFVAIKRIIRGTPEEMTVD-  210

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FLSELGII HI+HPN AKL+G+  + G+HLVL   PHGSLA LL++  + LEW+IR+K+
Sbjct  211   -FLSELGIIVHIDHPNTAKLVGYGVEGGMHLVLYLSPHGSLASLLYSPEKKLEWEIRYKI  269

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G AEGL YLH   QRRIIHRDI ASNILL ED+  QISDFGLAKWLPE+  HH+VS  
Sbjct  270   ALGTAEGLGYLHEGGQRRIIHRDIKASNILLKEDFEPQISDFGLAKWLPEQCTHHIVSGF  329

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+ PEYF+HGIVDEKTDV+A+GVLLLELITGR A+DSS++SLVMWAKPLL  N+I
Sbjct  330   EGTFGYLPPEYFLHGIVDEKTDVYAYGVLLLELITGRPALDSSQKSLVMWAKPLLINNSI  389

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ---  416
              EL DPRL DAYD  +M     V+  C+      RP M +VV+VLKG  ++    ++   
Sbjct  390   DELVDPRLADAYDSEQMNIVATVSSLCLHQSSVQRPRMNQVVQVLKGREDISTLGKRYQK  449

Query  415   ---SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                 ++ S E L   ++ ST +   L RH+++++E
Sbjct  450   PILQRTYSEELLDAEEYNSTKHLNDLSRHMEILLE  484



>ref|XP_003594054.1| Somatic embryogenesis receptor kinase [Medicago truncatula]
 gb|AES64305.1| receptor-like cytosolic Serine/Threonine-kinase [Medicago truncatula]
Length=442

 Score =   386 bits (991),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 202/397 (51%), Positives = 271/397 (68%), Gaps = 17/397 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSF----PI--VPLFGHDIIRKSRRMFFSW--SRCSEDNIDCGDFS  1316
             QW+  F  IK+     F    P+  VP       ++ R  F     S   + + D  +F 
Sbjct  43    QWRGFFKLIKKGPQMPFHTFHPLKNVPKLTRRKSKRIREEFIPSLNSPALQSSFDS-EFM  101

Query  1315  ITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdee  1136
               K SW+NFTL E+  AT++FS +N++G+GG+AEVY G+L DG  +A+KR+ +  +++  
Sbjct  102   CFKSSWKNFTLAEIQAATNDFSQDNLIGEGGYAEVYLGKLEDGNFVAIKRLTRGCQEEMT  161

Query  1135  rieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIR  956
                 FLSELGII H++HPN A+LIG+  + G+ LVLQ  PHGSL+ LL+   E L W +R
Sbjct  162   AD--FLSELGIIVHVDHPNIARLIGYGVEGGMFLVLQLSPHGSLSSLLYGPREKLNWSLR  219

Query  955   FKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVV  776
             +++ +G AEGLHYLH  CQRRIIH+DI ASNILL+ED+  QISDFGLAKWLP++W HH V
Sbjct  220   YRITLGTAEGLHYLHEGCQRRIIHKDIKASNILLSEDFEPQISDFGLAKWLPDQWTHHTV  279

Query  775   SPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQ  596
             S +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS++SLVMWAKPLL  
Sbjct  280   SKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQKSLVMWAKPLLTS  339

Query  595   NNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE-LKVELR  419
             NNIKEL DP L DAYD  +M+  +  A  CI      RP+M +VV++L+GE E L++   
Sbjct  340   NNIKELVDPVLDDAYDAEQMKLVILAASMCIDQSSIQRPHMSQVVQILRGEEESLRILKE  399

Query  418   QSKS----VSSESLHIA-DFTSTSYRKHLDRHLQLIM  323
             + KS      SE L+ A D+ ST +    DR+++ I+
Sbjct  400   RQKSKLHRTYSEELYAAEDYNSTKFLSDRDRYMETIL  436



>ref|XP_010649820.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Vitis vinifera]
 emb|CBI26143.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   387 bits (995),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 206/395 (52%), Positives = 268/395 (68%), Gaps = 11/395 (3%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFG-HDIIR-KSRRMFFSWSRCSEDNIDCGDFSITK  1307
             +A  W       K+ SA     +P  G   + R KSRR   S       ++D G   + K
Sbjct  95    SASNWHRFSQLFKKGSAMGLQTLPSLGIRKLSRSKSRRARGSMIPALYPSLDAG-LCLMK  153

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
             PSW+ F+L EL  ATDNFS +N++G+GG+AEVYKG+L DGQ +A+KRII+   ++     
Sbjct  154   PSWKAFSLSELETATDNFSHKNLIGEGGYAEVYKGQLQDGQFVAIKRIIRGTPEEMTVD-  212

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FLSELGII HI+HPN AKL+G+  + G+HLVL   PHGSLA LL++  + LEW+IR+K+
Sbjct  213   -FLSELGIIVHIDHPNTAKLVGYGVEGGMHLVLYLSPHGSLASLLYSPEKKLEWEIRYKI  271

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G AEGL YLH   QRRIIHRDI ASNILL ED+  QISDFGLAKWLPE+  HH+VS  
Sbjct  272   ALGTAEGLGYLHEGGQRRIIHRDIKASNILLKEDFEPQISDFGLAKWLPEQCTHHIVSGF  331

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+ PEYF+HGIVDEKTDV+A+GVLLLELITGR A+DSS++SLVMWAKPLL  N+I
Sbjct  332   EGTFGYLPPEYFLHGIVDEKTDVYAYGVLLLELITGRPALDSSQKSLVMWAKPLLINNSI  391

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ---  416
              EL DPRL DAYD  +M     V+  C+      RP M +VV+VLKG  ++    ++   
Sbjct  392   DELVDPRLADAYDSEQMNIVATVSSLCLHQSSVQRPRMNQVVQVLKGREDISTLGKRYQK  451

Query  415   ---SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                 ++ S E L   ++ ST +   L RH+++++E
Sbjct  452   PILQRTYSEELLDAEEYNSTKHLNDLSRHMEILLE  486



>ref|XP_011012531.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Populus euphratica]
Length=553

 Score =   389 bits (999),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 249/337 (74%), Gaps = 4/337 (1%)
 Frame = -3

Query  1327  GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
             G+F   K SW+NF+L EL  ATD FS EN++G+GG+AEVYKG+L DGQ +A+KR+ +   
Sbjct  184   GEFCHFKSSWKNFSLSELHTATDTFSQENLIGEGGYAEVYKGKLEDGQFVAIKRLTRGSP  243

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             +D      FLSELGII H++HPN AK+IG+  + G+HLVL+   +GSLA LL+   E L+
Sbjct  244   EDMTVD--FLSELGIIVHVDHPNIAKVIGYGVEGGMHLVLELSANGSLASLLYGPKEKLD  301

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W+IR+K+A+G A GL YLH  CQRRIIH+DI ASNILLTED   QISDFGLAKWLPE+W 
Sbjct  302   WRIRYKIALGTASGLLYLHEECQRRIIHKDIKASNILLTEDLEPQISDFGLAKWLPEEWS  361

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HH +S IEGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS+ SLVMWAKP
Sbjct  362   HHTLSKIEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQHSLVMWAKP  421

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL  N+I+EL DP L DAYD  +M+R    A  CI   P+ RP M  VV VL+G+     
Sbjct  422   LLLNNSIEELVDPILADAYDSEQMDRLACTASMCIHQSPSERPQMSHVVRVLQGDESSFE  481

Query  427   ELRQSKSVSS-ESLHIADFT-STSYRKHLDRHLQLIM  323
             EL+Q +   S E L+ AD   ST Y + L++ +++++
Sbjct  482   ELKQRQRTPSIEDLYDADENDSTEYLRDLNQQMEVVL  518



>ref|XP_011012532.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X3 [Populus euphratica]
Length=549

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 249/337 (74%), Gaps = 4/337 (1%)
 Frame = -3

Query  1327  GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
             G+F   K SW+NF+L EL  ATD FS EN++G+GG+AEVYKG+L DGQ +A+KR+ +   
Sbjct  180   GEFCHFKSSWKNFSLSELHTATDTFSQENLIGEGGYAEVYKGKLEDGQFVAIKRLTRGSP  239

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             +D      FLSELGII H++HPN AK+IG+  + G+HLVL+   +GSLA LL+   E L+
Sbjct  240   EDMTVD--FLSELGIIVHVDHPNIAKVIGYGVEGGMHLVLELSANGSLASLLYGPKEKLD  297

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W+IR+K+A+G A GL YLH  CQRRIIH+DI ASNILLTED   QISDFGLAKWLPE+W 
Sbjct  298   WRIRYKIALGTASGLLYLHEECQRRIIHKDIKASNILLTEDLEPQISDFGLAKWLPEEWS  357

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HH +S IEGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS+ SLVMWAKP
Sbjct  358   HHTLSKIEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQHSLVMWAKP  417

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL  N+I+EL DP L DAYD  +M+R    A  CI   P+ RP M  VV VL+G+     
Sbjct  418   LLLNNSIEELVDPILADAYDSEQMDRLACTASMCIHQSPSERPQMSHVVRVLQGDESSFE  477

Query  427   ELRQSKSVSS-ESLHIADFT-STSYRKHLDRHLQLIM  323
             EL+Q +   S E L+ AD   ST Y + L++ +++++
Sbjct  478   ELKQRQRTPSIEDLYDADENDSTEYLRDLNQQMEVVL  514



>ref|XP_011012530.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Populus euphratica]
Length=553

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 249/337 (74%), Gaps = 4/337 (1%)
 Frame = -3

Query  1327  GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
             G+F   K SW+NF+L EL  ATD FS EN++G+GG+AEVYKG+L DGQ +A+KR+ +   
Sbjct  184   GEFCHFKSSWKNFSLSELHTATDTFSQENLIGEGGYAEVYKGKLEDGQFVAIKRLTRGSP  243

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             +D      FLSELGII H++HPN AK+IG+  + G+HLVL+   +GSLA LL+   E L+
Sbjct  244   EDMTVD--FLSELGIIVHVDHPNIAKVIGYGVEGGMHLVLELSANGSLASLLYGPKEKLD  301

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W+IR+K+A+G A GL YLH  CQRRIIH+DI ASNILLTED   QISDFGLAKWLPE+W 
Sbjct  302   WRIRYKIALGTASGLLYLHEECQRRIIHKDIKASNILLTEDLEPQISDFGLAKWLPEEWS  361

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HH +S IEGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS+ SLVMWAKP
Sbjct  362   HHTLSKIEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQHSLVMWAKP  421

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL  N+I+EL DP L DAYD  +M+R    A  CI   P+ RP M  VV VL+G+     
Sbjct  422   LLLNNSIEELVDPILADAYDSEQMDRLACTASMCIHQSPSERPQMSHVVRVLQGDESSFE  481

Query  427   ELRQSKSVSS-ESLHIADFT-STSYRKHLDRHLQLIM  323
             EL+Q +   S E L+ AD   ST Y + L++ +++++
Sbjct  482   ELKQRQRTPSIEDLYDADENDSTEYLRDLNQQMEVVL  518



>emb|CDX70854.1| BnaC03g09380D [Brassica napus]
Length=492

 Score =   386 bits (991),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 274/396 (69%), Gaps = 32/396 (8%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPI-VPLFGHDII--RKSRRMFFSWSRC-SEDNIDCGDFSI  1313
             T+ QW+  F ++ +K + + P   PL G   +  RKS+R+  +        ++D GD   
Sbjct  113   TSGQWRGRFVRLLKKGSSAMPFNTPLKGVPKLTRRKSKRIRDNMVPVLPATSLDTGDLFC  172

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
              KPSWRN++LQ++  AT+ +S EN++G+GG+AEVYKG++ DGQ++A+K++ +   ++   
Sbjct  173   FKPSWRNYSLQDIQTATNGYSRENLIGEGGYAEVYKGQMADGQIVAIKKLTRGSAEEMTM  232

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRF  953
                +LSELGII H++HPN AKLIG+  + G+HLVLQ  P+GSLA LL+ A E L W IR+
Sbjct  233   D--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLQLSPNGSLASLLYEAKEKLSWSIRY  290

Query  952   KVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVS  773
             KVA G AEGL+YLH  CQRRIIH+DI ASNILLTE++ AQISDFGLAKWLP++W HH +S
Sbjct  291   KVATGTAEGLYYLHEGCQRRIIHKDIKASNILLTENFEAQISDFGLAKWLPDQWTHHTLS  350

Query  772   PIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQN  593
              IEGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITG+QA+DS++ SLVMWAKPL+++N
Sbjct  351   KIEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGKQALDSAQHSLVMWAKPLIKEN  410

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ-  416
              IK+L DP +GD YD+ E+ER                     VVE+ +G+     +L+Q 
Sbjct  411   KIKQLVDPVMGDDYDLEELER--------------------LVVEIFRGDKGSLDQLKQR  450

Query  415   -----SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                   ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  451   QNSKLQRTYSEELLDNEEYNSTRYLNDINRHMETVL  486



>ref|XP_006419738.1| hypothetical protein CICLE_v10006445mg [Citrus clementina]
 gb|ESR32978.1| hypothetical protein CICLE_v10006445mg [Citrus clementina]
Length=456

 Score =   384 bits (987),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/385 (50%), Positives = 261/385 (68%), Gaps = 17/385 (4%)
 Frame = -3

Query  1465  KSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRNFT  1286
             KS    I +   K+ P +       IR SR + F+ +          +    KP W+NF 
Sbjct  75    KSAPKNIPKSVTKNAPKLTRRKTKRIRGSRGLSFNATLVD------AELCYLKPGWKNFA  128

Query  1285  LQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELG  1106
             L EL  ATDNFS EN++G+GG+AEVYKG+L DGQ +A+KR+ +   ++      +LSELG
Sbjct  129   LSELQAATDNFSHENLIGQGGYAEVYKGQLEDGQFVAIKRLTRGSPEEMTTD--YLSELG  186

Query  1105  IIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEG  926
             II H++HPN AK+IG+  + G+HL+L+  PHGSLA LL+   E L W IR+K+A G AEG
Sbjct  187   IIVHVDHPNIAKMIGYGVEGGMHLILELSPHGSLASLLYGPKEKLNWDIRYKIAFGTAEG  246

Query  925   LHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYM  746
             + YLH  CQRRIIH+DI A+NILLTED+  QISDFGLAKWLP+KW HH+VS IEGTFGY+
Sbjct  247   ICYLHEGCQRRIIHKDIKAANILLTEDFQPQISDFGLAKWLPDKWTHHIVSKIEGTFGYL  306

Query  745   APEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPR  566
              PE+FMHGI DEKTDV+A+GVLLLE+ITGRQA+DSS++SLVMWAKPLL+++++KEL DP 
Sbjct  307   PPEFFMHGIADEKTDVYAYGVLLLEIITGRQALDSSQKSLVMWAKPLLKKSSMKELVDPT  366

Query  565   LGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVSSESLH  386
             LGDAY+  ++ R + +A +CI      RP M K    ++     +  LR  ++ S E   
Sbjct  367   LGDAYNTEQLTRLLLIASACINQTSACRPQMSKACSFMR-----QKALRLQRTFSEEFFD  421

Query  385   IADFTSTSYRK----HLDRHLQLIM  323
               +F S S  +     ++RH+++++
Sbjct  422   AEEFNSASLNELDVNDINRHMEIVL  446



>ref|XP_004486085.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Cicer arietinum]
Length=506

 Score =   386 bits (991),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 202/400 (51%), Positives = 266/400 (67%), Gaps = 24/400 (6%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIV-PLFGHDIIRKSRRMFFSWSRCSEDNIDC-----------  1328
             QW+  F  +K+ S   F    PL   ++ + +RR      R  ED I             
Sbjct  100   QWRGFFKLLKKGSQMPFQTFHPL--KNVPKLTRR---KSKRIREDLIPSLNSPALQSSFD  154

Query  1327  GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
              +F   K SW+NFTL E+  AT++FS +N++G+GG+AEVY G+L DG  +A+KR+ +  +
Sbjct  155   SEFCCFKSSWKNFTLSEIQAATNDFSHDNLIGEGGYAEVYLGKLEDGNFVAIKRLTRGCQ  214

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             ++      FLSELGII H++HPN A+LIG+  + G+ LVLQ  PHGSL+ LL+   E L 
Sbjct  215   EEMTAD--FLSELGIIVHVDHPNIARLIGYGVEGGMFLVLQLSPHGSLSSLLYGPREKLN  272

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W +RFK+A+G AEGL YLH  CQRRIIH+DI ASNILL+ED+  QISDFGLAKWLP++W 
Sbjct  273   WSLRFKIAMGTAEGLRYLHEGCQRRIIHKDIKASNILLSEDFEPQISDFGLAKWLPDQWT  332

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HH VS +EGTFGY+ PE+F+HGIVDEKTDV+A+GVLLLELITGRQA+DSS++SLVMWAKP
Sbjct  333   HHTVSKVEGTFGYLPPEFFLHGIVDEKTDVYAYGVLLLELITGRQALDSSQKSLVMWAKP  392

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL  NNIKEL DP L DAYD  +M+  +  A  CI      RP M +V+++L+GE E   
Sbjct  393   LLSSNNIKELVDPILDDAYDGEQMKLVILTASMCIDQSSIQRPVMSQVLQILRGEQECLK  452

Query  427   ELRQSKS-----VSSESLHIADFTSTSYRKHLDRHLQLIM  323
              L+  KS      S E     D+ ST +    DRH++ I+
Sbjct  453   TLKGQKSKLHRTYSEELFDAEDYNSTKFLSDRDRHMETIL  492



>ref|XP_010024468.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Eucalyptus grandis]
Length=596

 Score =   389 bits (999),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 206/400 (52%), Positives = 272/400 (68%), Gaps = 25/400 (6%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSED---------NIDCGDF  1319
             +W+     +K+ S   F   PL    + + +RR     +R  ED         + + GD 
Sbjct  194   KWRGFLRTLKKGSPVRFHTFPL--KSVPKLTRR---KSTRIREDMVPAFHASLDTELGDL  248

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  KPSWRNFTL EL  ATDNFS +N++G+GG AEVYKG L  G+++A+KR+ +   ++ 
Sbjct  249   SYFKPSWRNFTLIELQDATDNFSRDNLIGEGGCAEVYKGMLPGGEIVAIKRLTRGSPEEM  308

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT--ETLEW  965
                  FLSELGII H++HPN AKLIG+  + G+HL+L   PHGSLA LL+ A   E L+W
Sbjct  309   TAD--FLSELGIIVHVDHPNIAKLIGYGVEGGMHLILHLSPHGSLASLLYVAGSGEKLDW  366

Query  964   KIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGH  785
              IR+KVA+G AEGL YLH  CQRRIIH+D+ A+NILL+ED+  QISDFGLAKWLPE+W H
Sbjct  367   GIRYKVALGTAEGLMYLHEECQRRIIHKDVKAANILLSEDFEPQISDFGLAKWLPEQWSH  426

Query  784   HVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPL  605
             H+VS IEGTFGY+ PEYFMHGIVDEKTDV+A+GVLLLELITG++A+DSS++SLVMWAKPL
Sbjct  427   HIVSQIEGTFGYLPPEYFMHGIVDEKTDVYAYGVLLLELITGQKALDSSQKSLVMWAKPL  486

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN-ELKV  428
             L  N IKE  DP LG AY+  +M+R +  A  C  H    RP M +VV +L+GE   L++
Sbjct  487   LSDNRIKEFVDPSLGGAYNSEQMDRLILAASLCTHHSSIHRPQMSQVVCLLRGEQGSLEL  546

Query  427   ELRQSKS-----VSSESLHIA-DFTSTSYRKHLDRHLQLI  326
                Q +        SE L+ A ++ +T Y   LDR+++++
Sbjct  547   AREQDRGPLLQRTYSEELYAAEEYNATKYLNDLDRYMEIV  586



>ref|XP_010242571.1| PREDICTED: autophagy-related protein 18h-like [Nelumbo nucifera]
Length=1470

 Score =   409 bits (1050),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 210/394 (53%), Positives = 274/394 (70%), Gaps = 17/394 (4%)
 Frame = -3

Query  1468  WKSIFDQIKRKSAK---SFP--IVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKP  1304
             W+     IK ++ K   +FP  +VP       R +R    S    +ED      F   K 
Sbjct  103   WQEFVRLIKARTIKRLYTFPPFVVPKLSKRKSRNTRANPISKPNPTED----ASFCSIKS  158

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
             SW+NFTL EL  AT+NFS  N++GKGG+AEVYKGRL DGQ +AVKR+I+   ++      
Sbjct  159   SWKNFTLSELQNATNNFSPGNIIGKGGYAEVYKGRLKDGQFVAVKRLIQGTPEETIGD--  216

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGII H+NHPN AKLIG+  + G+++VLQ  PHGSLA LL+ + E L+W IR+K+A
Sbjct  217   FLSELGIIVHVNHPNTAKLIGYGVEGGMYIVLQLSPHGSLASLLYGSKEKLKWSIRYKIA  276

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G A+GL YLH  CQRRIIHRDI ASNILLTED+  QI DFGLAKWLPE+W HH++   E
Sbjct  277   LGTAKGLKYLHENCQRRIIHRDIKASNILLTEDFEPQICDFGLAKWLPEQWTHHIIPKFE  336

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+APEYFMHGIVDEKTDVFAFGVLLLELITGRQA+D+S++SLVMWAKPLL++N+I+
Sbjct  337   GTFGYLAPEYFMHGIVDEKTDVFAFGVLLLELITGRQALDNSKKSLVMWAKPLLDKNDIR  396

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN------ELKVEL  422
             ELADP L +AYD  +M R +  A  C+Q+   +RP M +VV++L+G+       +L   L
Sbjct  397   ELADPSLDNAYDPEQMNRVVLSASLCVQNSSILRPRMSQVVQILRGDEGSLDCVKLCQNL  456

Query  421   RQSKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                ++ S E     ++ ST Y   L+RH ++ ++
Sbjct  457   GLQRTYSVELFDAEEYNSTRYLSDLNRHKEIALD  490



>ref|XP_002314438.2| hypothetical protein POPTR_0010s02810g, partial [Populus trichocarpa]
 gb|EEF00609.2| hypothetical protein POPTR_0010s02810g, partial [Populus trichocarpa]
Length=472

 Score =   384 bits (986),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 194/334 (58%), Positives = 246/334 (74%), Gaps = 4/334 (1%)
 Frame = -3

Query  1327  GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
             G+F   K SW+NF+L EL  ATD FS EN++G+GG+AEVYKG+L DGQ +A+KR+ +   
Sbjct  132   GEFCHFKSSWKNFSLSELHAATDTFSQENLIGEGGYAEVYKGKLEDGQFVAIKRLTRGSP  191

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             +D      FLSELGI+ H++HPN AK+IG+  + G+HLVL+   +GSLA LL+   E L+
Sbjct  192   EDMTVD--FLSELGILVHVDHPNIAKVIGYGVEGGMHLVLELSANGSLASLLYGPKEKLD  249

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W+IR+K+A+G A GL YLH  CQRRIIH+DI ASNILLTED   QISDFGLAKWLPE+W 
Sbjct  250   WRIRYKIALGTARGLLYLHEECQRRIIHKDIKASNILLTEDLEPQISDFGLAKWLPEEWS  309

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HH +S IEGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS+ SLVMWAKP
Sbjct  310   HHTLSKIEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQHSLVMWAKP  369

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKV  428
             LL  N+I+EL DP L DAYD  +M+R    A  CI   P+ RP M +VV VL+G+     
Sbjct  370   LLLNNSIEELVDPILADAYDSEQMDRLACTASMCIHQSPSERPQMSQVVRVLQGDESSFE  429

Query  427   ELRQSKSVSS-ESLHIADFT-STSYRKHLDRHLQ  332
             EL+Q +   S E L+ AD   ST Y   L++ ++
Sbjct  430   ELKQRQRTPSIEELYDADENDSTEYLSDLNQQME  463



>gb|KHN33097.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Glycine soja]
Length=447

 Score =   383 bits (984),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 207/410 (50%), Positives = 272/410 (66%), Gaps = 29/410 (7%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSF----PI--VPLFGHDIIRKSRR----MFFSWS  1355
             GS  G      QW+  F  +K+ S   F    P+  VP       RKS+R    +  S +
Sbjct  38    GSFAGTPNNNNQWRGFFKLLKKGSQMPFQTFHPLKNVPKLTR---RKSKRIREDLIPSLN  94

