BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26837_g1_i1 len=849 path=[827:0-848]

Length=849
                                                                      Score     E

ref|XP_009588535.1|  PREDICTED: sacsin isoform X2                       508   5e-161   
ref|XP_009588464.1|  PREDICTED: sacsin isoform X1                       508   6e-161   
ref|XP_009758398.1|  PREDICTED: sacsin                                  507   3e-160   
ref|XP_006354978.1|  PREDICTED: sacsin-like                             505   1e-159   
ref|XP_010315556.1|  PREDICTED: sacsin                                  502   2e-158   
emb|CDP11009.1|  unnamed protein product                                500   8e-158   
ref|XP_011093575.1|  PREDICTED: sacsin                                  499   3e-157   
ref|XP_002307173.2|  hypothetical protein POPTR_0005s09590g             493   2e-155   Populus trichocarpa [western balsam poplar]
ref|XP_010648419.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             493   4e-155   
ref|XP_011022055.1|  PREDICTED: uncharacterized protein LOC105123...    492   6e-155   
ref|XP_011022054.1|  PREDICTED: uncharacterized protein LOC105123...    492   6e-155   
ref|XP_008221054.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             489   6e-154   
ref|XP_007221931.1|  hypothetical protein PRUPE_ppa000003mg             489   7e-154   
gb|EYU27279.1|  hypothetical protein MIMGU_mgv1a000002mg                488   2e-153   
ref|XP_004297744.1|  PREDICTED: sacsin-like                             486   7e-153   
ref|XP_002527141.1|  protein binding protein, putative                  484   4e-152   Ricinus communis
ref|XP_009351717.1|  PREDICTED: sacsin                                  481   7e-151   
ref|XP_010245479.1|  PREDICTED: sacsin                                  480   7e-151   
ref|XP_008340450.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             479   2e-150   
ref|XP_010688704.1|  PREDICTED: sacsin                                  476   2e-149   
gb|KGN45079.1|  hypothetical protein Csa_7G420720                       474   7e-149   
ref|XP_010094076.1|  hypothetical protein L484_018092                   474   9e-149   
ref|XP_004135955.1|  PREDICTED: uncharacterized protein LOC101212447    474   1e-148   
ref|XP_004158223.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        474   1e-148   
ref|XP_008461369.1|  PREDICTED: sacsin isoform X1                       474   1e-148   
ref|XP_008461370.1|  PREDICTED: uncharacterized protein LOC103499...    473   2e-148   
ref|XP_004960086.1|  PREDICTED: uncharacterized protein LOC101774020    472   6e-148   
gb|KDO52761.1|  hypothetical protein CISIN_1g0000071mg                  471   7e-148   
gb|KHN29572.1|  Sacsin                                                  470   2e-147   
ref|XP_008668531.1|  PREDICTED: uncharacterized protein LOC100501...    470   3e-147   
ref|XP_003533689.1|  PREDICTED: sacsin-like                             470   3e-147   
tpg|DAA35374.1|  TPA: putative RING zinc finger domain superfamil...    469   4e-147   
ref|XP_006484544.1|  PREDICTED: uncharacterized protein LOC102609886    469   4e-147   
tpg|DAA35373.1|  TPA: putative RING zinc finger domain superfamil...    468   4e-147   
ref|XP_007043303.1|  Binding protein, putative isoform 1                469   6e-147   
ref|XP_004516754.1|  PREDICTED: uncharacterized protein LOC101513373    469   6e-147   
ref|XP_006437569.1|  hypothetical protein CICLE_v10030469mg             469   7e-147   
ref|XP_007043304.1|  Binding protein, putative isoform 2                468   9e-147   
ref|XP_008803352.1|  PREDICTED: sacsin                                  468   1e-146   
gb|KHG13033.1|  Sacsin                                                  468   2e-146   
ref|XP_007153087.1|  hypothetical protein PHAVU_003G005800g             468   2e-146   
ref|XP_009398271.1|  PREDICTED: sacsin                                  467   3e-146   
gb|KHM99059.1|  Endoglucanase 12                                        466   4e-146   
gb|KEH40905.1|  zinc finger, C3HC4 type (RING finger) protein           466   6e-146   
ref|XP_006653022.1|  PREDICTED: uncharacterized protein LOC102717242    465   2e-145   
ref|XP_010547719.1|  PREDICTED: uncharacterized protein LOC104819...    464   4e-145   
emb|CAE03243.2|  OSJNBa0018M05.18                                       464   4e-145   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86102.1|  H0103C06.6                                             464   4e-145   Oryza sativa [red rice]
emb|CBG76273.1|  OO_Ba0005L10-OO_Ba0081K17.24                           464   5e-145   Oryza officinalis
ref|XP_006605419.1|  PREDICTED: sacsin-like                             463   6e-145   
gb|EEE61898.1|  hypothetical protein OsJ_16607                          463   6e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447315.1|  hypothetical protein SORBIDRAFT_06g032770          463   6e-145   Sorghum bicolor [broomcorn]
ref|XP_010547718.1|  PREDICTED: sacsin isoform X3                       463   7e-145   
ref|XP_010547716.1|  PREDICTED: sacsin isoform X1                       463   7e-145   
ref|XP_010031907.1|  PREDICTED: uncharacterized protein LOC104421...    463   8e-145   
ref|XP_010031906.1|  PREDICTED: uncharacterized protein LOC104421...    463   9e-145   
ref|XP_010935539.1|  PREDICTED: sacsin                                  462   1e-144   
ref|XP_010240604.1|  PREDICTED: sacsin                                  462   1e-144   
ref|XP_010456655.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        462   2e-144   
ref|XP_010421109.1|  PREDICTED: sacsin-like                             461   3e-144   
ref|XP_002872036.1|  zinc finger family protein                         460   8e-144   
ref|NP_197702.1|  uncharacterized protein                               460   9e-144   Arabidopsis thaliana [mouse-ear cress]
gb|EMS66849.1|  Sacsin                                                  460   9e-144   
gb|EMT30440.1|  Sacsin                                                  460   1e-143   
ref|XP_006286874.1|  hypothetical protein CARUB_v10000018mg             459   3e-143   
ref|XP_006847865.1|  hypothetical protein AMTR_s00029p00083380          456   3e-142   
emb|CDY02207.1|  BnaA03g39600D                                          455   3e-142   
ref|XP_006394579.1|  hypothetical protein EUTSA_v10003499mg             455   5e-142   
ref|XP_009136390.1|  PREDICTED: sacsin                                  455   5e-142   
gb|KFK27634.1|  hypothetical protein AALP_AA8G408700                    455   5e-142   
gb|KDP43312.1|  hypothetical protein JCGZ_24233                         435   4e-135   
ref|XP_001765706.1|  predicted protein                                  395   3e-121   
ref|XP_002988476.1|  hypothetical protein SELMODRAFT_159510             370   2e-112   
ref|XP_002978873.1|  hypothetical protein SELMODRAFT_152901             369   6e-112   
ref|XP_005650565.1|  hypothetical protein COCSUDRAFT_46461              326   3e-97    
ref|XP_002953889.1|  hypothetical protein VOLCADRAFT_118510             306   3e-90    
gb|EWM29613.1|  Ubiquitin-associated/translation elongation facto...    299   1e-87    
ref|XP_002509303.1|  predicted protein                                  292   2e-85    Micromonas commoda
ref|XP_005840977.1|  hypothetical protein GUITHDRAFT_100248             292   2e-85    
ref|XP_003061457.1|  predicted protein                                  286   3e-83    
gb|ETM49653.1|  hypothetical protein L914_06148                         280   2e-81    
gb|ETP47728.1|  hypothetical protein, variant 2                         280   3e-81    
gb|ETP47727.1|  hypothetical protein, variant 1                         280   3e-81    
gb|ETL96494.1|  hypothetical protein, variant 2                         280   3e-81    
gb|ETL96493.1|  hypothetical protein, variant 1                         280   3e-81    
gb|ETI50016.1|  hypothetical protein, variant 2                         280   3e-81    
gb|ETP47729.1|  hypothetical protein, variant 3                         280   3e-81    
gb|ETK89913.1|  hypothetical protein, variant 1                         280   3e-81    
gb|ETO78749.1|  hypothetical protein, variant 4                         280   3e-81    
gb|ETP19794.1|  hypothetical protein, variant 2                         280   3e-81    
gb|ETO78747.1|  hypothetical protein, variant 2                         280   3e-81    
ref|XP_008891782.1|  hypothetical protein, variant 2                    280   3e-81    
gb|ETK89914.1|  hypothetical protein, variant 2                         280   3e-81    
gb|ETP19793.1|  hypothetical protein, variant 1                         280   3e-81    
gb|ETL43313.1|  hypothetical protein, variant 2                         280   3e-81    
ref|XP_008891781.1|  hypothetical protein, variant 1                    280   3e-81    
gb|ETL43312.1|  hypothetical protein, variant 1                         280   3e-81    
gb|ETI50015.1|  hypothetical protein, variant 1                         280   3e-81    
gb|ETO78746.1|  hypothetical protein, variant 1                         280   3e-81    
gb|ETP47730.1|  hypothetical protein, variant 4                         280   3e-81    
gb|ETP19796.1|  hypothetical protein, variant 4                         280   3e-81    
ref|XP_008891783.1|  hypothetical protein, variant 4                    280   3e-81    
gb|ETP47726.1|  hypothetical protein F442_06378                         280   4e-81    
gb|ETP47731.1|  hypothetical protein, variant 5                         280   4e-81    
gb|ETO78750.1|  hypothetical protein, variant 5                         280   4e-81    
ref|XP_008891780.1|  hypothetical protein, variant 5                    280   4e-81    
gb|ETO78748.1|  hypothetical protein, variant 3                         280   4e-81    
gb|ETP19797.1|  hypothetical protein, variant 5                         280   4e-81    
gb|ETL43311.1|  hypothetical protein L916_06149                         280   4e-81    
gb|ETP19792.1|  hypothetical protein F441_06343                         280   4e-81    
ref|XP_008891779.1|  hypothetical protein, variant 3                    280   4e-81    
gb|ETP19795.1|  hypothetical protein, variant 3                         280   4e-81    
gb|ETI50014.1|  hypothetical protein F443_06336                         280   4e-81    
gb|ETK89912.1|  hypothetical protein L915_06212                         280   4e-81    
gb|ETO78745.1|  hypothetical protein F444_06398                         280   4e-81    
ref|XP_008891778.1|  hypothetical protein PPTG_02450                    280   4e-81    
gb|ETL96492.1|  hypothetical protein L917_06027                         280   4e-81    
ref|XP_005765974.1|  hypothetical protein EMIHUDRAFT_212654             276   7e-80    
emb|CBI27138.3|  unnamed protein product                                269   2e-77    
emb|CBI39913.3|  unnamed protein product                                266   3e-77    
gb|KDO29648.1|  hypothetical protein SPRG_05600                         246   1e-69    
ref|XP_008607680.1|  hypothetical protein SDRG_03814                    246   2e-69    
emb|CBN79498.1|  conserved unknown protein                              238   1e-66    
ref|XP_008864357.1|  hypothetical protein, variant                      229   2e-63    
ref|XP_008864356.1|  hypothetical protein H310_02575                    229   2e-63    
ref|XP_009040882.1|  hypothetical protein AURANDRAFT_67157              216   4e-59    
emb|CDY66470.1|  BnaC07g49850D                                          203   2e-55    
emb|CAN68779.1|  hypothetical protein VITISV_043379                     187   2e-53    Vitis vinifera
ref|XP_001690195.1|  predicted protein                                  187   4e-49    Chlamydomonas reinhardtii
ref|XP_004992090.1|  hypothetical protein PTSG_06697                    182   2e-47    
ref|XP_009519246.1|  hypothetical protein PHYSODRAFT_479380             176   2e-45    
gb|AFM84533.1|  sacsin                                                  170   2e-44    
gb|AFM84519.1|  sacsin                                                  169   2e-44    
gb|AFM84529.1|  sacsin                                                  169   4e-44    
ref|XP_003382377.1|  PREDICTED: sacsin-like                             172   5e-44    
gb|AFM84514.1|  sacsin                                                  169   5e-44    
ref|XP_002589277.1|  hypothetical protein BRAFLDRAFT_102519             172   5e-44    Branchiostoma floridae
gb|AFM84526.1|  sacsin                                                  168   6e-44    
gb|AFM84516.1|  sacsin                                                  168   7e-44    
ref|XP_002901723.1|  conserved hypothetical protein                     171   9e-44    
ref|XP_010163801.1|  PREDICTED: sacsin                                  171   1e-43    
gb|KFZ46646.1|  Sacsin                                                  171   2e-43    
gb|ELK09292.1|  Sacsin                                                  170   3e-43    
ref|XP_006915912.1|  PREDICTED: sacsin                                  170   3e-43    
ref|XP_009288519.1|  PREDICTED: sacsin                                  170   3e-43    
gb|KFV63988.1|  Sacsin                                                  170   3e-43    
gb|KFQ05946.1|  Sacsin                                                  170   3e-43    
ref|XP_010086209.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             170   3e-43    
gb|KFM02372.1|  Sacsin                                                  170   4e-43    
gb|ELK36851.1|  Sacsin                                                  169   4e-43    
ref|XP_009919582.1|  PREDICTED: sacsin                                  170   4e-43    
ref|XP_009894365.1|  PREDICTED: sacsin                                  170   4e-43    
ref|XP_010570952.1|  PREDICTED: sacsin                                  170   4e-43    
ref|XP_006754952.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             169   5e-43    
ref|XP_005883195.1|  PREDICTED: sacsin-like                             169   5e-43    
gb|EPQ18244.1|  Sacsin                                                  169   5e-43    
ref|XP_010000200.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             169   5e-43    
ref|XP_006083668.1|  PREDICTED: sacsin isoform X1                       169   5e-43    
gb|AFM84537.1|  sacsin                                                  166   5e-43    
ref|XP_006083669.1|  PREDICTED: sacsin isoform X2                       169   5e-43    
gb|AFM84521.1|  sacsin                                                  166   6e-43    
ref|XP_004604552.1|  PREDICTED: sacsin                                  169   6e-43    
ref|XP_008157701.1|  PREDICTED: sacsin isoform X2                       169   6e-43    
gb|KFU92814.1|  Sacsin                                                  169   6e-43    
ref|XP_008157700.1|  PREDICTED: sacsin isoform X1                       169   6e-43    
ref|XP_009950489.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        169   6e-43    
gb|AFM84512.1|  sacsin                                                  166   6e-43    
gb|AFM84531.1|  sacsin                                                  166   7e-43    
ref|XP_009475086.1|  PREDICTED: sacsin                                  169   7e-43    
gb|KFZ68285.1|  Sacsin                                                  169   7e-43    
gb|AFM84538.1|  sacsin                                                  166   7e-43    
ref|XP_005022634.1|  PREDICTED: sacsin                                  169   7e-43    
gb|EOA99087.1|  Sacsin                                                  169   7e-43    
ref|XP_009888919.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             169   7e-43    
ref|XP_010138377.1|  PREDICTED: sacsin                                  169   7e-43    
gb|KFP21003.1|  Sacsin                                                  169   7e-43    
gb|KFV57297.1|  Sacsin                                                  169   7e-43    
ref|XP_010306927.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             169   7e-43    
ref|XP_009326039.1|  PREDICTED: sacsin                                  169   7e-43    
ref|XP_009813779.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        169   8e-43    
ref|XP_009643181.1|  PREDICTED: sacsin                                  169   8e-43    
ref|XP_005446509.1|  PREDICTED: sacsin                                  169   8e-43    
ref|XP_009941509.1|  PREDICTED: sacsin                                  169   8e-43    
gb|KFO92165.1|  Sacsin                                                  169   8e-43    
gb|KFW69747.1|  Sacsin                                                  169   8e-43    
ref|XP_005244639.1|  PREDICTED: LOW QUALITY PROTEIN: spastic atax...    169   8e-43    
ref|XP_009486035.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        169   8e-43    
ref|XP_010198542.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             169   8e-43    
gb|KFR17487.1|  Sacsin                                                  169   8e-43    
gb|KFV46567.1|  Sacsin                                                  169   8e-43    
ref|XP_010191687.1|  PREDICTED: sacsin isoform X1                       169   8e-43    
gb|KFQ57525.1|  Sacsin                                                  169   8e-43    
ref|XP_010295867.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        169   8e-43    
ref|XP_010191688.1|  PREDICTED: sacsin isoform X2                       169   8e-43    
gb|KFP53043.1|  Sacsin                                                  169   8e-43    
gb|KFQ92839.1|  Sacsin                                                  169   8e-43    
ref|XP_009970016.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        169   9e-43    
ref|XP_009504976.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             169   9e-43    
ref|XP_009571237.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             169   9e-43    
gb|KFQ84776.1|  Sacsin                                                  169   9e-43    
ref|XP_009867454.1|  PREDICTED: sacsin                                  169   9e-43    
ref|XP_010013957.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             169   1e-42    
gb|KFP88474.1|  Sacsin                                                  168   1e-42    
gb|AFM84527.1|  sacsin                                                  165   1e-42    
ref|XP_005501499.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             168   1e-42    
gb|AFM84535.1|  sacsin                                                  165   1e-42    
gb|KFQ24452.1|  Sacsin                                                  168   1e-42    
ref|XP_005516322.1|  PREDICTED: sacsin                                  168   1e-42    
ref|XP_008948241.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        168   1e-42    
ref|XP_010949933.1|  PREDICTED: sacsin                                  168   1e-42    
gb|AFM84536.1|  sacsin                                                  165   1e-42    
ref|XP_009564744.1|  PREDICTED: sacsin                                  168   1e-42    
ref|XP_005038141.1|  PREDICTED: sacsin                                  168   1e-42    
gb|EKC22471.1|  Sacsin                                                  168   1e-42    
gb|EFB22146.1|  hypothetical protein PANDA_009473                       168   1e-42    Ailuropoda melanoleuca
ref|XP_005417740.1|  PREDICTED: sacsin                                  168   1e-42    
gb|EPY87075.1|  sacsin                                                  168   1e-42    
ref|XP_009071198.1|  PREDICTED: sacsin                                  168   1e-42    
ref|XP_008918914.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             168   1e-42    
gb|KFP07409.1|  Sacsin                                                  168   1e-42    
ref|XP_007074470.1|  PREDICTED: sacsin                                  168   2e-42    
gb|KFV11891.1|  Sacsin                                                  168   2e-42    
ref|XP_006176630.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             168   2e-42    
ref|XP_005635602.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             168   2e-42    
ref|XP_010157366.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        168   2e-42    
ref|XP_006927228.1|  PREDICTED: sacsin                                  168   2e-42    
ref|XP_008582381.1|  PREDICTED: sacsin                                  168   2e-42    
ref|XP_004186247.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             168   2e-42    
ref|XP_004774405.1|  PREDICTED: sacsin isoform X6                       168   2e-42    
ref|XP_002920712.1|  PREDICTED: sacsin-like                             168   2e-42    
ref|XP_009978816.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             168   2e-42    
ref|XP_005482576.1|  PREDICTED: sacsin                                  168   2e-42    
ref|XP_004774402.1|  PREDICTED: sacsin isoform X3                       168   2e-42    
ref|XP_004774400.1|  PREDICTED: sacsin isoform X1                       168   2e-42    
ref|XP_010987049.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             168   2e-42    
ref|XP_004774404.1|  PREDICTED: sacsin isoform X5                       168   2e-42    
gb|KFW12164.1|  Sacsin                                                  168   2e-42    
ref|XP_006216298.1|  PREDICTED: sacsin                                  168   2e-42    
ref|XP_010398799.1|  PREDICTED: sacsin isoform X1                       168   2e-42    
ref|XP_004774403.1|  PREDICTED: sacsin isoform X4                       168   2e-42    
ref|XP_010398806.1|  PREDICTED: sacsin isoform X2                       168   2e-42    
ref|XP_008500549.1|  PREDICTED: sacsin                                  168   2e-42    
ref|XP_004088146.1|  PREDICTED: sacsin                                  168   2e-42    
gb|AAF31262.1|AF193556_1  sacsin                                        167   2e-42    Homo sapiens [man]
ref|XP_008019908.1|  PREDICTED: sacsin isoform X4                       167   2e-42    
ref|XP_009425000.1|  PREDICTED: sacsin isoform X2                       167   2e-42    
ref|XP_008956773.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             167   2e-42    
ref|XP_008996285.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             167   2e-42    
gb|EHH28888.1|  DnaJ-like protein subfamily C member 29                 167   2e-42    
ref|XP_008019906.1|  PREDICTED: sacsin isoform X2                       167   2e-42    
ref|XP_009424999.1|  PREDICTED: sacsin isoform X1                       167   2e-42    
gb|EHH61786.1|  DnaJ-like protein subfamily C member 29                 167   2e-42    
ref|NP_001264984.1|  sacsin isoform 2                                   167   2e-42    
ref|XP_008690359.1|  PREDICTED: sacsin                                  167   2e-42    
ref|XP_009189895.1|  PREDICTED: sacsin isoform X5                       167   2e-42    
gb|KFO57051.1|  Sacsin                                                  167   2e-42    
gb|AFM84528.1|  sacsin                                                  164   2e-42    
ref|XP_004054297.1|  PREDICTED: sacsin                                  167   2e-42    
ref|XP_003913715.1|  PREDICTED: sacsin isoform X3                       167   2e-42    
ref|NP_055178.3|  sacsin isoform 1                                      167   2e-42    Homo sapiens [man]
ref|XP_009083862.1|  PREDICTED: sacsin                                  167   2e-42    
ref|XP_005266395.1|  PREDICTED: sacsin isoform X1                       167   2e-42    
ref|XP_005585535.1|  PREDICTED: sacsin isoform X5                       167   2e-42    
ref|XP_001089964.2|  PREDICTED: sacsin-like isoform 2                   167   2e-42    Macaca mulatta [rhesus macaque]
ref|XP_009189894.1|  PREDICTED: sacsin isoform X4                       167   2e-42    
ref|XP_009189893.1|  PREDICTED: sacsin isoform X2                       167   2e-42    
ref|XP_009189892.1|  PREDICTED: sacsin isoform X1                       167   2e-42    
ref|XP_008019905.1|  PREDICTED: sacsin isoform X1                       167   2e-42    
ref|XP_004409573.1|  PREDICTED: sacsin                                  167   2e-42    
ref|XP_010377928.1|  PREDICTED: sacsin                                  167   2e-42    
ref|XP_008019907.1|  PREDICTED: sacsin isoform X3                       167   2e-42    
ref|XP_005585531.1|  PREDICTED: sacsin isoform X1                       167   2e-42    
ref|XP_008629201.1|  PREDICTED: sacsin                                  167   2e-42    
ref|XP_005585534.1|  PREDICTED: sacsin isoform X4                       167   2e-42    
ref|XP_009695283.1|  PREDICTED: sacsin                                  167   2e-42    
ref|XP_005585533.1|  PREDICTED: sacsin isoform X3                       167   2e-42    
ref|XP_005149818.1|  PREDICTED: sacsin                                  167   2e-42    
ref|XP_002824122.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             167   2e-42    
ref|XP_006727905.1|  PREDICTED: sacsin isoform X1                       167   3e-42    
ref|XP_010727196.1|  PREDICTED: sacsin                                  167   3e-42    
ref|XP_006727906.1|  PREDICTED: sacsin isoform X2                       167   3e-42    
ref|XP_004453157.1|  PREDICTED: sacsin                                  167   3e-42    
gb|KFP40622.1|  Sacsin                                                  167   4e-42    
ref|XP_009684855.1|  PREDICTED: sacsin                                  167   4e-42    
ref|XP_010115953.1|  PREDICTED: sacsin                                  167   4e-42    
ref|XP_007495279.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             167   4e-42    
ref|XP_004938853.1|  PREDICTED: sacsin isoform X6                       167   4e-42    
gb|KFV87298.1|  Sacsin                                                  166   5e-42    
ref|XP_417138.4|  PREDICTED: sacsin isoform X5                          166   5e-42    
ref|XP_004938854.1|  PREDICTED: sacsin isoform X7                       166   5e-42    
ref|XP_005406373.1|  PREDICTED: sacsin                                  166   6e-42    
ref|XP_006159585.1|  PREDICTED: sacsin                                  166   6e-42    
ref|XP_004435316.1|  PREDICTED: sacsin isoform 2                        166   7e-42    
ref|XP_008071892.1|  PREDICTED: sacsin isoform X2                       166   7e-42    
ref|XP_004435315.1|  PREDICTED: sacsin isoform 1                        166   7e-42    
ref|XP_008258130.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             166   7e-42    
ref|XP_008071891.1|  PREDICTED: sacsin isoform X1                       166   7e-42    
ref|XP_004680205.1|  PREDICTED: sacsin                                  166   7e-42    
ref|XP_010592254.1|  PREDICTED: sacsin isoform X2                       166   8e-42    
gb|ELW47586.1|  Sacsin                                                  166   8e-42    
ref|XP_010592253.1|  PREDICTED: sacsin isoform X1                       166   8e-42    
ref|XP_003477292.2|  PREDICTED: LOW QUALITY PROTEIN: sacsin             166   8e-42    
ref|XP_008531558.1|  PREDICTED: sacsin                                  166   9e-42    
ref|XP_005601152.1|  PREDICTED: sacsin isoform X1                       166   9e-42    
ref|XP_004670595.1|  PREDICTED: sacsin isoform X1                       166   9e-42    
gb|ETE71199.1|  Sacsin                                                  166   9e-42    
ref|XP_004670596.1|  PREDICTED: sacsin isoform X2                       166   9e-42    
ref|XP_006832018.1|  PREDICTED: sacsin                                  166   9e-42    
ref|XP_005601153.1|  PREDICTED: sacsin isoform X2                       166   9e-42    
gb|AFM84517.1|  sacsin                                                  162   1e-41    
gb|KFO22202.1|  Sacsin                                                  166   1e-41    
ref|XP_010605785.1|  PREDICTED: sacsin isoform X2                       166   1e-41    
ref|XP_003796777.1|  PREDICTED: sacsin                                  166   1e-41    
ref|XP_010605784.1|  PREDICTED: sacsin isoform X1                       166   1e-41    
gb|EHA98399.1|  Sacsin                                                  166   1e-41    
gb|AFM84515.1|  sacsin                                                  162   1e-41    
ref|XP_003764508.1|  PREDICTED: sacsin                                  166   1e-41    
ref|XP_007533745.1|  PREDICTED: sacsin                                  166   1e-41    
ref|XP_004854909.1|  PREDICTED: sacsin isoform X2                       166   1e-41    
ref|XP_004854908.1|  PREDICTED: sacsin isoform X1                       166   1e-41    
ref|XP_004854910.1|  PREDICTED: sacsin isoform X3                       166   1e-41    
ref|XP_004877518.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             165   1e-41    
ref|XP_004854911.1|  PREDICTED: sacsin isoform X4                       165   1e-41    
ref|XP_004631088.1|  PREDICTED: sacsin isoform X1                       165   1e-41    
ref|XP_006039498.1|  PREDICTED: LOW QUALITY PROTEIN: spastic atax...    165   2e-41    
ref|XP_007422589.1|  PREDICTED: sacsin                                  165   2e-41    
ref|XP_004281836.1|  PREDICTED: sacsin                                  165   2e-41    
ref|XP_004315724.1|  PREDICTED: sacsin                                  165   2e-41    
ref|XP_007128441.1|  PREDICTED: sacsin isoform X1                       165   2e-41    
ref|XP_007164276.1|  PREDICTED: sacsin                                  165   2e-41    
ref|XP_002606448.1|  hypothetical protein BRAFLDRAFT_118535             165   2e-41    
ref|XP_006138940.1|  PREDICTED: sacsin isoform X4                       165   2e-41    
gb|AFM84532.1|  sacsin                                                  161   2e-41    
ref|XP_006138937.1|  PREDICTED: sacsin isoform X1                       165   2e-41    
ref|XP_008823226.1|  PREDICTED: sacsin                                  164   2e-41    
ref|XP_005315644.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin             164   2e-41    
ref|XP_007072702.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin molec...    164   2e-41    
ref|XP_007940710.1|  PREDICTED: sacsin                                  164   2e-41    
ref|XP_006894190.1|  PREDICTED: sacsin                                  164   3e-41    
ref|XP_002740585.1|  PREDICTED: sacsin-like                             164   3e-41    
ref|XP_007471523.1|  PREDICTED: sacsin                                  164   3e-41    
ref|XP_004577637.1|  PREDICTED: sacsin isoform X1                       164   3e-41    
ref|XP_010210173.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin-like        164   3e-41    
ref|XP_004386616.1|  PREDICTED: sacsin isoform 1                        164   3e-41    
ref|XP_004386617.1|  PREDICTED: sacsin isoform 2                        164   3e-41    
ref|XP_005975548.1|  PREDICTED: sacsin                                  164   3e-41    
ref|XP_010819302.1|  PREDICTED: sacsin isoform X3                       164   4e-41    
ref|XP_005888791.1|  PREDICTED: sacsin-like                             164   4e-41    
gb|ELR61498.1|  Sacsin                                                  164   4e-41    
ref|XP_006071002.1|  PREDICTED: sacsin isoform X2                       164   4e-41    
tpg|DAA23892.1|  TPA: hypothetical protein BOS_12530                    164   4e-41    
ref|XP_005687693.1|  PREDICTED: sacsin                                  164   4e-41    
ref|XP_005194206.1|  PREDICTED: sacsin isoform X2                       164   4e-41    
ref|XP_005194205.1|  PREDICTED: sacsin isoform X1                       164   4e-41    
ref|XP_010849500.1|  PREDICTED: sacsin                                  164   5e-41    
ref|XP_004012352.1|  PREDICTED: sacsin                                  164   5e-41    
ref|XP_006071001.1|  PREDICTED: sacsin isoform X1                       164   5e-41    
ref|XP_006260008.1|  PREDICTED: sacsin-like                             163   5e-41    
ref|XP_004714904.1|  PREDICTED: sacsin                                  163   8e-41    
ref|XP_008106211.1|  PREDICTED: sacsin isoform X3                       163   9e-41    
ref|XP_008106210.1|  PREDICTED: sacsin isoform X2                       163   1e-40    
ref|XP_008106209.1|  PREDICTED: sacsin isoform X1                       163   1e-40    
gb|AFM84530.1|  sacsin                                                  159   1e-40    
dbj|BAK00868.1|  predicted protein                                      149   1e-40    
ref|XP_004912121.1|  PREDICTED: sacsin                                  161   3e-40    
gb|AFM84523.1|  sacsin                                                  157   6e-40    
gb|AFM84520.1|  sacsin                                                  157   6e-40    
ref|XP_007662285.1|  PREDICTED: sacsin                                  160   7e-40    
ref|XP_001200196.1|  PREDICTED: sacsin-like                             160   8e-40    
ref|XP_008306727.1|  PREDICTED: sacsin                                  160   1e-39    
gb|AFM84534.1|  sacsin                                                  157   1e-39    
ref|XP_003726975.1|  PREDICTED: sacsin-like                             159   1e-39    
gb|ESA01166.1|  hypothetical protein GLOINDRAFT_262344                  159   1e-39    
ref|XP_002599568.1|  hypothetical protein BRAFLDRAFT_77670              159   2e-39    
ref|XP_005990601.1|  PREDICTED: sacsin                                  158   3e-39    
gb|AFM84524.1|  sacsin                                                  155   3e-39    
gb|AFM84522.1|  sacsin                                                  155   3e-39    
emb|CAG02848.1|  unnamed protein product                                158   4e-39    
ref|XP_002606415.1|  hypothetical protein BRAFLDRAFT_67666              157   5e-39    
ref|XP_009936914.1|  PREDICTED: sacsin-like                             157   6e-39    
gb|EXX51192.1|  hypothetical protein RirG_263850                        156   9e-39    
ref|XP_005720656.1|  PREDICTED: sacsin-like                             157   1e-38    
ref|XP_004544051.1|  PREDICTED: sacsin-like isoform X2                  157   1e-38    
ref|XP_009289776.1|  PREDICTED: sacsin isoform X1                       157   1e-38    
ref|XP_010776727.1|  PREDICTED: sacsin                                  157   1e-38    
ref|XP_009026668.1|  hypothetical protein HELRODRAFT_193608             157   1e-38    
ref|XP_004544050.1|  PREDICTED: sacsin-like isoform X1                  157   1e-38    
ref|XP_009289777.1|  PREDICTED: sacsin isoform X2                       157   1e-38    
ref|XP_005927399.1|  PREDICTED: sacsin-like isoform X2                  157   1e-38    
ref|XP_005927398.1|  PREDICTED: sacsin-like isoform X1                  157   1e-38    
ref|XP_005337640.1|  PREDICTED: sacsin isoform X2                       157   1e-38    
ref|XP_005337639.1|  PREDICTED: sacsin isoform X1                       156   1e-38    
ref|XP_005474627.1|  PREDICTED: sacsin-like                             155   2e-38    
ref|XP_003968348.1|  PREDICTED: sacsin-like                             155   3e-38    
ref|XP_005355453.1|  PREDICTED: sacsin isoform X1                       155   3e-38    
ref|XP_005355455.1|  PREDICTED: sacsin isoform X3                       155   3e-38    
ref|XP_005355454.1|  PREDICTED: sacsin isoform X2                       155   3e-38    
gb|AFM84513.1|  sacsin                                                  152   3e-38    
ref|XP_007623003.1|  PREDICTED: LOW QUALITY PROTEIN: sacsin isofo...    155   3e-38    
ref|XP_005075345.1|  PREDICTED: sacsin                                  155   3e-38    
gb|EDL36107.1|  mCG7227                                                 155   3e-38    
ref|XP_007639447.1|  PREDICTED: sacsin isoform X2                       155   3e-38    
gb|EGW04618.1|  Sacsin                                                  155   3e-38    
ref|XP_007639448.1|  PREDICTED: sacsin isoform X1                       155   3e-38    
ref|XP_010731885.1|  PREDICTED: sacsin                                  155   3e-38    
ref|XP_006519292.1|  PREDICTED: sacsin isoform X4                       155   3e-38    
ref|XP_006519290.1|  PREDICTED: sacsin isoform X2                       155   3e-38    
ref|XP_006519291.1|  PREDICTED: sacsin isoform X3                       155   3e-38    
ref|XP_006519289.1|  PREDICTED: sacsin isoform X1                       155   3e-38    
ref|XP_006986387.1|  PREDICTED: sacsin isoform X2                       155   4e-38    
ref|XP_006799884.1|  PREDICTED: sacsin-like                             155   4e-38    
ref|XP_004075943.1|  PREDICTED: sacsin-like                             155   4e-38    
gb|AFM84471.1|  sacsin                                                  152   4e-38    
ref|XP_003390766.1|  PREDICTED: sacsin-like                             155   4e-38    
gb|AAF31263.1|  sacsin                                                  155   4e-38    
ref|XP_001639543.1|  predicted protein                                  155   4e-38    
ref|XP_006986386.1|  PREDICTED: sacsin isoform X1                       155   5e-38    
ref|XP_010849547.1|  PREDICTED: sacsin-like                             149   5e-38    
ref|XP_008274141.1|  PREDICTED: sacsin                                  155   5e-38    
gb|EDL85271.1|  rCG52205                                                155   5e-38    
gb|AFM84472.1|  sacsin                                                  152   5e-38    
sp|Q9JLC8.2|SACS_MOUSE  RecName: Full=Sacsin; AltName: Full=DnaJ ...    155   5e-38    
ref|XP_008767433.1|  PREDICTED: sacsin isoform X4                       154   6e-38    
ref|XP_006222037.1|  PREDICTED: sacsin isoform X3                       154   6e-38    
ref|XP_010308053.1|  PREDICTED: sacsin-like                             154   6e-38    
ref|XP_006222035.1|  PREDICTED: sacsin isoform X1                       154   6e-38    
ref|XP_010289064.1|  PREDICTED: sacsin-like                             154   6e-38    
ref|XP_006222036.1|  PREDICTED: sacsin isoform X2                       154   7e-38    
emb|CBJ27900.1|  conserved unknown protein                              143   7e-38    
ref|XP_009952840.1|  PREDICTED: sacsin-like                             154   7e-38    
gb|AFM84518.1|  sacsin                                                  151   1e-37    
gb|AFM84525.1|  sacsin                                                  151   1e-37    
ref|XP_005888804.1|  PREDICTED: sacsin-like                             149   1e-37    
ref|XP_005808354.1|  PREDICTED: sacsin-like                             153   2e-37    
ref|XP_009677571.1|  PREDICTED: sacsin-like                             153   2e-37    
gb|KFR13950.1|  Sacsin                                                  152   2e-37    
gb|AAI71956.1|  Sacs protein                                            150   2e-37    
emb|CDQ87087.1|  unnamed protein product                                153   2e-37    
gb|AFM84473.1|  sacsin                                                  150   2e-37    
ref|XP_001624956.1|  predicted protein                                  143   2e-37    
ref|XP_009486971.1|  PREDICTED: sacsin-like                             152   3e-37    
ref|XP_005146883.1|  PREDICTED: sacsin-like                             152   3e-37    
ref|XP_009471638.1|  PREDICTED: sacsin-like                             152   3e-37    
ref|XP_002940013.2|  PREDICTED: sacsin-like                             152   4e-37    
gb|AAI38484.1|  Sacs protein                                            149   4e-37    
ref|NP_766397.2|  sacsin                                                150   4e-37    
ref|XP_007575983.1|  PREDICTED: sacsin                                  152   4e-37    
ref|XP_003962039.1|  PREDICTED: sacsin-like                             152   5e-37    
gb|EMP36413.1|  Sacsin                                                  150   5e-37    
ref|XP_006627789.1|  PREDICTED: sacsin-like                             152   5e-37    
ref|XP_010170134.1|  PREDICTED: sacsin-like                             151   6e-37    
ref|XP_010883246.1|  PREDICTED: sacsin                                  151   7e-37    
gb|ELK09293.1|  Sacsin                                                  148   7e-37    
ref|XP_007910720.1|  PREDICTED: sacsin-like                             151   8e-37    
gb|KFZ48093.1|  Sacsin                                                  148   8e-37    
gb|ESA02316.1|  hypothetical protein GLOINDRAFT_252504                  150   8e-37    
ref|XP_003382551.1|  PREDICTED: sacsin-like                             151   8e-37    
ref|XP_007898845.1|  PREDICTED: sacsin                                  151   8e-37    
ref|XP_010171378.1|  PREDICTED: sacsin-like                             148   8e-37    
ref|XP_009504997.1|  PREDICTED: sacsin-like                             151   9e-37    
ref|XP_008578341.1|  PREDICTED: sacsin-like                             148   9e-37    
ref|XP_005532267.1|  PREDICTED: sacsin-like                             151   9e-37    
gb|EXX69729.1|  hypothetical protein RirG_093750                        150   9e-37    
gb|KFP47228.1|  Sacsin                                                  147   1e-36    
gb|EAX08323.1|  spastic ataxia of Charlevoix-Saguenay (sacsin)          150   1e-36    
gb|ERE91621.1|  sacsin                                                  150   1e-36    
gb|EPQ14601.1|  Sacsin                                                  147   1e-36    
ref|XP_009981767.1|  PREDICTED: sacsin-like                             149   1e-36    
ref|XP_006266605.1|  PREDICTED: sacsin-like                             150   2e-36    
ref|XP_005877351.1|  PREDICTED: sacsin                                  147   2e-36    
ref|XP_010148115.1|  PREDICTED: sacsin-like                             150   2e-36    
emb|CDQ63529.1|  unnamed protein product                                150   2e-36    
ref|XP_003390695.1|  PREDICTED: sacsin-like                             150   2e-36    
gb|ELT96105.1|  hypothetical protein CAPTEDRAFT_195081                  150   2e-36    
ref|XP_008424126.1|  PREDICTED: sacsin isoform X2                       150   2e-36    
ref|XP_008424125.1|  PREDICTED: sacsin isoform X1                       150   2e-36    
emb|CAE45964.1|  hypothetical protein                                   147   2e-36    
ref|XP_010727268.1|  PREDICTED: sacsin                                  147   3e-36    
ref|XP_007234568.1|  PREDICTED: sacsin isoform X2                       150   3e-36    
ref|XP_007234567.1|  PREDICTED: sacsin isoform X1                       150   3e-36    
ref|XP_007882664.1|  PREDICTED: sacsin-like                             149   3e-36    
ref|XP_006819457.1|  PREDICTED: sacsin-like                             149   3e-36    
ref|XP_009805349.1|  PREDICTED: sacsin-like                             149   3e-36    
ref|XP_004081920.1|  PREDICTED: sacsin-like                             148   7e-36    
ref|XP_010180401.1|  PREDICTED: sacsin-like                             148   8e-36    
gb|KFO54048.1|  Sacsin                                                  147   8e-36    
ref|XP_010411483.1|  PREDICTED: sacsin-like                             148   9e-36    
ref|XP_008932772.1|  PREDICTED: sacsin-like                             148   9e-36    
ref|XP_006026841.1|  PREDICTED: sacsin-like                             148   9e-36    
ref|XP_009563692.1|  PREDICTED: sacsin-like                             148   1e-35    
ref|XP_010127979.1|  PREDICTED: sacsin-like                             147   1e-35    
gb|EXX72162.1|  hypothetical protein RirG_071940                        147   1e-35    
ref|XP_008641708.1|  PREDICTED: sacsin-like                             148   1e-35    
emb|CAH18265.1|  hypothetical protein                                   147   1e-35    
ref|XP_009075148.1|  PREDICTED: sacsin-like                             147   2e-35    
ref|XP_010335271.1|  PREDICTED: sacsin                                  147   2e-35    
gb|ERZ96180.1|  hypothetical protein GLOINDRAFT_12880                   147   2e-35    
ref|XP_003383365.1|  PREDICTED: sacsin-like                             147   2e-35    
ref|XP_009097050.1|  PREDICTED: sacsin-like                             147   2e-35    
ref|XP_006815605.1|  PREDICTED: sacsin-like                             147   2e-35    