Query  1354  RCSEDNIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIA  1175
               S D     +F   K SW+NFTL E+  ATD+FS EN++G+GG+AEVY G+L DG  +A
Sbjct  95    AASLDT----EFGCFKSSWKNFTLAEIQAATDDFSHENLIGEGGYAEVYLGKLEDGNFVA  150

Query  1174  VkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFL  995
             +KR+ +  +++      FLSELGII H++HPN A+LIG+  + G+ LVLQ  PHGSL+ +
Sbjct  151   IKRLTRGCQEEMTAD--FLSELGIIVHVDHPNIARLIGYGVEGGMFLVLQLSPHGSLSSI  208

Query  994   LHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGL  815
             L+   E L W +R+K+A+G AEGL YLH  CQRRIIH+DI ASNILL+ED+  QISDFGL
Sbjct  209   LYGPREKLNWSLRYKIAMGTAEGLRYLHEGCQRRIIHKDIKASNILLSEDFEPQISDFGL  268

Query  814   AKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSR  635
             AKWLP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DSS+
Sbjct  269   AKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQ  328

Query  634   QSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEV  455
             +SLVMWAKPLL  NNIKEL DP L DAYD  +M+     A  C+      RP    V+++
Sbjct  329   KSLVMWAKPLLTANNIKELVDPVLADAYDEEQMKLVTLTASLCVDQSSIQRP----VLDI  384

Query  454   LKGENE-LKVELRQSKS-----VSSESLHIADFTSTSYRKHLDRHLQLIM  323
             L+GE E L++   +SKS      S E L   ++ ST +    DRH++ I+
Sbjct  385   LRGEEESLRIMKERSKSKLQRTYSEELLDAEEYNSTKFLSERDRHMETIL  434



>emb|CDY02597.1| BnaC02g08380D [Brassica napus]
Length=519

 Score =   385 bits (990),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 195/410 (48%), Positives = 280/410 (68%), Gaps = 31/410 (8%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPIVPLFGH--DIIRKSRRMFFSWSRCSEDN---------  1337
             PT   W+ +F ++ +K + + P    F H   + + +RR     S+  +DN         
Sbjct  112   PTNGHWR-VFHRLLKKGSSAMPF-NTFSHLKGVPKLTRRK----SKRIKDNMVPVLPAAA  165

Query  1336  IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
             +D  D  + KPSW+N++LQ++  AT+ +S EN++G+GG+AEVYKG + DGQ++AVK++ +
Sbjct  166   LDTDDLFLFKPSWKNYSLQDIQTATNGYSPENLIGEGGYAEVYKGEMADGQIVAVKKLTR  225

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
                ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA LL+ A +
Sbjct  226   GSAEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLASLLYEAKD  283

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              L W IR+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLTE++ AQISDFGLAKWLP+
Sbjct  284   KLSWSIRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTENFEAQISDFGLAKWLPD  343

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+AFGVLLLELITG+QA+DS++ S+VMW
Sbjct  344   QWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELITGKQAIDSAQHSVVMW  403

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMK-----KVVEVL  452
             AKPL+++N IKEL DP LGD YD+ E++R + +A  CI      RP+M      K   + 
Sbjct  404   AKPLIKENKIKELVDPILGDDYDLEELDRLVSIASLCIHQTSMNRPHMSQARITKTFTLF  463

Query  451   KGENELKVEL-------RQSKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
               +N+  ++        +  ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  464   FSKNKCSLDKLKEGENSKLQRTYSEELLDNEEYNSTKYLNDINRHMETVL  513



>ref|XP_004145041.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Cucumis sativus]
 ref|XP_004154070.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Cucumis sativus]
 gb|KGN46176.1| hypothetical protein Csa_6G067340 [Cucumis sativus]
Length=549

 Score =   387 bits (993),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 271/394 (69%), Gaps = 14/394 (4%)
 Frame = -3

Query  1468  WKSIFDQIKRKSA---KSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG---DFSITK  1307
             W+  F  +K+      ++FP +        RKS+R+           ID     +F   +
Sbjct  151   WRGFFRLLKKGPQMRFQTFPPLKAVPKLTRRKSKRIREDMIPVVSPVIDSSIETEFCYFR  210

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
              SW+NFTL EL  A +NFS EN++G+GG++EVYKG+L DGQ++A+KR+ +  +++     
Sbjct  211   SSWKNFTLSELEVACNNFSQENLIGEGGYSEVYKGQLEDGQLVAIKRLNRGSQEEMTAD-  269

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FLSELGII H++HPN A +IG+  + G+HL+L   PHGSLA +L+ + E L+W  R+K+
Sbjct  270   -FLSELGIIVHVDHPNIASVIGYGVEGGMHLILHLSPHGSLASILYGSKERLDWSTRYKI  328

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G+AEGL YLH  CQRRIIHRDI A+NILL +D+  QISDFGLAKWLP++W HH VS  
Sbjct  329   ALGIAEGLLYLHEGCQRRIIHRDIKAANILLRDDFEPQISDFGLAKWLPDQWTHHTVSKF  388

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGR+A+DS +QSLVMWAKPLL + N+
Sbjct  389   EGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRRALDSLQQSLVMWAKPLLSKQNL  448

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL--RQ-  416
             KEL D  L DA+D  +M+R + +A  CI     +RP M ++V++LKG+    +EL  RQ 
Sbjct  449   KELVDLSLVDAFDTEQMKRMISIASMCINQSSILRPEMSEIVQILKGDGVDNLELVKRQK  508

Query  415   ---SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                 ++ S E L   ++ ST Y   +DRHL++++
Sbjct  509   SKLQRTYSEELLDAEEYNSTKYLSDIDRHLEIVL  542



>ref|XP_004164632.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Cucumis sativus]
Length=524

 Score =   385 bits (990),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 271/394 (69%), Gaps = 14/394 (4%)
 Frame = -3

Query  1468  WKSIFDQIKRKSA---KSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG---DFSITK  1307
             W+  F  +K+      ++FP +        RKS+R+           ID     +F   +
Sbjct  126   WRGFFRLLKKGPQMRFQTFPPLKAVPKLTRRKSKRIREDMIPVVSPVIDSSIETEFCYFR  185

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
              SW+NFTL EL  A +NFS EN++G+GG++EVYKG+L DGQ++A+KR+ +  +++     
Sbjct  186   SSWKNFTLSELEVACNNFSQENLIGEGGYSEVYKGQLEDGQLVAIKRLNRGSQEEMTAD-  244

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FLSELGII H++HPN A +IG+  + G+HL+L   PHGSLA +L+ + E L+W  R+K+
Sbjct  245   -FLSELGIIVHVDHPNIASVIGYGVEGGMHLILHLSPHGSLASILYGSKERLDWSTRYKI  303

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G+AEGL YLH  CQRRIIHRDI A+NILL +D+  QISDFGLAKWLP++W HH VS  
Sbjct  304   ALGIAEGLLYLHEGCQRRIIHRDIKAANILLRDDFEPQISDFGLAKWLPDQWTHHTVSKF  363

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGR+A+DS +QSLVMWAKPLL + N+
Sbjct  364   EGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRRALDSLQQSLVMWAKPLLSKQNL  423

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL--RQ-  416
             KEL D  L DA+D  +M+R + +A  CI     +RP M ++V++LKG+    +EL  RQ 
Sbjct  424   KELVDLSLVDAFDTEQMKRMISIASMCINQSSILRPEMSEIVQILKGDGVDNLELVKRQK  483

Query  415   ---SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                 ++ S E L   ++ ST Y   +DRHL++++
Sbjct  484   SKLQRTYSEELLDAEEYNSTKYLSDIDRHLEIVL  517



>ref|XP_008458519.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Cucumis melo]
Length=549

 Score =   385 bits (989),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 196/395 (50%), Positives = 272/395 (69%), Gaps = 16/395 (4%)
 Frame = -3

Query  1468  WKSIFDQIKRKSA---KSFPIVPLFGHDIIRKSRR----MFFSWSRCSEDNIDCGDFSIT  1310
             W+  F  +K+      ++FP +        RKS+R    M    S   + +I+  +F   
Sbjct  151   WRGFFRLLKKGPQMRFQTFPPLKAVPKLTRRKSKRIREDMIPVVSPVMDSSIET-EFCYF  209

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             + SW+NFTL EL  A +NFS EN++G+GG++EVYKG+L DGQ++A+KR+ +  +++    
Sbjct  210   RSSWKNFTLSELEAACNNFSQENLIGEGGYSEVYKGQLEDGQLVAIKRLNRGSQEEMTAD  269

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FLSELGII H++HPN A +IG+  + G+HL+L   PHGSLA +L+   E L+W  R+K
Sbjct  270   --FLSELGIIVHVDHPNIASVIGYGVEGGMHLILHLSPHGSLASILYGPKERLDWSTRYK  327

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G AEGL YLH  CQRRIIHRDI A+NILL +D+  QISDFGLAKWLP++W HH VS 
Sbjct  328   IALGTAEGLLYLHEGCQRRIIHRDIKAANILLRDDFEPQISDFGLAKWLPDQWTHHTVSK  387

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGR+A+DS +QSLVMWAKPLL + N
Sbjct  388   FEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRRALDSLQQSLVMWAKPLLSKQN  447

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL--RQ  416
             +KEL D  L DA+D  +M+R + +A  CI     +RP M ++V++LKG+    +EL  RQ
Sbjct  448   LKELVDLSLVDAFDSEQMKRMISIASMCINQSSILRPEMSEIVQILKGDGVYNLELVKRQ  507

Query  415   ----SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                  ++ S E L   ++ ST Y   +DRHL++++
Sbjct  508   KSKLQRTYSEELLDAEEYNSTKYLSDIDRHLEIVL  542



>ref|XP_007147835.1| hypothetical protein PHAVU_006G159100g [Phaseolus vulgaris]
 gb|ESW19829.1| hypothetical protein PHAVU_006G159100g [Phaseolus vulgaris]
Length=498

 Score =   383 bits (983),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 202/412 (49%), Positives = 275/412 (67%), Gaps = 24/412 (6%)
 Frame = -3

Query  1504  GSGGGFDPTAV-QWKSIFDQIKRKSAKSF----PI--VPLFGHDIIRKSRRMFFSW----  1358
             GS  G  P +  QW+  F  +K+ S   F    P+  VP       RKS+R+        
Sbjct  85    GSLVGNSPNSNNQWRGFFKLLKKGSQMPFQTFHPLKNVPKLTR---RKSKRIREDLIPSL  141

Query  1357  -SRCSEDNIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQV  1181
              S   + + D  +F   K SW+NFTL E+  ATD FS  N++G+GG+AEVY G+L DG  
Sbjct  142   NSPALQSSFDT-EFGCFKSSWKNFTLAEILTATDEFSQVNLIGEGGYAEVYLGKLEDGNF  200

Query  1180  IAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLA  1001
             +A+KR+ + ++++      FLSELGII H++HPN A+LIG+  + G+ LVLQ  PHGSL+
Sbjct  201   VAIKRLTRGNQEEMTAD--FLSELGIIVHVDHPNIARLIGYGVEGGMFLVLQLSPHGSLS  258

Query  1000  FLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDF  821
              +L+   E L W++R+K+ +G AEGL YLH  CQRRIIH+DI ASNILL+ED+  QISDF
Sbjct  259   SILYGPREKLNWRLRYKIILGTAEGLRYLHEECQRRIIHKDIKASNILLSEDFEPQISDF  318

Query  820   GLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS  641
             GLAKWLP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DS
Sbjct  319   GLAKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDS  378

Query  640   SRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVV  461
             S++SLVMWAKPLL  NNIK L DP L DAYD  +M+     A  C+      RP+M +V+
Sbjct  379   SQRSLVMWAKPLLSANNIKALVDPVLVDAYDEEQMKLVTLTASLCVDQSSIQRPDMSQVL  438

Query  460   EVLKGENEL------KVELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
             E+L+GE E+      + +++  ++ S E L   ++ ST +    DRH++ I+
Sbjct  439   EILRGEEEILSILKERSKVKLQRTYSEELLDAEEYNSTKFLSERDRHMETIL  490



>ref|XP_010941738.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Elaeis guineensis]
Length=456

 Score =   380 bits (976),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 200/394 (51%), Positives = 266/394 (68%), Gaps = 17/394 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDII--RKS-RRMFFSWSRCSEDNIDCGDFSITKPS  1301
             +WK  F   K++S +     P  G   +  RKS R      S  + D  +C      KP+
Sbjct  69    RWKGFFRFWKQQSMRRLSSFPPLGVPKLSRRKSNRETHVPISDSTTDYSNC----YFKPT  124

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             W+NFT+ EL +AT+NFS EN++GKGG+AEVYKG L +GQ++A+K + +    +      F
Sbjct  125   WKNFTISELQKATNNFSPENIIGKGGYAEVYKGSLENGQLVAIKMLTQGTADERTNS--F  182

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGII H++HPN AKLIG  A+ G++LVLQ   HGSL  LLH + E L W +R+K+A 
Sbjct  183   LSELGIIVHVDHPNTAKLIGVGAEGGMYLVLQLSSHGSLETLLHGSKEKLSWDVRYKIAT  242

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G A GL YLH  CQRRIIHRDI A+N+LLT+D+  QI DFGLA WLP+K  HH VS +EG
Sbjct  243   GAATGLEYLHERCQRRIIHRDIKAANVLLTDDFEPQICDFGLAMWLPDKLTHHTVSNLEG  302

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGY+APEY  HGIVDEKTDV+AFGVLLLELITGR AV+SS+QSLVMWAKPLLE+++IKE
Sbjct  303   TFGYLAPEYCTHGIVDEKTDVYAFGVLLLELITGRSAVNSSQQSLVMWAKPLLEKDDIKE  362

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVE----LRQS  413
             L DP L D+YD+ ++      A  CIQH   +RP M +V+++LKG+ E++ E    L +S
Sbjct  363   LVDPSLNDSYDIKQVRCVAQTAYMCIQHSSVLRPRMTQVLDLLKGK-EMQSESMKVLHKS  421

Query  412   ---KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                ++ S E     ++ +T Y   L +H +L ++
Sbjct  422   LIRRTYSVELFDAEEYNATRYLNDLTQHKKLALD  455



>ref|XP_004298085.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Fragaria vesca subsp. vesca]
Length=508

 Score =   382 bits (981),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 249/336 (74%), Gaps = 9/336 (3%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             K SW+N++L EL  AT+ F  EN++G+GG+AEVYKG L DGQ +A+KR+I+ + ++    
Sbjct  169   KSSWKNYSLSELEAATNKFDIENLIGEGGYAEVYKGTLEDGQFVAIKRLIRGNPEEMTAD  228

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FLSELG+I H++HPN AK+IG+  + G+HLVL   PHGSL+ +L+   E L W IR+K
Sbjct  229   --FLSELGVIVHVDHPNIAKVIGYGVEGGMHLVLDLSPHGSLSSILYGPREILNWGIRYK  286

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             VA+G A+GL YLH  CQRRIIH+DI ASNILL ED+  QISDFGLAKWLP++W HH+VS 
Sbjct  287   VALGTAKGLVYLHEGCQRRIIHKDIKASNILLAEDFEPQISDFGLAKWLPDQWTHHIVSK  346

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+ PE+FMHGIVDEKTDV+A+GVL+LELITGRQA+DSS +SLVMWAKPLL +NN
Sbjct  347   FEGTFGYLPPEFFMHGIVDEKTDVYAYGVLILELITGRQALDSSHKSLVMWAKPLLMKNN  406

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL--KVELRQ  416
             IKELADP L D YDV +M+    +A  C+Q     RP M+++V++L+G+ E    V+ RQ
Sbjct  407   IKELADPSLADGYDVEQMKCLASIASLCVQQSSVNRPQMRQIVQILEGDQESLDLVKKRQ  466

Query  415   -----SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                   ++ S E L   ++ ST Y   +D+HL+ I+
Sbjct  467   KSKKLQRTYSEELLDADEYNSTKYLTDMDKHLEFIL  502



>ref|XP_009386291.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Musa acuminata subsp. malaccensis]
Length=491

 Score =   381 bits (978),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/391 (50%), Positives = 264/391 (68%), Gaps = 10/391 (3%)
 Frame = -3

Query  1468  WKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDF-SITKPSWRN  1292
             W   F   K KS +     P  G     + RR          D+    D  S  KP+WRN
Sbjct  102   WHGFFRLWKHKSMRRLSSFPPIGFRKRSRRRRSNRDSRVPMPDSTSAADNESSFKPTWRN  161

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             FT+ EL +AT+NF+SENM+GKGG AE+Y+G L +GQ++AVK+I +   +++     FLSE
Sbjct  162   FTISELEKATNNFNSENMIGKGGSAEIYRGCLENGQLVAVKKITRGTTEEKTHN--FLSE  219

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             +G++ H++HPN A+LIG   + G+HLVL   PHGSLA LLH++ + L W IR+KVAVG A
Sbjct  220   MGVLVHVDHPNTARLIGVGVEGGMHLVLVLSPHGSLANLLHDSKDKLAWGIRYKVAVGTA  279

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
              GL YLH  C +RIIHRDI A+NILLTED+  QI DFGLAKWLP++  HH +   EGTFG
Sbjct  280   NGLEYLHERCHKRIIHRDIKAANILLTEDFEPQICDFGLAKWLPDEVTHHTLPSFEGTFG  339

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y+APEY MHG+VDEKTDVFAFG+LLLELI+GR+AV+SS+QSL+MWAKPLLEQN I++L D
Sbjct  340   YLAPEYCMHGVVDEKTDVFAFGILLLELISGRRAVNSSQQSLLMWAKPLLEQNRIRDLVD  399

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVE----LRQS---  413
             P LGD+YD  +M+R+   A  CIQH   +RP M +V+++L G +E + E    L +S   
Sbjct  400   PSLGDSYDSKQMDRAAKTAYICIQHSSVLRPRMSEVLKLLSGGDEGRAENGRALHRSFLR  459

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             ++ S E     ++ +T Y   + RH Q+  +
Sbjct  460   RTYSEEIFDAEEYNATRYLSDISRHKQIAFD  490



>ref|XP_010941737.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Elaeis guineensis]
Length=506

 Score =   380 bits (975),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 200/394 (51%), Positives = 266/394 (68%), Gaps = 17/394 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDII--RKS-RRMFFSWSRCSEDNIDCGDFSITKPS  1301
             +WK  F   K++S +     P  G   +  RKS R      S  + D  +C      KP+
Sbjct  119   RWKGFFRFWKQQSMRRLSSFPPLGVPKLSRRKSNRETHVPISDSTTDYSNC----YFKPT  174

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             W+NFT+ EL +AT+NFS EN++GKGG+AEVYKG L +GQ++A+K + +    +      F
Sbjct  175   WKNFTISELQKATNNFSPENIIGKGGYAEVYKGSLENGQLVAIKMLTQGTADERTNS--F  232

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             LSELGII H++HPN AKLIG  A+ G++LVLQ   HGSL  LLH + E L W +R+K+A 
Sbjct  233   LSELGIIVHVDHPNTAKLIGVGAEGGMYLVLQLSSHGSLETLLHGSKEKLSWDVRYKIAT  292

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G A GL YLH  CQRRIIHRDI A+N+LLT+D+  QI DFGLA WLP+K  HH VS +EG
Sbjct  293   GAATGLEYLHERCQRRIIHRDIKAANVLLTDDFEPQICDFGLAMWLPDKLTHHTVSNLEG  352

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGY+APEY  HGIVDEKTDV+AFGVLLLELITGR AV+SS+QSLVMWAKPLLE+++IKE
Sbjct  353   TFGYLAPEYCTHGIVDEKTDVYAFGVLLLELITGRSAVNSSQQSLVMWAKPLLEKDDIKE  412

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVE----LRQS  413
             L DP L D+YD+ ++      A  CIQH   +RP M +V+++LKG+ E++ E    L +S
Sbjct  413   LVDPSLNDSYDIKQVRCVAQTAYMCIQHSSVLRPRMTQVLDLLKGK-EMQSESMKVLHKS  471

Query  412   ---KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
                ++ S E     ++ +T Y   L +H +L ++
Sbjct  472   LIRRTYSVELFDAEEYNATRYLNDLTQHKKLALD  505



>emb|CDY47188.1| BnaAnng08580D [Brassica napus]
Length=493

 Score =   379 bits (972),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 193/396 (49%), Positives = 274/396 (69%), Gaps = 29/396 (7%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDN---------ID  1331
             PT   W+  F ++ +K + + P    F H  ++   ++    S+  +DN         +D
Sbjct  112   PTNGHWRG-FHRLLKKGSSAMPF-NTFSH--LKGVPKLTRRKSKRIKDNMVPVLPAAALD  167

Query  1330  CGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
               D  + KPSW+N++LQ++  AT+ +S EN++G+GG+AEVYKG + DGQ++AVK++ +  
Sbjct  168   TDDLLLFKPSWKNYSLQDIQTATNGYSPENLIGEGGYAEVYKGEMADGQIVAVKKLTRGS  227

Query  1150  kkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETL  971
              ++      +LSELGII H++HPN AKLIG+  + G+HLVL+  P+GSLA LL+ A E L
Sbjct  228   AEEMTMD--YLSELGIIVHVDHPNIAKLIGYCVEGGMHLVLELSPNGSLASLLYEAKEKL  285

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
              W IR+KVA+G AEGL+YLH  CQRRIIH+DI ASNILLTE++ AQISDFGLAKWLP++W
Sbjct  286   NWSIRYKVAMGTAEGLYYLHEGCQRRIIHKDIKASNILLTENFEAQISDFGLAKWLPDQW  345

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              HH VS +EGTFGY+ PE+FMHGIVDEKTDV+AFGVLLLELITG+QA+DSS+ S+VMWAK
Sbjct  346   THHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAFGVLLLELITGKQAIDSSQHSVVMWAK  405

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELK  431
             PL++ N IKEL DP LGD YD+ E++R +      ++ L   + ++ K+ E   GEN   
Sbjct  406   PLIKDNKIKELVDPILGDDYDLEELDRLV------VEILKGDKCSLDKLKE---GENS--  454

Query  430   VELRQSKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                +  ++ S E L   ++ ST Y   ++RH++ ++
Sbjct  455   ---KLQRTYSEELLDNEEYNSTKYLNDINRHMETVL  487



>ref|XP_008340874.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Malus domestica]
Length=504

 Score =   378 bits (970),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/341 (55%), Positives = 242/341 (71%), Gaps = 8/341 (2%)
 Frame = -3

Query  1327  GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
              DF   K SW+N++  EL  AT+NFS EN++G+GG+A+VYKG L DGQ++A+K + +  +
Sbjct  160   ADFCRFKSSWKNYSFLELQAATNNFSHENLIGEGGYADVYKGTLEDGQIVAIKCLTRGTQ  219

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             ++      FLSELG+I H++HPN AKLIG+  + G+HLVL   PHGSL+ +L+   E L+
Sbjct  220   EEMTAD--FLSELGVIVHVDHPNIAKLIGYGVEGGMHLVLHLSPHGSLSSILYGPRENLD  277

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W IR+KVA+G A+GL YLH  CQRRIIH+DI ASNILL ED+   ISDFGLAKWLP+ W 
Sbjct  278   WXIRYKVALGTAKGLLYLHEGCQRRIIHKDIKASNILLAEDFEPLISDFGLAKWLPDSWT  337

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HH VS  EGTFGY+ PE+FMHGIVDEKTDV+A+GVL+LELITGRQA+D S +SLVMWAKP
Sbjct  338   HHXVSKFEGTFGYLPPEFFMHGIVDEKTDVYAYGVLILELITGRQALDRSHKSLVMWAKP  397

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG-ENELK  431
             LL  NN+ EL DP LGDAYD+ EM+R +  A  CI      RP M ++VE+L+G E  L+
Sbjct  398   LLSMNNMNELVDPXLGDAYDLKEMKRLVLTASFCIHQSSVNRPQMSQIVEILEGDEGSLE  457

Query  430   VELRQSKS-----VSSESLHIADFTSTSYRKHLDRHLQLIM  323
                ++ KS      S E L   D+ ST      ++ L+ I+
Sbjct  458   YATKRQKSKLQRTYSEELLDADDYNSTKCLSDREKQLEFIL  498



>ref|XP_008790289.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Phoenix dactylifera]
Length=506

 Score =   378 bits (970),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 196/391 (50%), Positives = 257/391 (66%), Gaps = 13/391 (3%)
 Frame = -3

Query  1468  WKSIFDQIKRKSAKSFPIVPLFGHDII--RKSRRMFFSWSRCSEDNIDCGDFSITKPSWR  1295
             WK  F   K+KS +     P  G   +  RKS R          DN    D    KPSW+
Sbjct  120   WKGFFRFWKQKSMRRLSSFPPLGVPKLSRRKSNRETHG---PRSDNTTDYDNCCFKPSWK  176

Query  1294  NFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLS  1115
             NFTL EL +AT+NF  EN++GKGG+AEVYKG L DGQ++A+K++ +    +  +   FLS
Sbjct  177   NFTLSELQKATNNFRPENIIGKGGYAEVYKGSLEDGQLVAIKKLTQGTADERTKN--FLS  234

Query  1114  ELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGV  935
             ELGII H+NHPN AKLIG   + G++LVLQ   HGSL  LLH + + L W +R+K+A G 
Sbjct  235   ELGIIVHLNHPNTAKLIGVGTEGGMYLVLQLSSHGSLETLLHGSKDKLNWDVRYKIATGT  294

Query  934   AEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTF  755
             A GL YLH  CQ+RIIHRDI A+N+LLT+D+  QI DFGLA WLP+K  HH +S  EGTF
Sbjct  295   ATGLEYLHERCQKRIIHRDIKAANVLLTDDFEPQICDFGLAMWLPDKLTHHTLSNFEGTF  354

Query  754   GYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELA  575
             GY+APEY  HGIVDEKTDV+AFGVLLLELITGR+A+++S+QSLVMWAKPLLE+N IKEL 
Sbjct  355   GYLAPEYCTHGIVDEKTDVYAFGVLLLELITGRRAINASQQSLVMWAKPLLEKNEIKELV  414

Query  574   DPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ------S  413
             DP L DAYD+ ++      A  CIQH   +RP M +V+++L+GE      ++        
Sbjct  415   DPFLNDAYDLKQVRCVAQTAYMCIQHSSVLRPQMSQVLKLLEGEQMRSESMKGIHKPLIR  474

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
             ++ S E     ++ +T Y   L +H +L ++
Sbjct  475   RTYSEELFDAEEYNATRYLNALTQHKKLALD  505



>ref|XP_006846528.1| hypothetical protein AMTR_s00018p00192760 [Amborella trichopoda]
 gb|ERN08203.1| hypothetical protein AMTR_s00018p00192760 [Amborella trichopoda]
Length=550

 Score =   379 bits (974),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 206/398 (52%), Positives = 266/398 (67%), Gaps = 18/398 (5%)
 Frame = -3

Query  1486  DPTAV-QWKSIFDQIKRKSAKSFPIVPLFGHDII----RKSRRMFFSWSRCSEDNIDCGD  1322
             +P+ + QW++ F   K++S + F   P  G         +SR +     + S D   C  
Sbjct  138   NPSPISQWRAFFRLWKQRSIRRFSTFPHIGVPKFPTRKHRSRDICLRSPKSSCDAKLC--  195

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
                +KPSW+NFTL EL  AT+NF++EN++GKGGHAEVYKG L DGQ++AVKR+     ++
Sbjct  196   --CSKPSWKNFTLLELQNATNNFNAENLIGKGGHAEVYKGCLDDGQLVAVKRLTWGTMEE  253

Query  1141  eerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWK  962
                   FLSE+GII HINHPNAA LIGF  + GLHLVLQ  P GSL  +LH + E   W 
Sbjct  254   RTGD--FLSEIGIIVHINHPNAAHLIGFGVEGGLHLVLQLSPCGSLESMLHGSKEKPNWS  311

Query  961   IRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHH  782
             IR+KVA+GVA+GL YLH  C RRIIHRDI ASNILLTED+ AQI+DFGLAKWLP +  H 
Sbjct  312   IRYKVALGVAKGLQYLHDSCPRRIIHRDIKASNILLTEDFEAQIADFGLAKWLPNQLTHL  371

Query  781   VVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLL  602
              VS  EGTFGYMAPEYFMHG+VDEKTDVF+FGVLLLELITGR+A+DSS++SLVMWA PL+
Sbjct  372   TVSQFEGTFGYMAPEYFMHGVVDEKTDVFSFGVLLLELITGRRAIDSSQKSLVMWATPLI  431

Query  601   EQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL  422
             E  NI  L DP LG+ Y++ +M+  +  A  CIQ+   +RP M +VV +L GE       
Sbjct  432   ETRNIMALVDPCLGNDYNMQQMKLVVSTASMCIQY-SILRPCMSQVVHLLVGEEGSSKSD  490

Query  421   RQ------SKSVSSESLHIADFTSTSYRKHLDRHLQLI  326
             +Q      S++ S+       ++  SY  +L +H +L+
Sbjct  491   KQVQNPIFSRTFSAGQFEGEGYSLRSYTNNLRQHKELV  528



>ref|XP_006361909.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Solanum tuberosum]
Length=456

 Score =   374 bits (961),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/391 (50%), Positives = 257/391 (66%), Gaps = 13/391 (3%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
             T+ +W   F   KR S K  P  P      +   +      SR + +N+  G +  T  S
Sbjct  68    TSSRWHKFFKMWKRSSVKRLPSFPPLAVPTMSTRK------SRSARENVAAGIYHFTS-S  120

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             W+NF+L EL  AT+NFS EN +GKGG+AEVYKG L DGQ+IAVKR+ K  +  +E+   F
Sbjct  121   WKNFSLSELKIATNNFSIENFIGKGGYAEVYKGCLPDGQLIAVKRLNKGTEAQQEQS--F  178

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             L E+G IAH++HPN A+++G+  + G +LVLQ    GSL   L  + E L+W  R+K+  
Sbjct  179   LCEIGTIAHVDHPNTARMVGYGVEGGTYLVLQLSSQGSLGSFLRGSREKLDWAARYKIIF  238

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EG
Sbjct  239   GIANGLMYLHENCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKEWTHHNVGKFEG  298

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGY APEYFMHG VDEKTDVF+FGVLLLE+ITGRQA+D S+QSLV+WAKPLL ++NIKE
Sbjct  299   TFGYFAPEYFMHGTVDEKTDVFSFGVLLLEIITGRQALDDSQQSLVIWAKPLLHKHNIKE  358

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE-LKVELRQSKSV  404
             L DP LGD Y+  EM R +  A  C++  P MRP M + + ++K E++  K    + ++ 
Sbjct  359   LIDPVLGDNYNPKEMNRVIITAGLCVEQNPLMRPRMNQAIVLMKTEDDYYKQNFLRKRTY  418

Query  403   SSESLHIADFTSTSYRKHLDRHLQLIME*SI  311
             S E L  A++ ST   K L+   QL +  S+
Sbjct  419   SEELLDAAEYNST---KCLNEFKQLNLRSSV  446



>ref|XP_010312381.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Solanum lycopersicum]
Length=470

 Score =   374 bits (961),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 189/373 (51%), Positives = 250/373 (67%), Gaps = 10/373 (3%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
             T+ +W   F   KR S K  P  P      +   +      SR + +N+  G +  T  S
Sbjct  82    TSSRWHKFFKMWKRSSVKRLPSFPPLAVPTMSTRK------SRSARENVAAGIYHFTS-S  134

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             W+NF+L EL  AT+NFS +N++GKGG+AEVYKG L DGQ+IAVK + K  +  +E+   F
Sbjct  135   WKNFSLSELKSATNNFSKDNLIGKGGYAEVYKGCLPDGQLIAVKCLNKGTEAQQEQS--F  192

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             L E+G IAH++HPN A+++G+  + G +LVLQ    GSL   L  + E L+W  R+K+  
Sbjct  193   LCEIGTIAHVDHPNTARMVGYGVEGGTYLVLQLSSQGSLGSFLRGSREKLDWAARYKIIF  252

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EG
Sbjct  253   GIANGLMYLHENCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKEWTHHNVGKFEG  312

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGY APEYFMHG VDEKTDVF+FGVLLLE+ITGRQA+D S+QSLV+WAKPLL ++N+KE
Sbjct  313   TFGYFAPEYFMHGTVDEKTDVFSFGVLLLEIITGRQALDDSQQSLVIWAKPLLHKHNVKE  372

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL-KVELRQSKSV  404
             L DP LGD Y+  EM R +  A  C++  P MRP M + + ++K E++  K   ++ ++ 
Sbjct  373   LIDPVLGDNYNPKEMNRVIITAGLCVEQNPLMRPRMNQAIVLMKTEDDCYKHNFQRKRTY  432

Query  403   SSESLHIADFTST  365
             S E L  A++ ST
Sbjct  433   SEELLDAAEYNST  445



>ref|XP_010312379.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Solanum lycopersicum]
Length=477

 Score =   374 bits (960),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 189/373 (51%), Positives = 250/373 (67%), Gaps = 10/373 (3%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPS  1301
             T+ +W   F   KR S K  P  P      +   +      SR + +N+  G +  T  S
Sbjct  89    TSSRWHKFFKMWKRSSVKRLPSFPPLAVPTMSTRK------SRSARENVAAGIYHFTS-S  141

Query  1300  WRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDF  1121
             W+NF+L EL  AT+NFS +N++GKGG+AEVYKG L DGQ+IAVK + K  +  +E+   F
Sbjct  142   WKNFSLSELKSATNNFSKDNLIGKGGYAEVYKGCLPDGQLIAVKCLNKGTEAQQEQS--F  199

Query  1120  LSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAV  941
             L E+G IAH++HPN A+++G+  + G +LVLQ    GSL   L  + E L+W  R+K+  
Sbjct  200   LCEIGTIAHVDHPNTARMVGYGVEGGTYLVLQLSSQGSLGSFLRGSREKLDWAARYKIIF  259

Query  940   GVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEG  761
             G+A GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EG
Sbjct  260   GIANGLMYLHENCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKEWTHHNVGKFEG  319

Query  760   TFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKE  581
             TFGY APEYFMHG VDEKTDVF+FGVLLLE+ITGRQA+D S+QSLV+WAKPLL ++N+KE
Sbjct  320   TFGYFAPEYFMHGTVDEKTDVFSFGVLLLEIITGRQALDDSQQSLVIWAKPLLHKHNVKE  379

Query  580   LADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENEL-KVELRQSKSV  404
             L DP LGD Y+  EM R +  A  C++  P MRP M + + ++K E++  K   ++ ++ 
Sbjct  380   LIDPVLGDNYNPKEMNRVIITAGLCVEQNPLMRPRMNQAIVLMKTEDDCYKHNFQRKRTY  439

Query  403   SSESLHIADFTST  365
             S E L  A++ ST
Sbjct  440   SEELLDAAEYNST  452



>ref|XP_008455275.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Cucumis melo]
Length=483

 Score =   374 bits (960),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 259/388 (67%), Gaps = 16/388 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
              WK+ F   K++S +     P  G  +++ SRR     +R   +N    D    K S  N
Sbjct  101   HWKNFFKLWKKRSFRRLASFPPLG--VLKISRR----GNRSGRENPGLSDLYKFKSSLGN  154

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             FT  EL  AT+ FS EN++GKGG+AEVYKGRL DGQ+IAVKR+ K    +      FLSE
Sbjct  155   FTFSELQTATNKFSPENLIGKGGYAEVYKGRLHDGQLIAVKRLTKGAPDERTAC--FLSE  212

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLH--NATETLEWKIRFKVAVG  938
             +GIIAHI+HPN AKLIG S D G+HLV +  P+GSL   LH  NA + L+W  R+K+A+G
Sbjct  213   IGIIAHIDHPNTAKLIGCSIDGGMHLVFKLSPNGSLGSFLHGPNANK-LDWSKRYKIALG  271

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W H+ VS  EGT
Sbjct  272   TADGLLYLHDHCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKQWTHYSVSKFEGT  331

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEYFMHGIVDEKTDV++FGVLLLELITGR+A+D   QSLV+WAKPLL+ NN +E+
Sbjct  332   FGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRRALDELCQSLVLWAKPLLDNNNHEEV  391

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELK-----VELRQS  413
              DP L ++YD+ E+ER +  A  CI+  P +RP M +VV +L+G+  +K       +   
Sbjct  392   IDPALKESYDLEEVERMILTASLCIEQSPILRPRMSQVVVLLRGDKYVKECEKGTRVPLQ  451

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQL  329
             ++ S E L   ++  T Y   L +H QL
Sbjct  452   RTYSEELLDAQEYNKTRYLSDLKKHRQL  479



>ref|XP_010914352.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Elaeis guineensis]
Length=510

 Score =   374 bits (960),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 255/389 (66%), Gaps = 9/389 (2%)
 Frame = -3

Query  1468  WKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRNF  1289
             WK  F   K+KS +     P  G   + + +    +    S    DC D    KPSW+NF
Sbjct  124   WKGFFLFWKQKSMRRLSSFPPLGVPKLSRKKSSRETHDPRSNTTTDC-DNCCFKPSWKNF  182

Query  1288  TLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSEL  1109
             TL EL +AT+NF  EN++GKGG+A+VYKG L DGQ++A+K++ +    +  +   FLSEL
Sbjct  183   TLSELQKATNNFKPENIIGKGGYAKVYKGSLEDGQLVAIKKLTRGTADERTKN--FLSEL  240

Query  1108  GIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAE  929
             GII H+NHPN AKLIG   + G++LVLQ   HGSL  LL  + E L W +R+K+A+G A 
Sbjct  241   GIIVHVNHPNTAKLIGVGTEGGMYLVLQLSSHGSLETLLCGSKEKLNWDVRYKIAMGTAT  300

Query  928   GLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGY  749
             GL YLH  CQ+RIIHRDI A+N+LLT+DY  QI DFGLA WLP+K  H  VS  EGTFGY
Sbjct  301   GLEYLHERCQKRIIHRDIKAANVLLTDDYEPQICDFGLAMWLPDKLTHQTVSNFEGTFGY  360

Query  748   MAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADP  569
             +APEY  HGIVDEKTDV+AFGVLLLELITG +A++SS+QSLVMWAKPLLE+N+IKEL DP
Sbjct  361   LAPEYCTHGIVDEKTDVYAFGVLLLELITGHRAINSSQQSLVMWAKPLLEKNDIKELVDP  420

Query  568   RLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ------SKS  407
              L DAYD+ ++     +A  CIQH   +RP M +V+ +L G+      ++        ++
Sbjct  421   FLNDAYDLEQVRSLAQIAYMCIQHSSVLRPRMSQVLMLLDGKQRQSEPMKVIHKPLIRRT  480

Query  406   VSSESLHIADFTSTSYRKHLDRHLQLIME  320
              S E     ++ +T Y   L +H +L ++
Sbjct  481   YSEELFDAEEYNATRYLNDLTQHKKLALD  509



>ref|XP_010914353.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Elaeis guineensis]
Length=506

 Score =   373 bits (958),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 255/389 (66%), Gaps = 9/389 (2%)
 Frame = -3

Query  1468  WKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRNF  1289
             WK  F   K+KS +     P  G   + + +    +    S    DC D    KPSW+NF
Sbjct  120   WKGFFLFWKQKSMRRLSSFPPLGVPKLSRKKSSRETHDPRSNTTTDC-DNCCFKPSWKNF  178

Query  1288  TLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSEL  1109
             TL EL +AT+NF  EN++GKGG+A+VYKG L DGQ++A+K++ +    +  +   FLSEL
Sbjct  179   TLSELQKATNNFKPENIIGKGGYAKVYKGSLEDGQLVAIKKLTRGTADERTKN--FLSEL  236

Query  1108  GIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAE  929
             GII H+NHPN AKLIG   + G++LVLQ   HGSL  LL  + E L W +R+K+A+G A 
Sbjct  237   GIIVHVNHPNTAKLIGVGTEGGMYLVLQLSSHGSLETLLCGSKEKLNWDVRYKIAMGTAT  296

Query  928   GLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGY  749
             GL YLH  CQ+RIIHRDI A+N+LLT+DY  QI DFGLA WLP+K  H  VS  EGTFGY
Sbjct  297   GLEYLHERCQKRIIHRDIKAANVLLTDDYEPQICDFGLAMWLPDKLTHQTVSNFEGTFGY  356

Query  748   MAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADP  569
             +APEY  HGIVDEKTDV+AFGVLLLELITG +A++SS+QSLVMWAKPLLE+N+IKEL DP
Sbjct  357   LAPEYCTHGIVDEKTDVYAFGVLLLELITGHRAINSSQQSLVMWAKPLLEKNDIKELVDP  416

Query  568   RLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ------SKS  407
              L DAYD+ ++     +A  CIQH   +RP M +V+ +L G+      ++        ++
Sbjct  417   FLNDAYDLEQVRSLAQIAYMCIQHSSVLRPRMSQVLMLLDGKQRQSEPMKVIHKPLIRRT  476

Query  406   VSSESLHIADFTSTSYRKHLDRHLQLIME  320
              S E     ++ +T Y   L +H +L ++
Sbjct  477   YSEELFDAEEYNATRYLNDLTQHKKLALD  505



>ref|XP_004139200.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Cucumis sativus]
Length=456

 Score =   371 bits (953),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 257/388 (66%), Gaps = 16/388 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
              WK+ F   K++S +     P  G  +++ SRR     +R   +N    D    K S  N
Sbjct  74    HWKNFFKLWKKRSFRRLASFPPLG--VLKISRR----GNRSGRENPGLSDLYKFKSSLGN  127

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             FT  EL  AT+ FS EN++GKGG+AEVYKGRL DGQ+IAVKR+ K    D      FLSE
Sbjct  128   FTFSELQTATNKFSHENLIGKGGYAEVYKGRLHDGQLIAVKRLTKGAPDDRTAC--FLSE  185

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLH--NATETLEWKIRFKVAVG  938
             +GIIAHI+HPN AKLIG   D G+HLV +  P+GSL   LH  NA + L+W  R+K+A+G
Sbjct  186   IGIIAHIDHPNTAKLIGCGIDGGMHLVFKLSPNGSLGSFLHGPNANK-LDWSKRYKIALG  244

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W H+ VS  EGT
Sbjct  245   TADGLLYLHDHCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKQWTHYSVSKFEGT  304

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEYFMHGIVDEKTDV++FGVLLLEL+TGR+A+D   QSLV+WAKPLL+ NN +E+
Sbjct  305   FGYFAPEYFMHGIVDEKTDVYSFGVLLLELVTGRRALDELCQSLVLWAKPLLDNNNHEEV  364

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG-----ENELKVELRQS  413
              DP L ++YD+ E+ER +  A  CI+  P +RP M +VV +L+G     E E    +   
Sbjct  365   IDPALKESYDLEEVERMILTASLCIEQSPILRPRMSQVVVLLRGDKYVAECEKSTRVPLQ  424

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQL  329
             ++ S E L   ++  T Y   L +H QL
Sbjct  425   RTYSEELLDAQEYNKTRYLSDLKKHRQL  452



>ref|XP_004156435.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Cucumis sativus]
Length=456

 Score =   371 bits (953),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 257/388 (66%), Gaps = 16/388 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
              WK+ F   K++S +     P  G  +++ SRR     +R   +N    D    K S  N
Sbjct  74    HWKNFFKLWKKRSFRRLASFPPLG--VLKISRR----GNRSGRENPGLSDLYKFKSSLGN  127

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             FT  EL  AT+ FS EN++GKGG+AEVYKGRL DGQ+IAVKR+ K    D      FLSE
Sbjct  128   FTFSELQTATNKFSHENLIGKGGYAEVYKGRLHDGQLIAVKRLTKGAPDDRTAC--FLSE  185

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLH--NATETLEWKIRFKVAVG  938
             +GIIAHI+HPN AKLIG   D G+HLV +  P+GSL   LH  NA + L+W  R+K+A+G
Sbjct  186   IGIIAHIDHPNTAKLIGCGIDGGMHLVFKLSPNGSLGSFLHGPNANK-LDWSKRYKIALG  244

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W H+ VS  EGT
Sbjct  245   TADGLLYLHDHCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKQWTHYSVSKFEGT  304

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEYFMHGIVDEKTDV++FGVLLLEL+TGR+A+D   QSLV+WAKPLL+ NN +E+
Sbjct  305   FGYFAPEYFMHGIVDEKTDVYSFGVLLLELVTGRRALDELCQSLVLWAKPLLDNNNHEEV  364

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG-----ENELKVELRQS  413
              DP L ++YD+ E+ER +  A  CI+  P +RP M +VV +L+G     E E    +   
Sbjct  365   IDPALKESYDLEEVERMILTASLCIEQSPILRPRMSQVVVLLRGDKYLAECEKSTRVPLQ  424

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQL  329
             ++ S E L   ++  T Y   L +H QL
Sbjct  425   RTYSEELLDAQEYNKTRYLSDLKKHRQL  452



>ref|XP_009418073.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Musa acuminata subsp. malaccensis]
Length=446

 Score =   370 bits (951),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 189/392 (48%), Positives = 259/392 (66%), Gaps = 10/392 (3%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSR--RMFFSWSRCSEDNIDCGDFSITKPSW  1298
             +W+ +F   K+KS +     P  G     K R  R          D     DF   +P+W
Sbjct  56    RWQGLFRLWKQKSMRRLSSFPPVGFRKWSKKRGNRDAHPSPASRPDAHPAADFCFFRPTW  115

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             +NFT+ EL +ATDNFS EN +GKGG+A++Y+GRL +G+++AVKRI +  K +      FL
Sbjct  116   KNFTISELEKATDNFSPENKIGKGGYADIYRGRLENGRLVAVKRISRGTKDERTHN--FL  173

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
              E+GI+ H++HPN AKLIG   + G+HLV +   HGSL  LLH++ + L W++R+K+A+G
Sbjct  174   CEMGILVHLHHPNIAKLIGVGVEGGMHLVFELSHHGSLENLLHDSKDKLAWEVRYKIAIG  233

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  CQRRIIHRDI   NILLTED+  QI DFGLAKWLP++  HH +S  EGT
Sbjct  234   AAKGLEYLHERCQRRIIHRDIKVDNILLTEDFEPQICDFGLAKWLPDEVTHHTLSSFEGT  293

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY+APEY  HG+VDEKTDVFAFG+LLLELITGR+AVDSS++SL+MWAKP+LE+N +K+L
Sbjct  294   FGYVAPEYCTHGVVDEKTDVFAFGILLLELITGRRAVDSSQKSLLMWAKPVLEENKVKDL  353

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQ------  416
              DP LGD+YD  ++  +   A  CIQ+   +RP M +V+ +L+GE      +R       
Sbjct  354   VDPLLGDSYDCKQLLFAARTAFMCIQYSSVLRPRMSQVLRILRGEEGRSDNVRVLQKPFI  413

Query  415   SKSVSSESLHIADFTSTSYRKHLDRHLQLIME  320
              ++ S   L   ++ ST Y K + RH Q+  +
Sbjct  414   RRTFSEGILDAEEYNSTRYLKDITRHKQIAFD  445



>gb|KFK24185.1| hypothetical protein AALP_AAs68745U000500 [Arabis alpina]
Length=394

 Score =   369 bits (946),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 190/366 (52%), Positives = 258/366 (70%), Gaps = 16/366 (4%)
 Frame = -3

Query  1498  GGGFDPTAVQ---WKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCS--EDNI  1334
             G   +PT  Q   ++ I   ++ +S KS     L  ++ I+ S R      RCS   DN+
Sbjct  21    GPSSEPTKNQSSRFRKIVQLLRSRSKKSLE--NLKNNNAIKSSLR------RCSSMRDNL  72

Query  1333  DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriike  1154
               G   +       FT  +L  AT+NF+ +N++GKGG+AEVYKGRL +GQ++A+KR+++ 
Sbjct  73    RFGSTHLLLSPRSIFTFSDLKFATNNFALDNLIGKGGYAEVYKGRLSNGQMVAIKRLMRG  132

Query  1153  dkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATET  974
             + ++      FLSE+GI+AH+NHPN AKL+G+  + G+HLVL+  PHGSLA +L+N+ E 
Sbjct  133   NSEENIVD--FLSEMGIMAHVNHPNIAKLLGYGIEGGMHLVLELSPHGSLASMLYNSKEK  190

Query  973   LEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEK  794
             ++W IR+K+A+GVAEGL YLH  C RRIIHRDI A+NILLT D+  QI DFGLAKWLPE+
Sbjct  191   MKWSIRYKIALGVAEGLVYLHSGCHRRIIHRDIKAANILLTHDFSPQICDFGLAKWLPEQ  250