>ref|XP_009588535.1| PREDICTED: sacsin isoform X2 [Nicotiana tomentosiformis]
Length=2858

 Score =   508 bits (1308),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 246/285 (86%), Positives = 263/285 (92%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsd--dpdssngSAMALHAK  676
             AQHLS+VQF ED +KIYLPDVSCRL +ATDLVYNDAPWLLDS+       + S MA +A 
Sbjct  1280  AQHLSEVQFSEDPVKIYLPDVSCRLLSATDLVYNDAPWLLDSEDPSSSFGSSSTMAFNAS  1339

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             QT+ RFVHGNISNDVAEKLGVRS RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1340  QTVHRFVHGNISNDVAEKLGVRSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1399

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDANASKV FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1400  LEMYADGPGTLFELVQNAEDANASKVTFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1459

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQE+KLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1460  FTPQDLYAISRIGQETKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1519

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GRRILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1520  GISPSHPGLRIKFAGRRILEQFPDQFSPFLHFGCDLQHSFPGTLF  1564


 Score =   202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +GT S+LS +
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVCLCLDRRNHGTESLLSDK  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +  WQGPAL  +N++VFS +D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LGQWQGPALLAYNDAVFSEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI++V    +  + DQF P+  FGCD+++PF GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSASNPGKRIEYVSSSAISLYKDQFFPYCAFGCDMKSPFHGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/159 (25%), Positives = 75/159 (47%), Gaps = 30/159 (19%)
 Frame = -1

Query  843   HLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI-  667
             ++  + F      + LPD S  L +A +LVYNDAPW+                    T+ 
Sbjct  2713  NMDSLMFEASSTPLLLPDSSGALMSAGNLVYNDAPWM-----------------ESSTVG  2755

Query  666   -QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
              +R VH ++S ++A++LG++S R + L     + +L                T++  +LE
Sbjct  2756  GKRLVHPSLSQNLADRLGIQSLRSVSLVSEEMTKDLPCMD-----------YTKICELLE  2804

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVL  373
             +Y     +L++L++ A+   A K+  + D+ ++   S+L
Sbjct  2805  LYGKTDFLLYDLLELADCCKAKKLHLIFDRREHRCQSLL  2843



>ref|XP_009588464.1| PREDICTED: sacsin isoform X1 [Nicotiana tomentosiformis]
Length=2943

 Score =   508 bits (1308),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 246/285 (86%), Positives = 263/285 (92%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsd--dpdssngSAMALHAK  676
             AQHLS+VQF ED +KIYLPDVSCRL +ATDLVYNDAPWLLDS+       + S MA +A 
Sbjct  1280  AQHLSEVQFSEDPVKIYLPDVSCRLLSATDLVYNDAPWLLDSEDPSSSFGSSSTMAFNAS  1339

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             QT+ RFVHGNISNDVAEKLGVRS RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1340  QTVHRFVHGNISNDVAEKLGVRSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1399

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDANASKV FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1400  LEMYADGPGTLFELVQNAEDANASKVTFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1459

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQE+KLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1460  FTPQDLYAISRIGQETKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1519

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GRRILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1520  GISPSHPGLRIKFAGRRILEQFPDQFSPFLHFGCDLQHSFPGTLF  1564


 Score =   202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +GT S+LS +
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVCLCLDRRNHGTESLLSDK  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +  WQGPAL  +N++VFS +D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LGQWQGPALLAYNDAVFSEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI++V    +  + DQF P+  FGCD+++PF GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSASNPGKRIEYVSSSAISLYKDQFFPYCAFGCDMKSPFHGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 112/248 (45%), Gaps = 42/248 (17%)
 Frame = -1

Query  843   HLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI-  667
             ++  + F      + LPD S  L +A +LVYNDAPW+                    T+ 
Sbjct  2713  NMDSLMFEASSTPLLLPDSSGALMSAGNLVYNDAPWM-----------------ESSTVG  2755

Query  666   -QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
              +R VH ++S ++A++LG++S R + L     + +L                T++  +LE
Sbjct  2756  GKRLVHPSLSQNLADRLGIQSLRSVSLVSEEMTKDLPCMD-----------YTKICELLE  2804

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             +Y     +L++L++ A+   A K+  + D+ ++   S+L   + D+QGPAL         
Sbjct  2805  LYGKTDFLLYDLLELADCCKAKKLHLIFDRREHRCQSLLQHNLGDFQGPALVVILEGANL  2864

Query  309   PQDLYAISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACS  142
              +D  A        +   P+++      +GLG  S +  +D  + VS   + MFDP   +
Sbjct  2865  SRDEVA------GLQFLPPWSLRGDTMNYGLGLISCFSISDFVSVVSDGFLYMFDPRGLA  2918

Query  141   LPGISPSH  118
             L    PSH
Sbjct  2919  LA--MPSH  2924



>ref|XP_009758398.1| PREDICTED: sacsin [Nicotiana sylvestris]
Length=4188

 Score =   507 bits (1305),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 249/285 (87%), Positives = 266/285 (93%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             AQHLS+VQF ED +KIYLPDVSCRL +ATDLVYNDAPWLLDS+DP SS    S MA +A 
Sbjct  1280  AQHLSEVQFSEDPVKIYLPDVSCRLLSATDLVYNDAPWLLDSEDPSSSFGGSSTMASNAS  1339

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             QT+ RFVHGNISNDVAEKLGVRS RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1340  QTVHRFVHGNISNDVAEKLGVRSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1399

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDANASKV FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1400  LEMYADGPGTLFELVQNAEDANASKVTFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1459

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQE+KLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPH+C+LP
Sbjct  1460  FTPQDLYAISRIGQETKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHSCNLP  1519

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GRRILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1520  GISPSHPGLRIKFTGRRILEQFPDQFSPFLHFGCDLQHSFPGTLF  1564


 Score =   202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +GT S+LS +
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVCLCLDRRNHGTESLLSDK  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +  WQGPAL  +N++VFS +D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LGQWQGPALLAYNDAVFSEEDFVSISRIGGSGKHGQTWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI++V    +  + DQF P+  FGCD+++PF GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSASNPGKRIEYVSSSAISLYKDQFFPYCAFGCDMKSPFHGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 123/273 (45%), Gaps = 41/273 (15%)
 Frame = -1

Query  843   HLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI-  667
             ++  + F      + LPD S  L +A +LVYNDAPW+                    T+ 
Sbjct  2713  NMDSLMFEASSTPLLLPDSSGALMSAGNLVYNDAPWM-----------------ESSTVG  2755

Query  666   -QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
              +R VH +IS ++A++LG++S R + L     + +L                 ++  +LE
Sbjct  2756  GKRLVHPSISQNLADRLGIQSLRSVSLVSEEMTKDLLCMDYP-----------KICELLE  2804

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             +Y     +L++L++ A+   A K+  + D+ ++   S+L   + D+QGPAL         
Sbjct  2805  LYGKTDFLLYDLLELADCCKAKKLHLIFDRREHRCQSLLQHNLGDFQGPALVVILEGANL  2864

Query  309   PQDLYAISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACS  142
              +D  A        +   P+++      +GLG  S +  +D  + VS   + MFDP   +
Sbjct  2865  SRDEVA------GLQFLPPWSLRGDTMNYGLGLLSCFSISDFVSVVSDGFLYMFDPRGLA  2918

Query  141   LPGISPSHPGLRI-KFVGRRILEQFPDQFSPFL  46
             L   S   P  ++    G  + E+F DQFSP L
Sbjct  2919  LAMPSHRAPAAKMFSLRGTNLTERFRDQFSPLL  2951



>ref|XP_006354978.1| PREDICTED: sacsin-like [Solanum tuberosum]
Length=4757

 Score =   505 bits (1301),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 245/285 (86%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsd--dpdssngSAMALHAK  676
             AQHLS+VQF ED +KIYLPDVSCRL  ATDLV+NDAPWLLDS+       + S MA +A 
Sbjct  1279  AQHLSEVQFSEDPVKIYLPDVSCRLLFATDLVFNDAPWLLDSEDPSSSFGSSSNMAFNAS  1338

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             QT+ RFVHGNISNDVAEKLGVRS RRMLLAES+DSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1339  QTVHRFVHGNISNDVAEKLGVRSLRRMLLAESSDSMNLSLSGAAEAFGQHEALTTRLKHI  1398

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDANASKV FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1399  LEMYADGPGTLFELVQNAEDANASKVIFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1458

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQE+KLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1459  FTPQDLYAISRIGQETKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1518

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GRRILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1519  GISPSHPGLRIKFAGRRILEQFPDQFSPFLHFGCDLQHSFPGTLF  1563


 Score =   204 bits (519),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 127/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +GT S+LS +
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVCLCLDRRNHGTESLLSDK  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N+++FS +D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPALLAYNDAIFSEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI++V    +  + DQFSP+  FGCD+++P  GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSASNPGKRIEYVSSSAISLYKDQFSPYCAFGCDMRSPLHGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/273 (27%), Positives = 124/273 (45%), Gaps = 41/273 (15%)
 Frame = -1

Query  843   HLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI-  667
             ++  + F      + LPD S  L +A +LVYNDAPW+                    T+ 
Sbjct  2709  NMDSLMFESSSTPLLLPDSSGVLMSAGNLVYNDAPWM-----------------ESNTVG  2751

Query  666   -QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
              +R VH +IS ++A++LG++S R + L     + +L                T++  +LE
Sbjct  2752  GKRLVHPSISQNLADRLGIQSLRSVSLVSEEMTKDLPCMD-----------YTKICELLE  2800

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             +Y     +L++L++ A+   A K+  + D+ ++   S+L   + D+QGPAL         
Sbjct  2801  LYGKTDFLLYDLLELADCCKAKKLHLIFDRREHRCQSLLQHNLGDFQGPALVVILEGANL  2860

Query  309   PQDLYAISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACS  142
              +D  A        +   P+ +      +GLG  S +  +DI + VS   + MFDP   +
Sbjct  2861  SRDEVA------GLQFLPPWGLRGDTMNYGLGLLSCFSISDIVSVVSDGFLYMFDPKGLA  2914

Query  141   LPGISPSHPGLRI-KFVGRRILEQFPDQFSPFL  46
             L   S   P  ++    G  + E+F DQFSP L
Sbjct  2915  LAMPSQRGPAAKMFSLRGTNLTERFRDQFSPLL  2947



>ref|XP_010315556.1| PREDICTED: sacsin [Solanum lycopersicum]
Length=4757

 Score =   502 bits (1293),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsd--dpdssngSAMALHAK  676
             AQHLS+VQF E+ +KIYLPDVSCRL  ATDLV+NDAPWLLDS+       + S MA +A 
Sbjct  1279  AQHLSEVQFSENPVKIYLPDVSCRLLFATDLVFNDAPWLLDSEDPSSSFGSSSNMAFNAS  1338

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             QT+ RFVHGNISNDVAEKLGVRS RRMLLAES+DSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1339  QTVHRFVHGNISNDVAEKLGVRSLRRMLLAESSDSMNLSLSGAAEAFGQHEALTTRLKHI  1398

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDANASKV FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1399  LEMYADGPGTLFELVQNAEDANASKVFFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1458

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQE+KLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1459  FTPQDLYAISRIGQETKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1518

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GRRILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1519  GISPSHPGLRIKFAGRRILEQFPDQFSPFLHFGCDLQHSFPGTLF  1563


 Score =   204 bits (520),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 127/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +GT S+LS +
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVCLCLDRRNHGTESLLSDK  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VFS +D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPALLAYNDAVFSEEDFISISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI++V    +  + DQFSP+  FGCD+++P  GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSASNPGKRIEYVSSSAISLYKDQFSPYCAFGCDMRSPLHGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 120/262 (46%), Gaps = 45/262 (17%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI--QRFVHGNISNDV  631
             + LPD S  L +A +LVYNDAPW+                    T+  +R VH +IS ++
Sbjct  2722  LLLPDSSGVLTSAGNLVYNDAPWM-----------------ESNTVGGKRLVHPSISQNL  2764

Query  630   AEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELV  451
             A++LG++S R + L     + +L                T++  +LE+Y     +L++L+
Sbjct  2765  ADRLGIQSLRSVSLVSEEMTKDLPCMD-----------YTKICELLELYGKTDFLLYDLL  2813

Query  450   QNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQE  271
             + A+   A K+  + D+  +   S+L   + D+QGPAL       +  +D  A       
Sbjct  2814  ELADCCKAKKLHLIFDRRDHRCQSLLQHNLGDFQGPALVVILEGAYLSRDEVA------G  2867

Query  270   SKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI  103
              +   P+ +      +GLG  S +  +D  + VS   + MFDP   +L    PSH G   
Sbjct  2868  LQFLPPWGLRGDTINYGLGLLSCFSISDFVSVVSDGFLYMFDPKGLALA--MPSHRGPAA  2925

Query  102   KFV---GRRILEQFPDQFSPFL  46
             K     G  + E+F DQFSP L
Sbjct  2926  KMFSLRGTNLTERFRDQFSPLL  2947



>emb|CDP11009.1| unnamed protein product [Coffea canephora]
Length=4772

 Score =   500 bits (1288),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssn--gSAMALHAK  676
             AQHL+D Q Y+D IKIYLPD+SCRL NA DLVYNDAPWLLDS+D + S    + M+LH K
Sbjct  1292  AQHLADSQSYDDHIKIYLPDMSCRLLNAADLVYNDAPWLLDSEDSERSMGNTTNMSLHVK  1351

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             Q +Q+FVH +ISNDVAE+LGVRS RRMLLAESADSMNLSLSGAAEAFGQHE+LTTRLRHI
Sbjct  1352  QIVQKFVHRSISNDVAERLGVRSLRRMLLAESADSMNLSLSGAAEAFGQHEALTTRLRHI  1411

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QY TSSVLSPEMADWQGPALYCFN+SV
Sbjct  1412  LEMYADGPGILFELVQNAEDARASQVTFLLDKTQYATSSVLSPEMADWQGPALYCFNDSV  1471

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTD+P+FVSGEN+VMFDPHAC+LP
Sbjct  1472  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDVPSFVSGENIVMFDPHACNLP  1531

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGRR+LEQFPDQFSPFLHFGCDL+  F GTLF
Sbjct  1532  GISPSHPGLRIKFVGRRVLEQFPDQFSPFLHFGCDLKQSFPGTLF  1576


 Score =   209 bits (531),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 129/181 (71%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV+  LD+  +GT S+LS +
Sbjct  22   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVSLCLDRRSHGTQSLLSDK  81

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VFS  D  +ISRIG  SK  + +  GRFG+GFNSVYH TD+P+F+
Sbjct  82   LAQWQGPALLAYNDAVFSEDDFVSISRIGGSSKHGQAWKTGRFGVGFNSVYHLTDLPSFI  141

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI+FV    +  + DQFSP+  +GCD++NPFRGT 
Sbjct  142  SGKYVVIFDPQGVYLPNISAANPGKRIEFVSSSAIFMYKDQFSPYCGYGCDMKNPFRGTF  201

Query  3    F  1
            F
Sbjct  202  F  202


 Score = 82.4 bits (202),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 71/266 (27%), Positives = 118/266 (44%), Gaps = 38/266 (14%)
 Frame = -1

Query  819   EDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNIS  640
             E    +++PD    L ++ +LVYNDAPW+              +L  K      VH  IS
Sbjct  2740  EASTDLFIPDSFGVLVSSGELVYNDAPWM-----------ENTSLGGKH----LVHPCIS  2784

Query  639   NDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLF  460
             +++  +LG++S R + L    D M   L              +R+  +LE+Y     +LF
Sbjct  2785  HELCSRLGIQSLRCISLV--GDDMTKDLPCMD---------YSRICELLELYGSKDFLLF  2833