Query  793   WGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWA  614
             W HHVVS  EGTFGY+APEY  HGIVDEKTDVFA GVLLLEL+TGR+A+D SRQSLV+WA
Sbjct  251   WTHHVVSKFEGTFGYLAPEYLTHGIVDEKTDVFALGVLLLELVTGRRALDYSRQSLVLWA  310

Query  613   KPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE-NE  437
             KPL+++N I+EL DP L D Y++ +++  +  A   IQ     RP M +VVE+LKG+ N+
Sbjct  311   KPLMKKNKIRELIDPSLADDYELTQIKLVLLAASLSIQQSSIQRPEMSQVVEILKGKLND  370

Query  436   LKVELR  419
             LK  ++
Sbjct  371   LKCIMK  376



>gb|KGN60861.1| hypothetical protein Csa_2G015850 [Cucumis sativus]
Length=485

 Score =   371 bits (953),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 257/388 (66%), Gaps = 16/388 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
              WK+ F   K++S +     P  G  +++ SRR     +R   +N    D    K S  N
Sbjct  103   HWKNFFKLWKKRSFRRLASFPPLG--VLKISRR----GNRSGRENPGLSDLYKFKSSLGN  156

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             FT  EL  AT+ FS EN++GKGG+AEVYKGRL DGQ+IAVKR+ K    D      FLSE
Sbjct  157   FTFSELQTATNKFSHENLIGKGGYAEVYKGRLHDGQLIAVKRLTKGAPDDRTAC--FLSE  214

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLH--NATETLEWKIRFKVAVG  938
             +GIIAHI+HPN AKLIG   D G+HLV +  P+GSL   LH  NA + L+W  R+K+A+G
Sbjct  215   IGIIAHIDHPNTAKLIGCGIDGGMHLVFKLSPNGSLGSFLHGPNANK-LDWSKRYKIALG  273

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W H+ VS  EGT
Sbjct  274   TADGLLYLHDHCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKQWTHYSVSKFEGT  333

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEYFMHGIVDEKTDV++FGVLLLEL+TGR+A+D   QSLV+WAKPLL+ NN +E+
Sbjct  334   FGYFAPEYFMHGIVDEKTDVYSFGVLLLELVTGRRALDELCQSLVLWAKPLLDNNNHEEV  393

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG-----ENELKVELRQS  413
              DP L ++YD+ E+ER +  A  CI+  P +RP M +VV +L+G     E E    +   
Sbjct  394   IDPALKESYDLEEVERMILTASLCIEQSPILRPRMSQVVVLLRGDKYVAECEKSTRVPLQ  453

Query  412   KSVSSESLHIADFTSTSYRKHLDRHLQL  329
             ++ S E L   ++  T Y   L +H QL
Sbjct  454   RTYSEELLDAQEYNKTRYLSDLKKHRQL  481



>ref|XP_002270886.3| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Vitis vinifera]
 ref|XP_010652097.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Vitis vinifera]
 emb|CBI32304.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   369 bits (947),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 196/381 (51%), Positives = 254/381 (67%), Gaps = 32/381 (8%)
 Frame = -3

Query  1507  GGSGGGFDP-TAVQWKSIFDQIKRKSAKSFPIVP---LFGHDIIRKSRRMFFSWSRCSED  1340
             G SG G    T   W+ +   ++ +S +    +    ++ + + RK R M FS       
Sbjct  32    GTSGSGSSQNTKPTWRGLIQLLRTQSKRRLATLDPRNVWKYSV-RKCRSMRFS--NGVGR  88

Query  1339  NIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkrii  1160
             N+D    S ++  W+NFTL EL +AT NFS EN++GKGG+AEVYKG L DGQ++AVKR++
Sbjct  89    NLDGETVSYSRSGWKNFTLSELQRATKNFSHENLIGKGGYAEVYKGCLQDGQLVAVKRLV  148

Query  1159  kedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT  980
             +   ++      FLSELGI+AH+NHPN AKLIG+  + GLHLVL+  PHGSLA LLH   
Sbjct  149   RGKPEERTGN--FLSELGIMAHVNHPNTAKLIGYGVEGGLHLVLELSPHGSLASLLHGGR  206

Query  979   ETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLP  800
               L+W +R++VA+G+AEGL YLH  CQRR IHRDI ASNILLTED+  QI DFGLAKWLP
Sbjct  207   VKLKWSMRYQVALGIAEGLLYLHEGCQRRFIHRDIKASNILLTEDFQPQICDFGLAKWLP  266

Query  799   EKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVM  620
             E+W HH +S  EGTFGY+APEY MHGIVDEKTDV+AFGVLLLELITGR+A++ S++SLV 
Sbjct  267   EQWTHHTISSFEGTFGYLAPEYLMHGIVDEKTDVYAFGVLLLELITGRRALECSQRSLVT  326

Query  619   WAKPLLEQNNIKELADPRLGDA-----------------------YDVVEMERSMFVALS  509
             WAKPLL++N+I+EL DP L D                        Y+  +M   +  A  
Sbjct  327   WAKPLLKKNDIQELVDPFLADDQYNSRQMKTQIQELVDPFLADDHYNSQQMNLLVLSASL  386

Query  508   CIQHLPNMRPNMKKVVEVLKG  446
             CIQ    +RP M++VVE+LKG
Sbjct  387   CIQRSSILRPQMRQVVEILKG  407



>gb|KCW60918.1| hypothetical protein EUGRSUZ_H03652 [Eucalyptus grandis]
Length=507

 Score =   372 bits (954),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 242/347 (70%), Gaps = 18/347 (5%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSED---------NIDCGDF  1319
             +W+     +K+ S   F   PL    + + +RR     +R  ED         + + GD 
Sbjct  110   KWRGFLRTLKKGSPVRFHTFPL--KSVPKLTRR---KSTRIREDMVPAFHASLDTELGDL  164

Query  1318  SITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkde  1139
             S  KPSWRNFTL EL  ATDNFS +N++G+GG AEVYKG L  G+++A+KR+ +   ++ 
Sbjct  165   SYFKPSWRNFTLIELQDATDNFSRDNLIGEGGCAEVYKGMLPGGEIVAIKRLTRGSPEEM  224

Query  1138  erieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT--ETLEW  965
                  FLSELGII H++HPN AKLIG+  + G+HL+L   PHGSLA LL+ A   E L+W
Sbjct  225   TAD--FLSELGIIVHVDHPNIAKLIGYGVEGGMHLILHLSPHGSLASLLYVAGSGEKLDW  282

Query  964   KIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGH  785
              IR+KVA+G AEGL YLH  CQRRIIH+D+ A+NILL+ED+  QISDFGLAKWLPE+W H
Sbjct  283   GIRYKVALGTAEGLMYLHEECQRRIIHKDVKAANILLSEDFEPQISDFGLAKWLPEQWSH  342

Query  784   HVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPL  605
             H+VS IEGTFGY+ PEYFMHGIVDEKTDV+A+GVLLLELITG++A+DSS++SLVMWAKPL
Sbjct  343   HIVSQIEGTFGYLPPEYFMHGIVDEKTDVYAYGVLLLELITGQKALDSSQKSLVMWAKPL  402

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKV  464
             L  N IKE  DP LG AY+  +M+R +  A  C  H    RP M + 
Sbjct  403   LSDNRIKEFVDPSLGGAYNSEQMDRLILAASLCTHHSSIHRPQMSQA  449



>gb|KHN37534.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Glycine soja]
Length=493

 Score =   371 bits (952),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 202/412 (49%), Positives = 264/412 (64%), Gaps = 46/412 (11%)
 Frame = -3

Query  1504  GSGGGFDPTAVQWKSIFDQIKRKSAKSF-PIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC  1328
             GS  G   T  QW+  F  +K+ S   F P  PL   ++ + +RR      R  ED I  
Sbjct  97    GSFAGAPNTNNQWRGFFKLLKKGSQMPFQPFHPL--KNVPKLTRR---KSKRIREDLIPS  151

Query  1327  -----------GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQV  1181
                         +F   K SW+NFTL E+  AT++FS EN++G+GG+AEVY G+L DG  
Sbjct  152   LNSPALHASFDAEFGCFKSSWKNFTLAEIQAATNDFSHENLIGEGGYAEVYLGKLEDGNF  211

Query  1180  IAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLA  1001
             +A+KR+ +  +++      FLSELGII H++HPN A+LIG+  + G+ LVLQ  PHGSL+
Sbjct  212   VAIKRLTRGCQEEMTAD--FLSELGIIVHVDHPNIARLIGYGVEGGMFLVLQLSPHGSLS  269

Query  1000  FLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDF  821
              +L+   E L W +R+K+A+G AEGL YLH  CQRRIIH+DI ASNILL+ED+  QISDF
Sbjct  270   SILYGPREKLNWNLRYKIALGTAEGLRYLHEECQRRIIHKDIKASNILLSEDFEPQISDF  329

Query  820   GLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDS  641
             GLAKWLP++W HH VS +EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGRQA+DS
Sbjct  330   GLAKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDS  389

Query  640   SRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVV  461
             S++SLVMWAKPLL  NNIKEL DP L DAYD                        MK V 
Sbjct  390   SQKSLVMWAKPLLTANNIKELVDPVLADAYD---------------------EEQMKLVF  428

Query  460   EVLKGENE-LKVELRQSKS-----VSSESLHIADFTSTSYRKHLDRHLQLIM  323
             ++L+GE E L++   +SKS      S E     ++ ST +    DRH++ I+
Sbjct  429   DILRGEEESLRIMEERSKSKLQRTYSEELFDAEEYNSTKFLSERDRHMETIL  480



>ref|XP_009772261.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Nicotiana sylvestris]
Length=410

 Score =   368 bits (944),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 250/360 (69%), Gaps = 11/360 (3%)
 Frame = -3

Query  1498  GGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNI-----  1334
             G     +A +W    +  + KS   F   PL     ++ S+R   S    S  ++     
Sbjct  38    GPKIQTSASRWTGFLELFRSKSKGHFAKDPLISS--LKLSKRFSRSMRETSSSSVMPNPI  95

Query  1333  -DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
              D G  S  KP W+ FTL EL  AT+NF  EN++GKGG+AEV+KGRL +GQ IAVKR+++
Sbjct  96    LDNG-LSYFKPQWKLFTLSELQTATNNFHQENLIGKGGYAEVHKGRLRNGQYIAVKRLMR  154

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
               + +      FLSELGI+AHINHPN AKLIG++ D GL LVL+  P+GSLA +LH + +
Sbjct  155   GQQDERIGD--FLSELGIMAHINHPNTAKLIGYAVDGGLFLVLELSPYGSLANMLHASKQ  212

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              LEWKIR+KVA+G+AEGL YLH   QRRIIHRDI A+NILLT+D   QI DFGLAKWLPE
Sbjct  213   KLEWKIRYKVAIGIAEGLLYLHEGGQRRIIHRDIKAANILLTKDLEPQICDFGLAKWLPE  272

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W H  +S  EGTFGY+APE+ MHGIVDEKTDVFAFGVLLLELITGR+A+D S+QSLV+W
Sbjct  273   RWTHLTISKFEGTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELITGRRALDYSQQSLVIW  332

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLL++N I+EL DP L D Y+++++   +  A  C+Q     RP + +++ +LKG ++
Sbjct  333   AKPLLKKNRIRELVDPSLADDYNLLQINLIVLAASLCVQQSSIRRPRINQILLLLKGNSK  392



>ref|XP_009772258.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009772259.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009772260.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Nicotiana sylvestris]
Length=438

 Score =   368 bits (945),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 250/360 (69%), Gaps = 11/360 (3%)
 Frame = -3

Query  1498  GGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNI-----  1334
             G     +A +W    +  + KS   F   PL     ++ S+R   S    S  ++     
Sbjct  38    GPKIQTSASRWTGFLELFRSKSKGHFAKDPLISS--LKLSKRFSRSMRETSSSSVMPNPI  95

Query  1333  -DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
              D G  S  KP W+ FTL EL  AT+NF  EN++GKGG+AEV+KGRL +GQ IAVKR+++
Sbjct  96    LDNG-LSYFKPQWKLFTLSELQTATNNFHQENLIGKGGYAEVHKGRLRNGQYIAVKRLMR  154

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
               + +      FLSELGI+AHINHPN AKLIG++ D GL LVL+  P+GSLA +LH + +
Sbjct  155   GQQDERIGD--FLSELGIMAHINHPNTAKLIGYAVDGGLFLVLELSPYGSLANMLHASKQ  212

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              LEWKIR+KVA+G+AEGL YLH   QRRIIHRDI A+NILLT+D   QI DFGLAKWLPE
Sbjct  213   KLEWKIRYKVAIGIAEGLLYLHEGGQRRIIHRDIKAANILLTKDLEPQICDFGLAKWLPE  272

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W H  +S  EGTFGY+APE+ MHGIVDEKTDVFAFGVLLLELITGR+A+D S+QSLV+W
Sbjct  273   RWTHLTISKFEGTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELITGRRALDYSQQSLVIW  332

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLL++N I+EL DP L D Y+++++   +  A  C+Q     RP + +++ +LKG ++
Sbjct  333   AKPLLKKNRIRELVDPSLADDYNLLQINLIVLAASLCVQQSSIRRPRINQILLLLKGNSK  392



>ref|XP_008449906.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Cucumis melo]
 ref|XP_008449907.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Cucumis melo]
 ref|XP_008449908.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Cucumis melo]
Length=414

 Score =   367 bits (943),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 243/349 (70%), Gaps = 8/349 (2%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNI--DCGDFSIT  1310
             P    W+ IF  ++ KS K  P+  L    +++ S+R+  S       +   D  D +  
Sbjct  33    PAGSFWRGIFKILRSKSRK--PVSKLHPQSVLKLSKRLSNSMRETLHLHFGFDSDDCNFN  90

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
              P W+NFTL+EL  AT+ FS EN++GKGG+AEVY+G L  GQV+A+KR+ +    +    
Sbjct  91    SP-WKNFTLRELEAATNCFSPENVIGKGGYAEVYRGCLKSGQVVAIKRLTRGSFDENVGD  149

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FL ELGI+AH+NHPN AKLIG+    G+HLVL++ PHGSLA  LH   E LEW IR+K
Sbjct  150   --FLLELGIMAHLNHPNTAKLIGYGIQGGMHLVLEFFPHGSLASTLHGLKEKLEWNIRYK  207

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G+AEGL YLH  CQRRIIHRDI A+NILLT+D+  QI DFGLAKWLP++W HH+VS 
Sbjct  208   IAIGIAEGLRYLHEGCQRRIIHRDIKAANILLTQDFEPQICDFGLAKWLPKQWTHHIVSK  267

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+ PEY  HGIVDEKTDVFAFGV+LLEL+TGR+A+D S+QSLV+WAKPLL++NN
Sbjct  268   FEGTFGYLPPEYLSHGIVDEKTDVFAFGVVLLELVTGRRALDYSQQSLVLWAKPLLKKNN  327

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             ++EL DP     Y+  +M   +  A  CIQ     RP M +VV++L G+
Sbjct  328   VRELVDP-FTINYNSRQMNLVLLAASLCIQQSSIRRPCMSQVVQILTGD  375



>ref|XP_009335648.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Pyrus x bretschneideri]
Length=486

 Score =   369 bits (948),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 196/387 (51%), Positives = 253/387 (65%), Gaps = 14/387 (4%)
 Frame = -3

Query  1468  WKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRNF  1289
             W+  F Q  ++S K     P  G   I   RR+      C+ +N    + S  K S  NF
Sbjct  103   WRKFFKQWGKRSLKRLVSFPPLGVPKISSRRRI-----GCARENPALTNISNFKSSLVNF  157

Query  1288  TLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSEL  1109
             T+ EL +ATDNF+SEN +GKGG++EVYKGRL  GQ++AVKR+ K    ++     FLSEL
Sbjct  158   TIAELQKATDNFNSENTIGKGGYSEVYKGRLKSGQLVAVKRLTKGTADEKTAG--FLSEL  215

Query  1108  GIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHN-ATETLEWKIRFKVAVGVA  932
             G IAH++HPN AKLIG   + G+HLV +    GSL  LLH      ++W  R+K+A+G A
Sbjct  216   GTIAHVDHPNTAKLIGCCVEGGMHLVFELFSLGSLGSLLHGPKANEIDWSKRYKIALGTA  275

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
             +GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EGTFG
Sbjct  276   DGLLYLHESCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKQWTHHNVPKSEGTFG  335

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y APEYFMHGIVDEKTDV++FGVLLLELITGR A+D  ++SLV+WAKPLL+ N IKEL D
Sbjct  336   YFAPEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVD  395

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK------  410
             P +GD YD  EM+  +  A  CI+    +RP M +VV +L+G++ +    ++SK      
Sbjct  396   PNIGDNYDGKEMDHMVLTAALCIEQSSILRPRMSQVVVLLRGDDYVSKCAKESKRRFLQR  455

Query  409   SVSSESLHIADFTSTSYRKHLDRHLQL  329
             + S E     ++ ST Y   L+RH Q+
Sbjct  456   TYSEELSDAQEYNSTKYLGDLNRHKQV  482



>ref|XP_009626405.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009626406.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Nicotiana tomentosiformis]
Length=438

 Score =   367 bits (943),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 190/360 (53%), Positives = 250/360 (69%), Gaps = 11/360 (3%)
 Frame = -3

Query  1498  GGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNI-----  1334
             G     +A +W    +  + KS   F   PL     ++ S+R   S    S  ++     
Sbjct  38    GPKIQRSASRWTGFLELFRSKSKGHFAKDPLISS--LKLSKRFSRSMRETSSSSVMPNPI  95

Query  1333  -DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
              D G  S  KP W+ FTL EL  AT+NF  EN++GKGG+AEV+KGRL +GQ IAVKR+++
Sbjct  96    LDNG-LSYFKPQWKLFTLSELQTATNNFHKENLIGKGGYAEVHKGRLRNGQYIAVKRLMR  154

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
               + +      FLSELGI+AHINHPN AKLIG++ D GL LVL+  P+GSLA +LH + +
Sbjct  155   GQQDERIGD--FLSELGIMAHINHPNTAKLIGYAVDGGLFLVLELSPYGSLANMLHASKQ  212

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              LEWKIR+KVA+G+AEG+ YLH   QRRIIHRDI A+NILLT+D   QI DFGLAKWLPE
Sbjct  213   KLEWKIRYKVAIGIAEGILYLHEGGQRRIIHRDIKAANILLTKDLEPQICDFGLAKWLPE  272

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W H  VS  EGTFGY+APE+ MHGIVDEKTDVFAFGVLLLELITGR+A+D S+QSLV+W
Sbjct  273   RWTHLTVSKFEGTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELITGRRALDYSQQSLVIW  332

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLL++N I+EL DP L D Y+++++   +  A  C+Q     RP + +++ +L+G ++
Sbjct  333   AKPLLKKNRIRELVDPSLADDYNLLQINLMVLAASLCVQQSSIRRPRINQILLLLRGNSK  392



>ref|XP_009626407.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Nicotiana tomentosiformis]
Length=410

 Score =   366 bits (940),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 190/360 (53%), Positives = 250/360 (69%), Gaps = 11/360 (3%)
 Frame = -3

Query  1498  GGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNI-----  1334
             G     +A +W    +  + KS   F   PL     ++ S+R   S    S  ++     
Sbjct  38    GPKIQRSASRWTGFLELFRSKSKGHFAKDPLISS--LKLSKRFSRSMRETSSSSVMPNPI  95

Query  1333  -DCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
              D G  S  KP W+ FTL EL  AT+NF  EN++GKGG+AEV+KGRL +GQ IAVKR+++
Sbjct  96    LDNG-LSYFKPQWKLFTLSELQTATNNFHKENLIGKGGYAEVHKGRLRNGQYIAVKRLMR  154

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
               + +      FLSELGI+AHINHPN AKLIG++ D GL LVL+  P+GSLA +LH + +
Sbjct  155   GQQDERIGD--FLSELGIMAHINHPNTAKLIGYAVDGGLFLVLELSPYGSLANMLHASKQ  212

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              LEWKIR+KVA+G+AEG+ YLH   QRRIIHRDI A+NILLT+D   QI DFGLAKWLPE
Sbjct  213   KLEWKIRYKVAIGIAEGILYLHEGGQRRIIHRDIKAANILLTKDLEPQICDFGLAKWLPE  272

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W H  VS  EGTFGY+APE+ MHGIVDEKTDVFAFGVLLLELITGR+A+D S+QSLV+W
Sbjct  273   RWTHLTVSKFEGTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELITGRRALDYSQQSLVIW  332

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLL++N I+EL DP L D Y+++++   +  A  C+Q     RP + +++ +L+G ++
Sbjct  333   AKPLLKKNRIRELVDPSLADDYNLLQINLMVLAASLCVQQSSIRRPRINQILLLLRGNSK  392



>ref|XP_010693786.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=478

 Score =   368 bits (944),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 244/336 (73%), Gaps = 8/336 (2%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSW+NF+L+EL +AT+ F++EN +G+GG+A+VYKG L +G +IAVKR+ K + ++    
Sbjct  144   KPSWKNFSLEELHEATNTFNNENKIGEGGYADVYKGVLPNGHLIAVKRLSKGNPEELAAD  203

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FLSELGII H+NHPN AK++G+  D G+HL+L   P+GSL  +L  + E L W IR+K
Sbjct  204   --FLSELGIIVHVNHPNIAKVVGYGVDGGMHLILDLSPNGSLESILRGSRENLRWDIRYK  261

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G A+GL YLH  CQRRIIHRDI A+NILLTED+ AQISDFGLAKWLP++W HH VS 
Sbjct  262   IALGSAQGLQYLHEGCQRRIIHRDIKAANILLTEDFEAQISDFGLAKWLPDQWTHHTVSK  321

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGR A+D++++SLVMWAKP L++N 
Sbjct  322   FEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRLALDNTQKSLVMWAKPFLDKNK  381

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELK--VELRQ  416
             +KEL DP LGD YD  +++     A  CI      RP M +VV++L GE +     +L Q
Sbjct  382   LKELVDPYLGDGYDKDQLKLLAMTANMCIHQSSIERPQMSEVVQILNGETKCSEFAKLTQ  441

Query  415   SKSV----SSESLHIADFTSTSYRKHLDRHLQLIME  320
               S+    S E     ++ ST Y   +D+ +Q+ +E
Sbjct  442   KPSLKRTYSVELFDAEEYNSTKYLNDVDQLMQIALE  477



>ref|XP_010539943.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Tarenaya hassleriana]
Length=445

 Score =   366 bits (940),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 234/322 (73%), Gaps = 14/322 (4%)
 Frame = -3

Query  1363  SWSRCSEDN----IDC------GDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAE  1214
             S  RCS        DC        F +  P  R FTL EL  ATDNF+ +N++GKGG+AE
Sbjct  96    SMRRCSSMRETIGFDCNFVFNDARFHLVSPR-RIFTLAELQSATDNFAFDNLIGKGGYAE  154

Query  1213  VYKGRLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHL  1034
             V+KGRL +GQ++A+KR+ +    +      FLSE+G++AH+NHPN AKL G+  + G+HL
Sbjct  155   VFKGRLQNGQLVAIKRLTRGTTDEIIVD--FLSEMGMMAHVNHPNVAKLFGYGIEGGMHL  212

Query  1033  VLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILL  854
             VL+  PHGSLA +L+ + E ++W +R+K+A+G AEGL YLH  CQRRIIHRDI A+NILL
Sbjct  213   VLELSPHGSLASMLYGSREKIDWGVRYKIALGTAEGLVYLHRGCQRRIIHRDIKAANILL  272

Query  853   TEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLL  674
             T+D+  QI DFGLAKWLPE W HH+VS  EGTFGY+APEY  +GIVDEKTDVFAFGVLLL
Sbjct  273   TQDFQPQICDFGLAKWLPEHWTHHIVSKFEGTFGYLAPEYMTYGIVDEKTDVFAFGVLLL  332

Query  673   ELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHL  494
             EL+TGR+A+D SRQSLV+WAKPL+++N I+EL DP L +AYD  +M+  +  A  CIQ  
Sbjct  333   ELVTGRRALDYSRQSLVLWAKPLMKKNKIRELIDPSLANAYDTRQMKLVLLAASLCIQQS  392

Query  493   PNMRPNMKKVVEVLKGE-NELK  431
                RP M +V+E+LKG  N+LK
Sbjct  393   SIQRPQMSQVLEILKGNLNDLK  414



>ref|XP_010070315.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Eucalyptus grandis]
 gb|KCW58974.1| hypothetical protein EUGRSUZ_H01604 [Eucalyptus grandis]
Length=417

 Score =   365 bits (938),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/325 (55%), Positives = 237/325 (73%), Gaps = 6/325 (2%)
 Frame = -3

Query  1381  SRRMFFSWSRCSEDNIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKG  1202
             S R   +++ C     D     ++K  W+ FTL EL  AT+NFS E  +GKGG+AEVYKG
Sbjct  73    SMREMIAFAPCFLSRAD----ELSKTPWKYFTLPELQAATNNFSPERQIGKGGYAEVYKG  128

Query  1201  RLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQY  1022
             +L +GQ++A+KR+++    +      FLSELGI+AH+NH N AKL+G+  + G+HLVL+ 
Sbjct  129   QLRNGQLVAIKRLMRGTPDEIIGD--FLSELGIMAHVNHRNTAKLVGYGVEGGMHLVLEL  186

Query  1021  LPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDY  842
              PHGSLA +L++A ETLEW++R+K+A+G AEGL YLH  CQRRIIHRDI A+NILLTED+
Sbjct  187   SPHGSLASVLYSAKETLEWQLRYKIALGTAEGLLYLHEGCQRRIIHRDIKAANILLTEDF  246

Query  841   GAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELIT  662
               QI DFGLAKWLPEKW HH VS  EGTFGY+APEY MHGIVDEKTDVFAFGVLLLEL+T
Sbjct  247   EPQICDFGLAKWLPEKWTHHTVSKFEGTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELVT  306

Query  661   GRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMR  482
             GR+A+D ++QSLV+WAKPLL +NN++EL DP LG  YD  ++   +  A  C+      R
Sbjct  307   GRRALDYAQQSLVLWAKPLLRKNNVRELLDPALGSNYDARQINLVLLAASICVHQSSIRR  366

Query  481   PNMKKVVEVLKGENELKVELRQSKS  407
             P++ +V ++L G+      +R+ ++
Sbjct  367   PSISQVAQILNGDLSCLKSMRKIRT  391



>ref|XP_006433226.1| hypothetical protein CICLE_v10001189mg [Citrus clementina]
 gb|ESR46466.1| hypothetical protein CICLE_v10001189mg [Citrus clementina]
Length=437

 Score =   366 bits (939),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 256/391 (65%), Gaps = 17/391 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIV-PLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
               W   F   K+KS K      PL    + R+        SR + ++ D       + S 
Sbjct  55    TNWSRFFKLWKKKSTKHLRTFHPLAMPKLSREK-------SRSTREDPDLTHIYNYRSSL  107

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             + FTL EL  AT NFSSEN++GKGG+AEVYKG L DG ++AVKR+ K    ++     FL
Sbjct  108   KEFTLSELQTATKNFSSENLIGKGGYAEVYKGCLRDGTLVAVKRLTKGTVDEKTCG--FL  165

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
              E+GIIA+++HPN AKL+G  +D G+HLV Q  P GSLA +LH + +  +W  R+++A+G
Sbjct  166   CEIGIIAYVDHPNTAKLVGCDSD-GIHLVFQLSPLGSLASILHGSKDKPDWSKRYRIALG  224

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A GL YLH  CQ+RIIHRDI A NILLTEDY  QI DFGLAKWLP +W HH VS  EGT
Sbjct  225   TANGLTYLHEGCQKRIIHRDIKADNILLTEDYEPQICDFGLAKWLPRQWTHHNVSKFEGT  284

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEYFMHGIVDEKTDV++FGVLLLELITGR+AVD  +QS+V+WAKPLL+ N+I+EL
Sbjct  285   FGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRRAVDHLQQSVVIWAKPLLDSNDIREL  344

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS-----  413
              DP LGD YD  EM+R++  A  CI+  P +RP M +VV +L+G+ +    +++S     
Sbjct  345   VDPSLGDNYDAEEMDRAVLTASLCIEQSPILRPKMSQVVILLRGDEDNAQSVKESQKQTH  404

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
              ++ S E     ++ ST Y   + R  ++ +
Sbjct  405   RRTYSEELFDAQEYNSTRYLSDISRFKEIAL  435



>ref|XP_010660039.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X3 [Vitis vinifera]
Length=464

 Score =   367 bits (941),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 200/386 (52%), Positives = 256/386 (66%), Gaps = 23/386 (6%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFP-IVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWR  1295
              W+S  ++  + S   FP + P+      ++SR      S+ + +N+     +    SW+
Sbjct  91    HWRSFLNRFTKNSVIRFPSLTPVMS----KRSR----GKSQSARENVLA--VNTFNSSWK  140

Query  1294  NFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLS  1115
             NF+L EL  AT NF  EN++GKGG+AEVYKGRL DGQ IA+KR+ +   ++      FL 
Sbjct  141   NFSLVELQNATKNFHHENLIGKGGYAEVYKGRLKDGQFIAIKRLTQGTPEERVMS--FLH  198

Query  1114  ELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGV  935
             ELGIIAH+NHPN AKLIG+    GLHLVLQ  P GSL  LLH     LEW  R+K+A+G 
Sbjct  199   ELGIIAHVNHPNTAKLIGYGVQGGLHLVLQLSPLGSLGSLLHVTKSKLEWSSRYKIALGT  258

Query  934   AEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTF  755
             A+GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W H  V+  EGTF
Sbjct  259   ADGLRYLHEHCQRRIIHRDIKADNILLTEDFEPQICDFGLAKWLPKQWTHFNVTKFEGTF  318

Query  754   GYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELA  575
             GY APEYFMHGIVDEKTD+F+FGVLLLELITGR+AVD  +QSLV+WAKPLL +N++ EL 
Sbjct  319   GYFAPEYFMHGIVDEKTDIFSFGVLLLELITGRRAVDHMKQSLVVWAKPLLYKNSVAELV  378

Query  574   DPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS------  413
             DP L D YD  EM+R +  A  CI+  P +RP M +VV +L+G+       ++S      
Sbjct  379   DPAL-DEYDEEEMDRMLLTASLCIEQSPVLRPRMNQVVVLLRGDEYNPDGAQESQNHMPK  437

Query  412   KSVSSESLHIADFTSTSYRKHLDRHL  335
             ++ S+E L  A++ ST   K LD  L
Sbjct  438   RTYSNEILDAAEYNST---KCLDERL  460



>ref|XP_007199072.1| hypothetical protein PRUPE_ppa018798mg [Prunus persica]
 gb|EMJ00271.1| hypothetical protein PRUPE_ppa018798mg [Prunus persica]
Length=422

 Score =   365 bits (937),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 183/349 (52%), Positives = 247/349 (71%), Gaps = 8/349 (2%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNI--DCGDFSIT  1310
             PT+ +W  +   ++ KS K  PI     H +++ S+RM  S           D  D    
Sbjct  43    PTS-RWHGLVQLLRTKSKK--PIATTM-HPLVKFSKRMSSSMREIITPKFQSDIDDMYPF  98

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             K  W+NF+L EL  AT +FS EN +GKGG+AEVYKG L +GQ++AVKR+ +   ++    
Sbjct  99    KSPWKNFSLYELQAATKSFSHENQIGKGGYAEVYKGCLPNGQLVAVKRLTRGTPEEITGD  158

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FL+E+GI+AH+NHPN A+LIG+  + G+HLVL+  P GSLA +L+ + E L+W IR+K
Sbjct  159   --FLAEIGIMAHVNHPNTARLIGYGVEGGMHLVLELSPKGSLASVLYGSKEKLDWGIRYK  216

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G  +GL YLH  CQRRIIHRDI A+NILLTED+ A+I DFGLAKWLPEKW HH +S 
Sbjct  217   IALGAGKGLQYLHEGCQRRIIHRDIKAANILLTEDFEAKICDFGLAKWLPEKWTHHTISK  276

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+APE+ +HGIVDEKTDVFA+GV+LLEL+TGR+A+D S+QSLV+WAKPLL++N 
Sbjct  277   FEGTFGYLAPEFLLHGIVDEKTDVFAYGVVLLELVTGRRALDYSQQSLVLWAKPLLKKNE  336

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             +K L DP L D Y+  +M   + VA +CIQ     RP+M +VV++L G+
Sbjct  337   VKSLVDPSLRDEYNTRQMNLVLLVASACIQQSSIRRPSMNQVVQLLSGD  385



>ref|XP_010693785.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=499

 Score =   368 bits (944),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 244/336 (73%), Gaps = 8/336 (2%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSW+NF+L+EL +AT+ F++EN +G+GG+A+VYKG L +G +IAVKR+ K + ++    
Sbjct  165   KPSWKNFSLEELHEATNTFNNENKIGEGGYADVYKGVLPNGHLIAVKRLSKGNPEELAAD  224

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FLSELGII H+NHPN AK++G+  D G+HL+L   P+GSL  +L  + E L W IR+K
Sbjct  225   --FLSELGIIVHVNHPNIAKVVGYGVDGGMHLILDLSPNGSLESILRGSRENLRWDIRYK  282

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G A+GL YLH  CQRRIIHRDI A+NILLTED+ AQISDFGLAKWLP++W HH VS 
Sbjct  283   IALGSAQGLQYLHEGCQRRIIHRDIKAANILLTEDFEAQISDFGLAKWLPDQWTHHTVSK  342

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGR A+D++++SLVMWAKP L++N 
Sbjct  343   FEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRLALDNTQKSLVMWAKPFLDKNK  402

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELK--VELRQ  416
             +KEL DP LGD YD  +++     A  CI      RP M +VV++L GE +     +L Q
Sbjct  403   LKELVDPYLGDGYDKDQLKLLAMTANMCIHQSSIERPQMSEVVQILNGETKCSEFAKLTQ  462

Query  415   SKSV----SSESLHIADFTSTSYRKHLDRHLQLIME  320
               S+    S E     ++ ST Y   +D+ +Q+ +E
Sbjct  463   KPSLKRTYSVELFDAEEYNSTKYLNDVDQLMQIALE  498



>ref|XP_008370527.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Malus domestica]
Length=491

 Score =   367 bits (943),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 196/384 (51%), Positives = 251/384 (65%), Gaps = 14/384 (4%)
 Frame = -3

Query  1459  IFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRNFTLQ  1280
              F Q  ++S K     P  G   I   RR+      C+ +N    + S  K S  NFT+ 
Sbjct  111   FFKQWGKRSLKRLVSFPPLGVPKISSRRRI-----GCARENPALXNISNFKSSLVNFTIA  165

Query  1279  ELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGII  1100
             EL +ATDNF+SEN +GKGG++EVYKGRL  GQ++AVKR+ K    ++     FLSELG I
Sbjct  166   ELQKATDNFNSENTIGKGGYSEVYKGRLKSGQLVAVKRLTKGTADEKTAG--FLSELGTI  223

Query  1099  AHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHN-ATETLEWKIRFKVAVGVAEGL  923
             AH++HPN AKLIG   + G+HLV +    GSL  LLH      L+W  R+K+A+G A+GL
Sbjct  224   AHVDHPNTAKLIGCCVEGGMHLVFELFSLGSLGSLLHGPKANELDWSKRYKIALGTADGL  283

Query  922   HYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMA  743
              YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EGTFGY A
Sbjct  284   LYLHESCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKQWTHHNVPKSEGTFGYFA  343

Query  742   PEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRL  563
             PEYFMHGIVDEKTDV++FGVLLLELITGR A+D  ++SLV+WAKPLL+ N IKEL DP +
Sbjct  344   PEYFMHGIVDEKTDVYSFGVLLLELITGRPALDDLQKSLVLWAKPLLDNNEIKELVDPNI  403

Query  562   GDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK------SVS  401
             GD YD  EM+  +  A  CI+    +RP M +VV +L+G++ +    ++SK      + S
Sbjct  404   GDNYDRKEMDHMVLTAALCIEQSSILRPRMSQVVVLLRGDDYVSKCAKESKRRFLQRTYS  463

Query  400   SESLHIADFTSTSYRKHLDRHLQL  329
              E     ++ ST Y   L+RH Q+
Sbjct  464   EELSDAQEYNSTKYLGDLNRHKQV  487



>ref|XP_010693784.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=502

 Score =   368 bits (944),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 244/336 (73%), Gaps = 8/336 (2%)
 Frame = -3

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             KPSW+NF+L+EL +AT+ F++EN +G+GG+A+VYKG L +G +IAVKR+ K + ++    
Sbjct  168   KPSWKNFSLEELHEATNTFNNENKIGEGGYADVYKGVLPNGHLIAVKRLSKGNPEELAAD  227

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FLSELGII H+NHPN AK++G+  D G+HL+L   P+GSL  +L  + E L W IR+K
Sbjct  228   --FLSELGIIVHVNHPNIAKVVGYGVDGGMHLILDLSPNGSLESILRGSRENLRWDIRYK  285

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G A+GL YLH  CQRRIIHRDI A+NILLTED+ AQISDFGLAKWLP++W HH VS 
Sbjct  286   IALGSAQGLQYLHEGCQRRIIHRDIKAANILLTEDFEAQISDFGLAKWLPDQWTHHTVSK  345

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+ PE+FMHGIVDEKTDV+A+GVLLLELITGR A+D++++SLVMWAKP L++N 
Sbjct  346   FEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRLALDNTQKSLVMWAKPFLDKNK  405

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELK--VELRQ  416
             +KEL DP LGD YD  +++     A  CI      RP M +VV++L GE +     +L Q
Sbjct  406   LKELVDPYLGDGYDKDQLKLLAMTANMCIHQSSIERPQMSEVVQILNGETKCSEFAKLTQ  465

Query  415   SKSV----SSESLHIADFTSTSYRKHLDRHLQLIME  320
               S+    S E     ++ ST Y   +D+ +Q+ +E
Sbjct  466   KPSLKRTYSVELFDAEEYNSTKYLNDVDQLMQIALE  501



>ref|XP_002524777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37620.1| ATP binding protein, putative [Ricinus communis]
Length=462

 Score =   367 bits (941),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 183/341 (54%), Positives = 245/341 (72%), Gaps = 6/341 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNI-DCGDFSITKPSWR  1295
             +W+  F  +K ++ K  P+  L    +++ S R   S      +   D   +++  P   
Sbjct  81    RWRGFFQLLKSRTKK--PLATLHPLSVLKLSLRRSSSMREMVPNLFADSDSYNLNCPRM-  137

Query  1294  NFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLS  1115
             +FTL EL  AT++FS EN++GKGG+AEVYKG L +G+++A+KR+I+    +      FLS
Sbjct  138   SFTLSELQAATNDFSQENLIGKGGYAEVYKGCLKNGKLVAIKRLIRGTADEIVGD--FLS  195

Query  1114  ELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGV  935
             E+GI+AH+NHPN A+LIG+  + G+HLVL+  PHGSLA +L  + ETL+W IR+K+AVG 
Sbjct  196   EMGIMAHVNHPNTARLIGYGIEGGMHLVLELSPHGSLASVLSGSKETLKWDIRYKIAVGT  255

Query  934   AEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTF  755
             AEG+ YLH  CQRRIIHRDI A+NILLTED+  QI DFGLAKWLP++W HHVVS  EGTF
Sbjct  256   AEGIRYLHEDCQRRIIHRDIKAANILLTEDFEPQICDFGLAKWLPQQWTHHVVSKFEGTF  315

Query  754   GYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELA  575
             GY+APEY MHGIVDEKTDVFAFGVLLLEL+TGR+A+D S+QSLV+WAKPLL++N I+EL 
Sbjct  316   GYLAPEYLMHGIVDEKTDVFAFGVLLLELVTGRRALDYSQQSLVLWAKPLLKKNEIRELV  375

Query  574   DPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVL  452
             DP LG+ Y+  +M   +  A  CIQ     RP + +VV++L
Sbjct  376   DPALGNDYNARQMNLILLAASLCIQQSSLRRPKITQVVQIL  416



>ref|XP_002264044.3| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Vitis vinifera]
Length=475

 Score =   367 bits (942),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 200/385 (52%), Positives = 256/385 (66%), Gaps = 23/385 (6%)
 Frame = -3

Query  1468  WKSIFDQIKRKSAKSFP-IVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             W+S  ++  + S   FP + P+      ++SR      S+ + +N+     +    SW+N
Sbjct  103   WRSFLNRFTKNSVIRFPSLTPVMS----KRSR----GKSQSARENVLA--VNTFNSSWKN  152

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             F+L EL  AT NF  EN++GKGG+AEVYKGRL DGQ IA+KR+ +   ++      FL E
Sbjct  153   FSLVELQNATKNFHHENLIGKGGYAEVYKGRLKDGQFIAIKRLTQGTPEERVMS--FLHE  210

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             LGIIAH+NHPN AKLIG+    GLHLVLQ  P GSL  LLH     LEW  R+K+A+G A
Sbjct  211   LGIIAHVNHPNTAKLIGYGVQGGLHLVLQLSPLGSLGSLLHVTKSKLEWSSRYKIALGTA  270

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
             +GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W H  V+  EGTFG
Sbjct  271   DGLRYLHEHCQRRIIHRDIKADNILLTEDFEPQICDFGLAKWLPKQWTHFNVTKFEGTFG  330

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y APEYFMHGIVDEKTD+F+FGVLLLELITGR+AVD  +QSLV+WAKPLL +N++ EL D
Sbjct  331   YFAPEYFMHGIVDEKTDIFSFGVLLLELITGRRAVDHMKQSLVVWAKPLLYKNSVAELVD  390

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS------K  410
             P L D YD  EM+R +  A  CI+  P +RP M +VV +L+G+       ++S      +
Sbjct  391   PAL-DEYDEEEMDRMLLTASLCIEQSPVLRPRMNQVVVLLRGDEYNPDGAQESQNHMPKR  449

Query  409   SVSSESLHIADFTSTSYRKHLDRHL  335
             + S+E L  A++ ST   K LD  L
Sbjct  450   TYSNEILDAAEYNST---KCLDERL  471



>ref|XP_010660038.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Vitis vinifera]
Length=514

 Score =   368 bits (945),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 205/402 (51%), Positives = 261/402 (65%), Gaps = 24/402 (6%)
 Frame = -3

Query  1516  TRCGGSGGGFDPTA-VQWKSIFDQIKRKSAKSFP-IVPLFGHDIIRKSRRMFFSWSRCSE  1343
             T C GS       A   W+S  ++  + S   FP + P+      ++SR      S+ + 
Sbjct  125   TSCLGSSESKRSRARSHWRSFLNRFTKNSVIRFPSLTPVMS----KRSR----GKSQSAR  176

Query  1342  DNIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkri  1163
             +N+     +    SW+NF+L EL  AT NF  EN++GKGG+AEVYKGRL DGQ IA+KR+
Sbjct  177   ENVLA--VNTFNSSWKNFSLVELQNATKNFHHENLIGKGGYAEVYKGRLKDGQFIAIKRL  234

Query  1162  ikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
              +   ++      FL ELGIIAH+NHPN AKLIG+    GLHLVLQ  P GSL  LLH  
Sbjct  235   TQGTPEERVMS--FLHELGIIAHVNHPNTAKLIGYGVQGGLHLVLQLSPLGSLGSLLHVT  292

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
                LEW  R+K+A+G A+GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWL
Sbjct  293   KSKLEWSSRYKIALGTADGLRYLHEHCQRRIIHRDIKADNILLTEDFEPQICDFGLAKWL  352

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLV  623
             P++W H  V+  EGTFGY APEYFMHGIVDEKTD+F+FGVLLLELITGR+AVD  +QSLV
Sbjct  353   PKQWTHFNVTKFEGTFGYFAPEYFMHGIVDEKTDIFSFGVLLLELITGRRAVDHMKQSLV  412

Query  622   MWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             +WAKPLL +N++ EL DP L D YD  EM+R +  A  CI+  P +RP M +VV +L+G+
Sbjct  413   VWAKPLLYKNSVAELVDPAL-DEYDEEEMDRMLLTASLCIEQSPVLRPRMNQVVVLLRGD  471

Query  442   NELKVELRQS------KSVSSESLHIADFTSTSYRKHLDRHL  335
                    ++S      ++ S+E L  A++ ST   K LD  L
Sbjct  472   EYNPDGAQESQNHMPKRTYSNEILDAAEYNST---KCLDERL  510



>ref|XP_006358443.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Solanum tuberosum]
Length=440

 Score =   365 bits (938),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 187/350 (53%), Positives = 245/350 (70%), Gaps = 4/350 (1%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRK--SRRMFFSWSRCSEDNIDCGDFSITK  1307
             ++ +W    +  + KS       PL     + K  SR M  + S    ++I     S  K
Sbjct  44    SSSRWTGFLELFRSKSKGHMTKDPLISSLKLSKRFSRSMRETSSGDMPNSILDNGLSYFK  103

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
             P W+ FTL EL  AT+ F  EN++GKGG+AEV+KGRL +GQ IAVKR+ +  + +     
Sbjct  104   PQWKLFTLSELQTATNYFHQENLIGKGGYAEVHKGRLRNGQFIAVKRLTRGPQDERIGD-  162

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FLSELGI+AHINHPN AKLIG++ D GL LVL+  P+GSL  +LH + + LEWKIR+KV
Sbjct  163   -FLSELGIMAHINHPNTAKLIGYAVDGGLFLVLELSPYGSLTNMLHASKKKLEWKIRYKV  221

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G+A+G+ YLH   QRRIIHRDI A+NILLT+D   QI DFGLAKWLPE+W H  V   
Sbjct  222   AIGIAKGIFYLHEGGQRRIIHRDIKAANILLTKDLEPQICDFGLAKWLPERWTHLTVGKF  281

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+APE+ MHGIVDEKTDVFAFGVLLLELITGR+A+D S+QSLV+WAKPLL++N I
Sbjct  282   EGTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELITGRRALDYSQQSLVIWAKPLLKKNRI  341

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             +ELADP L D YD+++M   +  A  C+Q     RP + +++++L+G +E
Sbjct  342   RELADPSLADDYDLLQMNLMVLAASLCVQQSSIKRPRINQILQLLRGNSE  391



>ref|XP_010070316.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Eucalyptus grandis]
Length=417

 Score =   364 bits (934),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 236/325 (73%), Gaps = 6/325 (2%)
 Frame = -3

Query  1381  SRRMFFSWSRCSEDNIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKG  1202
             S R   +++ C     D     ++K  W+ FTL EL  AT+NFS E  +GKGG+AEVYKG
Sbjct  73    SMREMIAFAPCFLSRAD----ELSKTPWKYFTLPELQAATNNFSPERQIGKGGYAEVYKG  128

Query  1201  RLGDGQVIAVkriikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQY  1022
             +L +GQ++A+KR+++    +      FLSELGI+AH+NH N AKL+G+  + G+HLVL+ 
Sbjct  129   QLRNGQLVAIKRLMRGTPDEIIGD--FLSELGIMAHVNHRNTAKLVGYGVEGGMHLVLEL  186

Query  1021  LPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDY  842
              PHGSLA +L++A ETLEW++R+K+A+G AEGL YLH  CQRRIIHRDI A+NILLTED+
Sbjct  187   SPHGSLASVLYSAKETLEWQLRYKIALGTAEGLLYLHEGCQRRIIHRDIKAANILLTEDF  246

Query  841   GAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELIT  662
               QI DFGLAKWLPEKW HH VS  EGTFGY+APEY MHGIVDEKTDVFAFGVLLLEL+T
Sbjct  247   EPQICDFGLAKWLPEKWTHHTVSKFEGTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELVT  306

Query  661   GRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMR  482
             GR+A+D ++QSLV+WAKPLL +NN++EL DP LG  YD  ++   +  A  C+      R
Sbjct  307   GRRALDYAQQSLVLWAKPLLRKNNVRELLDPALGSNYDARQINLVLLAASICVHQSSIRR  366

Query  481   PNMKKVVEVLKGENELKVELRQSKS  407
             P++ +  ++L G+      +R+ ++
Sbjct  367   PSISQATQILNGDLSCLKSMRKIRT  391



>ref|XP_006480260.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Citrus sinensis]
Length=483

 Score =   366 bits (940),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 193/391 (49%), Positives = 256/391 (65%), Gaps = 17/391 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIV-PLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
               W   F   K+KS K      PL    + R+        SR + ++ D       + S 
Sbjct  101   TNWSRFFKLWKKKSTKHLRTFHPLAMPKLSREK-------SRSTREDPDLTHIYNYRSSL  153