Query  459   ELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRI  280
             +L++ A+   A K+  + DK ++   S+L   + ++QGPAL          +D  A    
Sbjct  2834  DLLEMADCCKAKKLHLIFDKREHPRLSLLQHNLGEFQGPALLAILEGASLSRDEVA----  2889

Query  279   GQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPG  112
                 +   P+++      +GLG  S +  +D+P+ VS   + M DP   +    S   P 
Sbjct  2890  --SLQFLPPWSLRGDTLNYGLGLLSCFAISDLPSVVSDGCLYMLDPRGLAFAIPSNHAPA  2947

Query  111   LR-IKFVGRRILEQFPDQFSPFLHFG  37
              +     G  + E+F DQFS  L FG
Sbjct  2948  AKAFSLKGTNLTERFHDQFSALL-FG  2972



>ref|XP_011093575.1| PREDICTED: sacsin [Sesamum indicum]
Length=4755

 Score =   499 bits (1284),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 238/284 (84%), Positives = 261/284 (92%), Gaps = 1/284 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss-ngSAMALHAKQ  673
             AQHL++  FYEDQ  IYLPDVSCRL  AT+LVYNDAPWLL+SD  ++    +A++L AKQ
Sbjct  1275  AQHLAEAHFYEDQTDIYLPDVSCRLHTATNLVYNDAPWLLESDGSENLFGSAAISLGAKQ  1334

Query  672   TIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL  493
             T+ +FVHGNIS+D+AEKLGVRSFRR+LLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL
Sbjct  1335  TVHKFVHGNISHDIAEKLGVRSFRRILLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL  1394

Query  492   EMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVF  313
             EMYADGP VLFELVQNAEDA AS V FLLDK+ YGTSS+LSPEM DWQGPALYCFN+S+F
Sbjct  1395  EMYADGPAVLFELVQNAEDAGASNVTFLLDKTHYGTSSLLSPEMGDWQGPALYCFNDSIF  1454

Query  312   SPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG  133
             SPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LPG
Sbjct  1455  SPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLPG  1514

Query  132   ISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             ISP+HPGLRIKF GR+ILEQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1515  ISPTHPGLRIKFAGRKILEQFPDQFSPFLHFGCDLQHPFPGTLF  1558


 Score =   204 bits (519),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 128/181 (71%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+ ++G  S+LS  
Sbjct  8    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATTVRLCLDRRKHGVDSLLSDS  67

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +  WQGPAL  +N++VF+ +D  +ISRIG  +K  KP+  GRFG+GFNSVYH TD+P+FV
Sbjct  68   LGQWQGPALLAYNDAVFTEEDFVSISRIGGSAKHAKPWKTGRFGVGFNSVYHLTDLPSFV  127

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG++VV+FDP    LP IS ++PG RI++V  + +  + DQF P+  FGCD+++PF GTL
Sbjct  128  SGKHVVLFDPQGVYLPNISTANPGKRIEYVTSKAISLYKDQFFPYCAFGCDMKSPFHGTL  187

Query  3    F  1
            F
Sbjct  188  F  188


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/266 (28%), Positives = 124/266 (47%), Gaps = 43/266 (16%)
 Frame = -1

Query  819   EDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNIS  640
             E++  + +PD +  L  A DLVYNDAPW+  +                   +RFVH +IS
Sbjct  2716  ENRSTLLIPDSTGVLIGAADLVYNDAPWMETNSVVG---------------KRFVHSSIS  2760

Query  639   NDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLF  460
             +D+A +LG++S R + L     + +                  ++  +LE + D   +LF
Sbjct  2761  HDLANRLGIQSLRSLSLVSKELTKDFPCMD-----------YNKITELLESHGDYEFLLF  2809

Query  459   ELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRI  280
             +L++ A+   A K+  + DK ++   S+L   +A++QGPAL            L   S  
Sbjct  2810  DLLELADCCKAKKLHLIFDKREHPRQSLLQHNLAEFQGPALVAI---------LEGASLS  2860

Query  279   GQES---KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPS  121
             G E    +   P+++      +GLG  S +  TD+P  VS   + +FDP   ++   S  
Sbjct  2861  GDEVASLQFLPPWSLRGDTLNYGLGLLSCFSITDLPLVVSDGYLYIFDPRGVAIATPSTR  2920

Query  120   HPGLRI-KFVGRRILEQFPDQFSPFL  46
              P  ++    G ++ E+F DQFSP L
Sbjct  2921  LPSAKVFPLRGTKLTERFRDQFSPML  2946



>ref|XP_002307173.2| hypothetical protein POPTR_0005s09590g [Populus trichocarpa]
 gb|EEE94169.2| hypothetical protein POPTR_0005s09590g [Populus trichocarpa]
Length=4775

 Score =   493 bits (1270),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 245/285 (86%), Positives = 265/285 (93%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++VQF+E Q+KIYLPDVS RLF ATDLVYNDAPWLL SD+ DSS G A  +ALHAK
Sbjct  1291  VQHLAEVQFHE-QVKIYLPDVSGRLFPATDLVYNDAPWLLGSDNSDSSFGGASTVALHAK  1349

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             + + +FVHGNISN+VAEKLGV S RR+LLAES+DSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1350  RAVHKFVHGNISNEVAEKLGVCSLRRILLAESSDSMNLSLSGAAEAFGQHEALTTRLKHI  1409

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALYCFNNSV
Sbjct  1410  LEMYADGPGILFELVQNAEDAGASEVIFLLDKTQYGTSSVLSPEMADWQGPALYCFNNSV  1469

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FS QDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGENVVMFDPHAC+LP
Sbjct  1470  FSSQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENVVMFDPHACNLP  1529

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GR+ILEQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1530  GISPSHPGLRIKFTGRKILEQFPDQFSPFLHFGCDLQHPFPGTLF  1574


 Score =   191 bits (485),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+  + T+S+LSP 
Sbjct  16   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATVVRLCLDRRHHSTTSLLSPS  75

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            ++ +QGPAL  +N++VF+ +D  +ISRIG   K  +    GRFG+GFNSVYH TD+P+FV
Sbjct  76   LSAFQGPALLSYNDAVFTEEDFTSISRIGGSVKHNQATKTGRFGVGFNSVYHLTDLPSFV  135

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG  +VMFDP    LP ++ S+PG RI FV  + +  + DQF P+  FGCD++N F GTL
Sbjct  136  SGNYIVMFDPQGGYLPNVNSSNPGKRIDFVSTKAMSFYRDQFEPYAVFGCDMENRFSGTL  195

Query  3    F  1
            F
Sbjct  196  F  196


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/255 (29%), Positives = 120/255 (47%), Gaps = 31/255 (12%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR-FVHGNISNDVA  628
             + +PD S  L  A DLVYNDAPW+                     I++ FVH +ISND+A
Sbjct  2745  LLIPDSSGVLMCAGDLVYNDAPWI----------------ENNTLIEKHFVHPSISNDLA  2788

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              +LGV+S R + L +   + +L     A           +L  +L +Y +   +LF+L++
Sbjct  2789  NRLGVKSLRCLSLVDDDMTKDLPCMDFA-----------KLNELLALYGNNDFLLFDLLE  2837

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
              A+   A K+  + DK ++  +S+L   + ++QGPAL      V   ++     ++    
Sbjct  2838  VADCCKAKKLHLIFDKREHPRNSLLQHNLGEFQGPALVAILEGVSLNREEVGSLQLLPPW  2897

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-KFVG  91
             +L        +GLG  S Y  +++ + +SG    MFDP   +L   S   P  ++    G
Sbjct  2898  RLRGDTV--NYGLGLLSCYFVSNLLSIISGGYFYMFDPCGLALGAPSSHAPAAKMFSLAG  2955

Query  90    RRILEQFPDQFSPFL  46
               + E+F DQF P L
Sbjct  2956  TNLTERFCDQFKPML  2970



>ref|XP_010648419.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Vitis vinifera]
Length=4775

 Score =   493 bits (1268),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 264/285 (93%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++VQF+E + KIYLPDVS RL   ++LVYNDAPWLL S+D D+S GSA  +A +AK
Sbjct  1285  VQHLAEVQFHEHKAKIYLPDVSGRLLPVSELVYNDAPWLLGSEDVDNSFGSASTVAFNAK  1344

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
              TIQ+FVHGNISNDVAEKLGV S RR LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1345  GTIQKFVHGNISNDVAEKLGVCSLRRTLLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1404

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMADWQGPALYCFN+SV
Sbjct  1405  LEMYADGPGILFELVQNAEDAGASEVIFLLDKTQYGTSSILSPEMADWQGPALYCFNDSV  1464

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1465  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1524

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRI++VGRRILEQFPDQFSPFLHFGCDLQNPF GTLF
Sbjct  1525  GISPSHPGLRIRYVGRRILEQFPDQFSPFLHFGCDLQNPFPGTLF  1569


 Score =   199 bits (507),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 127/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +G+ S+LS +
Sbjct  18   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVCLCLDRRVHGSESLLSEK  77

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +NN+ F+ +D  +ISRIG  +K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  78   LAQWQGPALLAYNNAEFTEEDFVSISRIGGSNKHGQAWKTGRFGVGFNSVYHLTDLPSFV  137

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI++V    +  + DQF P+  FGCD+++PF GTL
Sbjct  138  SGKYVVLFDPQGVYLPNVSTANPGKRIEYVSSSAISLYKDQFLPYCAFGCDMKHPFSGTL  197

Query  3    F  1
            F
Sbjct  198  F  198


 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 86/275 (31%), Positives = 135/275 (49%), Gaps = 40/275 (15%)
 Frame = -1

Query  849   AQHLSDVQFYE-DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQ  673
             A   SD   +E     + LPD S  L  A DLVYNDAPW+              AL  K 
Sbjct  2718  ADCCSDKPLFEASNTPLLLPDSSGVLICAGDLVYNDAPWM-----------ENNALVGKH  2766

Query  672   TIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL  493
                 FVH +ISND+A +LGV+S R + L +   + +L        +G       ++  +L
Sbjct  2767  ----FVHPSISNDLANRLGVQSLRCLSLVDEEMTKDL----PCMDYG-------KISELL  2811

Query  492   EMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCF-NNSV  316
               Y D   +LF+L++ A+   A K+  + DK ++   S+L   + ++QGPAL      + 
Sbjct  2812  VSYGDRDFLLFDLLELADCCKAKKLHLIFDKREHPRQSLLQHNLGEFQGPALVAIMEGAS  2871

Query  315   FSPQDLYAISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHA  148
              S +++ ++       +L  P+ +      +GLG  S Y  +D+P+ VSG    +FDPH 
Sbjct  2872  LSREEVSSL-------QLLPPWRLRGDTLNYGLGLLSCYSISDLPSIVSGGYFYIFDPHG  2924

Query  147   CSLPGISPSHPGLRI-KFVGRRILEQFPDQFSPFL  46
              +LPG S   P  ++   +G  + E+F DQF+P L
Sbjct  2925  LALPGSSSHGPTAKVFSLIGTNLTERFCDQFNPML  2959



>ref|XP_011022055.1| PREDICTED: uncharacterized protein LOC105123955 isoform X2 [Populus 
euphratica]
Length=4775

 Score =   492 bits (1267),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 265/285 (93%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++VQF+E Q+KIYLPDVS RLF ATDLVYNDAPWLL SD+ DSS G A  +ALHAK
Sbjct  1291  VQHLAEVQFHE-QVKIYLPDVSGRLFPATDLVYNDAPWLLGSDNSDSSFGGASTVALHAK  1349

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             + + +FVHGNISN+VAEKLGV S RR+LLAES+DSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1350  RAVHKFVHGNISNEVAEKLGVCSLRRILLAESSDSMNLSLSGAAEAFGQHEALTTRLKHI  1409

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYG+SSVLSPEMADWQGPALYCFNNSV
Sbjct  1410  LEMYADGPGILFELVQNAEDAGASEVIFLLDKTQYGSSSVLSPEMADWQGPALYCFNNSV  1469

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FS QDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGENVVMFDPHAC+LP
Sbjct  1470  FSSQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENVVMFDPHACNLP  1529

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GR+ILEQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1530  GISPSHPGLRIKFTGRKILEQFPDQFSPFLHFGCDLQHPFPGTLF  1574


 Score =   192 bits (487),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+ ++ T+S+LSP 
Sbjct  16   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATVVRLCLDRRRHSTTSLLSPS  75

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            ++ +QGPAL  +N++VF+ +D  +ISRIG   K  +    GRFG+GFNSVYH TD+P+FV
Sbjct  76   LSAFQGPALLSYNDAVFTEEDFTSISRIGGSVKHNQATKTGRFGVGFNSVYHLTDLPSFV  135

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG  +VMFDP    LP ++ S+PG RI FV  + +  + DQF P++ FGCD++N F G+L
Sbjct  136  SGNYIVMFDPQGVHLPNVNSSNPGKRIDFVSTKAMSFYRDQFEPYVVFGCDMENRFSGSL  195

Query  3    F  1
            F
Sbjct  196  F  196


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/255 (29%), Positives = 120/255 (47%), Gaps = 31/255 (12%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR-FVHGNISNDVA  628
             + +PD S  L  A DLVYNDAPW+                     I++ FVH +ISND+A
Sbjct  2745  LLIPDSSGVLMCAGDLVYNDAPWI----------------ENNTLIEKHFVHPSISNDLA  2788

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              +LGV+S R + L +   + +L     A           +L  +L +Y +   +LF+L++
Sbjct  2789  NRLGVKSLRCLSLVDDDMTKDLPCMDFA-----------KLNELLALYGNNDFLLFDLLE  2837

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
              A+   A K+  + DK ++  +S+L   + ++QGPAL      V   ++     ++    
Sbjct  2838  VADCCKAKKLHLIFDKREHPRNSLLQHNLGEFQGPALVAILEGVSLNREEVGSLQLLPPW  2897

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-KFVG  91
             +L        +GLG  S Y  +++ + +SG    MFDP   +L   S   P  ++    G
Sbjct  2898  RLRGDTV--NYGLGLLSCYFISNLLSIISGGYFYMFDPCGLALGAPSSHAPAAKMFSLAG  2955

Query  90    RRILEQFPDQFSPFL  46
               + E+F DQF P L
Sbjct  2956  TNLTERFCDQFKPML  2970



>ref|XP_011022054.1| PREDICTED: uncharacterized protein LOC105123955 isoform X1 [Populus 
euphratica]
Length=4777

 Score =   492 bits (1267),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 265/285 (93%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++VQF+E Q+KIYLPDVS RLF ATDLVYNDAPWLL SD+ DSS G A  +ALHAK
Sbjct  1291  VQHLAEVQFHE-QVKIYLPDVSGRLFPATDLVYNDAPWLLGSDNSDSSFGGASTVALHAK  1349

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             + + +FVHGNISN+VAEKLGV S RR+LLAES+DSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1350  RAVHKFVHGNISNEVAEKLGVCSLRRILLAESSDSMNLSLSGAAEAFGQHEALTTRLKHI  1409

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYG+SSVLSPEMADWQGPALYCFNNSV
Sbjct  1410  LEMYADGPGILFELVQNAEDAGASEVIFLLDKTQYGSSSVLSPEMADWQGPALYCFNNSV  1469

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FS QDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGENVVMFDPHAC+LP
Sbjct  1470  FSSQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENVVMFDPHACNLP  1529

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GR+ILEQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1530  GISPSHPGLRIKFTGRKILEQFPDQFSPFLHFGCDLQHPFPGTLF  1574


 Score =   192 bits (487),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+ ++ T+S+LSP 
Sbjct  16   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATVVRLCLDRRRHSTTSLLSPS  75

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            ++ +QGPAL  +N++VF+ +D  +ISRIG   K  +    GRFG+GFNSVYH TD+P+FV
Sbjct  76   LSAFQGPALLSYNDAVFTEEDFTSISRIGGSVKHNQATKTGRFGVGFNSVYHLTDLPSFV  135

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG  +VMFDP    LP ++ S+PG RI FV  + +  + DQF P++ FGCD++N F G+L
Sbjct  136  SGNYIVMFDPQGVHLPNVNSSNPGKRIDFVSTKAMSFYRDQFEPYVVFGCDMENRFSGSL  195

Query  3    F  1
            F
Sbjct  196  F  196


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/255 (29%), Positives = 120/255 (47%), Gaps = 31/255 (12%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR-FVHGNISNDVA  628
             + +PD S  L  A DLVYNDAPW+                     I++ FVH +ISND+A
Sbjct  2745  LLIPDSSGVLMCAGDLVYNDAPWI----------------ENNTLIEKHFVHPSISNDLA  2788

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              +LGV+S R + L +   + +L     A           +L  +L +Y +   +LF+L++
Sbjct  2789  NRLGVKSLRCLSLVDDDMTKDLPCMDFA-----------KLNELLALYGNNDFLLFDLLE  2837

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
              A+   A K+  + DK ++  +S+L   + ++QGPAL      V   ++     ++    
Sbjct  2838  VADCCKAKKLHLIFDKREHPRNSLLQHNLGEFQGPALVAILEGVSLNREEVGSLQLLPPW  2897

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-KFVG  91
             +L        +GLG  S Y  +++ + +SG    MFDP   +L   S   P  ++    G
Sbjct  2898  RLRGDTV--NYGLGLLSCYFISNLLSIISGGYFYMFDPCGLALGAPSSHAPAAKMFSLAG  2955

Query  90    RRILEQFPDQFSPFL  46
               + E+F DQF P L
Sbjct  2956  TNLTERFCDQFKPML  2970



>ref|XP_008221054.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Prunus mume]
Length=4734

 Score =   489 bits (1259),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 263/285 (92%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpds--sngSAMALHAK  676
              QHL++VQ ++ ++KIYLPDVS RL+ ATDLVYNDAPWLL S+D DS     S +AL+A+
Sbjct  1282  VQHLAEVQIHDQKVKIYLPDVSGRLYPATDLVYNDAPWLLGSEDHDSPFGGPSNVALNAR  1341

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNIS DVAEKLGV S RR LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1342  RTVQKFVHGNISIDVAEKLGVCSLRRTLLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1401

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V+FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1402  LEMYADGPGILFELVQNAEDAGASEVSFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1461

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1462  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1521

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GR+I+EQFPDQFSPFLHFGCDLQ PF GTLF
Sbjct  1522  GISPSHPGLRIKFAGRKIMEQFPDQFSPFLHFGCDLQQPFPGTLF  1566


 Score =   193 bits (490),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+  +GT S+LS  
Sbjct  14   EDFGQKVDLTRRIREVLVNYPEGTTVLKELIQNADDAGATTVRLCLDRRLHGTDSLLSET  73

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  74   LAPWQGPALLAYNDAVFTEEDFVSISRIGGSSKHGQASKTGRFGVGFNSVYHLTDLPSFV  133

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI +V    +  + DQF P+  FGCD++  F GTL
Sbjct  134  SGKYVVLFDPQGIFLPKVSASNPGKRIDYVSSSAISVYKDQFFPYCAFGCDMKTQFAGTL  193

Query  3    F  1
            F
Sbjct  194  F  194


 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 74/266 (28%), Positives = 126/266 (47%), Gaps = 39/266 (15%)
 Frame = -1

Query  825   FYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGN  646
             F      I +PD S  L +A +LVYNDAPW+                ++    + F+H  
Sbjct  2731  FEASNTPILIPDASAVLMHAGNLVYNDAPWMD---------------NSTPVGKHFIHPT  2775

Query  645   ISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGV  466
             ISND+A +LGV+S R + L ++  + +L     A           R++ +L  Y D   +
Sbjct  2776  ISNDLASRLGVQSLRCLSLVDNDMTKDLPCMDYA-----------RIKELLTSYGDNDLL  2824

Query  465   LFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-FSPQDLYAI  289
             LF+L++ A+   A+K+  + DK ++   S+L   M ++QGPAL      V  S +++ ++
Sbjct  2825  LFDLLELADCCKANKLHLIFDKREHPRQSLLQHNMGEFQGPALLAILEGVSLSREEISSL  2884

Query  288   SRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPS  121
                    +   P+ +      +GL   S Y   D+ + VSG  + +FDP    L   S  
Sbjct  2885  -------QFLPPWRLRGNTLNYGLALLSCYFVCDLLSVVSGGYLYLFDPLGLVLAAPSTC  2937

Query  120   HPGLRI-KFVGRRILEQFPDQFSPFL  46
              P  ++   +G  + ++F DQF+P L
Sbjct  2938  APAAKMFSLIGTNLTDRFRDQFNPML  2963



>ref|XP_007221931.1| hypothetical protein PRUPE_ppa000003mg [Prunus persica]
 gb|EMJ23130.1| hypothetical protein PRUPE_ppa000003mg [Prunus persica]
Length=4774

 Score =   489 bits (1259),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 263/285 (92%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpds--sngSAMALHAK  676
              QHL++VQ ++ ++KIYLPDVS RL+ ATDLVYNDAPWLL S+D DS     S +AL+A+
Sbjct  1283  VQHLAEVQIHDQKVKIYLPDVSGRLYPATDLVYNDAPWLLGSEDHDSPFGGPSNVALNAR  1342

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNIS DVAEKLGV S RR LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1343  RTVQKFVHGNISIDVAEKLGVCSLRRTLLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1402

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V+FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1403  LEMYADGPGILFELVQNAEDAGASEVSFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1462

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1463  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1522

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GR+I+EQFPDQFSPFLHFGCDLQ PF GTLF
Sbjct  1523  GISPSHPGLRIKFAGRKIMEQFPDQFSPFLHFGCDLQQPFPGTLF  1567


 Score =   192 bits (487),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+  +GT S+LS  
Sbjct  14   EDFGQKVYLTRRIREVLVNYPEGTTVLKELIQNADDAGATTVRLCLDRRLHGTDSLLSET  73

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N+++F+ +D  +ISRIG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  74   LAPWQGPALLAYNDAIFTEEDFVSISRIGGSSKHGQASKTGRFGVGFNSVYHLTDLPSFV  133

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI +V    +  + DQF P+  FGCD++  F GTL
Sbjct  134  SGKYVVLFDPQGIFLPKVSASNPGKRIDYVSSSAISLYKDQFFPYCAFGCDMKTQFAGTL  193

Query  3    F  1
            F
Sbjct  194  F  194


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/266 (29%), Positives = 124/266 (47%), Gaps = 39/266 (15%)
 Frame = -1

Query  825   FYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGN  646
             F      I +PD S  L +A DLVYNDAPW+                ++    + F+H  
Sbjct  2732  FEASNTPILIPDASAVLMHAGDLVYNDAPWMD---------------NSTPVGKHFIHPT  2776

Query  645   ISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGV  466
             ISND+A +LGV+S R + L +  D M   L     A         R++ +L  Y     +
Sbjct  2777  ISNDLASRLGVQSLRCLSLVD--DDMTKDLPCMDYA---------RIKELLTSYGVNDLL  2825

Query  465   LFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-FSPQDLYAI  289
             LF+L++ A+   A+K+  + DK ++   S+L   M ++QGPAL      V  S +++ ++
Sbjct  2826  LFDLLELADCCKANKLHLIFDKREHPRQSLLQHNMGEFQGPALLAILEGVSLSREEISSL  2885

Query  288   SRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPS  121
                    +   P+ +      +GL   S Y   D+ + VSG  + MFDP    L   S  
Sbjct  2886  -------QFLPPWRLRGNTLNYGLALLSCYFVCDLLSVVSGGYLYMFDPLGLVLAAPSTC  2938

Query  120   HPGLRI-KFVGRRILEQFPDQFSPFL  46
              P  ++   +G  + ++F DQF+P L
Sbjct  2939  APAAKMFSLIGTNLTDRFRDQFNPML  2964



>gb|EYU27279.1| hypothetical protein MIMGU_mgv1a000002mg [Erythranthe guttata]
Length=4744

 Score =   488 bits (1255),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 256/284 (90%), Gaps = 1/284 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss-ngSAMALHAKQ  673
             AQHL+D  F EDQ KIYLPDV+ RL NAT LVYNDAPWLL+S+  ++    +A++L AKQ
Sbjct  1275  AQHLADAHFSEDQTKIYLPDVAGRLHNATSLVYNDAPWLLESEGSNNLFGNAAISLGAKQ  1334

Query  672   TIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL  493
              I +FVHGNIS+D+AEKLGVRSFRR+LLAESADSMNLSLSGAAEAFGQHE+LTTRLRHIL
Sbjct  1335  AIHKFVHGNISHDIAEKLGVRSFRRILLAESADSMNLSLSGAAEAFGQHEALTTRLRHIL  1394

Query  492   EMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVF  313
             EMYADGP VLFE+VQNAEDA AS V FLLDKS YGTSS+LSPEM DWQGPALYCFN+SVF
Sbjct  1395  EMYADGPSVLFEMVQNAEDAGASNVTFLLDKSNYGTSSLLSPEMGDWQGPALYCFNDSVF  1454

Query  312   SPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG  133
             S QDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTD+PTFVSGEN+VMFDPHAC LPG
Sbjct  1455  SSQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDVPTFVSGENIVMFDPHACHLPG  1514

Query  132   ISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
              SP+HPGLRIKFVGR ILEQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1515  TSPTHPGLRIKFVGRNILEQFPDQFSPFLHFGCDLQHPFPGTLF  1558


 Score =   201 bits (511),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R IL  Y +G  VL EL+QNA+DA A+ V   LD+  +G  S+LS  
Sbjct  8    EDFGQKVDLTRRIREILLNYPEGTTVLKELIQNADDAGATTVRLCLDRRTHGVDSLLSDS  67

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VFS QD  +ISRIG  SK    +  GRFG+GFNSVYH TD+P+FV
Sbjct  68   LASWQGPALLAYNDAVFSEQDFVSISRIGGSSKHADAWKTGRFGVGFNSVYHLTDLPSFV  127

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG++ V+FDP    LP +S ++PG RI++V    +  + DQF P+  FGCD+++PF+GTL
Sbjct  128  SGKHAVIFDPQGVYLPNVSTTNPGKRIEYVSSSAISLYKDQFLPYCAFGCDMKSPFQGTL  187

Query  3    F  1
            F
Sbjct  188  F  188


 Score = 88.6 bits (218),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 128/263 (49%), Gaps = 43/263 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD +  L  A +LVYNDAPW+              +L  K    RFVH +IS D+A 
Sbjct  2717  LLIPDSTGMLIGAANLVYNDAPWM-----------EPNSLGGK----RFVHSSISYDLAS  2761

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LG++S R +    S  S  L+       +        ++R +LE Y +   +LF+L++ 
Sbjct  2762  RLGIQSLRSL----SFVSKELTKDFPCMDYN-------KIRELLESYGNYEFLLFDLLEL  2810

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES-  268
             A+   A K+  + DK ++   S+L   +A++QGPAL            L   S  G E  
Sbjct  2811  ADCCKAKKLHLIFDKREHPRQSLLQHNLAEFQGPALVVI---------LEGASLNGDEVG  2861

Query  267   --KLEKPFAI-GR---FGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR  106
               +   P+++ GR   +GLG  S +  +D+P+ +S   + +FDP   ++   S   P  +
Sbjct  2862  SLQFLPPWSLRGRTLSYGLGLLSCFSISDLPSMISDGCLYIFDPRGLAIATPSARSPSAK  2921

Query  105   I-KFVGRRILEQFPDQFSPFLHF  40
             + +  G  + E+F DQFSP L +
Sbjct  2922  VFQLKGTNLTERFHDQFSPMLIY  2944



>ref|XP_004297744.1| PREDICTED: sacsin-like [Fragaria vesca subsp. vesca]
Length=4717

 Score =   486 bits (1251),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 237/285 (83%), Positives = 263/285 (92%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++VQ +  ++KIYLPDVS RL+ A+DLVYNDAPWLL S+D DS  G +  M L+A+
Sbjct  1284  VQHLAEVQIHNQKVKIYLPDVSGRLYPASDLVYNDAPWLLGSEDHDSPFGGSSNMPLNAR  1343

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNIS DVAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1344  RTVQKFVHGNISIDVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1403

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1404  LEMYADGPGILFELVQNAEDAGASEVNFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1463

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1464  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1523

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GR+I+EQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1524  GISPSHPGLRIKFSGRKIMEQFPDQFSPFLHFGCDLQHPFPGTLF  1568


 Score =   194 bits (492),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+  +G+ S+LS  
Sbjct  16   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATTVRLCLDRRLHGSDSLLSKT  75

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  76   LAPWQGPSLLAYNDAVFTEEDFVSISRIGGSSKHGQASKTGRFGVGFNSVYHLTDLPSFV  135

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI +V    +  + DQF P+  FGCD++ PF GTL
Sbjct  136  SGKYVVLFDPQGIFLPNVSASNPGKRIDYVSSSAISVYRDQFLPYCAFGCDMKTPFSGTL  195