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             + FTL EL  AT NFSSEN++GKGG+AEVYKG L DG ++AVKR+ K    ++     FL
Sbjct  154   KEFTLSELQTATKNFSSENLIGKGGYAEVYKGCLRDGTLVAVKRLTKGTVDEKTCG--FL  211

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
              E+GIIA+++HPN AKL+G  +D G+HLV Q  P GSLA +LH + +  +W  R+++A+G
Sbjct  212   CEIGIIAYVDHPNTAKLVGCDSD-GIHLVFQLSPLGSLASILHGSKDKPDWSKRYRIALG  270

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A GL YLH  CQ+RIIHRDI A NILLTEDY  QI DFGLAKWLP +W HH VS  EGT
Sbjct  271   TANGLTYLHEGCQKRIIHRDIKADNILLTEDYEPQICDFGLAKWLPRQWTHHNVSKFEGT  330

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEYFMHGIVDEKTDV++FGVLLLELITGR+AVD  +QS+V+WAKPLL+ N+I+EL
Sbjct  331   FGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRRAVDHLQQSVVIWAKPLLDSNDIREL  390

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS-----  413
              DP LGD YD  EM+R++  A  CI+  P +RP M +VV +L+G+ +    +++S     
Sbjct  391   VDPSLGDNYDAEEMDRAVLTASLCIEQSPILRPKMSQVVILLRGDEDNAQSVKESQKQTH  450

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
              ++ S E     ++ ST Y   + R  ++ +
Sbjct  451   RRTYSEELFDAQEYNSTRYLSDISRFKEIAL  481



>emb|CAN71781.1| hypothetical protein VITISV_028676 [Vitis vinifera]
Length=479

 Score =   366 bits (939),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 206/409 (50%), Positives = 259/409 (63%), Gaps = 31/409 (8%)
 Frame = -3

Query  1516  TRCGGSGGGFDPTA-VQWKSIFDQIKRKSAKSFP-IVPLFGHDIIRKSRRMFFSWSRCSE  1343
             T C GS       A   W+S  ++  + S   FP + P+        S+R         E
Sbjct  83    TSCLGSSESKRSRARSHWRSFLNRFTKNSVIRFPSLTPVM-------SKRSRGKSQSARE  135

Query  1342  DNIDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkri  1163
             + +    F+    SW+NF+L EL  AT NF  EN++GKGG+AEVYKGRL DGQ IA+KR+
Sbjct  136   NVLAVNTFN---SSWKNFSLVELQNATKNFHHENLIGKGGYAEVYKGRLKDGQFIAIKRL  192

Query  1162  ikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
              +   ++      FL ELGIIAH+NHPN AKLIG+    GLHLVLQ  P GSL  LLH  
Sbjct  193   TQGTPEERVMS--FLHELGIIAHVNHPNTAKLIGYGVQGGLHLVLQLSPLGSLGSLLHVT  250

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
                LEW  R+K+A+G A+GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWL
Sbjct  251   KSKLEWSSRYKIALGTADGLRYLHEHCQRRIIHRDIKADNILLTEDFEPQICDFGLAKWL  310

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLV  623
             P++W H  V+  EGTFGY APEYFMHGIVDEKTD+F+FGVLLLELITGR+AVD  +QSLV
Sbjct  311   PKQWTHFNVTKFEGTFGYFAPEYFMHGIVDEKTDIFSFGVLLLELITGRRAVDHMKQSLV  370

Query  622   MWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRP-------NMKKV  464
             +WAKPLL +N++ EL DP L D YD  EM+R +  A  CI+  P +RP       N +KV
Sbjct  371   VWAKPLLYKNSVAELVDPAL-DEYDEEEMDRMLLTASLCIEQSPVLRPRMNQASTNFRKV  429

Query  463   VEVLKGENELKVELRQS------KSVSSESLHIADFTSTSYRKHLDRHL  335
             V +L+G+       ++S      ++ S+E L  A++ ST   K LD  L
Sbjct  430   VVLLRGDEYNPDGAQESQNHMPKRTYSNEILDAAEYNST---KCLDERL  475



>emb|CDP17987.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   366 bits (939),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 198/383 (52%), Positives = 250/383 (65%), Gaps = 27/383 (7%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             +W   F   K+ S K  P  P         SRR     SR   D++D  D    K  W+N
Sbjct  102   RWHKFFKLWKKSSIKRLPSFPPLA------SRRR----SRTLRDHVD-NDCCPVKSEWKN  150

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             F L +L +AT+NFS EN++GKGG+AEVYKG L DGQ++A+K++ K   +++     FLSE
Sbjct  151   FNLADLQKATNNFSQENLIGKGGYAEVYKGCLPDGQLVAIKQLNKGTPEEQIIS--FLSE  208

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             +GIIAH+NHPN AK+IG+  + G +LVLQ    GSL  LLH + E L W IR K+ +G A
Sbjct  209   VGIIAHVNHPNTAKMIGYGVEGGTYLVLQLSSQGSLGSLLHGSKEKLNWGIRHKIILGTA  268

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
             +GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP +W H  VS  EGTFG
Sbjct  269   DGLLYLHENCQRRIIHRDIKADNILLTEDFEPQICDFGLAKWLPNQWTHCNVSKFEGTFG  328

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y APEY+M+GIVDEKTDVFAFGVLLLELITGR+A+D S+ SLV+WAKPLLE NN+ EL D
Sbjct  329   YFAPEYYMNGIVDEKTDVFAFGVLLLELITGRKALDESQNSLVLWAKPLLENNNLSELVD  388

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKK--------VVEVLKGE-NELKVELR  419
             P LG+ Y+  EM+R +  A SCI+  P  RP M+K        VV +L+G  N L   + 
Sbjct  389   PSLGNEYNPEEMDRVILTATSCIEQDPIERPQMRKAKTWKRKMVVTLLRGNVNSLASLME  448

Query  418   Q-----SKSVSSESLHIADFTST  365
             +      ++ S E L   ++ ST
Sbjct  449   KHDRCLRRTYSEELLDADEYNST  471



>gb|KDO48498.1| hypothetical protein CISIN_1g013927mg [Citrus sinensis]
Length=434

 Score =   363 bits (933),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 192/391 (49%), Positives = 256/391 (65%), Gaps = 17/391 (4%)
 Frame = -3

Query  1474  VQWKSIFDQIKRKSAKSFPIV-PLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
               W   F   K+KS K      PL    + R+        SR + ++ D       + S 
Sbjct  52    TNWSRFFKLWKKKSTKHLRTFHPLAMPKLSREK-------SRSTREDPDLTHIYNYRSSL  104

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             + FTL EL  AT NFSSEN++GKGG+AEVYKG L DG ++AVKR+ K    ++     FL
Sbjct  105   KEFTLSELQTATKNFSSENLIGKGGYAEVYKGCLRDGTLVAVKRLTKGTVDEKTCG--FL  162

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
              E+GIIA+++HPN AKL+G  +D G+HLV Q  P GSLA +LH + +  +W  R+++A+G
Sbjct  163   CEIGIIAYVDHPNTAKLVGCDSD-GIHLVFQLSPLGSLASILHGSKDKPDWSKRYRIALG  221

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A GL YLH  CQ+RIIHRDI A NILLTEDY  QI DFGLAKWLP +W HH VS  EGT
Sbjct  222   TANGLTYLHEGCQKRIIHRDIKADNILLTEDYEPQICDFGLAKWLPRQWTHHNVSKFEGT  281

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEYFMHGIVDEKTDV++FGVLLLELITGR+AVD  +QS+V+WAKPLL+ N+I+EL
Sbjct  282   FGYFAPEYFMHGIVDEKTDVYSFGVLLLELITGRRAVDHLQQSVVIWAKPLLDSNDIREL  341

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQS-----  413
              DP LGD YD  E++R++  A  CI+  P +RP M +VV +L+G+ +    +++S     
Sbjct  342   VDPSLGDNYDAEEIDRAVLTASLCIEQSPILRPKMSQVVILLRGDEDNAQSVKESQKQTH  401

Query  412   -KSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
              ++ S E     ++ ST Y   + R  ++ +
Sbjct  402   RRTYSEELFDAQEYNSTRYLSDISRFKEIAL  432



>ref|XP_004149635.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Cucumis sativus]
 ref|XP_004164923.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Cucumis sativus]
 gb|KGN54011.1| hypothetical protein Csa_4G267460 [Cucumis sativus]
Length=414

 Score =   363 bits (931),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 241/349 (69%), Gaps = 8/349 (2%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNI--DCGDFSIT  1310
             P    W+ IF  +  KS K  P+  L    +++ S+R+  S       +   D    +  
Sbjct  33    PAGSFWRGIFKILGSKSRK--PVSKLHPQSVLKLSKRLSNSMRETLHLHFGFDSDVCNFN  90

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
              P W+NFTL+EL  AT+ FS EN++GKGG+AEVY+G L  GQV+A+KR+ +    +    
Sbjct  91    SP-WKNFTLRELEAATNYFSPENVIGKGGYAEVYRGCLKSGQVVAIKRLTRGSFDENVGD  149

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FL ELGI+AH+NHPN AKLIG+    G+HLVL++ PHGSLA  LH   E LEW IR+K
Sbjct  150   --FLLELGIMAHLNHPNTAKLIGYGIQGGMHLVLEFFPHGSLASTLHGLKEKLEWSIRYK  207

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G+AEGL YLH  CQRRIIHRDI A+NILLT+D+  QI DFGLAKWLP++W HH+VS 
Sbjct  208   IAIGIAEGLRYLHEGCQRRIIHRDIKAANILLTQDFEPQICDFGLAKWLPKQWTHHIVSK  267

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+ PEY  HGIVDEKTDVFAFGVLLLEL+TGR+A+D S+QSLV+WAKPLL++NN
Sbjct  268   FEGTFGYLPPEYLSHGIVDEKTDVFAFGVLLLELVTGRRALDYSQQSLVLWAKPLLKKNN  327

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             ++EL DP     Y+  +M   +  A  CIQ     RP M +VV++L G+
Sbjct  328   VRELVDP-FTINYNSRQMNLVLLAASLCIQQSSIRRPCMSQVVQILSGD  375



>gb|KDP40055.1| hypothetical protein JCGZ_02053 [Jatropha curcas]
Length=450

 Score =   364 bits (934),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/396 (49%), Positives = 269/396 (68%), Gaps = 28/396 (7%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAK---SFPIVPLFGHDIIR-KSRRM---FFSWSRCSEDNIDCGD  1322
              A  W+  F   K+ +A+   +FP  P  G  + R K++R+          +   +D  +
Sbjct  59    NAAHWRDFFRGFKKGAARRIQTFP-APKRGPRLTRSKTKRIREELIPVISTTTSPLDT-E  116

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
                 K SW+NF+L +L  AT+ FS EN++G+GG+AEVYKG+LGDGQ++A+KR+ +   ++
Sbjct  117   LVCFKSSWKNFSLSDLHSATNKFSKENLIGEGGYAEVYKGQLGDGQLVAIKRLTRGSPEE  176

Query  1141  eerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWK  962
                   FLSE+GI+ H++HP+ AK+IG+  + G+HLVLQ  P+GSLA +L+   E L+W 
Sbjct  177   MTVD--FLSEIGIMVHVDHPHIAKMIGYGVEGGMHLVLQLSPNGSLASILYGPKERLDWG  234

Query  961   IRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHH  782
             +RFK+A+G A+GL YLH  CQRRIIH+DI A+NILLTED+  Q+SDFGLAKWLPE+W HH
Sbjct  235   LRFKIALGTAKGLQYLHEGCQRRIIHKDIKAANILLTEDFEPQVSDFGLAKWLPEQWTHH  294

Query  781   VVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLL  602
              V  IEGTFGY+ PE+FMHGIVDEKTDVFA+GVLLLELITGRQA+DSS+QS+VMWAKP++
Sbjct  295   TVEKIEGTFGYLPPEFFMHGIVDEKTDVFAYGVLLLELITGRQAIDSSQQSIVMWAKPMI  354

Query  601   EQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVEL  422
              +N IKEL DP L  AYDV +MER   + L  +Q         KK++E LK   EL+  +
Sbjct  355   MKNKIKELVDPALAGAYDVDQMER---MVLEILQ-------GNKKILEELK---ELQQTI  401

Query  421   RQSKSVSSESLHIADFTSTSYRKHL---DRHLQLIM  323
              Q ++ S E     ++ ST Y   L   +R ++ ++
Sbjct  402   HQ-RTYSEELFDADEYNSTKYHLSLSDINRQMEFVL  436



>ref|XP_006444175.1| hypothetical protein CICLE_v10020400mg [Citrus clementina]
 ref|XP_006479818.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like isoform X1 [Citrus sinensis]
 ref|XP_006479819.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like isoform X2 [Citrus sinensis]
 ref|XP_006479820.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like isoform X3 [Citrus sinensis]
 ref|XP_006479821.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like isoform X4 [Citrus sinensis]
 gb|ESR57415.1| hypothetical protein CICLE_v10020400mg [Citrus clementina]
 gb|KDO87473.1| hypothetical protein CISIN_1g015339mg [Citrus sinensis]
 gb|KDO87474.1| hypothetical protein CISIN_1g015339mg [Citrus sinensis]
 gb|KDO87475.1| hypothetical protein CISIN_1g015339mg [Citrus sinensis]
Length=408

 Score =   362 bits (929),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/346 (53%), Positives = 246/346 (71%), Gaps = 14/346 (4%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDI-IRKSRRMFFSWSRCSED---NIDCGDFSITKP  1304
             +W   +D  + KS KS  +V L+   + IR+S  M     R   D   N+    +    P
Sbjct  44    RWHLFYDLFRNKSKKS--LVTLYPLKLSIRRSSSM-----REGIDMPRNLFVNSYDSQSP  96

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
               + F+L EL  AT+NFS EN++GKGG+AEVYKGRL +GQ++A+KR+ +    +      
Sbjct  97    Q-KIFSLYELQSATNNFSFENLIGKGGYAEVYKGRLRNGQLVAIKRLTRGTADEIIAD--  153

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGI+AH++HPN AKL+G+  + G+H+VL+  P+GSLA LL+   E L+W IR+K+A
Sbjct  154   FLSELGIMAHVDHPNTAKLLGYGIEGGMHIVLELSPNGSLASLLYGMKEKLKWGIRYKIA  213

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +GVAEGL YLH  CQRRIIHRDI A+NILLTED+  QI DFGLAKWLPE+W HH +S +E
Sbjct  214   LGVAEGLLYLHEGCQRRIIHRDIKAANILLTEDFEPQICDFGLAKWLPEQWTHHTISKVE  273

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+APE+ MHGIVDEKTDVFAFGVLLLEL+TGR+A+D S+QSLV+WA+P++++N I+
Sbjct  274   GTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELVTGRRALDYSQQSLVLWARPMIKRNEIR  333

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
             EL D  L D YD  +M   +  A  CIQ     RP M +VV++L+G
Sbjct  334   ELVDASLADEYDTRQMNLVLLAASLCIQQSSIRRPQMSQVVQLLRG  379



>ref|XP_009626408.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009626409.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X3 [Nicotiana tomentosiformis]
Length=357

 Score =   360 bits (923),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 230/300 (77%), Gaps = 3/300 (1%)
 Frame = -3

Query  1336  IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
             +D G  S  KP W+ FTL EL  AT+NF  EN++GKGG+AEV+KGRL +GQ IAVKR+++
Sbjct  15    LDNG-LSYFKPQWKLFTLSELQTATNNFHKENLIGKGGYAEVHKGRLRNGQYIAVKRLMR  73

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
               + +      FLSELGI+AHINHPN AKLIG++ D GL LVL+  P+GSLA +LH + +
Sbjct  74    GQQDERIGD--FLSELGIMAHINHPNTAKLIGYAVDGGLFLVLELSPYGSLANMLHASKQ  131

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              LEWKIR+KVA+G+AEG+ YLH   QRRIIHRDI A+NILLT+D   QI DFGLAKWLPE
Sbjct  132   KLEWKIRYKVAIGIAEGILYLHEGGQRRIIHRDIKAANILLTKDLEPQICDFGLAKWLPE  191

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W H  VS  EGTFGY+APE+ MHGIVDEKTDVFAFGVLLLELITGR+A+D S+QSLV+W
Sbjct  192   RWTHLTVSKFEGTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELITGRRALDYSQQSLVIW  251

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLL++N I+EL DP L D Y+++++   +  A  C+Q     RP + +++ +L+G ++
Sbjct  252   AKPLLKKNRIRELVDPSLADDYNLLQINLMVLAASLCVQQSSIRRPRINQILLLLRGNSK  311



>ref|XP_009589567.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009589568.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Nicotiana tomentosiformis]
Length=429

 Score =   362 bits (930),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 251/369 (68%), Gaps = 10/369 (3%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             +W   F   KR S K  P  P     + R SRR     SR + +N+  G F   K SW+N
Sbjct  48    RWHKFFKMWKRSSIKRLPTFPPLA--VPRISRRK----SRSARENVATG-FYHFKSSWKN  100

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             F+L +L  AT+NFS EN++GKGG+AEVYKG L DGQ++AVKR+ K   +++E    FL E
Sbjct  101   FSLSDLKNATNNFSEENLIGKGGYAEVYKGCLPDGQLVAVKRLNKGTPEEQETS--FLCE  158

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             +G IAH++HPN A+++G+  + G +LVL+    GSL   L  + + L+W  R+K+  G+A
Sbjct  159   IGTIAHVDHPNTARMVGYGVEGGTYLVLELSSQGSLGSFLRGSRDKLDWAARYKIIFGIA  218

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
              GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EGTFG
Sbjct  219   NGLLYLHENCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKEWTHHNVGKFEGTFG  278

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y APEYFMHGIVDEKTDVF+FGVLLLE+ITGRQA+D S+QSLV+WAKPLL+++++K L D
Sbjct  279   YFAPEYFMHGIVDEKTDVFSFGVLLLEIITGRQALDDSQQSLVLWAKPLLDKHDMKGLID  338

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVSSES  392
             P LGD Y+  EM   +  A  C++  P MRP M +V+ +L+ ++    +  + ++ S E 
Sbjct  339   PVLGDKYNPKEMRHVILTAGLCVEQNPLMRPRMNQVMVLLRTDDGYNKKCMR-RTYSEEL  397

Query  391   LHIADFTST  365
             L  A++ ST
Sbjct  398   LDAAEYNST  406



>ref|XP_009589566.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Nicotiana tomentosiformis]
Length=459

 Score =   363 bits (931),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 188/369 (51%), Positives = 251/369 (68%), Gaps = 10/369 (3%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             +W   F   KR S K  P  P     + R SRR     SR + +N+  G F   K SW+N
Sbjct  78    RWHKFFKMWKRSSIKRLPTFPPLA--VPRISRRK----SRSARENVATG-FYHFKSSWKN  130

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             F+L +L  AT+NFS EN++GKGG+AEVYKG L DGQ++AVKR+ K   +++E    FL E
Sbjct  131   FSLSDLKNATNNFSEENLIGKGGYAEVYKGCLPDGQLVAVKRLNKGTPEEQETS--FLCE  188

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             +G IAH++HPN A+++G+  + G +LVL+    GSL   L  + + L+W  R+K+  G+A
Sbjct  189   IGTIAHVDHPNTARMVGYGVEGGTYLVLELSSQGSLGSFLRGSRDKLDWAARYKIIFGIA  248

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
              GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EGTFG
Sbjct  249   NGLLYLHENCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKEWTHHNVGKFEGTFG  308

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y APEYFMHGIVDEKTDVF+FGVLLLE+ITGRQA+D S+QSLV+WAKPLL+++++K L D
Sbjct  309   YFAPEYFMHGIVDEKTDVFSFGVLLLEIITGRQALDDSQQSLVLWAKPLLDKHDMKGLID  368

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVSSES  392
             P LGD Y+  EM   +  A  C++  P MRP M +V+ +L+ ++    +  + ++ S E 
Sbjct  369   PVLGDKYNPKEMRHVILTAGLCVEQNPLMRPRMNQVMVLLRTDDGYNKKCMR-RTYSEEL  427

Query  391   LHIADFTST  365
             L  A++ ST
Sbjct  428   LDAAEYNST  436



>ref|XP_004247480.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Solanum lycopersicum]
Length=440

 Score =   362 bits (929),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 244/350 (70%), Gaps = 4/350 (1%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRK--SRRMFFSWSRCSEDNIDCGDFSITK  1307
             ++ +W    +  + KS       PL     + K  SR M  + S     +I     S  K
Sbjct  44    SSSRWTGFLELFRSKSKGHMTKDPLISSLKLSKRFSRSMRETSSGDMPSSILDNGLSYFK  103

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
             P W+ FTL EL  AT+ F  EN++GKGG+AEV+KGRL +GQ IAVKR+ +  + +     
Sbjct  104   PQWKLFTLSELQTATNYFHQENLIGKGGYAEVHKGRLRNGQFIAVKRLTRGPQDERIGD-  162

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FLSELGI+AHINHPN A+LIG++ D GL LVL+  P+GSL  +LH + + LEWKIR+KV
Sbjct  163   -FLSELGIMAHINHPNTARLIGYAVDGGLFLVLELSPYGSLTNMLHASKQKLEWKIRYKV  221

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G+A+G+ YLH   QRRIIHRDI A+NILLT+D   QI DFGLAKWLPE+W H  +   
Sbjct  222   AIGIAKGILYLHEGGQRRIIHRDIKAANILLTKDLEPQICDFGLAKWLPERWTHLTIGKF  281

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+APE+ MHGIVDEKTDVFAFGVLLLELITGR+A+D S+QSLV+WAKPL+++N I
Sbjct  282   EGTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELITGRRALDYSQQSLVIWAKPLVKKNRI  341

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             +ELADP L D YD+++M   +  A  C+Q     RP + +++++L+G +E
Sbjct  342   RELADPSLADDYDLLQMNLMVLAASLCVQQSSIKRPRINQILQLLRGNSE  391



>ref|XP_011079776.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Sesamum indicum]
 ref|XP_011079777.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Sesamum indicum]
 ref|XP_011079778.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Sesamum indicum]
Length=441

 Score =   362 bits (929),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 194/371 (52%), Positives = 256/371 (69%), Gaps = 16/371 (4%)
 Frame = -3

Query  1486  DPT-AVQWKSIFDQIKRKSAKSFPIV-PLFGHDIIRKSRRMFFSWSR----CSEDN--ID  1331
             DP  A +W   F  ++ KS +    + PL   + +  S+R  FS S     CS  N  ID
Sbjct  44    DPKPASRWAVFFQLLRFKSKRKLATLHPL---NALSLSKR--FSGSMREEVCSVSNPLID  98

Query  1330  CGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
               D +  KP W+NF+  EL  AT NF    ++GKGG+AEVY+GRL  GQ++A+KR++K  
Sbjct  99    -ADLNYFKPQWKNFSFSELQTATSNFCQGYLIGKGGYAEVYRGRLRGGQLVAIKRLMKGP  157

Query  1150  kkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETL  971
              ++      FLSELGI+AH+NHPN AK+IG+  + G++LVL++ P GSLA +LH++ + +
Sbjct  158   MEERIGD--FLSELGIMAHVNHPNTAKVIGYGVEGGMYLVLEFSPIGSLASMLHSSRDKV  215

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
             EW IR+KVAVG A+GL YLH  CQRRIIHRDI A+NILLTED+  QI DFGLAKWLP+ W
Sbjct  216   EWDIRYKVAVGTAKGLLYLHEGCQRRIIHRDIKAANILLTEDFEPQICDFGLAKWLPDLW  275

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              H  VS  EGTFGY+APE+ MHGIVDEKTDVFAFGVLLLELITGR+A+D S+QSLVMWAK
Sbjct  276   THLTVSKFEGTFGYLAPEFLMHGIVDEKTDVFAFGVLLLELITGRRALDYSQQSLVMWAK  335

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELK  431
             PLL++N I EL DP L +AY+ ++M   +  A  C+Q     RP M +V+ +L+G     
Sbjct  336   PLLKKNKISELIDPSLAEAYNPMQMNLMILAASLCVQQSSIKRPRMSQVLLLLRGSCGSS  395

Query  430   VELRQSKSVSS  398
               +++ K +SS
Sbjct  396   DIIKKCKKLSS  406



>ref|XP_009760127.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Nicotiana sylvestris]
 ref|XP_009760128.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Nicotiana sylvestris]
Length=429

 Score =   361 bits (927),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 251/369 (68%), Gaps = 10/369 (3%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             +W   F   KR S K  P  P     + R SRR     SR   +N+  G F   K SW+N
Sbjct  48    RWHKFFKMWKRSSIKRLPTFPPLA--VPRISRRK----SRSVRENVATG-FCHFKSSWKN  100

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             F+L +L+ AT+NFS EN++GKGG+AEVYKG L DGQ++AVKR+ K   +++E    FL E
Sbjct  101   FSLSDLNNATNNFSEENLIGKGGYAEVYKGCLPDGQLVAVKRLNKGTAEEQETS--FLCE  158

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             +G IAH++HPN AK++G+  + G +LVL+    GSL   L  + + L+W  R+K+  G+A
Sbjct  159   IGTIAHVDHPNTAKMVGYGVEGGTYLVLELSSQGSLGSFLRGSRDKLDWAARYKIIFGIA  218

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
              GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EGTFG
Sbjct  219   NGLLYLHENCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKEWTHHNVGKFEGTFG  278

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y APEYFMHGIVDEKTDVF+FGVLLLE+ITGRQA+D S+QSLV+WAKPLL+++++K L D
Sbjct  279   YFAPEYFMHGIVDEKTDVFSFGVLLLEIITGRQALDDSQQSLVLWAKPLLDKHDVKGLID  338

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVSSES  392
             P LGD ++  EM+  +  A  C++  P MRP M +V+ +L+ +     +  + ++ S E 
Sbjct  339   PVLGDKFNPEEMQHVILTAGLCVEQNPLMRPRMNQVMVLLRTDGGYNKKCLR-RTYSEEL  397

Query  391   LHIADFTST  365
             +  A++ ST
Sbjct  398   MDAAEYNST  406



>ref|XP_010112689.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
 gb|EXC34647.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
Length=411

 Score =   360 bits (925),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 245/354 (69%), Gaps = 5/354 (1%)
 Frame = -3

Query  1501  SGGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGD  1322
             S G  + T+ +W   F  ++ +S K  P+  +   +++  SRRM  S+            
Sbjct  34    SEGVKNSTSSKWHWFFKLLRTRSKK--PLTTMHSLNVMNLSRRMSSSFREIIASRFGSES  91

Query  1321  FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkd  1142
                 K  W+NF L EL  AT+ FS EN++GKGG+AEVYKGRL +GQ++A+KR+ +    +
Sbjct  92    DCHLKSPWKNFNLYELQIATNYFSPENLIGKGGYAEVYKGRLRNGQLVAIKRLTRGTPDE  151

Query  1141  eerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNAT-ETLEW  965
                   FLSE+GI+AH+NHPN AKLIG+  + G +LVL+  PHGSLA +L+  + E L W
Sbjct  152   ITAD--FLSEIGIMAHVNHPNTAKLIGYGVEGGFYLVLELSPHGSLASMLYGCSKEKLLW  209

Query  964   KIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGH  785
              IR+K+A+G A GL YLH  CQRRIIHRDI A+NILL+ED+  QI DFGLAKWLP++W H
Sbjct  210   GIRYKIALGTARGLLYLHERCQRRIIHRDIKAANILLSEDFEPQICDFGLAKWLPQQWTH  269

Query  784   HVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPL  605
             H VS  EGTFGY+APEY +HGIVDEKTDVFA+GVLLLEL+TGR+A+D S QSLV+WAKPL
Sbjct  270   HTVSKFEGTFGYLAPEYLLHGIVDEKTDVFAYGVLLLELVTGRRALDYSHQSLVLWAKPL  329

Query  604   LEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             L++++I+EL DP L D Y+  ++   +  A  CIQ     RP+M +V+E+L G+
Sbjct  330   LKKSDIRELVDPSLADDYNSRQVTLMLLAASLCIQQSSIRRPSMSQVLELLHGD  383



>ref|XP_002321047.1| hypothetical protein POPTR_0014s13210g [Populus trichocarpa]
 gb|EEE99362.1| hypothetical protein POPTR_0014s13210g [Populus trichocarpa]
Length=421

 Score =   360 bits (925),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 237/346 (68%), Gaps = 7/346 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNIDCGDFSITKP  1304
             A +W      ++ +S KS   +   G     +RKS  M  +       N D  +F   K 
Sbjct  41    ASRWHGFVKLLRSRSKKSLATLHPLGVLKLSMRKSSSMRENIITNLFANSDSSNF---KS  97

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
                NFTL EL  AT+NFS EN++GKGG+AEVYKG L +G+++A+KR+ +    +      
Sbjct  98    PRINFTLSELQAATNNFSQENLIGKGGYAEVYKGCLQNGKIVAIKRLTRGTTDEIIGD--  155

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSE+GI+AH+NHPN AKLIG+  + G+HLVL+  PHGSLA +L+ + E L W IR+K+A
Sbjct  156   FLSEMGIMAHVNHPNTAKLIGYGIEGGMHLVLELSPHGSLASVLYGSKERLTWHIRYKIA  215

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             +G A GL YLH  CQRRIIHRDI A+NILLTED+  QI DFGLAKWLPE W HH VS  E
Sbjct  216   LGTAHGLLYLHEGCQRRIIHRDIKAANILLTEDFEPQICDFGLAKWLPEHWTHHTVSKFE  275

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+APEY MHGIVDEKTDVFAFGVLLLEL+TGR+A+D S+QSLV+WAKPLL+ N I 
Sbjct  276   GTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELVTGRRALDYSQQSLVLWAKPLLKNNEIG  335

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
             EL DP L D Y+  +M   +  A  CIQ     RP+M +VV++L G
Sbjct  336   ELVDPALVDDYNARQMNLVLLAASLCIQQSSIRRPHMIQVVQILNG  381



>ref|XP_009760126.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Nicotiana sylvestris]
Length=461

 Score =   362 bits (928),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 251/369 (68%), Gaps = 10/369 (3%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             +W   F   KR S K  P  P     + R SRR     SR   +N+  G F   K SW+N
Sbjct  80    RWHKFFKMWKRSSIKRLPTFPPLA--VPRISRRK----SRSVRENVATG-FCHFKSSWKN  132

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             F+L +L+ AT+NFS EN++GKGG+AEVYKG L DGQ++AVKR+ K   +++E    FL E
Sbjct  133   FSLSDLNNATNNFSEENLIGKGGYAEVYKGCLPDGQLVAVKRLNKGTAEEQETS--FLCE  190

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             +G IAH++HPN AK++G+  + G +LVL+    GSL   L  + + L+W  R+K+  G+A
Sbjct  191   IGTIAHVDHPNTAKMVGYGVEGGTYLVLELSSQGSLGSFLRGSRDKLDWAARYKIIFGIA  250

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
              GL YLH  CQRRIIHRDI A NILLTED+  QI DFGLAKWLP++W HH V   EGTFG
Sbjct  251   NGLLYLHENCQRRIIHRDIKADNILLTEDFVPQICDFGLAKWLPKEWTHHNVGKFEGTFG  310

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y APEYFMHGIVDEKTDVF+FGVLLLE+ITGRQA+D S+QSLV+WAKPLL+++++K L D
Sbjct  311   YFAPEYFMHGIVDEKTDVFSFGVLLLEIITGRQALDDSQQSLVLWAKPLLDKHDVKGLID  370

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSKSVSSES  392
             P LGD ++  EM+  +  A  C++  P MRP M +V+ +L+ +     +  + ++ S E 
Sbjct  371   PVLGDKFNPEEMQHVILTAGLCVEQNPLMRPRMNQVMVLLRTDGGYNKKCLR-RTYSEEL  429

Query  391   LHIADFTST  365
             +  A++ ST
Sbjct  430   MDAAEYNST  438



>ref|XP_011023515.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X3 [Populus euphratica]
Length=428

 Score =   360 bits (925),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 253/391 (65%), Gaps = 18/391 (5%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFP--IVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
              W   F   KR S K  P  I P    +  RKSR         + +N    +    K + 
Sbjct  46    NWSRFFKSWKRFSLKHLPSFIPPPVPKEPKRKSR--------STRENTVLRNLYNFKSTL  97

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             ++FT  EL  AT+NF+ EN++GKGG AEVYKG L DG+++A+K++ K    ++     FL
Sbjct  98    QHFTFAELKMATNNFNHENLIGKGGFAEVYKGCLPDGRLVAIKQLTKGTLDEKTAG--FL  155

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAH++HPN AKL+G   D G+HLV +  P GSL   LH +   L+W  R+K+A+G
Sbjct  156   NELGIIAHVDHPNTAKLLGCGIDGGMHLVFELSPLGSLGSALHGSQVELDWSKRYKIALG  215

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  C+RRIIHRDI A NILLT+++  QI DFGLAKWLP +W HH VS  EGT
Sbjct  216   AADGLLYLHENCRRRIIHRDIKADNILLTKNFEPQICDFGLAKWLPTQWTHHNVSKFEGT  275

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEY+MHGIVDEKTD++AFGVLLLELITGR+ VD  +QSLV+WAKPLL+ ++ KEL
Sbjct  276   FGYFAPEYYMHGIVDEKTDIYAFGVLLLELITGRRPVDHLQQSLVVWAKPLLDNSDTKEL  335

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK----  410
             ADP LGD YD+ EM+R +  A  CI+  P +RP M +VV +L+G+  +    ++ K    
Sbjct  336   ADPSLGDNYDLEEMDRLVLTASLCIEQSPVLRPRMSQVVILLRGDEYVSERAKKGKGRAL  395

Query  409   --SVSSESLHIADFTSTSYRKHLDRHLQLIM  323
               + S E     D+ ST Y   L R+ +L +
Sbjct  396   LRTYSEEIFDAQDYNSTRYLNDLKRYKELAL  426



>ref|XP_009762353.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Nicotiana sylvestris]
Length=434

 Score =   360 bits (925),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 242/346 (70%), Gaps = 3/346 (1%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKP  1304
             P ++ W    +  + KS +     PL    + ++           +++ I   D +  +P
Sbjct  43    PVSI-WAGFLELFRTKSRRYLAKDPLSSLKLSKRFSSSMRELVGVAKNPIVDADLNYFRP  101

Query  1303  SWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieD  1124
               RNFTL EL  AT+NF  EN++GKGG+AEVYKG L  GQ +A+KR+ K  + +      
Sbjct  102   QRRNFTLSELLAATNNFHQENLIGKGGYAEVYKGCLKSGQFVAIKRLTKGKQDERTGD--  159

Query  1123  FLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVA  944
             FLSELGI+AH+NHPN AKLIG++ + G +LVL+  P+GSLA +L  + + L+WKIR+KVA
Sbjct  160   FLSELGIMAHVNHPNTAKLIGYAVEGGFYLVLELSPNGSLANMLQVSKQKLDWKIRYKVA  219

Query  943   VGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIE  764
             VGVAEGL YLH   QRRIIHRDI A+NILLT+D+  QI DFGLAKWLPE+W H  +S  E
Sbjct  220   VGVAEGLRYLHEGGQRRIIHRDIKAANILLTKDFEPQICDFGLAKWLPERWTHLTISKFE  279

Query  763   GTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIK  584
             GTFGY+APE+ MHGIVDEKTDVFAFGVL+LELITGR+A+D ++QSLV+WAKPLL++N I+
Sbjct  280   GTFGYLAPEFLMHGIVDEKTDVFAFGVLILELITGRRALDYTQQSLVIWAKPLLKKNRIR  339

Query  583   ELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
             EL DP L D Y++++M   +  A  CIQ     RP + +V+++LKG
Sbjct  340   ELVDPSLADDYNLLQMNLMVLAASLCIQQSSIRRPRISQVLQLLKG  385



>ref|XP_008234942.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Prunus mume]
Length=422

 Score =   360 bits (924),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 245/349 (70%), Gaps = 8/349 (2%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDC--GDFSIT  1310
             PT+ +W  +   ++ KS K  PI     H +++ S+RM  S              D    
Sbjct  43    PTS-RWHGLVQLLRTKSKK--PIATTM-HPLMKFSKRMSSSMRGIITPKFQSVIDDMYPF  98

Query  1309  KPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeeri  1130
             K  W+NF+L EL  AT +FS EN +GKGG+AEVYKG L  GQ++A+KR+ +   ++    
Sbjct  99    KSPWKNFSLYELQAATKSFSHENQIGKGGYAEVYKGCLPSGQLVAIKRLTRGTPEEITGD  158

Query  1129  eDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFK  950
               FL+E+GI+AH+NHPN A+LIG+  + G+HLVL+  P GSLA +L+ + E L+W IR+K
Sbjct  159   --FLAEIGIMAHVNHPNTARLIGYGVEGGMHLVLELSPKGSLASVLYGSKEKLDWGIRYK  216

Query  949   VAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSP  770
             +A+G A GL YLH  CQRRIIHRDI A+NILLTED+ A+I DFGLAKWLPEKW HH +S 
Sbjct  217   IALGAARGLQYLHEGCQRRIIHRDIKAANILLTEDFEAKICDFGLAKWLPEKWTHHTISK  276

Query  769   IEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNN  590
              EGTFGY+APE+ +HGIVDEKTDVFA+GV+LLEL+TGR+A+D S+QSLV+WAKPLL++N 
Sbjct  277   FEGTFGYLAPEFLLHGIVDEKTDVFAYGVVLLELVTGRRALDYSQQSLVLWAKPLLKKNV  336

Query  589   IKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             +K L DP L D Y+  +M   + VA +CIQ     RP+M +VV++L G+
Sbjct  337   VKSLVDPSLRDEYNTRQMNIVLLVASACIQQSSIRRPSMNQVVQLLSGD  385



>ref|XP_011033655.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Populus euphratica]
Length=396

 Score =   359 bits (921),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 186/348 (53%), Positives = 237/348 (68%), Gaps = 7/348 (2%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNIDCGDFSITK  1307
              A +W      ++ +S KS   +   G     +RKS  M  +       N D  +F   K
Sbjct  44    NASRWHGFVKLLRSRSKKSLATLHPLGVLKLSMRKSSSMRENIITNLFANSDSSNF---K  100

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
                 NFTL +L  AT+NFS EN++GKGG+AEVYKG L +G+++A+KR+ +    +     
Sbjct  101   SPRINFTLSDLQAATNNFSQENLIGKGGYAEVYKGCLQNGKIVAIKRLTRGTTDEIIGD-  159

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FLSE+GI+AH+NHPN AKLIG+  + G+HLVL+  PHGSLA +L+ + E L W IR+K+
Sbjct  160   -FLSEMGIMAHVNHPNTAKLIGYGIEGGMHLVLELSPHGSLASVLYGSKERLTWHIRYKI  218

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G A GL YLH  CQRRIIHRDI A+NILLTED+  QI DFGLAKWLPE W HH VS  
Sbjct  219   ALGTAHGLLYLHEGCQRRIIHRDIKAANILLTEDFEPQICDFGLAKWLPEHWTHHTVSKF  278

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+APEY MHGIVDEKTDVFAFGVLLLEL+TGR+A+D S+QSLV+WAKPLL+ N +
Sbjct  279   EGTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELVTGRRALDYSQQSLVLWAKPLLKNNEV  338

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
              EL DP L D Y+  +M   +  A  CIQ     RP+M +VV++L  E
Sbjct  339   GELVDPALVDDYNARQMNLVLLAASLCIQQSSIRRPDMIQVVQILNEE  386



>ref|XP_011033653.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Populus euphratica]
 ref|XP_011033654.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Populus euphratica]
Length=425

 Score =   359 bits (922),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 237/347 (68%), Gaps = 7/347 (2%)
 Frame = -3

Query  1480  TAVQWKSIFDQIKRKSAKSFPIVPLFG--HDIIRKSRRMFFSWSRCSEDNIDCGDFSITK  1307
              A +W      ++ +S KS   +   G     +RKS  M  +       N D  +F   K
Sbjct  44    NASRWHGFVKLLRSRSKKSLATLHPLGVLKLSMRKSSSMRENIITNLFANSDSSNF---K  100

Query  1306  PSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerie  1127
                 NFTL +L  AT+NFS EN++GKGG+AEVYKG L +G+++A+KR+ +    +     
Sbjct  101   SPRINFTLSDLQAATNNFSQENLIGKGGYAEVYKGCLQNGKIVAIKRLTRGTTDEIIGD-  159

Query  1126  DFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKV  947
              FLSE+GI+AH+NHPN AKLIG+  + G+HLVL+  PHGSLA +L+ + E L W IR+K+
Sbjct  160   -FLSEMGIMAHVNHPNTAKLIGYGIEGGMHLVLELSPHGSLASVLYGSKERLTWHIRYKI  218

Query  946   AVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPI  767
             A+G A GL YLH  CQRRIIHRDI A+NILLTED+  QI DFGLAKWLPE W HH VS  
Sbjct  219   ALGTAHGLLYLHEGCQRRIIHRDIKAANILLTEDFEPQICDFGLAKWLPEHWTHHTVSKF  278

Query  766   EGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNI  587
             EGTFGY+APEY MHGIVDEKTDVFAFGVLLLEL+TGR+A+D S+QSLV+WAKPLL+ N +
Sbjct  279   EGTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELVTGRRALDYSQQSLVLWAKPLLKNNEV  338

Query  586   KELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
              EL DP L D Y+  +M   +  A  CIQ     RP+M +VV++L G
Sbjct  339   GELVDPALVDDYNARQMNLVLLAASLCIQQSSIRRPDMIQVVQILNG  385



>ref|XP_007050718.1| Kinase family protein [Theobroma cacao]
 gb|EOX94875.1| Kinase family protein [Theobroma cacao]
Length=421

 Score =   359 bits (921),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 189/355 (53%), Positives = 244/355 (69%), Gaps = 16/355 (5%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCG-DFSITKPSW-  1298
             +W+      + +S KS   +  FG      S R+    S    +N+    DF  +  S+ 
Sbjct  46    RWRGFAQLFRSRSKKSLANLQPFG------SFRLSLGRSSSMRENVSVAPDFLASSNSYN  99

Query  1297  -----RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
                  + FTL EL  AT NFSSEN++GKGG+AEVYKG L +GQ++A+KR+ K    +   
Sbjct  100   LKSPRKVFTLSELHIATKNFSSENLIGKGGYAEVYKGSLPNGQLVAIKRLTKGTPDEIIG  159

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRF  953
                FLSELGI+AH+NHPN AKLIG+  + G+HLVL+  P+GSLA LL+ + + L+W IRF
Sbjct  160   D--FLSELGIMAHVNHPNTAKLIGYGIEGGMHLVLELSPNGSLASLLYGSKDKLKWGIRF  217

Query  952   KVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVS  773
             K+A+G AEGL YLH  C+RRIIHRD+ A+NILLT+D+  QI DFGLAKWLPE W HH VS
Sbjct  218   KIALGTAEGLSYLHEGCKRRIIHRDMKAANILLTKDFEPQICDFGLAKWLPEHWTHHTVS  277

Query  772   PIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQN  593
               EGTFGY+APEY MHGIVDEKTDVFAFGVLLLEL+TGR+A+D S+QSLV+WAKP L++N
Sbjct  278   KFEGTFGYLAPEYLMHGIVDEKTDVFAFGVLLLELVTGRRALDYSQQSLVLWAKPQLKKN  337

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE-NELK  431
             +I+EL DP LG+ Y+  +M   +  A  CI      RP M +VV++L G  N LK
Sbjct  338   DIRELIDPALGEDYNPRQMNLVLLAASLCIHQSSIRRPQMSQVVQLLNGNPNSLK  392



>emb|CDY37641.1| BnaC04g29830D [Brassica napus]
Length=405

 Score =   358 bits (920),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 257/365 (70%), Gaps = 18/365 (5%)
 Frame = -3

Query  1486  DPTAVQWKSIFDQIKRKSAKSFPIVPL-FGHDIIRKSRRMFFSWSRCS--EDNIDCGD--  1322
             +P++ +++ I + ++  S KS   + + F ++ I+ S R      RC+   DN+  G   
Sbjct  31    NPSSSRFRRIVELLRSTSKKSLENLKIPFHNNAIKSSLR------RCTSLRDNLRFGSSN  84

Query  1321  ---FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
                F +  P  R FT  EL  AT+NF+ EN++GKGG+AEVYKGRL +GQ++A+KR+++ +
Sbjct  85    DAHFLVHSPR-RIFTFSELKIATNNFAFENLIGKGGYAEVYKGRLSNGQMVAIKRLMRGN  143

Query  1150  kkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETL  971
              ++      FLSE+GI+AH+NH N AKL+G+  + G+HLVL+  PHGSLA +L+++ E +
Sbjct  144   SEEIIGD--FLSEMGIMAHVNHSNIAKLLGYGVEGGMHLVLELSPHGSLASMLYSSKEKM  201

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
              W IR+K+A+GVAEGL YLH  C RRIIHRDI A+NILLT D+  QI DFGLAKWLPE W
Sbjct  202   NWSIRYKIALGVAEGLVYLHRGCHRRIIHRDIKAANILLTRDFSPQICDFGLAKWLPEHW  261

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              HH+VS  EGTFGY+APEY  HGIVDEKTDVFA GVLLLEL+TGR+A+D S+QSLV+WAK
Sbjct  262   THHIVSKFEGTFGYLAPEYLTHGIVDEKTDVFALGVLLLELVTGRRALDYSKQSLVLWAK  321

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE-NEL  434
             PL+++N I+EL DP L   YD  +++  +  A   IQ     RP M +VVE+LKG  N+L
Sbjct  322   PLMKKNKIRELIDPSLVGDYDWRQIKLVLLAASLSIQQSSIERPGMSQVVEILKGNLNDL  381

Query  433   KVELR  419
             K  ++
Sbjct  382   KCIMK  386



>ref|XP_002870457.1| hypothetical protein ARALYDRAFT_355584 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46716.1| hypothetical protein ARALYDRAFT_355584 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   358 bits (919),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 250/354 (71%), Gaps = 17/354 (5%)
 Frame = -3

Query  1483  PTAVQWKSIFDQIKRKSAKSFP--IVPLFGHDIIRKSRRMFFSWSRCS--EDNIDCGD--  1322
             P++ +++ +   ++ +S KS     +P   + +I+ S R      RCS   DN+  G   
Sbjct  32    PSSSRFRKMVQLLRSRSKKSIENLKIPFHNNGVIQSSLR------RCSSMRDNLRFGSSD  85

Query  1321  --FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedk  1148
               F +  P  R FT  +L  AT+NF+ EN++GKGG+AEVYKG L +GQ++A+KR+++ + 
Sbjct  86    AQFLLLSPR-RIFTFSDLKTATNNFALENLIGKGGYAEVYKGMLPNGQMVAIKRLMRGNS  144

Query  1147  kdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLE  968
             ++      FLSE+GI+AH+NHPN AKL+G+  + G+HLVL+  PHGSLA +L+N+ E ++
Sbjct  145   EEIIVD--FLSEMGIMAHVNHPNIAKLLGYGVEGGMHLVLELSPHGSLASMLYNSKEKMK  202

Query  967   WKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWG  788
             W IR+K+A+GVAEGL YLH  C RRIIHRD+ A+NILLT D+  QI DFGL+KWLPE W 
Sbjct  203   WSIRYKIALGVAEGLVYLHRGCHRRIIHRDVKAANILLTHDFSPQICDFGLSKWLPENWT  262

Query  787   HHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKP  608
             HH+VS  EGTFGY+APEY  HGIVDEKTDVFA GVLLLEL+TGR+A+D S+QSLV+WAKP
Sbjct  263   HHIVSKFEGTFGYLAPEYLTHGIVDEKTDVFALGVLLLELVTGRRALDYSKQSLVLWAKP  322

Query  607   LLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
             L+++N I+EL DP L   Y+  +++  +  A   IQ     RP M +VVE+LKG
Sbjct  323   LMKKNKIRELIDPSLSGEYEWRQIKSVLLAAALSIQQSSIERPEMSQVVEILKG  376



>ref|XP_009124247.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Brassica rapa]
 emb|CDX74624.1| BnaA04g07650D [Brassica napus]
Length=405

 Score =   358 bits (919),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 256/365 (70%), Gaps = 18/365 (5%)
 Frame = -3

Query  1486  DPTAVQWKSIFDQIKRKSAKSFPIVPL-FGHDIIRKSRRMFFSWSRCS--EDNIDCGD--  1322
             +P++ +++ I + ++  S KS   + + F ++ I+ S R      RC+   DN+  G   
Sbjct  31    NPSSSRFRRIVELLRSTSKKSLENLKIPFHNNAIKSSLR------RCTSLRDNLRFGSSN  84