Query  3    F  1
            F
Sbjct  196  F  196


 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 75/259 (29%), Positives = 121/259 (47%), Gaps = 39/259 (15%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I +PD S  L +A DLVYNDAPW+                H     + FVH  ISND+A 
Sbjct  2740  ILIPDFSGVLMDAGDLVYNDAPWME---------------HNTLGGKHFVHPTISNDLAN  2784

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGV+S R + L +   + ++     A           +++ +L  Y D   +LF+L++ 
Sbjct  2785  RLGVQSLRSLSLVDDEMTKDIPCMDFA-----------KIKDLLASYGDNDLLLFDLLEL  2833

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRIGQES  268
             A+   A+K+  + DK ++   S+L   M ++QGPAL      +  S +++ ++       
Sbjct  2834  ADCCKANKLHLIFDKREHPRQSLLQHNMGEFQGPALLAVLEGASLSREEVSSL-------  2886

Query  267   KLEKPF----AIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
             +   P+    A   +GL   S Y   D+ + VSG    MFDP    L   S   P  ++ 
Sbjct  2887  QFLPPWRLRGATVNYGLALLSCYFVCDVLSVVSGGYYYMFDPRGSVLAAPSTCTPAAKMF  2946

Query  102   KFVGRRILEQFPDQFSPFL  46
                G  + ++F DQF+P L
Sbjct  2947  SLTGTNLTDRFRDQFNPML  2965



>ref|XP_002527141.1| protein binding protein, putative [Ricinus communis]
 gb|EEF35243.1| protein binding protein, putative [Ricinus communis]
Length=4704

 Score =   484 bits (1246),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 233/284 (82%), Positives = 259/284 (91%), Gaps = 1/284 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss-ngSAMALHAKQ  673
              QHL++VQF+  ++KIYLPD+S RLF   DLVYNDAPWLL SD   S+   S++AL+AK+
Sbjct  1282  VQHLAEVQFHAQEVKIYLPDISGRLFPPNDLVYNDAPWLLGSDISASTFGASSVALNAKR  1341

Query  672   TIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL  493
             T+Q+FVHGNISN+VAEKLGV S RR+LLAE+ADSMN  LSGAAEAFGQHE+LTTRL+HIL
Sbjct  1342  TVQKFVHGNISNEVAEKLGVCSLRRILLAENADSMNFGLSGAAEAFGQHEALTTRLKHIL  1401

Query  492   EMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVF  313
             EMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SVF
Sbjct  1402  EMYADGPGILFELVQNAEDAGASEVIFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSVF  1461

Query  312   SPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG  133
             SPQDLYAISRIGQESKLEKP AIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LPG
Sbjct  1462  SPQDLYAISRIGQESKLEKPLAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLPG  1521

Query  132   ISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             ISPSHPGLRIKF GR+ILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1522  ISPSHPGLRIKFAGRKILEQFPDQFSPFLHFGCDLQHSFPGTLF  1565


 Score =   196 bits (498),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  + + S++S  
Sbjct  15   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVRLCLDRRLHRSDSIISTS  74

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            ++ WQGPAL  +N++VF+ +D  +ISRIG  +K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  75   LSQWQGPALLAYNDAVFTEEDFVSISRIGGSAKHGQAWKTGRFGVGFNSVYHLTDLPSFV  134

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ +V+FDP    LP +S S+PG RI FV    +  + DQFSP++ FGCD+++ F GTL
Sbjct  135  SGKYIVLFDPQGVHLPNVSTSNPGKRIDFVSSSAINFYDDQFSPYIAFGCDMKSSFNGTL  194

Query  3    F  1
            F
Sbjct  195  F  195


 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 130/267 (49%), Gaps = 41/267 (15%)
 Frame = -1

Query  825   FYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGN  646
             F +    + +PD S  L  + DL+YNDAPW+              AL  K     FVH +
Sbjct  2727  FEDSNTSLLMPDSSGILMCSRDLIYNDAPWI-----------ENCALVGKH----FVHPS  2771

Query  645   ISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGV  466
             ISND+A +LGV+S R + L +   + +L     A           ++  +L +Y +   +
Sbjct  2772  ISNDLANRLGVKSLRCVSLVDEDMTKDLPCMDRA-----------KINELLALYGNSDFL  2820

Query  465   LFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-FSPQDLYAI  289
             LF+L++ A+   A K+  + DK ++   S+L   + ++QGPAL      V  + +D+ ++
Sbjct  2821  LFDLLELADCCKAKKLHLIFDKREHPRQSLLQQNLGEFQGPALVAILEGVSLNREDVSSL  2880

Query  288   SRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPS  121
                    +L  P+ +      +GLG  S Y   D+ + +SG    MFDP   +L G+  S
Sbjct  2881  -------QLLPPWRLRGNTLNYGLGLLSCYFICDLLSVISGGYFYMFDPCGLAL-GVPSS  2932

Query  120   H-PGLRI-KFVGRRILEQFPDQFSPFL  46
             H P  ++   +G  + E+F DQF+P L
Sbjct  2933  HTPAAKMFSLIGTNLTERFSDQFNPML  2959



>ref|XP_009351717.1| PREDICTED: sacsin [Pyrus x bretschneideri]
Length=4764

 Score =   481 bits (1237),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 233/285 (82%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++VQ  + ++KIYLPD+S RL+ A+DLVYNDAPWLL S+D +S  G    +AL  +
Sbjct  1281  VQHLAEVQIQDQKVKIYLPDMSGRLYPASDLVYNDAPWLLGSEDHNSLFGGPPNLALTGR  1340

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
              T+Q+FVHGNIS DVAEKLGV S RR LLA+SADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1341  TTVQKFVHGNISIDVAEKLGVCSLRRTLLAQSADSMNLSLSGAAEAFGQHEALTTRLKHI  1400

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1401  LEMYADGPGILFELVQNAEDAGASEVTFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1460

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F PQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1461  FGPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1520

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GRRI+EQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1521  GISPSHPGLRIKFAGRRIMEQFPDQFSPFLHFGCDLQHPFPGTLF  1565


 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+  +GT S+LS  
Sbjct  14   EDFGQKVDLTRRIREVLVNYPEGTTVLKELIQNADDAGATTVRLCLDRRLHGTDSLLSAT  73

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  74   LAPWQGPALLAYNDAVFTEEDFVSISRIGGSSKHGQASKTGRFGVGFNSVYHLTDLPSFV  133

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI +V    +  + DQF P+  FGCD++ PF GTL
Sbjct  134  SGKYVVLFDPQGIFLPKVSASNPGKRIDYVSSSAISVYKDQFLPYCAFGCDMKTPFAGTL  193

Query  3    F  1
            F
Sbjct  194  F  194


 Score = 87.0 bits (214),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 123/262 (47%), Gaps = 31/262 (12%)
 Frame = -1

Query  825   FYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR-FVHG  649
             F      I +PD S  L +A +LVYNDAPW+                 +   I + F+H 
Sbjct  2728  FEASNTPILIPDSSGVLMDACNLVYNDAPWM----------------DSSTPIGKYFIHP  2771

Query  648   NISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPG  469
             +ISND+A +LGV+S R + L +  D M   L     A         R++ +L  + D   
Sbjct  2772  SISNDLACRLGVKSLRCLSLVD--DDMTKDLPCMDYA---------RIKELLASHGDNDL  2820

Query  468   VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAI  289
             +LF+L++ A+   A+K+  + DK ++   S+L   M ++QGPAL      V   ++  + 
Sbjct  2821  LLFDLLELADCCKATKLHLIFDKREHPRQSLLQHNMGEFQGPALLAILEGVSLSREEVSS  2880

Query  288   SRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGL  109
              +     +L    +   +GL   S Y   D+ + VSG  + MFDP    L   S   P  
Sbjct  2881  LQFLPPWRLRG--STLNYGLALLSCYFVCDLLSVVSGGYLYMFDPRGLVLAAPSTCAPAA  2938

Query  108   RI-KFVGRRILEQFPDQFSPFL  46
             ++   +G  + ++F DQF+P L
Sbjct  2939  KMFSLIGTNLTDRFRDQFNPML  2960



>ref|XP_010245479.1| PREDICTED: sacsin [Nelumbo nucifera]
Length=4779

 Score =   480 bits (1236),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 234/285 (82%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++  F +   +IYLPDVS RLF+ATDLVYNDAPWLL S  P++  G+A  +  + K
Sbjct  1281  VQHLAEAHFQDKHNEIYLPDVSSRLFSATDLVYNDAPWLLGSGGPENEFGNASTVTFNVK  1340

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T Q+FVHGNISNDVAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1341  RTAQKFVHGNISNDVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1400

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             +EMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALYCFNNS+
Sbjct  1401  VEMYADGPGILFELVQNAEDAGASEVTFLLDKTQYGTSSVLSPEMADWQGPALYCFNNSI  1460

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FS QDLYAISRIGQ+SKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGEN+VMFDPHAC LP
Sbjct  1461  FSAQDLYAISRIGQDSKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENIVMFDPHACYLP  1520

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRI+FVGR ILEQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1521  GISPSHPGLRIRFVGRSILEQFPDQFSPFLHFGCDLQHPFPGTLF  1565


 Score =   199 bits (507),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +G  S+LS +
Sbjct  12   EDFGQKVDLTRRIREVLVNYPEGTTVLKELIQNADDAGATKVCLCLDRRVHGVGSLLSSK  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A+WQGPAL  +NN+ F+  D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAEWQGPALLAYNNAEFTDDDFVSISRIGDSKKQGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI++V    +  + DQF P+  FGCD++ PF GTL
Sbjct  132  SGKYVVLFDPQGIYLPNISVANPGKRIEYVNSSAMSLYKDQFLPYCTFGCDMKRPFHGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score =   103 bits (256),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/260 (28%), Positives = 126/260 (48%), Gaps = 41/260 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD S  L  + DLVYNDAPW+                +A  + + FVH +ISND+A 
Sbjct  2742  LLVPDSSGVLMCSMDLVYNDAPWME---------------NASLSAKHFVHPSISNDLAS  2786

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LG++S R + L +   + +L                 R+  +L +Y +   +LF+L++ 
Sbjct  2787  RLGIQSLRCLSLVDEETTKDLPCLD-----------YNRISELLALYGNSNFLLFDLLEL  2835

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCF-NNSVFSPQDLYAISRIGQES  268
             A+   A  +  + DK ++   S+L   + ++QGP+L      +  + +++ ++       
Sbjct  2836  ADCCKARMMHLIFDKREHPRQSLLQHNLGEFQGPSLVVIMEGATLTREEVSSL-------  2888

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSH-PGLRI  103
             +L  P+ +      +GLG  S Y   D+P+ +S     MFDP   +L  I PSH P  ++
Sbjct  2889  QLRPPWRLRGSTLTYGLGLLSTYFVCDLPSVISNGYFYMFDPRGLAL-SIPPSHVPSAKM  2947

Query  102   -KFVGRRILEQFPDQFSPFL  46
                 G  ++E+F DQF P L
Sbjct  2948  FSLTGTNLMERFHDQFKPML  2967



>ref|XP_008340450.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Malus domestica]
Length=4767

 Score =   479 bits (1233),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 233/285 (82%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++VQ  + ++KIYLPD+S RL+ A+DLVYNDAPWLL S+D DS  G    +AL  +
Sbjct  1281  VQHLAEVQIQDQKVKIYLPDMSGRLYLASDLVYNDAPWLLGSEDHDSLFGGPPNLALTGR  1340

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
              T+Q+FVHGNIS DVAEKLGV S RR LLA+SADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1341  TTVQKFVHGNISIDVAEKLGVCSLRRTLLAQSADSMNLSLSGAAEAFGQHEALTTRLKHI  1400

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1401  LEMYADGPGILFELVQNAEDAGASEVTFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1460

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F PQDLYAISRIGQESKLE+PFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LP
Sbjct  1461  FGPQDLYAISRIGQESKLEQPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLP  1520

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKF GRRI+EQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  1521  GISPSHPGLRIKFAGRRIMEQFPDQFSPFLHFGCDLQHPFPGTLF  1565


 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V   LD+  +GT S+LS  
Sbjct  14   EDFGQKVDLTRRIREVLVNYPEGTTVLKELIQNADDAGATSVRLCLDRRLHGTDSLLSAT  73

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  74   LAPWQGPALLAYNDAVFTEEDFVSISRIGGSSKHGQASKTGRFGVGFNSVYHLTDLPSFV  133

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI +V    +  + DQF P+  FGCD++ PF GTL
Sbjct  134  SGKYVVLFDPQGMFLPKVSASNPGKRIDYVSSSAISVYKDQFLPYCAFGCDMKTPFAGTL  193

Query  3    F  1
            F
Sbjct  194  F  194


 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 123/262 (47%), Gaps = 31/262 (12%)
 Frame = -1

Query  825   FYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR-FVHG  649
             F      I +PD S  L +A +LVYNDAPW+                 +   I + F+H 
Sbjct  2728  FEASNTPILIPDSSGVLMDACNLVYNDAPWM----------------DSSTPIGKYFIHP  2771

Query  648   NISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPG  469
             +ISND+A +LGV+S R + L +   + +L     A           R++ +L  + D   
Sbjct  2772  SISNDLACRLGVQSLRCLSLVDDDMTKDLPCMDFA-----------RIKELLASHGDNDL  2820

Query  468   VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAI  289
             +LF+L++ A+   A+K+  + DK ++   S+L   M ++QGPAL      V   ++  + 
Sbjct  2821  LLFDLLELADCCKATKLHLIFDKREHPRQSLLQHNMGEFQGPALLAILEGVSLSREEVSS  2880

Query  288   SRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGL  109
              +     +L    +   +GL   S Y   D+ + VSG  + MFDP    L   S   P  
Sbjct  2881  LQFLPPWRLRG--STLNYGLALLSCYFVCDLLSVVSGGYLYMFDPRGLVLAAPSTCAPAA  2938

Query  108   RI-KFVGRRILEQFPDQFSPFL  46
             ++   +G  + ++F DQF+P L
Sbjct  2939  KMFSLIGTNLTDRFRDQFNPML  2960



>ref|XP_010688704.1| PREDICTED: sacsin [Beta vulgaris subsp. vulgaris]
Length=4742

 Score =   476 bits (1225),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/285 (81%), Positives = 257/285 (90%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++  F E  + IYLPD S RL  A+DLVYNDAPWLL S+D D ++  A  ++L A+
Sbjct  1279  VQHLAEAAFNEKHVIIYLPDASGRLLPASDLVYNDAPWLLGSEDSDGTSNHASTLSLSAR  1338

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             Q++QRFVHGNISNDVAEKLGV S RR LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1339  QSVQRFVHGNISNDVAEKLGVCSLRRSLLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1398

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMADWQGPALYC+N+S+
Sbjct  1399  LEMYADGPGILFELVQNAEDAGASEVIFLLDKTHYGTSSLLSPEMADWQGPALYCYNDSI  1458

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLY+ISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP+FVSGEN+VMFDPHAC+LP
Sbjct  1459  FSPQDLYSISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPSFVSGENIVMFDPHACNLP  1518

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGRRILEQFPDQFSPFL+FGCDLQN F GTLF
Sbjct  1519  GISPSHPGLRIKFVGRRILEQFPDQFSPFLYFGCDLQNQFPGTLF  1563


 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV+  LD+  +G  S+LS  
Sbjct  9    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVSLCLDRRSHGVESLLSDT  68

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP L   N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  69   LAQWQGPGLLAHNDAVFTEEDFVSISRIGGSKKHSQAWKTGRFGVGFNSVYHLTDLPSFV  128

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ +V+FDP    LP +S ++PG RI++V    + ++ DQ  P+  FGCD+++PF GTL
Sbjct  129  SGKYLVLFDPQGVYLPNVSAANPGKRIEYVSTSAISRYNDQLFPYCAFGCDMRSPFSGTL  188

Query  3    F  1
            F
Sbjct  189  F  189


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 122/259 (47%), Gaps = 39/259 (15%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD S  L  + DLV+NDAPW+ ++                   + FVH  IS+D+A 
Sbjct  2715  LLIPDASGVLMYSKDLVFNDAPWMANNISIG---------------KNFVHQKISDDLAS  2759

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
              LGV+S R M L +   + +L     A           R+  +L +YA    +LF+L++ 
Sbjct  2760  ILGVQSLRCMSLVDEEMAKDLVCMDFA-----------RISELLTLYASEDFLLFDLLEL  2808

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRIGQES  268
             A+  N  K+  + DK ++   S+L   + ++QGPAL   F  +  S +++ ++       
Sbjct  2809  ADSCNTKKMHIIFDKREHPRQSLLQHNLGEFQGPALLVIFEGAGLSREEVTSL-------  2861

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
             +   P+ +      +GLG  S +   D+ + +SG    +FDP    L   S   PG ++ 
Sbjct  2862  QFLPPWRLRGDTLNYGLGLLSSFSVCDLLSVMSGGYYYIFDPRGLVLAPSSSHSPGAKVF  2921

Query  102   KFVGRRILEQFPDQFSPFL  46
                G  + E+F DQFSP L
Sbjct  2922  SLTGTNLTERFQDQFSPML  2940



>gb|KGN45079.1| hypothetical protein Csa_7G420720 [Cucumis sativus]
Length=4762

 Score =   474 bits (1221),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 223/285 (78%), Positives = 256/285 (90%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMA--LHAK  676
              QHL++ Q  + QI I+LPD+SCRLF A +LVYNDAPWLL +D+ D S     A  L+A+
Sbjct  1282  VQHLAEAQLPQQQIDIHLPDISCRLFPAKNLVYNDAPWLLGTDNTDVSFDGGSAAFLNAR  1341

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LT RLRHI
Sbjct  1342  KTVQKFVHGNISNDVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTNRLRHI  1401

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             L+MYADGPG+LFEL+QNAEDA +S+V FLLDK+ YGTSSVLSPEMADWQGPALYC+N+SV
Sbjct  1402  LDMYADGPGILFELIQNAEDAGSSEVIFLLDKTHYGTSSVLSPEMADWQGPALYCYNDSV  1461

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISR+GQESKL+KP +IGRFGLGFN VYHFTD+PTFVSGEN+VMFDPHAC+LP
Sbjct  1462  FSPQDLYAISRVGQESKLQKPLSIGRFGLGFNCVYHFTDVPTFVSGENIVMFDPHACNLP  1521

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIK+ GR+ILEQFPDQFSP+LHFGCD+Q PF GTLF
Sbjct  1522  GISPSHPGLRIKYAGRKILEQFPDQFSPYLHFGCDMQKPFPGTLF  1566


 Score =   190 bits (482),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL ELVQNA+DA A+KV   LD+  +G  S+LS  
Sbjct  14   EDFGQKVDLTRRIREVLLNYPEGTTVLKELVQNADDAGATKVCLCLDRRVHGRESLLSAS  73

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A +QGPAL  +NN+VF+ +D  +ISRIG  +K  + +  GRFG+GFNSVYH T++P+FV
Sbjct  74   LAPFQGPALLAYNNAVFTEEDFVSISRIGGSNKHGQAWKTGRFGVGFNSVYHLTELPSFV  133

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VVMFDP    LP +S S+PG RI F+    + Q+ DQF P+  F C +++ F GTL
Sbjct  134  SGKYVVMFDPQGIYLPKVSASNPGKRIDFIRSSAISQYRDQFLPYCAFDCTMESSFAGTL  193

Query  3    F  1
            F
Sbjct  194  F  194


 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 128/267 (48%), Gaps = 39/267 (15%)
 Frame = -1

Query  828   QFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHG  649
             +F    I + +P+ S  L  A DLVYNDAPW              M  +     + FVH 
Sbjct  2727  EFTATSIPLLIPNSSQVLMLANDLVYNDAPW--------------MEDNNILVGKHFVHP  2772

Query  648   NISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPG  469
             +ISND+A +LGV+S R + L +   + +L                +++  +L++Y +   
Sbjct  2773  SISNDLAGRLGVQSIRCLSLVDEEMTKDLPCMD-----------YSKISELLKLYGND-Y  2820

Query  468   VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYA  292
             + F+L++ A+   A  +  + DK ++   S+L   + ++QGPAL   F  S  S +++ +
Sbjct  2821  LFFDLLELADCCRAKNLRLIFDKREHPRQSLLQHNLGEFQGPALVAIFEGSSLSTEEISS  2880

Query  291   ISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISP  124
             +       +   P+ +      +GLG  S Y+  D+ + +SG    +FDP   +L     
Sbjct  2881  L-------QFRPPWKLRGDTLNYGLGLLSCYYVCDLLSIISGGYFYIFDPRGIALSVAPK  2933

Query  123   SHPGLRI-KFVGRRILEQFPDQFSPFL  46
             S PG ++   +G  ++E+F DQF P L
Sbjct  2934  SAPGAKVFSLIGSNLIERFNDQFYPLL  2960



>ref|XP_010094076.1| hypothetical protein L484_018092 [Morus notabilis]
 gb|EXB55166.1| hypothetical protein L484_018092 [Morus notabilis]
Length=4755

 Score =   474 bits (1221),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 227/285 (80%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHL++V  +E ++K+YLPDVS   + A+DLVYNDAPWLL S+DP +       + L+A+
Sbjct  1290  VQHLAEVPLHEQKVKLYLPDVSGTFYPASDLVYNDAPWLLGSEDPGNLFNVTPNVTLNAR  1349

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+ +FVHGNISN+VAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1350  KTVHKFVHGNISNNVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1409

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+L+ELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMADWQGPALYCFN+SV
Sbjct  1410  LEMYADGPGILYELVQNAEDAGASEVIFLLDKTQYGTSSLLSPEMADWQGPALYCFNDSV  1469

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTD+PTFVSGEN+VMFDPHAC LP
Sbjct  1470  FTPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDVPTFVSGENIVMFDPHACHLP  1529

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGRRIL+QFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1530  GISPSHPGLRIKFVGRRILDQFPDQFSPFLHFGCDLQHEFPGTLF  1574


 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 132/193 (68%), Gaps = 4/193 (2%)
 Frame = -1

Query  579  ADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDK  400
            ADSM + L    E FGQ   LT R+R +L  Y +G  V+ EL+QNA+DA A+KV   LD+
Sbjct  14   ADSMAILL----EDFGQKVDLTRRIREVLLNYPEGTTVMKELIQNADDAGATKVCLCLDR  69

Query  399  SQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFN  220
              +G+ S+LSP +A WQGPAL  +N++VF+  D  +ISRIG  SK  + +  GRFG+GFN
Sbjct  70   RVHGSESLLSPTLAQWQGPALLAYNDAVFTEDDFVSISRIGGSSKHGQAWKTGRFGVGFN  129

Query  219  SVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHF  40
            SVYH TD+P+FVSG+ VV+FDP +  LP +S S+PG RI +V    +  + DQF P+  F
Sbjct  130  SVYHLTDLPSFVSGKYVVLFDPQSIYLPKVSASNPGKRIDYVSSSAISVYRDQFFPYCAF  189

Query  39   GCDLQNPFRGTLF  1
            GCD+ +PF GTLF
Sbjct  190  GCDMTSPFAGTLF  202


 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/260 (26%), Positives = 124/260 (48%), Gaps = 41/260 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +P  S  L +  D+VYNDAPW+                ++    ++F+H +I+ND+A 
Sbjct  2748  LLVPVFSGVLMHVGDVVYNDAPWME---------------NSTPVGKQFLHSSINNDLAN  2792

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGV+S R + L +   + +L     A           R+  +L ++ D   +LF+L++ 
Sbjct  2793  RLGVQSLRCLSLVDEEMTKDLPCMDYA-----------RINELLALHGDSDLLLFDLLEL  2841

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRIGQES  268
             A+   A K+  + DK  +   S+L   + ++QGPAL      ++ S +++ ++       
Sbjct  2842  ADCCKAKKLHLIFDKRTHPRQSLLQHNLGEFQGPALVAVLEGAILSREEVSSL-------  2894

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSH-PGLRI  103
             +   P+ +      +GLG  S Y   ++ + VSG    +FDP   +   + PS  P  ++
Sbjct  2895  QFLPPWRLRGNTLSYGLGLLSCYSVCNLLSMVSGGFFYVFDPCGSTF-AVPPSRSPAAKV  2953

Query  102   -KFVGRRILEQFPDQFSPFL  46
                 G  + ++F DQFSP L
Sbjct  2954  FSLTGTNLTDRFRDQFSPML  2973



>ref|XP_004135955.1| PREDICTED: uncharacterized protein LOC101212447 [Cucumis sativus]
Length=4709

 Score =   474 bits (1220),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/285 (78%), Positives = 256/285 (90%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMA--LHAK  676
              QHL++ Q  + QI I+LPD+SCRLF A +LVYNDAPWLL +D+ D S     A  L+A+
Sbjct  1282  VQHLAEAQLPQQQIDIHLPDISCRLFPAKNLVYNDAPWLLGTDNTDVSFDGGSAAFLNAR  1341

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LT RLRHI
Sbjct  1342  KTVQKFVHGNISNDVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTNRLRHI  1401

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             L+MYADGPG+LFEL+QNAEDA +S+V FLLDK+ YGTSSVLSPEMADWQGPALYC+N+SV
Sbjct  1402  LDMYADGPGILFELIQNAEDAGSSEVIFLLDKTHYGTSSVLSPEMADWQGPALYCYNDSV  1461

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISR+GQESKL+KP +IGRFGLGFN VYHFTD+PTFVSGEN+VMFDPHAC+LP
Sbjct  1462  FSPQDLYAISRVGQESKLQKPLSIGRFGLGFNCVYHFTDVPTFVSGENIVMFDPHACNLP  1521

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIK+ GR+ILEQFPDQFSP+LHFGCD+Q PF GTLF
Sbjct  1522  GISPSHPGLRIKYAGRKILEQFPDQFSPYLHFGCDMQKPFPGTLF  1566


 Score =   189 bits (481),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL ELVQNA+DA A+KV   LD+  +G  S+LS  
Sbjct  14   EDFGQKVDLTRRIREVLLNYPEGTTVLKELVQNADDAGATKVCLCLDRRVHGRESLLSAS  73

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A +QGPAL  +NN+VF+ +D  +ISRIG  +K  + +  GRFG+GFNSVYH T++P+FV
Sbjct  74   LAPFQGPALLAYNNAVFTEEDFVSISRIGGSNKHGQAWKTGRFGVGFNSVYHLTELPSFV  133

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VVMFDP    LP +S S+PG RI F+    + Q+ DQF P+  F C +++ F GTL
Sbjct  134  SGKYVVMFDPQGIYLPKVSASNPGKRIDFIRSSAISQYRDQFLPYCAFDCTMESSFAGTL  193

Query  3    F  1
            F
Sbjct  194  F  194


 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 128/267 (48%), Gaps = 39/267 (15%)
 Frame = -1

Query  828   QFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHG  649
             +F    I + +P+ S  L  A DLVYNDAPW              M  +     + FVH 
Sbjct  2727  EFTATSIPLLIPNSSQVLMLANDLVYNDAPW--------------MEDNNILVGKHFVHP  2772

Query  648   NISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPG  469
             +ISND+A +LGV+S R + L +   + +L                +++  +L++Y +   
Sbjct  2773  SISNDLAGRLGVQSIRCLSLVDEEMTKDLPCMD-----------YSKISELLKLYGND-Y  2820

Query  468   VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYA  292
             + F+L++ A+   A  +  + DK ++   S+L   + ++QGPAL   F  S  S +++ +
Sbjct  2821  LFFDLLELADCCRAKNLRLIFDKREHPRQSLLQHNLGEFQGPALVAIFEGSSLSTEEISS  2880

Query  291   ISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISP  124
             +       +   P+ +      +GLG  S Y+  D+ + +SG    +FDP   +L     
Sbjct  2881  L-------QFRPPWKLRGDTLNYGLGLLSCYYVCDLLSIISGGYFYIFDPRGIALSVAPK  2933

Query  123   SHPGLRI-KFVGRRILEQFPDQFSPFL  46
             S PG ++   +G  ++E+F DQF P L
Sbjct  2934  SAPGAKVFSLIGSNLIERFNDQFYPLL  2960



>ref|XP_004158223.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Cucumis sativus]
Length=3586

 Score =   474 bits (1219),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/285 (78%), Positives = 256/285 (90%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMA--LHAK  676
              QHL++ Q  + QI I+LPD+SCRLF A +LVYNDAPWLL +D+ D S     A  L+A+
Sbjct  1282  VQHLAEAQLPQQQIDIHLPDISCRLFPAKNLVYNDAPWLLGTDNTDVSFDGGSAAFLNAR  1341

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LT RLRHI
Sbjct  1342  KTVQKFVHGNISNDVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTNRLRHI  1401

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             L+MYADGPG+LFEL+QNAEDA +S+V FLLDK+ YGTSSVLSPEMADWQGPALYC+N+SV
Sbjct  1402  LDMYADGPGILFELIQNAEDAGSSEVIFLLDKTHYGTSSVLSPEMADWQGPALYCYNDSV  1461

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISR+GQESKL+KP +IGRFGLGFN VYHFTD+PTFVSGEN+VMFDPHAC+LP
Sbjct  1462  FSPQDLYAISRVGQESKLQKPLSIGRFGLGFNCVYHFTDVPTFVSGENIVMFDPHACNLP  1521

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIK+ GR+ILEQFPDQFSP+LHFGCD+Q PF GTLF
Sbjct  1522  GISPSHPGLRIKYAGRKILEQFPDQFSPYLHFGCDMQKPFPGTLF  1566


 Score =   189 bits (481),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL ELVQNA+DA A+KV   LD+  +G  S+LS  
Sbjct  14   EDFGQKVDLTRRIREVLLNYPEGTTVLKELVQNADDAGATKVCLCLDRRVHGRESLLSAS  73

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A +QGPAL  +NN+VF+ +D  +ISRIG  +K  + +  GRFG+GFNSVYH T++P+FV
Sbjct  74   LAPFQGPALLAYNNAVFTEEDFVSISRIGGSNKHGQAWKTGRFGVGFNSVYHLTELPSFV  133

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VVMFDP    LP +S S+PG RI F+    + Q+ DQF P+  F C +++ F GTL
Sbjct  134  SGKYVVMFDPQGIYLPKVSASNPGKRIDFIRSSAISQYRDQFLPYCAFDCTMESSFAGTL  193

Query  3    F  1
            F
Sbjct  194  F  194


 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 128/267 (48%), Gaps = 39/267 (15%)
 Frame = -1

Query  828   QFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHG  649
             +F    I + +P+ S  L  A DLVYNDAPW              M  +     + FVH 
Sbjct  2727  EFTATSIPLLIPNSSQVLMLANDLVYNDAPW--------------MEDNNILVGKHFVHP  2772

Query  648   NISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPG  469
             +ISND+A +LGV+S R + L +   + +L                +++  +L++Y +   
Sbjct  2773  SISNDLAGRLGVQSIRCLSLVDEEMTKDLPCMD-----------YSKISELLKLYGND-Y  2820

Query  468   VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYA  292
             + F+L++ A+   A  +  + DK ++   S+L   + ++QGPAL   F  S  S +++ +
Sbjct  2821  LFFDLLELADCCRAKNLRLIFDKREHPRQSLLQHNLGEFQGPALVAIFEGSSLSTEEISS  2880

Query  291   ISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISP  124
             +       +   P+ +      +GLG  S Y+  D+ + +SG    +FDP   +L     
Sbjct  2881  L-------QFRPPWKLRGDTLNYGLGLLSCYYVCDLLSIISGGYFYIFDPRGIALSVAPK  2933

Query  123   SHPGLRI-KFVGRRILEQFPDQFSPFL  46
             S PG ++   +G  ++E+F DQF P L
Sbjct  2934  SAPGAKVFSLIGSNLIERFNDQFYPLL  2960



>ref|XP_008461369.1| PREDICTED: sacsin isoform X1 [Cucumis melo]
Length=4762

 Score =   474 bits (1220),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/285 (79%), Positives = 255/285 (89%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
              QHL++ Q  + QI IYLPD+SCRLF A +LVYNDAPWLL +D+ D S    SA  L A+
Sbjct  1282  VQHLAEAQLPKQQIDIYLPDISCRLFPAKNLVYNDAPWLLGTDNNDVSFDGESAAFLSAR  1341

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LT RLRHI
Sbjct  1342  KTVQKFVHGNISNDVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTNRLRHI  1401

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFEL+QNAEDA +S+V FLLDK+ YGTSS+LSPEMADWQGPALYC+N+SV
Sbjct  1402  LEMYADGPGILFELIQNAEDAGSSEVIFLLDKTHYGTSSILSPEMADWQGPALYCYNDSV  1461

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISR+GQESKL+KP AIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC+LP
Sbjct  1462  FSPQDLYAISRVGQESKLQKPLAIGRFGLGFNCVYHFTDIPMFVSGENIVMFDPHACNLP  1521

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIK+ GR+ILEQFPDQFSP+LHFGCD++ PF GTLF
Sbjct  1522  GISPSHPGLRIKYAGRKILEQFPDQFSPYLHFGCDMEKPFPGTLF  1566


 Score =   191 bits (484),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL ELVQNA+DA A+KV   LD+  +G  S+LS  
Sbjct  14   EDFGQKVDLTRRIREVLLNYPEGTTVLKELVQNADDAGATKVCLCLDRRVHGRESLLSAS  73

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A +QGPAL  +NN+VF+ +D  +ISRIG  +K  + +  GRFG+GFNSVYH T++P+FV
Sbjct  74   LAPFQGPALLAYNNAVFTEEDFVSISRIGGSNKHGQAWKTGRFGVGFNSVYHLTELPSFV  133

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VVMFDP    LP +S S+PG RI F+    + Q+ DQF P+  F C++++ F GTL
Sbjct  134  SGKYVVMFDPQGIYLPKVSASNPGKRIDFIRSSAISQYRDQFLPYCAFDCNMESSFAGTL  193

Query  3    F  1
            F
Sbjct  194  F  194


 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 72/267 (27%), Positives = 129/267 (48%), Gaps = 39/267 (15%)
 Frame = -1

Query  828   QFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHG  649
             +F    + + +P+ S  L  A DLVYNDAPW              M  +     + FVH 
Sbjct  2727  EFTATSMSLLIPNSSQVLMLANDLVYNDAPW--------------MEDNNILVGKHFVHP  2772

Query  648   NISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPG  469
             +ISND+A +LGV+S R + L +   + +L                +++  +L++Y +   
Sbjct  2773  SISNDLAGRLGVQSIRCLSLVDEEMTKDLPCMD-----------YSKISDLLKLYGND-Y  2820

Query  468   VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYA  292
             + F+L++ A+   A  +  + DK ++   S+L   + ++QGPAL   F  S  S +++ +
Sbjct  2821  LFFDLLELADCCKAKNLRLIFDKREHPRQSLLQHNLGEFQGPALVAIFEGSSLSTEEISS  2880

Query  291   ISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISP  124
             +       +   P+ +      +GLG  S Y+  D+ + +SG    +FDP   +L   + 
Sbjct  2881  L-------QFRPPWKLRGDTLNYGLGLLSCYYVCDLLSIISGGYFYIFDPRGIALSVAAK  2933

Query  123   SHPGLRI-KFVGRRILEQFPDQFSPFL  46
             S PG ++   +G  ++E+F DQF P L
Sbjct  2934  SAPGAKVFSLIGSNLIERFNDQFYPLL  2960



>ref|XP_008461370.1| PREDICTED: uncharacterized protein LOC103499971 isoform X2 [Cucumis 
melo]
Length=4422

 Score =   473 bits (1218),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 225/285 (79%), Positives = 255/285 (89%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
              QHL++ Q  + QI IYLPD+SCRLF A +LVYNDAPWLL +D+ D S    SA  L A+
Sbjct  942   VQHLAEAQLPKQQIDIYLPDISCRLFPAKNLVYNDAPWLLGTDNNDVSFDGESAAFLSAR  1001

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LT RLRHI
Sbjct  1002  KTVQKFVHGNISNDVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTNRLRHI  1061

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFEL+QNAEDA +S+V FLLDK+ YGTSS+LSPEMADWQGPALYC+N+SV
Sbjct  1062  LEMYADGPGILFELIQNAEDAGSSEVIFLLDKTHYGTSSILSPEMADWQGPALYCYNDSV  1121

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISR+GQESKL+KP AIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC+LP
Sbjct  1122  FSPQDLYAISRVGQESKLQKPLAIGRFGLGFNCVYHFTDIPMFVSGENIVMFDPHACNLP  1181

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIK+ GR+ILEQFPDQFSP+LHFGCD++ PF GTLF
Sbjct  1182  GISPSHPGLRIKYAGRKILEQFPDQFSPYLHFGCDMEKPFPGTLF  1226


 Score =   100 bits (250),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 72/267 (27%), Positives = 129/267 (48%), Gaps = 39/267 (15%)
 Frame = -1

Query  828   QFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHG  649
             +F    + + +P+ S  L  A DLVYNDAPW              M  +     + FVH 
Sbjct  2387  EFTATSMSLLIPNSSQVLMLANDLVYNDAPW--------------MEDNNILVGKHFVHP  2432

Query  648   NISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPG  469
             +ISND+A +LGV+S R + L +   + +L                +++  +L++Y +   
Sbjct  2433  SISNDLAGRLGVQSIRCLSLVDEEMTKDLPCMD-----------YSKISDLLKLYGND-Y  2480

Query  468   VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYA  292
             + F+L++ A+   A  +  + DK ++   S+L   + ++QGPAL   F  S  S +++ +
Sbjct  2481  LFFDLLELADCCKAKNLRLIFDKREHPRQSLLQHNLGEFQGPALVAIFEGSSLSTEEISS  2540

Query  291   ISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISP  124
             +       +   P+ +      +GLG  S Y+  D+ + +SG    +FDP   +L   + 
Sbjct  2541  L-------QFRPPWKLRGDTLNYGLGLLSCYYVCDLLSIISGGYFYIFDPRGIALSVAAK  2593

Query  123   SHPGLRI-KFVGRRILEQFPDQFSPFL  46
             S PG ++   +G  ++E+F DQF P L
Sbjct  2594  SAPGAKVFSLIGSNLIERFNDQFYPLL  2620



>ref|XP_004960086.1| PREDICTED: uncharacterized protein LOC101774020 [Setaria italica]
Length=4749

 Score =   472 bits (1215),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ +F + Q +IYLPD S RL  +++LV+NDAPWLLD     S + S+MAL +K+ 
Sbjct  1283  VQHLAEFRFQDQQTQIYLPDSSSRLCLSSELVFNDAPWLLDFGHDISGSASSMALSSKKY  1342

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1343  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1402

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1403  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1462

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC LPGI
Sbjct  1463  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHACYLPGI  1522

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGRRIL+QFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1523  SPSHPGLRIKFVGRRILDQFPDQFAPFLHFGCNLQQPFPGTLF  1565


 Score =   197 bits (501),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA A++V   LD+  +G +S+L+P 
Sbjct  12   EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGAARVRLCLDRRSHGEASLLAPA  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPALLAYNDAVFTDEDFASISRIGDSRKVAQTWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI +V       + DQ SP+  FGCD++  F+GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSAANPGKRIDYVNSSAFTMYHDQLSPYCAFGCDMKASFQGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 119/258 (46%), Gaps = 40/258 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  A +LVYNDAPW+                +A  T + FVH +I ND+A 
Sbjct  2729  LVIPDSFGVLAPARNLVYNDAPWM----------------NADSTSKNFVHISIGNDLAN  2772

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L +     NL     A           ++  +L +Y +   +LF+L++ 
Sbjct  2773  RLGVRSLRGSSLLDDELMRNLPCMEYA-----------KISELLALYGESDFLLFDLMEL  2821

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA KV  + DK ++   S+L   + D QG +L   F  ++ + +++ ++       
Sbjct  2822  ADYCNAKKVHLIYDKREHPKQSLLQQSLGDLQGSSLTVVFEGTIMNREEVCSL-------  2874

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-I  103
             +L  P+ +      +GLG  S Y   D  T +SG    +FDP   +    S +    R  
Sbjct  2875  QLPPPWKLRGNMLNYGLGLLSSYFVCDTLTILSGGYFYIFDPLGLTGGATSTATSSARYF  2934

Query  102   KFVGRRILEQFPDQFSPF  49
               +G  ++E+F DQF P 
Sbjct  2935  SLLGNDLVERFHDQFLPM  2952



>gb|KDO52761.1| hypothetical protein CISIN_1g0000071mg, partial [Citrus sinensis]
Length=3749

 Score =   471 bits (1213),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 234/285 (82%), Positives = 259/285 (91%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALH--AK  676
              QHL++ QF+E Q++IYLPDVS RLF A++LVYNDAPWLL SDD  SS   A  +H  A+
Sbjct  1280  VQHLAEGQFHE-QVQIYLPDVSGRLFLASELVYNDAPWLLGSDDFPSSFNDASTVHLNAR  1338

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T Q+FVHGNISN+VAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1339  RTSQKFVHGNISNEVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1398

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMADWQGPALY FN+SV
Sbjct  1399  LEMYADGPGTLFELVQNAEDAGASEVVFLLDKTQYGTSSLLSPEMADWQGPALYSFNDSV  1458

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDL+AISRIGQESKLEKP AIGRFGLGFN VYHFTD+PTFVSGEN+VMFDPHAC+LP
Sbjct  1459  FSPQDLFAISRIGQESKLEKPLAIGRFGLGFNCVYHFTDVPTFVSGENIVMFDPHACNLP  1518

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+ILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1519  GISPSHPGLRIKFVGRKILEQFPDQFSPFLHFGCDLQHSFPGTLF  1563


 Score =   193 bits (490),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V F LD+  + + S+LS  
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATLVRFCLDRRVHASDSLLSSS  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  FN++VFS +D  +ISRIG  SK  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPALLAFNDAVFSEEDFVSISRIGGSSKHGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI++V    + Q+ DQF P+  FGCD++ PF GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSSANPGKRIEYVSSSAISQYKDQFFPYCAFGCDMKTPFAGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 124/270 (46%), Gaps = 42/270 (16%)
 Frame = -1

Query  834   DVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFV  655
             D   +E    + +PD    L  A DLVYNDAPW+                      + F+
Sbjct  2720  DKPLFEACNTLLIPDSFGILRFARDLVYNDAPWI----------------EDNLVGKHFI  2763

Query  654   HGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADG  475
             H +ISND+A++LGV+S R + L +   + +L     A           R+  +L  Y   
Sbjct  2764  HPSISNDLADRLGVKSIRCLSLVDEDMTKDLPCMDFA-----------RISELLACYGSN  2812

Query  474   PGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDL  298
               +LF+L++ A+   A K+    DK  +   S+L   + ++QGPAL      ++ S +++
Sbjct  2813  DFLLFDLLELADCCKAKKLHLYFDKRDHPRQSLLQHNLGEFQGPALVAVLEGAILSREEI  2872

Query  297   YAISRIGQESKLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
              ++       +L  P+     I  +GLG  S Y   D  + VSG    MFDP   +L  I
Sbjct  2873  SSL-------QLLPPWRLRGDILNYGLGLLSCYFICDFLSIVSGGYYYMFDPRGLAL-AI  2924

Query  129   SPSHPGLRIKF--VGRRILEQFPDQFSPFL  46
             S SH     +F  +G  + E+F DQF+P L
Sbjct  2925  SSSHSPSAKEFSLLGTNLTERFRDQFNPML  2954



>gb|KHN29572.1| Sacsin [Glycine soja]
Length=3507

 Score =   470 bits (1209),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/285 (82%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = -1

Query  849  AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              HL++V  +E ++++YLPDVS RLF A DLVYNDAPWLL SDDP  S G+A  +AL+AK
Sbjct  22   VHHLAEVYHHEHKVQLYLPDVSGRLFLAGDLVYNDAPWLLGSDDPKGSFGNAPTVALNAK  81

Query  675  QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
            +T+Q+FVHGNISNDVAEKLGV S RRMLLAES+DSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  82   RTVQKFVHGNISNDVAEKLGVCSLRRMLLAESSDSMNFSLSGAAEAFGQHEALTTRLKHI  141

Query  495  LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
            LEMYADGPG LFE+VQNAEDA AS+V FLLDKS YGTSS+LSPEMADWQGPALYC+N+SV
Sbjct  142  LEMYADGPGSLFEMVQNAEDAGASEVIFLLDKSHYGTSSILSPEMADWQGPALYCYNDSV  201

Query  315  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
            FSPQDLYAISRIGQESKLEK FAIGRFGLGFN VYHFTDIP FVSGENVVMFDPHA +LP
Sbjct  202  FSPQDLYAISRIGQESKLEKAFAIGRFGLGFNCVYHFTDIPMFVSGENVVMFDPHASNLP  261

Query  135  GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
            GISPSHPGLRIKFVGR+ILEQFPDQFSP LHFGCDLQ+PF GTLF
Sbjct  262  GISPSHPGLRIKFVGRQILEQFPDQFSPLLHFGCDLQHPFPGTLF  306


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 114/250 (46%), Gaps = 39/250 (16%)
 Frame = -1

Query  777   LFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEKLGVRSFRR  598
             L  A DLVYNDAPWL                ++    + FVH  ISND+A+KLGV+S R 
Sbjct  1485  LMQAGDLVYNDAPWLE---------------NSSLIGRHFVHPIISNDLADKLGVQSVRC  1529

Query  597   MLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKV  418
             + L    D +   L               ++  +L  Y D   +LF+L++ A+   A ++
Sbjct  1530  LSLV--GDDLTKDLPCMD---------YNKVNELLAQYGDSEFLLFDLLELADCCKAKRL  1578

Query  417   AFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRIGQESKLEKPFAIG  241
               + DK ++   S+L   + D+QGPAL   F  +  S ++           +L  P+ + 
Sbjct  1579  HLIYDKREHPRQSLLQHNLGDFQGPALVAIFEGACLSREEFSNF-------QLRPPWRLR  1631

Query  240   ----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-KFVGRRILE  76
                  +GLG    Y   D+ + +SG    MFDP    L   S + P  ++   +G  + +
Sbjct  1632  GNTINYGLGLVCCYSICDLLSVISGGYFYMFDPRGLVLGVPSTNAPSAKMFSLIGTDLTQ  1691

Query  75    QFPDQFSPFL  46
             +F DQFSP L
Sbjct  1692  RFCDQFSPML  1701



>ref|XP_008668531.1| PREDICTED: uncharacterized protein LOC100501244 isoform X1 [Zea 
mays]
Length=4376

 Score =   470 bits (1209),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHLS+ +F + Q +IYLPD S RL  +++LV+NDAPWLLD     S + S++AL +K+ 
Sbjct  916   VQHLSEFRFQDQQTQIYLPDSSSRLCLSSELVFNDAPWLLDFGHDISGSASSIALSSKKY  975

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  976   VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1035

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1036  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1095

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC LPGI
Sbjct  1096  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHACYLPGI  1155

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRI+FVGRRIL+QFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1156  SPSHPGLRIQFVGRRILDQFPDQFAPFLHFGCNLQQPFPGTLF  1198


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 117/256 (46%), Gaps = 40/256 (16%)
 Frame = -1

Query  798   LPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEKL  619
             +PD    L  A +LVYNDAPW+                +A  T + F+H +I N++A +L
Sbjct  2364  IPDSLGVLTPARNLVYNDAPWM----------------NANPTSKNFIHLSIGNELANRL  2407

Query  618   GVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAE  439
             GVRS R   L +     NL     A           ++  +L +Y +   +LF+L++ A+
Sbjct  2408  GVRSLRGSSLLDDELMRNLPCMEYA-----------KISELLALYGESDFLLFDLIELAD  2456

Query  438   DANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQESKL  262
               NA KV  + DK ++   S+L   + D QG +L   F  ++ + +++ +        +L
Sbjct  2457  YCNAKKVHLIYDKREHPKQSLLQQSLGDLQGSSLTVVFEGTIMNREEVCSF-------QL  2509

Query  261   EKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-IKF  97
               P+     I  +GLG  S Y   D  T +SG    +FDP   +    S +    R    
Sbjct  2510  PPPWKLRGNILNYGLGLLSSYFVCDALTILSGGYFYIFDPLGLTGGTTSTATSSARYFSL  2569

Query  96    VGRRILEQFPDQFSPF  49
             +G  ++E+F DQF P 
Sbjct  2570  LGNDLVERFYDQFLPM  2585



>ref|XP_003533689.1| PREDICTED: sacsin-like [Glycine max]
Length=4760

 Score =   470 bits (1210),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 234/285 (82%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
               HL++V  +E ++++YLPDVS RLF A DLVYNDAPWLL SDDP  S G+A  +AL+AK
Sbjct  1275  VHHLAEVYHHEHKVQLYLPDVSGRLFLAGDLVYNDAPWLLGSDDPKGSFGNAPTVALNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RRMLLAES+DSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTVQKFVHGNISNDVAEKLGVCSLRRMLLAESSDSMNFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFE+VQNAEDA AS+V FLLDKS YGTSS+LSPEMADWQGPALYC+N+SV
Sbjct  1395  LEMYADGPGSLFEMVQNAEDAGASEVIFLLDKSHYGTSSILSPEMADWQGPALYCYNDSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEK FAIGRFGLGFN VYHFTDIP FVSGENVVMFDPHA +LP
Sbjct  1455  FSPQDLYAISRIGQESKLEKAFAIGRFGLGFNCVYHFTDIPMFVSGENVVMFDPHASNLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+ILEQFPDQFSP LHFGCDLQ+PF GTLF
Sbjct  1515  GISPSHPGLRIKFVGRQILEQFPDQFSPLLHFGCDLQHPFPGTLF  1559


 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V+  LD+  +   S+LS  
Sbjct  11   EDFGQTVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATTVSLCLDRRSHAAGSLLSDS  70

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  FN++VF+ +D  +IS+IG  +K  +    GRFG+GFNSVYH TD+P+FV
Sbjct  71   LAQWQGPALLAFNDAVFTEEDFVSISKIGGSTKHGQASKTGRFGVGFNSVYHLTDLPSFV  130

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI F G   L  + DQFSP+  FGCD+Q+PF GTL
Sbjct  131  SGKYVVLFDPQGVYLPRVSAANPGKRIDFTGSSALSFYRDQFSPYCAFGCDMQSPFSGTL  190

Query  3    F  1
            F
Sbjct  191  F  191


 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 114/250 (46%), Gaps = 39/250 (16%)
 Frame = -1

Query  777   LFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEKLGVRSFRR  598
             L  A DLVYNDAPWL                ++    + FVH  ISND+A+KLGV+S R 
Sbjct  2738  LMQAGDLVYNDAPWLE---------------NSSLIGRHFVHPIISNDLADKLGVQSVRC  2782

Query  597   MLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKV  418
             + L    D +   L               ++  +L  Y D   +LF+L++ A+   A ++
Sbjct  2783  LSLV--GDDLTKDLPCMD---------YNKVNELLAQYGDSEFLLFDLLELADCCKAKRL  2831

Query  417   AFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRIGQESKLEKPFAIG  241
               + DK ++   S+L   + D+QGPAL   F  +  S ++           +L  P+ + 
Sbjct  2832  HLIYDKREHPRQSLLQHNLGDFQGPALVAIFEGACLSREEF-------SNFQLRPPWRLR  2884

Query  240   ----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-KFVGRRILE  76
                  +GLG    Y   D+ + +SG    MFDP    L   S + P  ++   +G  + +
Sbjct  2885  GNTINYGLGLVCCYSICDLLSVISGGYFYMFDPRGLVLGVPSTNAPSAKMFSLIGTDLTQ  2944

Query  75    QFPDQFSPFL  46
             +F DQFSP L
Sbjct  2945  RFCDQFSPML  2954



>tpg|DAA35374.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=4743

 Score =   469 bits (1208),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHLS+ +F + Q +IYLPD S RL  +++LV+NDAPWLLD     S + S++AL +K+ 
Sbjct  1283  VQHLSEFRFQDQQTQIYLPDSSSRLCLSSELVFNDAPWLLDFGHDISGSASSIALSSKKY  1342

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1343  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1402

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1403  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1462

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC LPGI
Sbjct  1463  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHACYLPGI  1522

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRI+FVGRRIL+QFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1523  SPSHPGLRIQFVGRRILDQFPDQFAPFLHFGCNLQQPFPGTLF  1565


 Score =   201 bits (512),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA A +V   LD+  +G +S+LSP 
Sbjct  12   EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGAGRVRLCLDRRSHGRASLLSPA  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPALLAYNDAVFTDEDFASISRIGDSRKVAQTWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI +V    +  + DQFSP+  FGCD++  F+GTL
Sbjct  132  SGKYVVLFDPQGAYLPNVSASNPGKRIDYVSSSAITMYHDQFSPYCAFGCDMKASFQGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 117/256 (46%), Gaps = 40/256 (16%)
 Frame = -1

Query  798   LPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEKL  619
             +PD    L  A +LVYNDAPW+                +A  T + F+H +I N++A +L
Sbjct  2731  IPDSLGVLTPARNLVYNDAPWM----------------NANPTSKNFIHLSIGNELANRL  2774

Query  618   GVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAE  439
             GVRS R   L +     NL     A           ++  +L +Y +   +LF+L++ A+
Sbjct  2775  GVRSLRGSSLLDDELMRNLPCMEYA-----------KISELLALYGESDFLLFDLIELAD  2823

Query  438   DANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQESKL  262
               NA KV  + DK ++   S+L   + D QG +L   F  ++ + +++ +        +L
Sbjct  2824  YCNAKKVHLIYDKREHPKQSLLQQSLGDLQGSSLTVVFEGTIMNREEVCSF-------QL  2876

Query  261   EKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-IKF  97
               P+     I  +GLG  S Y   D  T +SG    +FDP   +    S +    R    
Sbjct  2877  PPPWKLRGNILNYGLGLLSSYFVCDALTILSGGYFYIFDPLGLTGGTTSTATSSARYFSL  2936

Query  96    VGRRILEQFPDQFSPF  49
             +G  ++E+F DQF P 
Sbjct  2937  LGNDLVERFYDQFLPM  2952



>ref|XP_006484544.1| PREDICTED: uncharacterized protein LOC102609886 [Citrus sinensis]
Length=4762

 Score =   469 bits (1208),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 233/285 (82%), Positives = 257/285 (90%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALH--AK  676
              QHL++ QF+E Q+KIYLPDVS  LF A++LVYNDAPWLL SDD  SS   A  +H  A+
Sbjct  1280  VQHLAEGQFHE-QVKIYLPDVSGSLFLASELVYNDAPWLLGSDDFSSSFNDASTVHLNAR  1338

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +  Q+FVHGNISN+VAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1339  RASQKFVHGNISNEVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1398

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMADWQGPALY FN+SV
Sbjct  1399  LEMYADGPGTLFELVQNAEDAGASEVVFLLDKTQYGTSSLLSPEMADWQGPALYSFNDSV  1458

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDL+AISRIGQESKLEKP AIGRFGLGFN VYHFTD+PTFVSGEN+VMFDPHAC+LP
Sbjct  1459  FSPQDLFAISRIGQESKLEKPLAIGRFGLGFNCVYHFTDVPTFVSGENIVMFDPHACNLP  1518

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+ILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1519  GISPSHPGLRIKFVGRKILEQFPDQFSPFLHFGCDLQHSFPGTLF  1563


 Score =   193 bits (491),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V F LD+  + + S+LS  
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATLVRFCLDRRVHASDSLLSSS  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  FN++VFS +D  +ISRIG  SK  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPALLAFNDAVFSEEDFVSISRIGGSSKHGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI++V    + Q+ DQF P+  FGCD++ PF GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSSANPGKRIEYVSSSAISQYKDQFFPYCAFGCDMKTPFAGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 124/270 (46%), Gaps = 42/270 (16%)
 Frame = -1

Query  834   DVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFV  655
             D   +E    + +PD    L  A DLVYNDAPW+                      + F+
Sbjct  2720  DKPLFEACNTLLIPDSFGILRFARDLVYNDAPWI----------------EDNLVGKHFI  2763

Query  654   HGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADG  475
             H +ISND+A++LGV+S R + L +   + +L     A           R+  +L  Y   
Sbjct  2764  HPSISNDLADRLGVKSIRCLSLVDEDMTKDLPCMDFA-----------RISELLACYGSN  2812

Query  474   PGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDL  298
               +LF+L++ A+   A K+    DK  +   S+L   + ++QGPAL      ++ S +++
Sbjct  2813  DFLLFDLLELADCCKAKKLHLYFDKRDHPRQSLLQHNLGEFQGPALVAVLEGAILSREEI  2872

Query  297   YAISRIGQESKLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
              ++       +L  P+     I  +GLG  S Y   D  + VSG    MFDP   +L  I
Sbjct  2873  SSL-------QLLPPWRLRGDILNYGLGLLSCYFICDFLSIVSGGYYYMFDPRGLAL-AI  2924

Query  129   SPSHPGLRIKF--VGRRILEQFPDQFSPFL  46
             S SH     +F  +G  + E+F DQF+P L
Sbjct  2925  SSSHSPSAKEFSLLGTNLTERFRDQFNPML  2954



>tpg|DAA35373.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=2950

 Score =   468 bits (1205),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHLS+ +F + Q +IYLPD S RL  +++LV+NDAPWLLD     S + S++AL +K+ 
Sbjct  1283  VQHLSEFRFQDQQTQIYLPDSSSRLCLSSELVFNDAPWLLDFGHDISGSASSIALSSKKY  1342

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1343  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1402

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1403  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1462

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC LPGI
Sbjct  1463  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHACYLPGI  1522