Query  1321  ---FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
                F +  P  R FT  EL  AT+NF+ EN++GKGG+AEVYKGRL +GQ++A+KR+++ +
Sbjct  85    DAHFLVHSPR-RIFTFSELKIATNNFAFENLIGKGGYAEVYKGRLSNGQMVAIKRLMRGN  143

Query  1150  kkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETL  971
              ++      FLSE+GI+AH+NH N AKL+G+    G+HLVL+  PHGSLA +L+++ E +
Sbjct  144   SEEIIGD--FLSEMGIMAHVNHSNIAKLLGYGVQGGMHLVLELSPHGSLASMLYSSKEKM  201

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
              W IR+K+A+GVAEGL YLH  C RRIIHRDI A+NILLT D+  QI DFGLAKWLPE W
Sbjct  202   NWSIRYKIALGVAEGLVYLHRGCHRRIIHRDIKAANILLTHDFSPQICDFGLAKWLPEHW  261

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              HH+VS  EGTFGY+APEY  HGIVDEKTDVFA GVLLLEL+TGR+A+D S+QSLV+WAK
Sbjct  262   THHIVSKFEGTFGYLAPEYLTHGIVDEKTDVFALGVLLLELVTGRRALDYSKQSLVLWAK  321

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE-NEL  434
             PL+++N I+EL DP L   YD  +++  +  A   IQ     RP M +VVE+LKG  N+L
Sbjct  322   PLMKKNKIRELIDPSLVSDYDWRQIKLVLLAASLSIQQSSIERPGMSQVVEILKGNLNDL  381

Query  433   KVELR  419
             K  ++
Sbjct  382   KCIMK  386



>ref|XP_010025133.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Eucalyptus grandis]
Length=431

 Score =   359 bits (921),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 199/405 (49%), Positives = 252/405 (62%), Gaps = 20/405 (5%)
 Frame = -3

Query  1516  TRCGGSGGGFDPTAVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDN  1337
             T C  SG         W+  F   KRKS K     P      + K +      SR + +N
Sbjct  38    THCSNSGA-----LSHWRKFFTSWKRKSIKRLASFPPLAMPKLSKRK------SRSAREN  86

Query  1336  ID--CGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkri  1163
             I     D    K S  +FT  EL  AT+NFS EN++GKGG+AEVYKG L +GQ++AVKR+
Sbjct  87    ITPVLSDIYNFKASLVHFTFSELQMATNNFSPENLIGKGGYAEVYKGCLQNGQLVAVKRL  146

Query  1162  ikedkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNA  983
              K    +      FLSELG IAH+NHPN AKLIG   + G+H++ Q    GSL  +LH +
Sbjct  147   NKGTADERITS--FLSELGTIAHVNHPNIAKLIGCGVEGGMHIIFQLSALGSLGSVLHGS  204

Query  982   TETLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWL  803
                L W  R+K+A+G A+GL YLH  C RRIIHRDI A NILL ED+  QI DFGLAKWL
Sbjct  205   KANLGWDKRYKIALGTADGLLYLHESCHRRIIHRDIKADNILLAEDFEPQICDFGLAKWL  264

Query  802   PEKWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLV  623
             P++W HH VS  EGTFGY APEYFMHGIVDEKTDV+AFGVLLLELITG++A+D   +SLV
Sbjct  265   PKQWTHHNVSKFEGTFGYFAPEYFMHGIVDEKTDVYAFGVLLLELITGQKALDHLGKSLV  324

Query  622   MWAKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             +WAKPLL  N IK+L DP LGD Y+  EM+  +  A  CI+  P +RP M +V  +L+GE
Sbjct  325   LWAKPLLNDNVIKDLVDPSLGDDYNADEMDCVIMTASLCIEQSPILRPRMNQVAILLRGE  384

Query  442   ---NELKVELRQS--KSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
                +E     R+S  ++ S E L   ++ ST Y   L RH ++ +
Sbjct  385   SFISECTEGQRRSLQRTYSEELLDAQEYNSTRYLSDLKRHKEVAL  429



>ref|XP_009124248.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Brassica rapa]
 ref|XP_009124249.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X3 [Brassica rapa]
Length=405

 Score =   358 bits (919),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 256/365 (70%), Gaps = 18/365 (5%)
 Frame = -3

Query  1486  DPTAVQWKSIFDQIKRKSAKSFPIVPL-FGHDIIRKSRRMFFSWSRCS--EDNIDCGD--  1322
             +P++ +++ I + ++  S KS   + + F ++ I+ S R      RC+   DN+  G   
Sbjct  31    NPSSSRFRRIVELLRSTSKKSLENLKIPFHNNAIKSSLR------RCTSLRDNLRFGSSN  84

Query  1321  ---FSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriiked  1151
                F +  P  R FT  EL  AT+NF+ EN++GKGG+AEVYKGRL +GQ++A+KR+++ +
Sbjct  85    DAHFLVHSPR-RIFTFSELKIATNNFAFENLIGKGGYAEVYKGRLSNGQMVAIKRLMRGN  143

Query  1150  kkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETL  971
              ++      FLSE+GI+AH+NH N AKL+G+    G+HLVL+  PHGSLA +L+++ E +
Sbjct  144   SEEIIGD--FLSEMGIMAHVNHSNIAKLLGYGVQGGMHLVLELSPHGSLASMLYSSKEKM  201

Query  970   EWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKW  791
              W IR+K+A+GVAEGL YLH  C RRIIHRDI A+NILLT D+  QI DFGLAKWLPE W
Sbjct  202   NWSIRYKIALGVAEGLVYLHRGCHRRIIHRDIKAANILLTHDFSPQICDFGLAKWLPEHW  261

Query  790   GHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAK  611
              HH+VS  EGTFGY+APEY  HGIVDEKTDVFA GVLLLEL+TGR+A+D S+QSLV+WAK
Sbjct  262   THHIVSKFEGTFGYLAPEYLTHGIVDEKTDVFALGVLLLELVTGRRALDYSKQSLVLWAK  321

Query  610   PLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE-NEL  434
             PL+++N I+EL DP L   YD  +++  +  A   IQ     RP M +VVE+LKG  N+L
Sbjct  322   PLMKKNKIRELIDPSLVSDYDWRQIKLVLLAASLSIQQSSIERPGMSQVVEILKGNLNDL  381

Query  433   KVELR  419
             K  ++
Sbjct  382   KCIMK  386



>ref|XP_003553445.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Glycine max]
Length=405

 Score =   358 bits (918),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 241/337 (72%), Gaps = 7/337 (2%)
 Frame = -3

Query  1456  FDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRNFTLQE  1277
             F Q+ R ++K  PI  L    +++ SRRM    S    + I   D S+ +P W+ FT  E
Sbjct  47    FLQLLRDTSKK-PIATLHPLSVLKLSRRM----SSSMRETIIDADSSLHRPPWKIFTHHE  101

Query  1276  LSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSELGIIA  1097
             +  AT+ F+ EN +GKGG+AEVYKG L +GQ++A+KR+    + +      FLSELGI+A
Sbjct  102   IQIATNCFTQENFIGKGGYAEVYKGCLPNGQLVAIKRLTHGTENETIGD--FLSELGIMA  159

Query  1096  HINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVAEGLHY  917
             H+NHPN AKL+G+  + G+HLVL+    G LA +L+   E L W IR K+A+G A+G+ Y
Sbjct  160   HVNHPNTAKLVGYGVEGGMHLVLELSEKGCLASVLNGFKEKLPWSIRQKIALGTAKGIMY  219

Query  916   LHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFGYMAPE  737
             LH  CQRRIIHRDITA+NILLTED+  QI DFGLAKWLPE W HH VS IEGTFGY+APE
Sbjct  220   LHEGCQRRIIHRDITAANILLTEDFEPQICDFGLAKWLPENWTHHTVSKIEGTFGYLAPE  279

Query  736   YFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELADPRLGD  557
             Y +HGIVDEKTDVFAFGV+LLEL+TGR+A+D S+QSLV+WAKPLL++N+I+EL DP L D
Sbjct  280   YLLHGIVDEKTDVFAFGVVLLELVTGRRALDHSQQSLVLWAKPLLKKNSIRELIDPSLAD  339

Query  556   AYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
              +D  +++  ++ A  CIQ     RP MK+VV++L G
Sbjct  340   DFDCRQIKIMLWAASLCIQQSSIHRPFMKQVVQLLNG  376



>ref|XP_007030763.1| Autophagy 18 H [Theobroma cacao]
 gb|EOY11265.1| Autophagy 18 H [Theobroma cacao]
Length=1402

 Score =   382 bits (980),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 201/405 (50%), Positives = 266/405 (66%), Gaps = 22/405 (5%)
 Frame = -3

Query  1513  RCGGSGGGFDPTAVQWKSIFDQIKRKSAKSFP-IVPLFGHDIIRKSRRMFFSWSRCSEDN  1337
             RC   G         W+  F   KR+S K      PL    + RK+       SR +++N
Sbjct  94    RCTNGGA-----LANWRKFFKLWKRRSRKHLAAFTPLAVPKLSRKN-------SRSTKEN  141

Query  1336  IDCGDFSITKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriik  1157
                 D    K S  +F+L EL  ATDNFS EN++GKGG+AEVYKGRL DG+++A+KR+IK
Sbjct  142   PVLRDLYNFKSSLEDFSLPELRAATDNFSQENLIGKGGYAEVYKGRLKDGKLVAIKRLIK  201

Query  1156  edkkdeerieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATE  977
                 +      FLSELGIIAH+NHPN A LIG   D G+HLV Q  P GSL  +LH +  
Sbjct  202   GTPDERTAG--FLSELGIIAHVNHPNTATLIGCGIDGGMHLVFQLSPLGSLGSVLHGSKG  259

Query  976   TLEWKIRFKVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPE  797
              L+W  R+K+A+G A+GL YLH  C+RRIIHRDI A NILLTE++  QI DFGLAKWLP+
Sbjct  260   VLDWNKRYKIALGTADGLTYLHETCERRIIHRDIKADNILLTENFEPQICDFGLAKWLPK  319

Query  796   KWGHHVVSPIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMW  617
             +W HH VS  EGTFGY APEYFMHGIVDEKTDV+AFGVLLLELITGR+A+D  +QS+V+W
Sbjct  320   QWTHHNVSKFEGTFGYFAPEYFMHGIVDEKTDVYAFGVLLLELITGRRALDDQQQSVVLW  379

Query  616   AKPLLEQNNIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENE  437
             AKPLL++N+IKEL DP LGD YD  E++R +  A  CI+  P +RP M +VV +L+G+  
Sbjct  380   AKPLLDENDIKELVDPSLGDDYDAEEVDRMVLTASLCIEQSPILRPQMSQVVILLRGDEY  439

Query  436   LKVELRQ-------SKSVSSESLHIADFTSTSYRKHLDRHLQLIM  323
             +  +  +        ++ S+E L   ++ ST +  +++R  ++ +
Sbjct  440   VAADCAKEPHRRSIQRTYSNELLDAQEYNSTKHLNNINRLREIAL  484



>ref|NP_198445.1| receptor-like cytoplasmic kinase VIA5 [Arabidopsis thaliana]
 dbj|BAB09252.1| serine/threonine protein kinase-like [Arabidopsis thaliana]
 gb|AED94033.1| receptor-like cytoplasmic kinase VIA5 [Arabidopsis thaliana]
Length=429

 Score =   358 bits (919),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 247/349 (71%), Gaps = 5/349 (1%)
 Frame = -3

Query  1486  DPTAVQWKSIFDQIKRKSAKSFPIV--PLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSI  1313
             +P++ +++ +   ++ KS KS   V  P   + +I+ S R   S       + +   F +
Sbjct  56    NPSSSRFRKMVQLLRSKSKKSLENVKIPFHNNGVIKSSFRRCSSMRENLRFSSNDSHFLL  115

Query  1312  TKPSWRNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeer  1133
               P  R FT  +L  AT+NFS EN++GKGG+AEVYKG L +GQ++A+KR+++ + ++   
Sbjct  116   HSPR-RIFTFSDLKSATNNFSLENLIGKGGYAEVYKGMLPNGQMVAIKRLMRGNSEEIIV  174

Query  1132  ieDFLSELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRF  953
                FLSE+GI+AH+NHPN AKL+G+  + G+HLVL+  PHGSLA +L+++ E ++W IR+
Sbjct  175   D--FLSEMGIMAHVNHPNIAKLLGYGVEGGMHLVLELSPHGSLASMLYSSKEKMKWSIRY  232

Query  952   KVAVGVAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVS  773
             K+A+GVAEGL YLH  C RRIIHRDI A+NILLT D+  QI DFGLAKWLPE W HH+VS
Sbjct  233   KIALGVAEGLVYLHRGCHRRIIHRDIKAANILLTHDFSPQICDFGLAKWLPENWTHHIVS  292

Query  772   PIEGTFGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQN  593
               EGTFGY+APEY  HGIVDEKTDVFA GVLLLEL+TGR+A+D S+QSLV+WAKPL+++N
Sbjct  293   KFEGTFGYLAPEYLTHGIVDEKTDVFALGVLLLELVTGRRALDYSKQSLVLWAKPLMKKN  352

Query  592   NIKELADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKG  446
              I+EL DP L   Y+  +++  +  A   IQ     RP M +VVE+LKG
Sbjct  353   KIRELIDPSLAGEYEWRQIKLVLLAAALSIQQSSIERPEMSQVVEILKG  401



>ref|XP_011023514.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Populus euphratica]
Length=490

 Score =   360 bits (924),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 253/391 (65%), Gaps = 18/391 (5%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFP--IVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
              W   F   KR S K  P  I P    +  RKSR         + +N    +    K + 
Sbjct  108   NWSRFFKSWKRFSLKHLPSFIPPPVPKEPKRKSR--------STRENTVLRNLYNFKSTL  159

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             ++FT  EL  AT+NF+ EN++GKGG AEVYKG L DG+++A+K++ K    ++     FL
Sbjct  160   QHFTFAELKMATNNFNHENLIGKGGFAEVYKGCLPDGRLVAIKQLTKGTLDEKTAG--FL  217

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAH++HPN AKL+G   D G+HLV +  P GSL   LH +   L+W  R+K+A+G
Sbjct  218   NELGIIAHVDHPNTAKLLGCGIDGGMHLVFELSPLGSLGSALHGSQVELDWSKRYKIALG  277

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  C+RRIIHRDI A NILLT+++  QI DFGLAKWLP +W HH VS  EGT
Sbjct  278   AADGLLYLHENCRRRIIHRDIKADNILLTKNFEPQICDFGLAKWLPTQWTHHNVSKFEGT  337

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEY+MHGIVDEKTD++AFGVLLLELITGR+ VD  +QSLV+WAKPLL+ ++ KEL
Sbjct  338   FGYFAPEYYMHGIVDEKTDIYAFGVLLLELITGRRPVDHLQQSLVVWAKPLLDNSDTKEL  397

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK----  410
             ADP LGD YD+ EM+R +  A  CI+  P +RP M +VV +L+G+  +    ++ K    
Sbjct  398   ADPSLGDNYDLEEMDRLVLTASLCIEQSPVLRPRMSQVVILLRGDEYVSERAKKGKGRAL  457

Query  409   --SVSSESLHIADFTSTSYRKHLDRHLQLIM  323
               + S E     D+ ST Y   L R+ +L +
Sbjct  458   LRTYSEEIFDAQDYNSTRYLNDLKRYKELAL  488



>ref|XP_004290699.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2-like [Fragaria vesca subsp. vesca]
Length=411

 Score =   357 bits (916),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 176/343 (51%), Positives = 242/343 (71%), Gaps = 6/343 (2%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSWRN  1292
             +W  +   ++ KS +S  + P+  H +++ S++M  S        +        K  W+N
Sbjct  45    RWHGLVQLLRTKSKRS--LAPM--HPLLKLSKKMSSSMREIITPKLVSDSEYPFKSPWKN  100

Query  1291  FTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFLSE  1112
             F++ EL  AT NFS ENM+GKGG+AEVYKG L +GQ +A+KR+ +   ++      FLSE
Sbjct  101   FSIHELQAATKNFSQENMIGKGGYAEVYKGCLANGQFVAIKRLTRGTPEEITGD--FLSE  158

Query  1111  LGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVGVA  932
             +GI+AH+NHPN AKLIG+  + G+HLVL+  P GSLA +L+ +   LEW +R+K+A+G A
Sbjct  159   IGIMAHVNHPNTAKLIGYGVEGGMHLVLELSPQGSLASVLYGSKVKLEWGVRYKIALGAA  218

Query  931   EGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGTFG  752
             +GL YLH  C RRIIHRDI A+NILLTE++ A+I DFGLAKWLPE W HH +S  EGTFG
Sbjct  219   KGLQYLHEGCLRRIIHRDIKAANILLTEEFEAKICDFGLAKWLPESWTHHTISKFEGTFG  278

Query  751   YMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKELAD  572
             Y+APE+ +HGIVDEKTDVFAFGVLLLEL+TGR+A+D S+QSLV+WAKPLL++N+I+EL D
Sbjct  279   YLAPEFLLHGIVDEKTDVFAFGVLLLELVTGRRALDYSQQSLVLWAKPLLKKNDIRELVD  338

Query  571   PRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGE  443
             P L + Y+  +M   +  A  CIQ     RP+M +V+ +L G+
Sbjct  339   PSLANDYNPQQMNLVLLAASLCIQRSSIRRPSMNQVLLLLNGD  381



>ref|XP_011013520.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X2 [Populus euphratica]
Length=490

 Score =   360 bits (923),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 253/391 (65%), Gaps = 18/391 (5%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFP--IVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
              W   F   KR S K  P  I P    +  RKSR         + +N    +    K + 
Sbjct  108   NWSRFFKSWKRFSLKHLPSFIPPPVPKEPKRKSR--------STRENTVLRNLYNFKSTL  159

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             ++FT  EL  AT+NF+ EN++GKGG AEVYKG L DG+++A+K++ K    ++     FL
Sbjct  160   QHFTFAELKMATNNFNHENLIGKGGFAEVYKGCLPDGRLVAIKQLTKGTLDEKTAG--FL  217

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAH++HPN AKL+G   D G+HLV +  P GSL   LH +   L+W  R+K+A+G
Sbjct  218   NELGIIAHVDHPNTAKLLGCGIDGGMHLVFELSPLGSLGSALHGSQVELDWSKRYKIALG  277

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  C+RRIIHRDI A NILLT+++  QI DFGLAKWLP +W HH VS  EGT
Sbjct  278   AADGLLYLHENCRRRIIHRDIKADNILLTKNFEPQICDFGLAKWLPTQWTHHNVSKFEGT  337

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEY+MHGIVDEKTD++AFGVLLLELITGR+ VD  +QSLV+WAKPLL+ ++ KEL
Sbjct  338   FGYFAPEYYMHGIVDEKTDIYAFGVLLLELITGRRPVDHLQQSLVVWAKPLLDNSDTKEL  397

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK----  410
             ADP LGD YD+ EM+R +  A  CI+  P +RP M +VV +L+G+  +    ++ K    
Sbjct  398   ADPSLGDNYDLEEMDRLVLTASLCIEQSPVLRPRMSQVVILLRGDEYVSERAKKGKGRAL  457

Query  409   --SVSSESLHIADFTSTSYRKHLDRHLQLIM  323
               + S E     D+ ST Y   L R+ +L +
Sbjct  458   LRTYSEEIFDAQDYNSTRYLNDLKRYKELAL  488



>ref|XP_009607171.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 [Nicotiana tomentosiformis]
Length=430

 Score =   358 bits (918),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 241/346 (70%), Gaps = 6/346 (2%)
 Frame = -3

Query  1477  AVQWKSIFDQIKRKSAKSFPIVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
             A +W    +  + KS +     PL        S R         ++ I   D +  KP W
Sbjct  44    ASKWAGFLELFRTKSRRYLAKDPLKLSKRFSSSMRELVG---VRKNPIVDADLNYFKPQW  100

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             R+FTL EL  AT+NF   N++GKGG+AEVYKG L  GQ +A+KR+ K  + +      FL
Sbjct  101   RSFTLSELHAATNNFHQGNLIGKGGYAEVYKGCLKSGQFVAIKRLTKGKQDERTGD--FL  158

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             SELGI+AH+NHPN AKLIG++ + GL+LVL+  P+GSLA +L  + + L+WKIR+KVAVG
Sbjct  159   SELGIMAHVNHPNTAKLIGYAVE-GLYLVLELSPNGSLANMLQVSKQKLDWKIRYKVAVG  217

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
             VAEGL YLH   QRRIIHRDI A+NILLT+D+  QI DFGLAKWLPE+W H  +S  EGT
Sbjct  218   VAEGLRYLHEGGQRRIIHRDIKAANILLTKDFEPQICDFGLAKWLPERWTHITISKFEGT  277

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY+APE+ MHGIVDEKTDVFAFGVL+LELITGR+A+D ++QSLV+WAKPLL++N I+EL
Sbjct  278   FGYLAPEFLMHGIVDEKTDVFAFGVLILELITGRRALDYTQQSLVIWAKPLLKKNRIREL  337

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGEN  440
              DP L D Y++++M   +  A  CIQ     RP + +V+++LKG +
Sbjct  338   VDPSLADDYNLLQMNLMVLAASLCIQQSSIRRPRISQVLQLLKGNS  383



>ref|XP_011013519.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK2 isoform X1 [Populus euphratica]
Length=500

 Score =   360 bits (924),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 191/391 (49%), Positives = 253/391 (65%), Gaps = 18/391 (5%)
 Frame = -3

Query  1471  QWKSIFDQIKRKSAKSFP--IVPLFGHDIIRKSRRMFFSWSRCSEDNIDCGDFSITKPSW  1298
              W   F   KR S K  P  I P    +  RKSR         + +N    +    K + 
Sbjct  118   NWSRFFKSWKRFSLKHLPSFIPPPVPKEPKRKSR--------STRENTVLRNLYNFKSTL  169

Query  1297  RNFTLQELSQATDNFSSENMLGKGGHAEVYKGRLGDGQVIAVkriikedkkdeerieDFL  1118
             ++FT  EL  AT+NF+ EN++GKGG AEVYKG L DG+++A+K++ K    ++     FL
Sbjct  170   QHFTFAELKMATNNFNHENLIGKGGFAEVYKGCLPDGRLVAIKQLTKGTLDEKTAG--FL  227

Query  1117  SELGIIAHINHPNAAKLIGFSADNGLHLVLQYLPHGSLAFLLHNATETLEWKIRFKVAVG  938
             +ELGIIAH++HPN AKL+G   D G+HLV +  P GSL   LH +   L+W  R+K+A+G
Sbjct  228   NELGIIAHVDHPNTAKLLGCGIDGGMHLVFELSPLGSLGSALHGSQVELDWSKRYKIALG  287

Query  937   VAEGLHYLHCVCQRRIIHRDITASNILLTEDYGAQISDFGLAKWLPEKWGHHVVSPIEGT  758
              A+GL YLH  C+RRIIHRDI A NILLT+++  QI DFGLAKWLP +W HH VS  EGT
Sbjct  288   AADGLLYLHENCRRRIIHRDIKADNILLTKNFEPQICDFGLAKWLPTQWTHHNVSKFEGT  347

Query  757   FGYMAPEYFMHGIVDEKTDVFAFGVLLLELITGRQAVDSSRQSLVMWAKPLLEQNNIKEL  578
             FGY APEY+MHGIVDEKTD++AFGVLLLELITGR+ VD  +QSLV+WAKPLL+ ++ KEL
Sbjct  348   FGYFAPEYYMHGIVDEKTDIYAFGVLLLELITGRRPVDHLQQSLVVWAKPLLDNSDTKEL  407

Query  577   ADPRLGDAYDVVEMERSMFVALSCIQHLPNMRPNMKKVVEVLKGENELKVELRQSK----  410
             ADP LGD YD+ EM+R +  A  CI+  P +RP M +VV +L+G+  +    ++ K    
Sbjct  408   ADPSLGDNYDLEEMDRLVLTASLCIEQSPVLRPRMSQVVILLRGDEYVSERAKKGKGRAL  467

Query  409   --SVSSESLHIADFTSTSYRKHLDRHLQLIM  323
               + S E     D+ ST Y   L R+ +L +
Sbjct  468   LRTYSEEIFDAQDYNSTRYLNDLKRYKELAL  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6318306807628