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRI+FVGRRIL+QFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1523  SPSHPGLRIQFVGRRILDQFPDQFAPFLHFGCNLQQPFPGTLF  1565


 Score =   201 bits (510),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA A +V   LD+  +G +S+LSP 
Sbjct  12   EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGAGRVRLCLDRRSHGRASLLSPA  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPALLAYNDAVFTDEDFASISRIGDSRKVAQTWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S S+PG RI +V    +  + DQFSP+  FGCD++  F+GTL
Sbjct  132  SGKYVVLFDPQGAYLPNVSASNPGKRIDYVSSSAITMYHDQFSPYCAFGCDMKASFQGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 63/220 (29%), Positives = 102/220 (46%), Gaps = 39/220 (18%)
 Frame = -1

Query  798   LPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEKL  619
             +PD    L  A +LVYNDAPW+                +A  T + F+H +I N++A +L
Sbjct  2731  IPDSLGVLTPARNLVYNDAPWM----------------NANPTSKNFIHLSIGNELANRL  2774

Query  618   GVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAE  439
             GVRS R   L +     NL     A           ++  +L +Y +   +LF+L++ A+
Sbjct  2775  GVRSLRGSSLLDDELMRNLPCMEYA-----------KISELLALYGESDFLLFDLIELAD  2823

Query  438   DANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQESKL  262
               NA KV  + DK ++   S+L   + D QG +L   F  ++ + +++ +        +L
Sbjct  2824  YCNAKKVHLIYDKREHPKQSLLQQSLGDLQGSSLTVVFEGTIMNREEVCSF-------QL  2876

Query  261   EKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDP  154
               P+     I  +GLG  S Y   D  T +SG    +FDP
Sbjct  2877  PPPWKLRGNILNYGLGLLSSYFVCDALTILSGGYFYIFDP  2916



>ref|XP_007043303.1| Binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOX99134.1| Binding protein, putative isoform 1 [Theobroma cacao]
Length=4780

 Score =   469 bits (1207),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 257/285 (90%), Gaps = 4/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssng--SAMALHAK  676
              QHLS VQ  E Q+KIYLPDVS RL  A+DLVYNDAPWLL SDD DS     SA  L+A+
Sbjct  1282  VQHLSGVQSVE-QVKIYLPDVSGRLIPASDLVYNDAPWLLGSDDSDSLFSGPSAAVLNAR  1340

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T Q+FVHGNISN+VAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1341  RT-QKFVHGNISNEVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1399

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1400  LEMYADGPGILFELVQNAEDAGASEVVFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  1459

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHA +LP
Sbjct  1460  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHASNLP  1519

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR++LEQFPDQFSP L+FGCDLQ  F GTLF
Sbjct  1520  GISPSHPGLRIKFVGRKVLEQFPDQFSPLLYFGCDLQQFFPGTLF  1564


 Score =   200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A++V   LD+  +G+ S+LS  
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATRVRLCLDRRPHGSDSLLSDS  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG  SK  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSSKHGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI +V    L  + DQF P+  FGCD++NPF GTL
Sbjct  132  SGKYVVLFDPQGFYLPNVSTANPGKRIDYVSSSALSIYKDQFLPYCAFGCDMKNPFTGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 129/271 (48%), Gaps = 40/271 (15%)
 Frame = -1

Query  837   SDVQFYE-DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR  661
             SD  F E     + +PD    L +A +LVYNDAPW+            + AL  K     
Sbjct  2742  SDKPFLEASNTPLLIPDSCGVLMSAGELVYNDAPWI-----------ESSALVGKH----  2786

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             FVH +I+ND+A +LGV+S R + L     + +L     A           R+  +L +Y 
Sbjct  2787  FVHPSINNDLANRLGVKSLRCLSLVSKDMTKDLPCMDFA-----------RINELLSLYD  2835

Query  480   DGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQ  304
             +   +LF+L++ A+   A K+  + DK ++   S+L   +A++QGPAL      +  S +
Sbjct  2836  NNEFLLFDLLELADCCKAKKLHLIFDKREHPHQSLLQHNLAEFQGPALVAILEGASLSRE  2895

Query  303   DLYAISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             ++ A+       +L  P+ +      +GLG  S Y   D+ + +SG    MFDP   +L 
Sbjct  2896  EISAL-------QLLPPWRLRTNTLNYGLGLLSCYFICDLLSIISGGYFYMFDPRGVALS  2948

Query  135   GISPSHPGLRI-KFVGRRILEQFPDQFSPFL  46
               S   P  ++   +G  + E+F DQF P L
Sbjct  2949  VASSHAPAAKMFSLIGTSLTERFRDQFIPML  2979



>ref|XP_004516754.1| PREDICTED: uncharacterized protein LOC101513373 [Cicer arietinum]
Length=4727

 Score =   469 bits (1207),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 232/285 (81%), Positives = 255/285 (89%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMAL--HAK  676
               HL++V  +E ++++YLPDVS RLF A DLVYNDAPWLL S+D D S G+A  +  +AK
Sbjct  1275  VHHLAEVYHHEQKVQLYLPDVSGRLFLAGDLVYNDAPWLLGSEDLDGSFGNASTVPWNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RRMLLAESADSMN  LSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTVQKFVHGNISNDVAEKLGVCSLRRMLLAESADSMNFGLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDA AS+V FLLDKSQYGTSS+LSPEMADWQGPALYCFN+SV
Sbjct  1395  LEMYADGPGTLFELVQNAEDAGASEVIFLLDKSQYGTSSILSPEMADWQGPALYCFNDSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEK FAIGRFGLGFN VYHFTDIP FVSGEN+V+FDPHA +LP
Sbjct  1455  FSPQDLYAISRIGQESKLEKAFAIGRFGLGFNCVYHFTDIPMFVSGENIVLFDPHASNLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+ILEQFPDQFS  LHFGCDLQNPF GTLF
Sbjct  1515  GISPSHPGLRIKFVGRQILEQFPDQFSSLLHFGCDLQNPFPGTLF  1559


 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V+  LD   +G+ S+LS  
Sbjct  12   EDFGQTVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATTVSLCLDLRSHGSDSLLSDS  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            ++ WQGPAL  +N++VFS +D  +IS+IG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  72   LSQWQGPALLAYNDAVFSEEDFVSISKIGGSSKHGQASKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI F     L  + DQFSPF  FGCD+Q+PF GTL
Sbjct  132  SGKYVVLFDPQGVYLPRVSAANPGKRIDFTSSSALSFYKDQFSPFCAFGCDMQSPFAGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/260 (29%), Positives = 121/260 (47%), Gaps = 41/260 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L +A DLVYNDAPWL                ++    + +VH +ISND+AE
Sbjct  2728  LLIPDAFGVLMHAGDLVYNDAPWLE---------------NSSLVGRHYVHPSISNDLAE  2772

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGV+S R + L     + +L                 ++  +L +Y +   +LF+L++ 
Sbjct  2773  RLGVQSVRCLSLVSEDMTKDLPCMD-----------YNKINELLALYGNNEFLLFDLLEL  2821

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALY------CFNNSVFSPQDLYAISR  283
             A+   A K+  + DK ++   S+L   + ++QGPAL       C +   FS   L    R
Sbjct  2822  ADCCKAKKLHLIYDKREHPRQSLLQHNLGEYQGPALVAIFEGACLSREEFSNFQLLPPWR  2881

Query  282   IGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI  103
             +   +          +GLG  S Y   D+ + VSG    MFDP    L  +S + P  ++
Sbjct  2882  LRGNTL--------NYGLGLVSCYSICDVLSVVSGGYFYMFDPRGLVLAALSTNAPSAKM  2933

Query  102   -KFVGRRILEQFPDQFSPFL  46
                +G  + ++F DQFSP L
Sbjct  2934  FSLIGTDLKQRFHDQFSPML  2953



>ref|XP_006437569.1| hypothetical protein CICLE_v10030469mg [Citrus clementina]
 gb|ESR50809.1| hypothetical protein CICLE_v10030469mg [Citrus clementina]
Length=4762

 Score =   469 bits (1207),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 232/285 (81%), Positives = 257/285 (90%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALH--AK  676
              QHL++ QF+E Q+KIYLPDVS  LF A++LVYNDAPWLL SDD  SS   A  +H  A+
Sbjct  1280  VQHLAEGQFHE-QVKIYLPDVSGSLFLASELVYNDAPWLLGSDDFSSSFNDASTVHLNAR  1338

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +  Q+FVHGNISN+VAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1339  RASQKFVHGNISNEVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1398

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMADWQGPALY FN+SV
Sbjct  1399  LEMYADGPGTLFELVQNAEDAGASEVVFLLDKTQYGTSSLLSPEMADWQGPALYSFNDSV  1458

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDL+AISRIGQESKLEKP AIGRFGLGFN VYHFTD+PTFVSGEN+VMFDPHAC+LP
Sbjct  1459  FSPQDLFAISRIGQESKLEKPLAIGRFGLGFNCVYHFTDVPTFVSGENIVMFDPHACNLP  1518

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             G+SPSHPGLRIKFVGR+ILEQFPDQFSPFLHFGCDLQ+ F GTLF
Sbjct  1519  GVSPSHPGLRIKFVGRKILEQFPDQFSPFLHFGCDLQHSFPGTLF  1563


 Score =   193 bits (491),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V F LD+  + + S+LS  
Sbjct  12   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATLVRFCLDRRVHASDSLLSSS  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  FN++VFS +D  +ISRIG  SK  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAQWQGPALLAFNDAVFSEEDFVSISRIGGSSKHGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI++V    + Q+ DQF P+  FGCD++ PF GTL
Sbjct  132  SGKYVVLFDPQGVYLPNVSSANPGKRIEYVSSSAISQYKDQFFPYCAFGCDMKTPFAGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 124/270 (46%), Gaps = 42/270 (16%)
 Frame = -1

Query  834   DVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFV  655
             D   +E    + +PD    L  A DLVYNDAPW+                      + F+
Sbjct  2720  DKPLFEACNTLLIPDSFGILRFARDLVYNDAPWI----------------EDNLVGKHFI  2763

Query  654   HGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADG  475
             H +ISND+A++LGV+S R + L +   + +L     A           R+  +L  Y   
Sbjct  2764  HPSISNDLADRLGVKSIRCLSLVDEDMTKDLPCMDFA-----------RISELLACYGSN  2812

Query  474   PGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDL  298
               +LF+L++ A+   A K+    DK  +   S+L   + ++QGPAL      ++ S +++
Sbjct  2813  DFLLFDLLELADCCKAKKLHLYFDKRDHPRQSLLQHNLGEFQGPALVAVLEGAILSREEI  2872

Query  297   YAISRIGQESKLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
              ++       +L  P+     I  +GLG  S Y   D  + VSG    MFDP   +L  I
Sbjct  2873  SSL-------QLLPPWRLRGDILNYGLGLLSCYFICDFLSIVSGGYYYMFDPRGLAL-AI  2924

Query  129   SPSHPGLRIKF--VGRRILEQFPDQFSPFL  46
             S SH     +F  +G  + E+F DQF+P L
Sbjct  2925  SSSHSPSAKEFSLLGTNLTERFRDQFNPML  2954



>ref|XP_007043304.1| Binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOX99135.1| Binding protein, putative isoform 2 [Theobroma cacao]
Length=3525

 Score =   468 bits (1204),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 257/285 (90%), Gaps = 4/285 (1%)
 Frame = -1

Query  849  AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssng--SAMALHAK  676
             QHLS VQ  E Q+KIYLPDVS RL  A+DLVYNDAPWLL SDD DS     SA  L+A+
Sbjct  672  VQHLSGVQSVE-QVKIYLPDVSGRLIPASDLVYNDAPWLLGSDDSDSLFSGPSAAVLNAR  730

Query  675  QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
            +T Q+FVHGNISN+VAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  731  RT-QKFVHGNISNEVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  789

Query  495  LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
            LEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  790  LEMYADGPGILFELVQNAEDAGASEVVFLLDKTQYGTSSVLSPEMADWQGPALYCFNDSV  849

Query  315  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
            FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHA +LP
Sbjct  850  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHASNLP  909

Query  135  GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
            GISPSHPGLRIKFVGR++LEQFPDQFSP L+FGCDLQ  F GTLF
Sbjct  910  GISPSHPGLRIKFVGRKVLEQFPDQFSPLLYFGCDLQQFFPGTLF  954


 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 129/271 (48%), Gaps = 40/271 (15%)
 Frame = -1

Query  837   SDVQFYE-DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR  661
             SD  F E     + +PD    L +A +LVYNDAPW+            + AL  K     
Sbjct  2132  SDKPFLEASNTPLLIPDSCGVLMSAGELVYNDAPWI-----------ESSALVGKH----  2176

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             FVH +I+ND+A +LGV+S R + L     + +L     A           R+  +L +Y 
Sbjct  2177  FVHPSINNDLANRLGVKSLRCLSLVSKDMTKDLPCMDFA-----------RINELLSLYD  2225

Query  480   DGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQ  304
             +   +LF+L++ A+   A K+  + DK ++   S+L   +A++QGPAL      +  S +
Sbjct  2226  NNEFLLFDLLELADCCKAKKLHLIFDKREHPHQSLLQHNLAEFQGPALVAILEGASLSRE  2285

Query  303   DLYAISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             ++ A+       +L  P+ +      +GLG  S Y   D+ + +SG    MFDP   +L 
Sbjct  2286  EISAL-------QLLPPWRLRTNTLNYGLGLLSCYFICDLLSIISGGYFYMFDPRGVALS  2338

Query  135   GISPSHPGLRI-KFVGRRILEQFPDQFSPFL  46
               S   P  ++   +G  + E+F DQF P L
Sbjct  2339  VASSHAPAAKMFSLIGTSLTERFRDQFIPML  2369



>ref|XP_008803352.1| PREDICTED: sacsin [Phoenix dactylifera]
Length=4767

 Score =   468 bits (1205),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 220/283 (78%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ QF + Q++IYLPDVS RL  ++DLV+NDAPWLLD  +    + S +AL++ + 
Sbjct  1284  VQHLAETQFQDLQVQIYLPDVSSRLLPSSDLVFNDAPWLLDVGESAFGDTSNVALNSMRN  1343

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAEKLGVRS R +LLAES+DS+NLSLSG AEAFGQHE+LTTRL+HI+E
Sbjct  1344  VHNFVHGNISNDVAEKLGVRSLRGLLLAESSDSVNLSLSGVAEAFGQHEALTTRLKHIVE  1403

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1404  MYADGPGILFELVQNAEDAQASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1463

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+V+FDPHAC LPGI
Sbjct  1464  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVIFDPHACYLPGI  1523

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SP+HPGLRI+FVGRRILEQFPDQF+PFLHFGCDLQ  F GTLF
Sbjct  1524  SPTHPGLRIRFVGRRILEQFPDQFTPFLHFGCDLQQSFPGTLF  1566


 Score =   187 bits (474),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+++   LD+  +G  S+LS +
Sbjct  13   EDFGQRVDLTRRIREVLVNYPEGTTVLKELIQNADDAGATRICLCLDRRTHGAGSLLSGK  72

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A  QGPAL  +N+++F+  D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  73   LAQCQGPALLAYNDAMFTEDDFASISRIGDSKKQSQAWKTGRFGVGFNSVYHLTDLPSFV  132

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            S + VV+FDP    LP +S ++PG R+++V    +  + DQF P+  FGCD++ PF GTL
Sbjct  133  SDKYVVLFDPQGAYLPNVSAANPGKRLEYVNSSAILLYKDQFMPYCAFGCDMKGPFPGTL  192

Query  3    F  1
            F
Sbjct  193  F  193


 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 125/261 (48%), Gaps = 43/261 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD S  L +A++LVYNDAPW+                +   T + FVH +IS+D+A 
Sbjct  2735  LLIPDSSGVLMHASNLVYNDAPWMT---------------NNNPTTKHFVHSSISDDLAN  2779

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGV+S R + L +  D M   L     A         R+  +L  Y D   +LF+L++ 
Sbjct  2780  RLGVQSLRSLSLVD--DEMMKDLPCMDYA---------RICELLAFYRDSDFLLFDLLEL  2828

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA K+  + DK ++   S+L   +  +QG AL      +  S +++  +       
Sbjct  2829  ADLCNAKKLRLIYDKREHPRQSLLQQNLGHFQGSALTVVLEGTTLSREEICGL-------  2881

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIK  100
             +L  P+ I      +GLG  S Y   D+ T VSG    +FDP   +L   +PS+ G   K
Sbjct  2882  QLPPPWKIRGNAINYGLGLVSSYFVCDLLTIVSGGYFYIFDPLGLALA--APSNTGSSAK  2939

Query  99    ---FVGRRILEQFPDQFSPFL  46
                  G  + E+F DQFSP L
Sbjct  2940  LFSLTGTDLTERFRDQFSPML  2960



>gb|KHG13033.1| Sacsin [Gossypium arboreum]
Length=4398

 Score =   468 bits (1203),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 257/285 (90%), Gaps = 4/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpds--sngSAMALHAK  676
              QHLS VQF+E ++KIYLPD S RL  A+DLVYNDAPW L SDD D+  S  SA  L+A+
Sbjct  929   VQHLSGVQFHE-EVKIYLPDASARLHPASDLVYNDAPWFLGSDDSDTLFSGRSAAVLNAR  987

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
              T QRFVHGNISN+VAEKLGV S RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  988   ST-QRFVHGNISNEVAEKLGVCSLRRILLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1046

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAED+ AS+V FLLDK+QYGTSS+LSPEMADWQGPALYCFN+SV
Sbjct  1047  LEMYADGPGILFELVQNAEDSGASEVTFLLDKTQYGTSSILSPEMADWQGPALYCFNDSV  1106

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHA +LP
Sbjct  1107  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHASNLP  1166

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             G SPSHPGLRIKFVGR++LEQFPDQFSPFL+FGCDLQ  F GTLF
Sbjct  1167  GTSPSHPGLRIKFVGRKVLEQFPDQFSPFLYFGCDLQQFFPGTLF  1211


 Score = 79.3 bits (194),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 75/271 (28%), Positives = 124/271 (46%), Gaps = 44/271 (16%)
 Frame = -1

Query  837   SDVQFYE-DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR  661
             SD  F+E     + +PD    L +A +LVYNDAPW+              AL  K    R
Sbjct  2390  SDKPFFEASNSPLLIPDSCGVLVSAGELVYNDAPWI-----------ENSALVGK----R  2434

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             F+H +I+ND+A +LGV+S R + L     + +L     A           R+  +L +Y 
Sbjct  2435  FIHPSINNDLANRLGVKSLRCLSLVSEDMTKDLPCMEFA-----------RISELLSLYG  2483

Query  480   DGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQ  304
             +   +LF+L++ A+   A  +  + DK ++   S+L   +    GPAL      +  + +
Sbjct  2484  NNEFLLFDLLELADCCKAKNLHLIFDKREHPRQSLLQHNL----GPALVAILEGASLNRE  2539

Query  303   DLYAISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             ++  +       +L  P+ +      +GLG  S Y   D+ + +SG    MFDP   +L 
Sbjct  2540  EISGL-------QLIPPWRLRANTLNYGLGLLSCYFICDVLSIISGGYFYMFDPRGVALS  2592

Query  135   GISPSHPGLRI-KFVGRRILEQFPDQFSPFL  46
               S   P  ++   +G  + E+F DQF P L
Sbjct  2593  VSSSQAPAAKMFSLIGTSLSERFRDQFIPML  2623



>ref|XP_007153087.1| hypothetical protein PHAVU_003G005800g [Phaseolus vulgaris]
 gb|ESW25081.1| hypothetical protein PHAVU_003G005800g [Phaseolus vulgaris]
Length=4756

 Score =   468 bits (1203),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 231/285 (81%), Positives = 254/285 (89%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
               H+++V  +E ++++YLPDVS RLF A DLVYNDAPWLL SDD   S GSA  +A +AK
Sbjct  1274  VHHIAEVYHHEQKVQLYLPDVSSRLFLAGDLVYNDAPWLLGSDDSSGSFGSAPTVAWNAK  1333

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RRMLLAES+DSMN  LSGAAEAFGQHE+LTTRL+HI
Sbjct  1334  RTVQKFVHGNISNDVAEKLGVCSLRRMLLAESSDSMNFGLSGAAEAFGQHEALTTRLKHI  1393

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFELVQNAEDA AS+V FLLD S YGTSS+LSPEMADWQGPALYCFN+SV
Sbjct  1394  LEMYADGPGTLFELVQNAEDAGASEVIFLLDNSHYGTSSILSPEMADWQGPALYCFNDSV  1453

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEK FAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA +LP
Sbjct  1454  FSPQDLYAISRIGQESKLEKAFAIGRFGLGFNCVYHFTDIPMFVSGENIVMFDPHASNLP  1513

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+ILEQFPDQFSP LHFGCDLQ+PF GTLF
Sbjct  1514  GISPSHPGLRIKFVGRQILEQFPDQFSPMLHFGCDLQHPFPGTLF  1558


 Score =   191 bits (484),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V+  LD+  +   S+L+  
Sbjct  10   EDFGQTVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATTVSLCLDRRSHRGDSLLANS  69

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++ F+  D  +IS+IG  +K  +    GRFG+GFNSVYH TD+P+FV
Sbjct  70   LAQWQGPALLAYNDAAFTEDDFVSISKIGGSAKHGQASKTGRFGVGFNSVYHLTDLPSFV  129

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI F G   L  + DQFSP+  FGCD+Q+PF GTL
Sbjct  130  SGKYVVLFDPQGAYLPRVSAANPGKRIDFTGSSALSFYRDQFSPYCAFGCDMQSPFSGTL  189

Query  3    F  1
            F
Sbjct  190  F  190


 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/250 (28%), Positives = 113/250 (45%), Gaps = 39/250 (16%)
 Frame = -1

Query  777   LFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEKLGVRSFRR  598
             L  A DLVYNDAPWL                ++    + FVH  I ND+A+KLGV+S R 
Sbjct  2734  LMQAGDLVYNDAPWLE---------------NSSLIGRHFVHPVIGNDLADKLGVQSVRC  2778

Query  597   MLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKV  418
             + L     + +L                 ++  +L  Y +   +LF+L++ A+   A ++
Sbjct  2779  LSLVSDDLTKDLPCMD-----------YNKVNELLAQYGNDEFLLFDLLELADCCQAKRL  2827

Query  417   AFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRIGQESKLEKPFAIG  241
               + DK ++   S+L   + ++QGPAL   F  +  S ++           +L  P+ + 
Sbjct  2828  HLIYDKREHPRQSLLQHNLGEFQGPALVAIFEGACLSREEF-------SNFQLRPPWRLR  2880

Query  240   ----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-KFVGRRILE  76
                  +GLG  S Y   D+ + +S     MFDPH   L     + P  ++   +G  + +
Sbjct  2881  GNTINYGLGLVSCYSICDLLSVISSGFFYMFDPHGLVLGTPLTNAPSAKMFSLIGNDLTQ  2940

Query  75    QFPDQFSPFL  46
             +F DQFSP L
Sbjct  2941  RFCDQFSPML  2950



>ref|XP_009398271.1| PREDICTED: sacsin [Musa acuminata subsp. malaccensis]
Length=4750

 Score =   467 bits (1202),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL +VQ  + ++++YLPD SCRL  +TDLV+NDAPWLL S +    + S +A  AK+ 
Sbjct  1283  VQHLVEVQSQDLKVQVYLPDASCRLLPSTDLVFNDAPWLLVSSESSFGDTSTLAFDAKRE  1342

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISND+AEKLGVRS RR+LLAES+DSMNLSLSG AEAFGQHE+LTTRL+HI+E
Sbjct  1343  VYNFVHGNISNDLAEKLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEALTTRLKHIVE  1402

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA+AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFNNSVFS
Sbjct  1403  MYADGPGILFELVQNAEDAHASEVFFLLDKTQYGTSSILSPEMAEWQGPALYCFNNSVFS  1462

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
              +DLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP+FVSGEN+V+FDPHA  LPGI
Sbjct  1463  SKDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPSFVSGENIVIFDPHASYLPGI  1522

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRI+++GRRILEQFPDQFSPFLHFGC+LQ PF GTLF
Sbjct  1523  SPSHPGLRIRYMGRRILEQFPDQFSPFLHFGCNLQEPFPGTLF  1565


 Score =   198 bits (504),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R IL  Y +G  VL EL+QNA+DA A+++ F LD+  +G  S+LSP 
Sbjct  13   EDFGQRVDLTRRIREILINYPEGTTVLKELIQNADDAGATRICFCLDRRSHGAESLLSPN  72

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+  D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  73   LAQWQGPALLAYNDAVFTEDDFISISRIGDSKKQSQTWKTGRFGVGFNSVYHLTDLPSFV  132

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            S + VV+FDP    LP +S ++PG R+ +V    +  + DQF P+  FGCD++ PF GTL
Sbjct  133  SDKYVVLFDPQGEYLPNVSAANPGKRLDYVSTSAISLYKDQFLPYCAFGCDMKKPFPGTL  192

Query  3    F  1
            F
Sbjct  193  F  193


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 112/259 (43%), Gaps = 39/259 (15%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD S  L     LVYNDAPW+ ++   +               +  VH +I++++A 
Sbjct  2725  LLIPDSSGILMPTLSLVYNDAPWMKNNSPGE---------------KHLVHPSINDELAR  2769

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
              LGV+S R + L +     +L     A            +  +L +Y D   +LF+LV+ 
Sbjct  2770  TLGVQSLRSLSLVDEEMMRDLPCMDYAT-----------ICELLALYGDSEFLLFDLVEL  2818

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+   A KV  + DK ++   S+L   + D+Q  +L         S  ++  +       
Sbjct  2819  ADKCKAKKVHLIYDKREHPRQSLLQQNLGDFQSASLTIVLEGPTLSMDEICNL-------  2871

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
              L  P+ +      +GLG  S Y   D+ T VS     +FDP   +L   S   P  R+ 
Sbjct  2872  HLSPPWKVQGSALHYGLGLISGYFICDLMTIVSSGYFYIFDPLGLALAAHSNGGPSARLF  2931

Query  102   KFVGRRILEQFPDQFSPFL  46
               +   + ++F DQFSP L
Sbjct  2932  SLIDTDLTKRFNDQFSPML  2950



>gb|KHM99059.1| Endoglucanase 12 [Glycine soja]
Length=2743

 Score =   466 bits (1198),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 233/285 (82%), Positives = 258/285 (91%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
               HL++V ++ + +++YLPDVS RLF A DLVYNDAPWLL SDDP+ S G+A  +AL+AK
Sbjct  1669  VHHLAEV-YHHEPVQLYLPDVSGRLFLAGDLVYNDAPWLLGSDDPNGSFGNAPTVALNAK  1727

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RRM+LAES+DSMN  LSGAAEAFGQHE+LTTRL+HI
Sbjct  1728  RTVQKFVHGNISNDVAEKLGVCSLRRMMLAESSDSMNFGLSGAAEAFGQHEALTTRLKHI  1787

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFE+VQNAEDA AS+V FLLDKS YGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1788  LEMYADGPGTLFEMVQNAEDAGASEVMFLLDKSHYGTSSVLSPEMADWQGPALYCFNDSV  1847

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEK FAIGRFGLGFN VYHFTDIP FVSGENVVMFDPHA +LP
Sbjct  1848  FSPQDLYAISRIGQESKLEKAFAIGRFGLGFNCVYHFTDIPMFVSGENVVMFDPHASNLP  1907

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+ILEQFPDQFSP LHFGCDLQ+PF GTLF
Sbjct  1908  GISPSHPGLRIKFVGRQILEQFPDQFSPLLHFGCDLQHPFPGTLF  1952


 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -1

Query  231  LGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSP  52
            +GFNSVYH TD+P+FVSG+ VV+FDP    LP +S ++PG RI F G      + DQFSP
Sbjct  509  VGFNSVYHLTDLPSFVSGKYVVLFDPQGVYLPRVSAANPGKRIDFTGSSAFSFYRDQFSP  568

Query  51   FLHFGCDLQNPFRGTLF  1
            +  FGCD+Q+PF GTLF
Sbjct  569  YCAFGCDMQSPFSGTLF  585



>gb|KEH40905.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=4760

 Score =   466 bits (1199),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 230/285 (81%), Positives = 253/285 (89%), Gaps = 2/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMAL--HAK  676
               HL++V  +E ++++YLPDVS RLF A DLVYNDAPWLL S+D D S G+A  +  +AK
Sbjct  1277  VHHLAEVYHHEQKVQLYLPDVSGRLFPAGDLVYNDAPWLLGSEDLDGSFGNASTVPWNAK  1336

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
              ++Q+FVHGNISNDVAEKLGV S RRMLLAESADSMN  LSGAAEAFGQHE+LTTRL+HI
Sbjct  1337  SSVQKFVHGNISNDVAEKLGVCSLRRMLLAESADSMNFGLSGAAEAFGQHEALTTRLKHI  1396

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFE+VQNAEDA AS+V FLLDKSQYGTSS+LSPEMADWQGPALYCFN+SV
Sbjct  1397  LEMYADGPGTLFEMVQNAEDAGASEVIFLLDKSQYGTSSILSPEMADWQGPALYCFNDSV  1456

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEK FAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA +LP
Sbjct  1457  FSPQDLYAISRIGQESKLEKAFAIGRFGLGFNCVYHFTDIPMFVSGENIVMFDPHASNLP  1516

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+ILEQFPDQFS  LHFGCDLQ PF GTLF
Sbjct  1517  GISPSHPGLRIKFVGRQILEQFPDQFSSMLHFGCDLQEPFPGTLF  1561


 Score =   191 bits (485),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V+  LD+  +G  S+LS  
Sbjct  12   EDFGQTVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATTVSLCLDRRSHGRESLLSDS  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            ++ WQGPAL  +N++VFS +D  +IS+IG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  72   LSQWQGPALLAYNDAVFSEEDFVSISKIGGSSKHGQASKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ +V+FDP    LP +S ++PG RI F     L  + DQF PF  FGCD+Q+ F GTL
Sbjct  132  SGKYLVLFDPQGVYLPRVSAANPGKRIDFTSSSALSFYKDQFFPFCAFGCDMQSSFTGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/259 (29%), Positives = 122/259 (47%), Gaps = 41/259 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L +A DLVYNDAPW+                ++    + FVH +ISND+AE
Sbjct  2728  LLIPDAFGVLMSAGDLVYNDAPWME---------------NSSLVGRHFVHPSISNDLAE  2772

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGV+S R + L     + +L                 +++ +L +Y +   +LF+L++ 
Sbjct  2773  RLGVQSVRCLSLVSEDMTKDLPCMD-----------YKKIKELLALYGNSEFLLFDLLEL  2821

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALY------CFNNSVFSPQDLYAISR  283
             A+  NA K+  + DK ++   S+L   + ++QGP+L       C +   FS   L    R
Sbjct  2822  ADCCNAKKLHLIYDKREHPRQSLLQHNLGEFQGPSLVAIFEGACLSREEFSNFQLLPPWR  2881

Query  282   IGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI  103
             +   +          +GLG  S Y   D+ + VSG    MFDP    L  +S + P  ++
Sbjct  2882  LRGNTI--------NYGLGLVSCYSICDLLSVVSGGYFYMFDPRGLVLAALSTNAPSAKM  2933

Query  102   -KFVGRRILEQFPDQFSPF  49
                +G  + ++F DQFSP 
Sbjct  2934  FSLIGTDLKQRFHDQFSPM  2952



>ref|XP_006653022.1| PREDICTED: uncharacterized protein LOC102717242 [Oryza brachyantha]
Length=4753

 Score =   465 bits (1196),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/283 (78%), Positives = 252/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ +F + Q +IYLPD S RL  +++LV+NDAPWLLD     + N S++A ++K+ 
Sbjct  1287  VQHLAEFRFQDHQTQIYLPDSSARLCLSSELVFNDAPWLLDFGYDTTGNASSIAFNSKKY  1346

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1347  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1406

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1407  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1466

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LPGI
Sbjct  1467  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHASYLPGI  1526

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGRRIL+QFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1527  SPSHPGLRIKFVGRRILDQFPDQFTPFLHFGCNLQQPFPGTLF  1569


 Score =   193 bits (490),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 125/187 (67%), Gaps = 6/187 (3%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASK------VAFLLDKSQYGTS  382
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA AS+      V   LD+  +G  
Sbjct  10   EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGASRDAGASRVRLCLDRRSHGAG  69

Query  381  SVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFT  202
            S+L+P +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH T
Sbjct  70   SLLAPALAQWQGPALLVYNDAVFTDEDFASISRIGDSRKVSQVWKTGRFGVGFNSVYHLT  129

Query  201  DIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQN  22
            D+P+FVSG+ +V+FDP    LP +S ++PG RI FV    +  + DQ SP+  FGC+++ 
Sbjct  130  DMPSFVSGKYIVLFDPQGAYLPNVSAANPGKRIDFVSSSAITLYNDQLSPYCAFGCNMKA  189

Query  21   PFRGTLF  1
            PF+GTLF
Sbjct  190  PFQGTLF  196


 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 122/258 (47%), Gaps = 40/258 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  A +LVYNDAPW+                +A  T + FVH +I ND+A 
Sbjct  2733  LLIPDSFGVLTPARNLVYNDAPWM----------------NADTTSKSFVHLSIGNDLAN  2776

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L +     +L     A           ++  +L +Y +   +LF+L++ 
Sbjct  2777  RLGVRSLRGSSLLDDELMTDLPCMEYA-----------KISELLALYGESDFLLFDLIEL  2825

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA KV  + DK ++   S+L   + D+QG +L   F  ++ S +++ ++       
Sbjct  2826  ADHCNAKKVHLIYDKREHPKQSLLQQSLGDFQGSSLTVVFEGTIMSREEVCSL-------  2878

Query  267   KLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-I  103
             +L  P+     I  +GLGF S Y   D  + +SG    +FDP   +    S +    R  
Sbjct  2879  QLPPPWKLKGNILNYGLGFLSSYFVCDTLSILSGGYFYIFDPLGLTGGTTSTAISSARFF  2938

Query  102   KFVGRRILEQFPDQFSPF  49
               +G  ++E+F DQF+P 
Sbjct  2939  SLIGNDLVERFHDQFTPM  2956



>ref|XP_010547719.1| PREDICTED: uncharacterized protein LOC104819381 isoform X4 [Tarenaya 
hassleriana]
Length=4325

 Score =   464 bits (1193),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 228/285 (80%), Positives = 257/285 (90%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             +Q L++ QF  D++ IYLPDVS RLF ++DLV+NDAPWL  SD+ +SS    S M L+AK
Sbjct  881   SQQLAEAQFL-DKVIIYLPDVSGRLFPSSDLVFNDAPWLAASDNGNSSFDAESTMLLNAK  939

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T Q+FVHGNISN+V EKLGVRS RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  940   RTTQKFVHGNISNEVGEKLGVRSLRRVLLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  999

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLD++QYGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1000  LEMYADGPGILFELVQNAEDAGASEVIFLLDRTQYGTSSLLSPEMADWQGPALYCFNNSV  1059

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1060  FTPQDLYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPAFVSGENIVMFDPHANHLP  1119

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1120  GISPSHPGLRIKFVGRQILDQFPDQFTPFLHFGCDLKHTFPGTLF  1164


 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 122/266 (46%), Gaps = 42/266 (16%)
 Frame = -1

Query  822   YEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNI  643
             Y D + + +PD    L    DLVYNDAPW+              +L  K     FVH +I
Sbjct  2316  YGDNL-LLVPDSDGFLVPFEDLVYNDAPWV-----------ENSSLPGKT----FVHPSI  2359

Query  642   SNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVL  463
             +ND+A KLG++S R + L ++  + ++     A           +L+ +L +Y D   VL
Sbjct  2360  NNDLAYKLGIKSLRCISLVDNDITQDIPCMDFA-----------KLKELLSLYGDKDLVL  2408

Query  462   FELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC------FNNSVFSPQD  301
             F+L++ A+     K+  + DK ++   S+L     ++QGPA+         N    S   
Sbjct  2409  FDLLELADCCKVKKLHLIFDKREHARKSLLQHNFGEFQGPAMVAILEGANLNRDEVSGLQ  2468

Query  300   LYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPS  121
               +  RI  E+          +GLG  S Y   D+ + VSG    MFDP   +L   +  
Sbjct  2469  HLSPGRIRGETL--------NYGLGLLSCYFLCDLLSIVSGGYFYMFDPQGLALSASTTH  2520

Query  120   HPGLRI-KFVGRRILEQFPDQFSPFL  46
              P  ++   +G  ++E+F DQF+P +
Sbjct  2521  SPAAKMFSLIGTNLVERFRDQFNPMM  2546



>emb|CAE03243.2| OSJNBa0018M05.18 [Oryza sativa Japonica Group]
Length=4666

 Score =   464 bits (1193),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 252/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ +F + Q +IYLPD S RL  +++LV+NDAPWLLD D+  + N  ++A ++K+ 
Sbjct  1262  VQHLAEFRFQDHQTQIYLPDSSARLCLSSELVFNDAPWLLDFDEDITGNAPSIAFNSKKY  1321

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1322  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1381

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMA+WQGPALYCFN+S+FS
Sbjct  1382  MYADGPGILFELVQNAEDAKASEVVFLLDKTHYGTSSILSPEMAEWQGPALYCFNDSIFS  1441

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LPGI
Sbjct  1442  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHASYLPGI  1501

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGRRILEQFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1502  SPSHPGLRIKFVGRRILEQFPDQFTPFLHFGCNLQQPFPGTLF  1544


 Score =   201 bits (512),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA AS+V   LD+  +G  S+L+P 
Sbjct  9    EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGASRVRLCLDRRAHGAGSLLAPA  68

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+FV
Sbjct  69   LAQWQGPALLAYNDAVFTDEDFASISRIGDSRKVSQVWKTGRFGVGFNSVYHLTDLPSFV  128

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ +V+FDP    LP +S ++PG RI FV    +  + DQ SP+  FGCD++ PF+GTL
Sbjct  129  SGKYIVLFDPQGAYLPNVSAANPGKRIDFVSSSAITLYNDQLSPYCAFGCDMKAPFQGTL  188

Query  3    F  1
            F
Sbjct  189  F  189


 Score = 94.4 bits (233),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 120/258 (47%), Gaps = 40/258 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  A +LVYNDAPW+                +A  T + FVH +I ND+A 
Sbjct  2703  LLIPDSFGVLTPARNLVYNDAPWM----------------NADPTSKSFVHLSIGNDLAN  2746

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L +     +L     A           ++  +L +Y +   +LF+L++ 
Sbjct  2747  RLGVRSLRGSSLLDDELMTDLPCMEYA-----------KISELLALYGESDFLLFDLIEL  2795

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA KV  + DK  +   S+L   + D+QG +L   F  ++ S +++ ++       
Sbjct  2796  ADHCNAKKVHLIYDKRDHPKQSLLQQSLGDFQGSSLTVVFEGTIMSREEVCSL-------  2848

Query  267   KLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-I  103
             +L  P+     I  +GLG  S Y   D  + +SG    +FDP   +    S +    R  
Sbjct  2849  QLPPPWKLKGNILNYGLGLLSSYFVCDTLSILSGGYFYIFDPLGLTGGTTSIATSSARFF  2908

Query  102   KFVGRRILEQFPDQFSPF  49
               +G  ++E+F DQF+P 
Sbjct  2909  SLIGNDLVERFHDQFTPM  2926



>emb|CAJ86102.1| H0103C06.6 [Oryza sativa Indica Group]
 gb|EAY96030.1| hypothetical protein OsI_17903 [Oryza sativa Indica Group]
Length=4737

 Score =   464 bits (1193),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 252/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ +F + Q +IYLPD S RL  +++LV+NDAPWLLD D+  + N  ++A ++K+ 
Sbjct  1280  VQHLAEFRFQDHQTQIYLPDSSARLCLSSELVFNDAPWLLDFDEDITGNAPSIAFNSKKY  1339

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1340  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1399

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMA+WQGPALYCFN+S+FS
Sbjct  1400  MYADGPGILFELVQNAEDAKASEVVFLLDKTHYGTSSILSPEMAEWQGPALYCFNDSIFS  1459

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LPGI
Sbjct  1460  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHASYLPGI  1519

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGRRILEQFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1520  SPSHPGLRIKFVGRRILEQFPDQFTPFLHFGCNLQQPFPGTLF  1562


 Score =   201 bits (510),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA AS+V   LD+  +G  S+L+P 
Sbjct  9    EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGASRVRLCLDRRAHGAGSLLAPA  68

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+FV
Sbjct  69   LAQWQGPALLAYNDAVFTDEDFASISRIGDSRKVSQVWKTGRFGVGFNSVYHLTDLPSFV  128

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ +V+FDP    LP +S ++PG RI FV    +  + DQ SP+  FGCD++ PF+GTL
Sbjct  129  SGKYIVLFDPQGAYLPNVSAANPGKRIDFVSSSAITLYNDQLSPYRAFGCDMKAPFQGTL  188

Query  3    F  1
            F
Sbjct  189  F  189


 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 121/258 (47%), Gaps = 40/258 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  A +LVYNDAPW+                +A  T + FVH +I ND+A 
Sbjct  2721  LLIPDSFGVLTPARNLVYNDAPWM----------------NADPTSKSFVHLSIGNDLAN  2764

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L ++    +L     A           ++  +L +Y +   +LF+L++ 
Sbjct  2765  RLGVRSLRGSSLLDNELMTDLPCMEYA-----------KISELLALYGESDFLLFDLIEL  2813

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA KV  + DK  +   S+L   + D+QG +L   F  ++ S +++ ++       
Sbjct  2814  ADHCNAKKVHLIYDKRDHPKQSLLQQSLGDFQGSSLTVVFEGTIMSREEVCSL-------  2866

Query  267   KLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-I  103
             +L  P+     I  +GLG  S Y   D  + +SG    +FDP   +    S +    R  
Sbjct  2867  QLPPPWKLKGNILNYGLGLLSSYFVCDTLSILSGGYFYIFDPLGLTGGTTSTATSSARFF  2926

Query  102   KFVGRRILEQFPDQFSPF  49
               +G  ++E+F DQF+P 
Sbjct  2927  SLIGNDLVERFHDQFTPM  2944



>emb|CBG76273.1| OO_Ba0005L10-OO_Ba0081K17.24 [Oryza officinalis]
Length=5010

 Score =   464 bits (1193),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 221/283 (78%), Positives = 251/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL+D +F + Q +IYLPD S RL  +++LV+NDAPWLLD  D  + N S++A ++K+ 
Sbjct  1185  VQHLADFRFQDHQTQIYLPDSSARLCLSSELVFNDAPWLLDFGDDITGNASSIAFNSKKY  1244

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1245  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1304

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+ YG SS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1305  MYADGPGILFELVQNAEDAKASEVVFLLDKTHYGASSILSPEMAEWQGPALYCFNDSVFS  1364

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LPGI
Sbjct  1365  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHASYLPGI  1424

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGRRILEQFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1425  SPSHPGLRIKFVGRRILEQFPDQFNPFLHFGCNLQQPFPGTLF  1467


 Score =   200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA AS+V   LD+  +G  S+L+P 
Sbjct  9    EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGASRVRLCLDRRAHGAGSLLAPA  68

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+FV
Sbjct  69   LAQWQGPALLTYNDAVFTDEDFASISRIGDSRKVSQVWKTGRFGVGFNSVYHLTDLPSFV  128

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ +V+FDP    LP +S ++PG RI FV       + DQ SP+  FGCD++ PF+GTL
Sbjct  129  SGKYIVLFDPQGAYLPNVSAANPGKRIDFVSSSAFTLYNDQLSPYRAFGCDMKAPFQGTL  188

Query  3    F  1
            F
Sbjct  189  F  189



>ref|XP_006605419.1| PREDICTED: sacsin-like [Glycine max]
Length=4758

 Score =   463 bits (1192),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 232/285 (81%), Positives = 258/285 (91%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
               HL++V ++ + +++YLPDVS RLF A DLVYNDAPWLL SDDP+ S G+A  +AL+AK
Sbjct  1275  VHHLAEV-YHHEPVQLYLPDVSGRLFLAGDLVYNDAPWLLGSDDPNGSFGNAPTVALNAK  1333

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISNDVAEKLGV S RRM+LAES+DSMN  LSGAAEAFGQHE+LTTRL+HI
Sbjct  1334  RTVQKFVHGNISNDVAEKLGVCSLRRMMLAESSDSMNFGLSGAAEAFGQHEALTTRLKHI  1393

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG LFE+VQNAEDA AS+V FLLDKS YGTSSVLSPEMADWQGPALYCFN+SV
Sbjct  1394  LEMYADGPGTLFEMVQNAEDAGASEVMFLLDKSHYGTSSVLSPEMADWQGPALYCFNDSV  1453

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEK FAIGRFGLGFN VYHFTDIP FVSGENVVMFDPHA +LP
Sbjct  1454  FSPQDLYAISRIGQESKLEKAFAIGRFGLGFNCVYHFTDIPMFVSGENVVMFDPHASNLP  1513

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVG++ILEQFPDQFSP LHFGCDLQ+PF GTLF
Sbjct  1514  GISPSHPGLRIKFVGQQILEQFPDQFSPLLHFGCDLQHPFPGTLF  1558


 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+ V+  LD+  +   S+LS  
Sbjct  11   EDFGQTVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATTVSLCLDRRSHPAGSLLSDS  70

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  FN++VF+ +D  +IS+IG  +K  +    GRFG+GFNSVYH TD+P+FV
Sbjct  71   LAQWQGPALLAFNDAVFTEEDFVSISKIGGSTKHGQASKTGRFGVGFNSVYHLTDLPSFV  130

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            S + VV+FDP    LP +S ++PG RI F G      + DQFSP+  FGCD+Q+PF GTL
Sbjct  131  SHKYVVLFDPQGVYLPRVSAANPGKRIDFTGSSAFSFYRDQFSPYCAFGCDMQSPFSGTL  190

Query  3    F  1
            F
Sbjct  191  F  191


 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 73/252 (29%), Positives = 110/252 (44%), Gaps = 43/252 (17%)
 Frame = -1

Query  777   LFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR-FVHGNISNDVAEKLGVRSFR  601
             L  A DLVYNDAPWL                     I R FVH  ISND+A+ LGV+S R
Sbjct  2737  LMQAGDLVYNDAPWL----------------ENNSLIGRHFVHPIISNDLADILGVQSVR  2780

Query  600   RMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASK  421
              + L     + +L                 ++  +L  Y D   +LF+L++ A+   A +
Sbjct  2781  CLSLVSDDLTKDLPCMD-----------YNKVNELLAQYGDNEFLLFDLLELADCCKAKR  2829

Query  420   VAFLLDKSQYGTSSVLSPEMADWQGPALY------CFNNSVFSPQDLYAISRIGQESKLE  259
             +  + DK ++   S+L   + ++QGPAL       C +   FS   L    R+   +   
Sbjct  2830  LHLIYDKREHPRQSLLQHNLGEFQGPALVAIFECACLSREEFSNFQLRPPWRLRGNTI--  2887

Query  258   KPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-KFVGRRI  82
                    +GLG    Y   D+ + +SG    MFDP    L   S + P  ++   +G  +
Sbjct  2888  ------NYGLGLVCCYSICDLLSVISGGYFYMFDPRGLVLGAPSTNAPSAKMFSLIGTDL  2941

Query  81    LEQFPDQFSPFL  46
              ++F DQFSP L
Sbjct  2942  TQRFCDQFSPML  2953



>gb|EEE61898.1| hypothetical protein OsJ_16607 [Oryza sativa Japonica Group]
Length=4635

 Score =   463 bits (1192),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 252/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ +F + Q +IYLPD S RL  +++LV+NDAPWLLD D+  + N  ++A ++K+ 
Sbjct  1280  VQHLAEFRFQDHQTQIYLPDSSARLCLSSELVFNDAPWLLDFDEDITGNAPSIAFNSKKY  1339

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1340  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1399

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMA+WQGPALYCFN+S+FS
Sbjct  1400  MYADGPGILFELVQNAEDAKASEVVFLLDKTHYGTSSILSPEMAEWQGPALYCFNDSIFS  1459

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LPGI
Sbjct  1460  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHASYLPGI  1519

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGRRILEQFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1520  SPSHPGLRIKFVGRRILEQFPDQFTPFLHFGCNLQQPFPGTLF  1562


 Score =   201 bits (511),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA AS+V   LD+  +G  S+L+P 
Sbjct  9    EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGASRVRLCLDRRAHGAGSLLAPA  68

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+FV
Sbjct  69   LAQWQGPALLAYNDAVFTDEDFASISRIGDSRKVSQVWKTGRFGVGFNSVYHLTDLPSFV  128

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ +V+FDP    LP +S ++PG RI FV    +  + DQ SP+  FGCD++ PF+GTL
Sbjct  129  SGKYIVLFDPQGAYLPNVSAANPGKRIDFVSSSAITLYNDQLSPYCAFGCDMKAPFQGTL  188

Query  3    F  1
            F
Sbjct  189  F  189


 Score = 94.4 bits (233),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 120/258 (47%), Gaps = 40/258 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  A +LVYNDAPW+                +A  T + FVH +I ND+A 
Sbjct  2721  LLIPDSFGVLTPARNLVYNDAPWM----------------NADPTSKSFVHLSIGNDLAN  2764

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L +     +L     A           ++  +L +Y +   +LF+L++ 
Sbjct  2765  RLGVRSLRGSSLLDDELMTDLPCMEYA-----------KISELLALYGESDFLLFDLIEL  2813

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA KV  + DK  +   S+L   + D+QG +L   F  ++ S +++ ++       
Sbjct  2814  ADHCNAKKVHLIYDKRDHPKQSLLQQSLGDFQGSSLTVVFEGTIMSREEVCSL-------  2866

Query  267   KLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-I  103
             +L  P+     I  +GLG  S Y   D  + +SG    +FDP   +    S +    R  
Sbjct  2867  QLPPPWKLKGNILNYGLGLLSSYFVCDTLSILSGGYFYIFDPLGLTGGTTSIATSSARFF  2926

Query  102   KFVGRRILEQFPDQFSPF  49
               +G  ++E+F DQF+P 
Sbjct  2927  SLIGNDLVERFHDQFTPM  2944



>ref|XP_002447315.1| hypothetical protein SORBIDRAFT_06g032770 [Sorghum bicolor]
 gb|EES11643.1| hypothetical protein SORBIDRAFT_06g032770 [Sorghum bicolor]
Length=4709

 Score =   463 bits (1192),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 253/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHLS+ +F + Q +IYLPD S RL  +++LV+NDAPWLLD     S + S++AL +K+ 
Sbjct  1225  VQHLSEFRFQDQQTQIYLPDSSSRLCLSSELVFNDAPWLLDFGHDISGSSSSIALSSKKY  1284

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1285  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1344

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1345  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1404

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC LPGI
Sbjct  1405  PQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHACYLPGI  1464

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRI+FVGRRIL+QFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1465  SPSHPGLRIQFVGRRILDQFPDQFTPFLHFGCNLQQPFPGTLF  1507


 Score =   134 bits (336),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA A +V   LD+  +G++S+L+P 
Sbjct  12   EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGAGRVRLCLDRRSHGSASLLAPA  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTF  187
            +A WQGPAL  +N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+F
Sbjct  72   LAQWQGPALLAYNDAVFTDEDFASISRIGDSRKVAQTWKTGRFGVGFNSVYHLTDLPSF  130


 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/258 (28%), Positives = 119/258 (46%), Gaps = 40/258 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  A +LVYNDAPW+                +A  T + F+H +I N++A 
Sbjct  2702  LVIPDSFGVLTPARNLVYNDAPWM----------------NANPTSKNFIHLSIGNELAN  2745

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L +     NL     A           ++  +L +Y +   +LF+L++ 
Sbjct  2746  RLGVRSLRGSSLLDDELMRNLPCMEYA-----------KISELLALYGESDFLLFDLIEL  2794

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  +A KV  + DK ++   S+L   + D QGP+L   F  ++ + +++ +        
Sbjct  2795  ADYCSAKKVHLIYDKREHPKQSLLQQSLGDLQGPSLTVVFEGTILNREEVCSF-------  2847

Query  267   KLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-I  103
             +L  P+     I  +GLG  S Y   D  T +SG    +FDP   +    S +    R  
Sbjct  2848  QLPPPWKLRGNILNYGLGLLSSYFVCDTLTILSGGYFYIFDPLGLTGGATSTATSSARYF  2907

Query  102   KFVGRRILEQFPDQFSPF  49
               +G  ++E+F DQF P 
Sbjct  2908  SLLGNDLVERFHDQFLPM  2925



>ref|XP_010547718.1| PREDICTED: sacsin isoform X3 [Tarenaya hassleriana]
Length=4643

 Score =   463 bits (1192),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 228/285 (80%), Positives = 257/285 (90%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             +Q L++ QF  D++ IYLPDVS RLF ++DLV+NDAPWL  SD+ +SS    S M L+AK
Sbjct  1199  SQQLAEAQFL-DKVIIYLPDVSGRLFPSSDLVFNDAPWLAASDNGNSSFDAESTMLLNAK  1257

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T Q+FVHGNISN+V EKLGVRS RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1258  RTTQKFVHGNISNEVGEKLGVRSLRRVLLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1317

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLD++QYGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1318  LEMYADGPGILFELVQNAEDAGASEVIFLLDRTQYGTSSLLSPEMADWQGPALYCFNNSV  1377

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1378  FTPQDLYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPAFVSGENIVMFDPHANHLP  1437

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1438  GISPSHPGLRIKFVGRQILDQFPDQFTPFLHFGCDLKHTFPGTLF  1482


 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 122/266 (46%), Gaps = 42/266 (16%)
 Frame = -1

Query  822   YEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNI  643
             Y D + + +PD    L    DLVYNDAPW+              +L  K     FVH +I
Sbjct  2634  YGDNL-LLVPDSDGFLVPFEDLVYNDAPWV-----------ENSSLPGKT----FVHPSI  2677

Query  642   SNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVL  463
             +ND+A KLG++S R + L ++  + ++     A           +L+ +L +Y D   VL
Sbjct  2678  NNDLAYKLGIKSLRCISLVDNDITQDIPCMDFA-----------KLKELLSLYGDKDLVL  2726

Query  462   FELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC------FNNSVFSPQD  301
             F+L++ A+     K+  + DK ++   S+L     ++QGPA+         N    S   
Sbjct  2727  FDLLELADCCKVKKLHLIFDKREHARKSLLQHNFGEFQGPAMVAILEGANLNRDEVSGLQ  2786

Query  300   LYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPS  121
               +  RI  E+          +GLG  S Y   D+ + VSG    MFDP   +L   +  
Sbjct  2787  HLSPGRIRGETL--------NYGLGLLSCYFLCDLLSIVSGGYFYMFDPQGLALSASTTH  2838

Query  120   HPGLRI-KFVGRRILEQFPDQFSPFL  46
              P  ++   +G  ++E+F DQF+P +
Sbjct  2839  SPAAKMFSLIGTNLVERFRDQFNPMM  2864


 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  123  SHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
            ++PG RI +VG   L Q+ DQFSP+  FGCD++NPFRGTLF
Sbjct  70   ANPGKRIDYVGSSALLQYKDQFSPYCVFGCDMKNPFRGTLF  110



>ref|XP_010547716.1| PREDICTED: sacsin isoform X1 [Tarenaya hassleriana]
 ref|XP_010547717.1| PREDICTED: sacsin isoform X2 [Tarenaya hassleriana]
Length=4720

 Score =   463 bits (1192),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 228/285 (80%), Positives = 257/285 (90%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             +Q L++ QF  D++ IYLPDVS RLF ++DLV+NDAPWL  SD+ +SS    S M L+AK
Sbjct  1276  SQQLAEAQFL-DKVIIYLPDVSGRLFPSSDLVFNDAPWLAASDNGNSSFDAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T Q+FVHGNISN+V EKLGVRS RR+LLAESADSMNLSLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTTQKFVHGNISNEVGEKLGVRSLRRVLLAESADSMNLSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLD++QYGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVIFLLDRTQYGTSSLLSPEMADWQGPALYCFNNSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+PQDLYAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTPQDLYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPAFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISPSHPGLRIKFVGR+IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPSHPGLRIKFVGRQILDQFPDQFTPFLHFGCDLKHTFPGTLF  1559


 Score =   209 bits (531),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 128/181 (71%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A++V   LD+  +G+ S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATRVCLCLDRRVHGSGSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  FN++VF+  D  +ISRIG   K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  67   LAQWQGPSLLAFNDAVFTEDDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDLPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI +VG   L Q+ DQFSP+  FGCD++NPFRGTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDYVGSSALLQYKDQFSPYCVFGCDMKNPFRGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 122/266 (46%), Gaps = 42/266 (16%)
 Frame = -1

Query  822   YEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNI  643
             Y D + + +PD    L    DLVYNDAPW+              +L  K     FVH +I
Sbjct  2711  YGDNL-LLVPDSDGFLVPFEDLVYNDAPWV-----------ENSSLPGKT----FVHPSI  2754

Query  642   SNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVL  463
             +ND+A KLG++S R + L ++  + ++     A           +L+ +L +Y D   VL
Sbjct  2755  NNDLAYKLGIKSLRCISLVDNDITQDIPCMDFA-----------KLKELLSLYGDKDLVL  2803

Query  462   FELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC------FNNSVFSPQD  301
             F+L++ A+     K+  + DK ++   S+L     ++QGPA+         N    S   
Sbjct  2804  FDLLELADCCKVKKLHLIFDKREHARKSLLQHNFGEFQGPAMVAILEGANLNRDEVSGLQ  2863

Query  300   LYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPS  121
               +  RI  E+          +GLG  S Y   D+ + VSG    MFDP   +L   +  
Sbjct  2864  HLSPGRIRGETL--------NYGLGLLSCYFLCDLLSIVSGGYFYMFDPQGLALSASTTH  2915

Query  120   HPGLRI-KFVGRRILEQFPDQFSPFL  46
              P  ++   +G  ++E+F DQF+P +
Sbjct  2916  SPAAKMFSLIGTNLVERFRDQFNPMM  2941



>ref|XP_010031907.1| PREDICTED: uncharacterized protein LOC104421597 isoform X2 [Eucalyptus 
grandis]
Length=4760

 Score =   463 bits (1191),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 231/285 (81%), Positives = 253/285 (89%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHLS+VQ  +DQ+KIYLPDVS RLF +++LVYNDAPWLL  D  DSS GS     L+AK
Sbjct  1276  VQHLSEVQV-QDQVKIYLPDVSGRLFPSSELVYNDAPWLLSPDYSDSSFGSGSNCVLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
               +Q+ VHGNISNDVAEKLGV S RR+LLAE+ADSMNLSL GAAEAFGQHE+LTTRL+HI
Sbjct  1335  TRVQKLVHGNISNDVAEKLGVCSLRRILLAENADSMNLSLYGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPGVLFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEM + QGPAL CFN+SV
Sbjct  1395  LEMYADGPGVLFELVQNAEDAGASEVTFLLDKTQYGTSSVLSPEMGELQGPALCCFNDSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC+LP
Sbjct  1455  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPAFVSGENLVMFDPHACNLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GI+PSHPGLRI+F GR ILEQFPDQFSPFLHFGCDLQ+PF GT F
Sbjct  1515  GITPSHPGLRIRFAGRNILEQFPDQFSPFLHFGCDLQHPFPGTFF  1559


 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL E++QNA+DA A+ V   LD+  +G+ S+LS  
Sbjct  10   EDFGQKVDLTRRIREVLLNYPEGTTVLKEVIQNADDAGATTVRLCLDRRAHGSGSLLSDS  69

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N+++FS +D  +ISRIG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  70   LAQWQGPALLAYNDAIFSEEDFASISRIGGSSKHSQATKTGRFGVGFNSVYHLTDLPSFV  129

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI FV    +  + DQFSP+  FGCD+Q+ F GTL
Sbjct  130  SGKYVVLFDPQGVYLPQVSAANPGKRIDFVNSSAISIYKDQFSPYCAFGCDMQSSFSGTL  189

Query  3    F  1
            F
Sbjct  190  F  190


 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 77/276 (28%), Positives = 128/276 (46%), Gaps = 39/276 (14%)
 Frame = -1

Query  813   QIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISND  634
             +  I +PD S  L  A DLVYNDAPW+  S+  +               +RFVH  ISND
Sbjct  2724  RTSILVPDSSGALRWAGDLVYNDAPWIDTSNLLE---------------KRFVHDCISND  2768

Query  633   VAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFEL  454
             +A KLG++S R + L +   + +L        +G       +++ +L  +     +LF+L
Sbjct  2769  LASKLGIQSLRCLSLVDEETTRDL----PCMDYG-------KVKELLAFFGGDEFLLFDL  2817

Query  453   VQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-FSPQDLYAISRIG  277
             ++ A+   A K+  ++DK ++   S++   +A++QGP L      V  S +++ ++    
Sbjct  2818  LELADCCKAKKLHLIIDKRKHACQSLMQHNLAEFQGPGLVAILEGVTLSTEEISSL----  2873

Query  276   QESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGL  109
                +L  P+ +      +GLG  S Y   DI   +S     +FDP   +L   S   P  
Sbjct  2874  ---QLRPPWRLCGDTLNYGLGLLSCYALCDILYVISSGYFYIFDPRGLALGAPSSFAPAA  2930

Query  108   R-IKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
             +     G  +  +F DQFS  L    +L +P   TL
Sbjct  2931  KAFSLRGTNLTARFRDQFSALLIDEDELWSPSGSTL  2966



>ref|XP_010031906.1| PREDICTED: uncharacterized protein LOC104421597 isoform X1 [Eucalyptus 
grandis]
 gb|KCW51303.1| hypothetical protein EUGRSUZ_J00863 [Eucalyptus grandis]
Length=4761

 Score =   463 bits (1191),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 231/285 (81%), Positives = 253/285 (89%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSA--MALHAK  676
              QHLS+VQ  +DQ+KIYLPDVS RLF +++LVYNDAPWLL  D  DSS GS     L+AK
Sbjct  1277  VQHLSEVQV-QDQVKIYLPDVSGRLFPSSELVYNDAPWLLSPDYSDSSFGSGSNCVLNAK  1335

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
               +Q+ VHGNISNDVAEKLGV S RR+LLAE+ADSMNLSL GAAEAFGQHE+LTTRL+HI
Sbjct  1336  TRVQKLVHGNISNDVAEKLGVCSLRRILLAENADSMNLSLYGAAEAFGQHEALTTRLKHI  1395

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPGVLFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEM + QGPAL CFN+SV
Sbjct  1396  LEMYADGPGVLFELVQNAEDAGASEVTFLLDKTQYGTSSVLSPEMGELQGPALCCFNDSV  1455

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             FSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHAC+LP
Sbjct  1456  FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPAFVSGENLVMFDPHACNLP  1515

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GI+PSHPGLRI+F GR ILEQFPDQFSPFLHFGCDLQ+PF GT F
Sbjct  1516  GITPSHPGLRIRFAGRNILEQFPDQFSPFLHFGCDLQHPFPGTFF  1560


 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 124/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL E++QNA+DA A+ V   LD+  +G+ S+LS  
Sbjct  10   EDFGQKVDLTRRIREVLLNYPEGTTVLKEVIQNADDAGATTVRLCLDRRAHGSGSLLSDS  69

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +N+++FS +D  +ISRIG  SK  +    GRFG+GFNSVYH TD+P+FV
Sbjct  70   LAQWQGPALLAYNDAIFSEEDFASISRIGGSSKHSQATKTGRFGVGFNSVYHLTDLPSFV  129

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI FV    +  + DQFSP+  FGCD+Q+ F GTL
Sbjct  130  SGKYVVLFDPQGVYLPQVSAANPGKRIDFVNSSAISIYKDQFSPYCAFGCDMQSSFSGTL  189

Query  3    F  1
            F
Sbjct  190  F  190


 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 77/276 (28%), Positives = 128/276 (46%), Gaps = 39/276 (14%)
 Frame = -1

Query  813   QIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISND  634
             +  I +PD S  L  A DLVYNDAPW+  S+  +               +RFVH  ISND
Sbjct  2725  RTSILVPDSSGALRWAGDLVYNDAPWIDTSNLLE---------------KRFVHDCISND  2769

Query  633   VAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFEL  454
             +A KLG++S R + L +   + +L        +G       +++ +L  +     +LF+L
Sbjct  2770  LASKLGIQSLRCLSLVDEETTRDL----PCMDYG-------KVKELLAFFGGDEFLLFDL  2818

Query  453   VQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-FSPQDLYAISRIG  277
             ++ A+   A K+  ++DK ++   S++   +A++QGP L      V  S +++ ++    
Sbjct  2819  LELADCCKAKKLHLIIDKRKHACQSLMQHNLAEFQGPGLVAILEGVTLSTEEISSL----  2874

Query  276   QESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGL  109
                +L  P+ +      +GLG  S Y   DI   +S     +FDP   +L   S   P  
Sbjct  2875  ---QLRPPWRLCGDTLNYGLGLLSCYALCDILYVISSGYFYIFDPRGLALGAPSSFAPAA  2931

Query  108   R-IKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
             +     G  +  +F DQFS  L    +L +P   TL
Sbjct  2932  KAFSLRGTNLTARFRDQFSALLIDEDELWSPSGSTL  2967



>ref|XP_010935539.1| PREDICTED: sacsin [Elaeis guineensis]
Length=4766

 Score =   462 bits (1190),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/283 (77%), Positives = 249/283 (88%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ QF +  ++IYLPDVS RL  ++DLV+NDAPWL D  +    + S + L++ + 
Sbjct  1284  VQHLAETQFQDLHVQIYLPDVSSRLLPSSDLVFNDAPWLFDIGENAFGDTSNVVLNSMRN  1343

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAEKLGVRS RR+LLAES+DSMNLSLSG AEAFGQHE+LTTRL+HI+E
Sbjct  1344  VHNFVHGNISNDVAEKLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEALTTRLKHIVE  1403

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYG SS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1404  MYADGPGILFELVQNAEDAQASEVVFLLDKTQYGISSILSPEMAEWQGPALYCFNDSVFS  1463

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
              QDLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+V+FDPHAC LPGI
Sbjct  1464  SQDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVIFDPHACYLPGI  1523

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SP+HPGLRI+FVGRRILEQFPDQF+PFLHFGCDLQ  F GTLF
Sbjct  1524  SPTHPGLRIRFVGRRILEQFPDQFTPFLHFGCDLQQSFPGTLF  1566


 Score =   195 bits (495),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 128/190 (67%), Gaps = 5/190 (3%)
 Frame = -1

Query  555  SGAA-----EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQY  391
            SGAA     E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A++V   LD+  +
Sbjct  4    SGAADLSLLEDFGQRVDLTRRIREVLVNYPEGTTVLKELIQNADDAGATRVCLCLDRRTH  63

Query  390  GTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVY  211
            G+ S+LS ++A WQGPAL  +N+++F+  D  +ISRIG   K  + +  GRFG+GFNSVY
Sbjct  64   GSGSLLSSKLAQWQGPALLAYNDAMFTEDDFVSISRIGDSKKQSQAWKTGRFGVGFNSVY  123

Query  210  HFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCD  31
            H TD+P+FVS + VV+FDP    LP +S ++PG R+++V    +  + DQF P+  FGCD
Sbjct  124  HLTDLPSFVSDKYVVLFDPQGAYLPNVSAANPGKRLEYVSSSAILLYKDQFMPYCAFGCD  183

Query  30   LQNPFRGTLF  1
            ++ PF GTLF
Sbjct  184  MKGPFPGTLF  193


 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 125/260 (48%), Gaps = 43/260 (17%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD S  L +A++LVYNDAPW+                +   T + FVH +IS+D++ 
Sbjct  2736  LLIPDSSGVLMHASNLVYNDAPWMK---------------NNNPTTKHFVHSSISDDISN  2780

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGV+S R + L +  D M   L               R+  +L +Y D   VLF+L++ 
Sbjct  2781  RLGVQSLRSLSLVD--DDMMKDLPCMD---------YVRICELLALYGDSDFVLFDLLEL  2829

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA K+  + DK ++   S+L   + D+QG AL      +  S +++  +       
Sbjct  2830  ADLCNAKKLRLIYDKREHPRQSLLQQNLGDFQGSALTVVLEGTTLSREEICGL-------  2882

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIK  100
             +L  P+ I      +GLG  S Y   D+ T VSG    +FDP   +L   +PS+ G   K
Sbjct  2883  QLPPPWKIRGNAINYGLGLVSSYFVCDLLTIVSGGYFYVFDPLGLALA--APSNTGSSAK  2940

Query  99    ---FVGRRILEQFPDQFSPF  49
                  G  + E+F DQFSP 
Sbjct  2941  LFSLTGTDLTERFRDQFSPM  2960



>ref|XP_010240604.1| PREDICTED: sacsin [Brachypodium distachyon]
Length=4754

 Score =   462 bits (1189),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 250/283 (88%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ +F + Q +IYLPD S RL  +++LV+NDAPWLLD     + N S +A  +K+ 
Sbjct  1284  VQHLAEFRFQDQQTQIYLPDSSARLCLSSELVFNDAPWLLDFGHEIAGNASTIAFSSKKY  1343

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1344  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1403

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1404  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1463

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLY+ISRIGQ+SKLEKPFAIGRFGLGFN VYHFTD+P FVSGEN+VMFDPHA  LPGI
Sbjct  1464  PQDLYSISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDMPGFVSGENIVMFDPHARYLPGI  1523

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGRRILEQFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1524  SPSHPGLRIKFVGRRILEQFPDQFTPFLHFGCNLQQPFPGTLF  1566


 Score =   199 bits (506),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 123/181 (68%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G   L EL+QNA+DA AS V   LD+  +G  S+L+P 
Sbjct  13   EDFGQRVDLTRRIREVLANYPEGTTALRELIQNADDAGASAVRLCLDRRSHGARSLLAPA  72

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL   N++VF+ +D  +ISRIG   K+ + +  GRFG+GFNSVYH TD+P+FV
Sbjct  73   LAQWQGPALLAHNDAVFTDEDFASISRIGDSKKVSQAWKTGRFGVGFNSVYHLTDLPSFV  132

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VVMFDP    LP +S ++PG RI +V    +  + DQ SP+  FGCD++ PF+GTL
Sbjct  133  SGKYVVMFDPQGAYLPNVSAANPGKRIDYVTSTAVTLYSDQLSPYRAFGCDMKAPFQGTL  192

Query  3    F  1
            F
Sbjct  193  F  193


 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 115/258 (45%), Gaps = 40/258 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  + +LVYNDAPW+                    T + FVH +I ND+A 
Sbjct  2730  LVIPDSFGVLTPSRNLVYNDAPWM----------------STDPTAKNFVHPSIGNDLAN  2773

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L +     +L     A           ++  +L +Y +   +LF+L++ 
Sbjct  2774  RLGVRSLRGSSLLDDELMRDLPCMEYA-----------KISELLALYGESDFILFDLIEL  2822

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA KV  + DK  +   S+L   + D QG +L   F  ++ S +++ ++       
Sbjct  2823  ADYCNAKKVHLIYDKRDHPKQSLLQQSLGDLQGSSLTVVFEGTMISREEICSL-------  2875

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-I  103
             +L  P+ +      +GLG  S Y   D  T +S     +FDP   +    S +    R  
Sbjct  2876  QLPPPWKLRGNTLNYGLGLLSSYFVCDALTILSAGYFYIFDPLGLTGGATSTATSSARFF  2935

Query  102   KFVGRRILEQFPDQFSPF  49
               +G  ++E+F DQF P 
Sbjct  2936  SLIGNDLVERFRDQFLPM  2953



>ref|XP_010456655.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Camelina sativa]
Length=4704

 Score =   462 bits (1188),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/285 (79%), Positives = 255/285 (89%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             AQ L++ QF  D++ +YLPDVSCRLF ++DLVYNDAPWL  SD+ +SS    S M L+AK
Sbjct  1276  AQQLAEAQFL-DKVTLYLPDVSCRLFPSSDLVYNDAPWLTASDNCNSSFSAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISN+VAEKLGVRS RR+LLAESADSM+ SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTMQKFVHGNISNEVAEKLGVRSLRRVLLAESADSMSFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDKTHYGTSSLLSPEMADWQGPALYCFNNSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRNILDQFPDQFAPFLHFGCDLEHTFPGTLF  1559


 Score =   204 bits (519),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +G+ S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVRLCLDRRVHGSGSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI +VG   L Q+ DQF P+  FGCD++ PF GTL
Sbjct  127  SGKYVVLFDPQDAYLPNISAANPGKRIDYVGSSALSQYKDQFLPYCAFGCDMRTPFHGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score = 97.8 bits (242),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 128/259 (49%), Gaps = 23/259 (9%)
 Frame = -1

Query  816   DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISN  637
             D+  + +PD +  L  +  LVYNDAPW+            + +L  K    RFVH +I+N
Sbjct  2707  DKNSVLVPDSAGFLVPSEKLVYNDAPWV-----------DSSSLSGK----RFVHPSINN  2751

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             D+A +LG++S R + L ++  + +L     ++      +L+     +L +Y     +LF+
Sbjct  2752  DIANRLGIQSLRCISLVDNDITQDLXNYDESQNLI---NLSXIXXELLSLYGSKDFLLFD  2808

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRI  280
             L++ A+     K+ F+ DK ++   ++L   + ++QGPAL   F     + +++  +  +
Sbjct  2809  LLELADCCRVKKLHFIFDKREHSRKTLLQHNLGEFQGPALVAIFEGVTLTREEVCNLQLL  2868

Query  279   GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
              Q     +      +GLG  S Y   D+ + VSG    MFDP   +L   +   P  ++ 
Sbjct  2869  SQWRVKGETL---NYGLGLLSCYFMCDLLSIVSGGYFYMFDPKGATLSASTTQAPAAKMF  2925

Query  102   KFVGRRILEQFPDQFSPFL  46
               +G  ++E+F DQFSP L
Sbjct  2926  SLIGTNLVERFSDQFSPML  2944



>ref|XP_010421109.1| PREDICTED: sacsin-like [Camelina sativa]
Length=4700

 Score =   461 bits (1187),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 225/285 (79%), Positives = 255/285 (89%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             AQ L++ QF  D++ +YLPDVSCRLF ++DLVYNDAPWL  SD+ +SS    S M L+AK
Sbjct  1276  AQQLAEAQFL-DKVTLYLPDVSCRLFPSSDLVYNDAPWLTASDNCNSSFSAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISN+VAEKLGVRS RR+LLAESADSM+ SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTMQKFVHGNISNEVAEKLGVRSLRRVLLAESADSMSFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDKTHYGTSSLLSPEMADWQGPALYCFNNSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRNILDQFPDQFAPFLHFGCDLEHTFPGTLF  1559


 Score =   204 bits (520),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +G+ S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVRLCLDRRVHGSGSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI +VG   L Q+ DQF P+  FGCD++ PF GTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDYVGSSALSQYEDQFLPYCAFGCDMKTPFHGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 127/259 (49%), Gaps = 31/259 (12%)
 Frame = -1

Query  816   DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISN  637
             D+  + +PD +  L    +LVYNDAPW+                ++  + +RFVH +I+N
Sbjct  2708  DKNSVLVPDSAGFLVPLEELVYNDAPWVD---------------NSSLSGKRFVHPSINN  2752

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             D+A +LG++S R + L ++  + +L                T+L+ +L +Y     +LF+
Sbjct  2753  DMANRLGIQSLRCISLVDNDITQDLPCMEF-----------TKLKELLSLYGSKDFLLFD  2801

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRI  280
             L++ A+     K+ F+ DK ++   ++L   + ++QGPAL   F     + +++  +  +
Sbjct  2802  LLELADCCRVKKLHFIFDKREHSRKTLLQHNLGEFQGPALVAIFEGVTLTREEVCNLQLL  2861

Query  279   GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
              Q     +      +GLG  S Y   D+ + VSG    MFDP   +L   +   P  ++ 
Sbjct  2862  SQWRVKGETL---NYGLGLLSCYFMCDLLSIVSGGYFYMFDPKGATLSASTTQAPAAKMF  2918

Query  102   KFVGRRILEQFPDQFSPFL  46
               +G  ++E+F DQFSP L
Sbjct  2919  SLIGTNLVERFSDQFSPML  2937



>ref|XP_002872036.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48295.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=4711

 Score =   460 bits (1184),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 226/285 (79%), Positives = 254/285 (89%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             AQ L++ QF  D++ IYLPDVS RLF ++DLVYNDAPWL  SD+ +SS    S M L+AK
Sbjct  1276  AQQLAEAQFL-DKVTIYLPDVSGRLFPSSDLVYNDAPWLTASDNHNSSFSAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISN+VAEKLGVRS RR+LLAESADSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTMQKFVHGNISNEVAEKLGVRSLRRVLLAESADSMNFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDKTHYGTSSLLSPEMADWQGPALYCFNNSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRNILDQFPDQFAPFLHFGCDLEHTFPGTLF  1559


 Score =   205 bits (521),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 127/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +G+ S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVRLCLDRRVHGSGSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI +VG   L Q+ DQF P+  FGCD+++PF GTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDYVGSSALSQYKDQFLPYCAFGCDMRSPFHGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 131/270 (49%), Gaps = 31/270 (11%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
             A   S+V    D   + +PD +  L    DLVYNDAPW+            + +L  K  
Sbjct  2696  ADCFSEVSSDSDNNSVLVPDSAGFLVPLDDLVYNDAPWV-----------DSSSLSGK--  2742

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
               RFVH +I++D+A +LG++S R + L ++  + +L                T+L+ +L 
Sbjct  2743  --RFVHPSINSDMANRLGIQSLRCISLVDNDITQDLPCMD-----------FTKLKELLS  2789

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-F  313
             +YA    +LF+L++ A+     K+  + DK ++   ++L   + ++QGPAL      V  
Sbjct  2790  LYASKDFLLFDLLELADCCRVKKLHIIFDKREHSRKTLLQHNLGEFQGPALVAILEGVTL  2849

Query  312   SPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG  133
             + +++ ++  + Q     +      +GLG  S Y   D+ + VSG    MFDP   +L  
Sbjct  2850  TREEVCSLQLLSQWRIKGETL---NYGLGLLSCYFMCDLLSIVSGGYFYMFDPQGATLSA  2906

Query  132   ISPSHPGLRI-KFVGRRILEQFPDQFSPFL  46
              +   P  ++   +G  ++E+F DQF+P L
Sbjct  2907  PTTQAPAAKMFSLIGTNLVERFSDQFNPML  2936



>ref|NP_197702.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09828.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED93123.1| uncharacterized protein AT5G23110 [Arabidopsis thaliana]
Length=4706

 Score =   460 bits (1183),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 226/285 (79%), Positives = 254/285 (89%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             AQ L++ QF  D++ IYLPDVS RLF ++DLVYNDAPWL  SD+ +SS    S M L+AK
Sbjct  1276  AQQLAEAQFL-DKVTIYLPDVSGRLFPSSDLVYNDAPWLTASDNLNSSFSAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISN+VAEKLGVRS RR+LLAESADSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTMQKFVHGNISNEVAEKLGVRSLRRVLLAESADSMNFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDKTHYGTSSLLSPEMADWQGPALYCFNNSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRYILDQFPDQFAPFLHFGCDLEHTFPGTLF  1559


 Score =   205 bits (521),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 127/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +G+ S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVRLCLDRRVHGSGSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI +VG   L Q+ DQF P+  FGCD+++PF GTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDYVGSSALSQYKDQFLPYCAFGCDMRSPFNGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 130/270 (48%), Gaps = 31/270 (11%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
             A   S+V    D   + +PD +  L    DLVYNDAPW+            + +L  K  
Sbjct  2696  ADCFSEVSSDSDNNSVLVPDSAGFLVPLEDLVYNDAPWV-----------DSSSLSGK--  2742

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
               RFVH +I++D+A +LG++S R + L ++  + +L                T+L+ +L 
Sbjct  2743  --RFVHPSINSDMANRLGIQSLRCISLVDNDITQDLPCMD-----------FTKLKELLS  2789

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-F  313
             +YA    +LF+L++ A+     K+  + DK ++   ++L   + ++QGPA+      V  
Sbjct  2790  LYASKDFLLFDLLELADCCKVKKLHIIFDKREHPRKTLLQHNLGEFQGPAIVAILEGVTL  2849

Query  312   SPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG  133
             + +++ ++  + Q     +      +GLG  S Y   D+ + VSG    MFDP   +L  
Sbjct  2850  TREEICSLQLLSQWRIKGETL---NYGLGLLSCYFMCDLLSIVSGGYFYMFDPQGATLSA  2906

Query  132   ISPSHP-GLRIKFVGRRILEQFPDQFSPFL  46
              +   P G     +G  ++E+F DQF+P L
Sbjct  2907  STTQAPAGKMFSLIGTNLVERFSDQFNPML  2936



>gb|EMS66849.1| Sacsin [Triticum urartu]
Length=4736

 Score =   460 bits (1183),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 217/283 (77%), Positives = 250/283 (88%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ +F + Q +IYLPD S RL  +++LV+NDAPWLLDS      + S++A   ++ 
Sbjct  1214  VQHLAEFRFQDQQTQIYLPDSSARLCLSSELVFNDAPWLLDSGHDIIGDASSIAFSPQKY  1273

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1274  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1333

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1334  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1393

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLY+ISRIGQ+SKLEKPFAIGRFGLGFN VYHFTD+P FVSGEN+VMFDPHA  LPGI
Sbjct  1394  PQDLYSISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDMPGFVSGENIVMFDPHARYLPGI  1453

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGR+ILEQFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1454  SPSHPGLRIKFVGRKILEQFPDQFTPFLHFGCNLQQPFPGTLF  1496


 Score =   100 bits (249),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -1

Query  234  GLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFS  55
             +GFNSVYH TD+P+FVSG+ VVMFDP    LP +S ++PG RI +V    L  + DQ S
Sbjct  5    SIGFNSVYHLTDLPSFVSGKYVVMFDPQGAYLPNVSAANPGKRIDYVSSTALTLYGDQLS  64

Query  54   PFLHFGCDLQNPFRGTLF  1
            P+  FGCD++ PF+GTLF
Sbjct  65   PYRAFGCDMKAPFQGTLF  82


 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 71/277 (26%), Positives = 115/277 (42%), Gaps = 59/277 (21%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  + +L+YNDAPW+                    T + FVH +I ND+A 
Sbjct  2660  LVIPDSFGVLTPSRNLLYNDAPWM----------------DTDPTSKHFVHHSIGNDLAN  2703

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L +     +L     A           ++  +L +Y +   +LF+L++ 
Sbjct  2704  RLGVRSLRGSSLLDDELMRDLPCMEYA-----------KISELLALYGESDFLLFDLIEL  2752

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA KV  + DK  +   S+L   + D QG +L   F  ++ S +++ ++       
Sbjct  2753  ADSCNAKKVHLIYDKRDHPKQSLLQQNLGDLQGSSLTVVFEGTMISREEVCSL-------  2805

Query  267   KLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR--  106
             +L  P+     I  +GLG  S Y   D  T +S     +FDP   +    S +    R  
Sbjct  2806  QLPPPWKLRGNILNYGLGLLSSYFVCDALTILSAGYFYVFDPLGLTGGATSTATSSARFF  2865

Query  105   ------------------IKFVGRRILEQFPDQFSPF  49
                                 F G  ++E+F DQF P 
Sbjct  2866  SLIVSAHVFYTLNEALNATGFSGNDLVERFRDQFLPM  2902



>gb|EMT30440.1| Sacsin [Aegilops tauschii]
Length=4585

 Score =   460 bits (1183),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/283 (77%), Positives = 250/283 (88%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++ +F + Q +IYLPD S RL  +++LV+NDAPWLLDS      + S++A   ++ 
Sbjct  1082  VQHLAEFRFQDQQTQIYLPDSSARLCLSSELVFNDAPWLLDSGHDIIGDASSIAFSPQKY  1141

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  FVHGNISNDVAE+LGVRS RR+LLAES+DSMNLSLSG AEAFGQHE LTTRL+HI+E
Sbjct  1142  VHNFVHGNISNDVAERLGVRSLRRLLLAESSDSMNLSLSGVAEAFGQHEDLTTRLKHIVE  1201

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMA+WQGPALYCFN+SVFS
Sbjct  1202  MYADGPGILFELVQNAEDAKASEVVFLLDKTQYGTSSILSPEMAEWQGPALYCFNDSVFS  1261

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLY+ISRIGQ+SKLEKPFAIGRFGLGFN VYHFTD+P FVSGEN+VMFDPHA  LPGI
Sbjct  1262  PQDLYSISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDMPGFVSGENIVMFDPHARYLPGI  1321

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGR+ILEQFPDQF+PFLHFGC+LQ PF GTLF
Sbjct  1322  SPSHPGLRIKFVGRKILEQFPDQFTPFLHFGCNLQQPFPGTLF  1364


 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 69/258 (27%), Positives = 114/258 (44%), Gaps = 40/258 (16%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD    L  + +L+YNDAPW+                    T + FVH +I ND+A 
Sbjct  2528  LVIPDSFGVLTPSRNLLYNDAPWM----------------DTDPTSKHFVHHSIGNDLAN  2571

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LGVRS R   L +     +L     A           ++  +L +Y +   +LF+L++ 
Sbjct  2572  RLGVRSLRGSSLLDDELMRDLPCMEYA-----------KISELLALYGESDFLLFDLIEL  2620

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+  NA KV  + DK  +   S+L   + D Q  +L   F  ++ S +++ ++       
Sbjct  2621  ADSCNAKKVHLIYDKRDHPKQSLLQQNLGDLQSSSLTVVFEGTMISREEVCSL-------  2673

Query  267   KLEKPFA----IGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLR-I  103
             +L  P+     I  +GLG  S Y   D  T +S     +FDP   +    S +    R  
Sbjct  2674  QLPPPWKLRGNILNYGLGLLSSYFVCDALTILSAGYFYVFDPLGLTGGATSTATSSARFF  2733

Query  102   KFVGRRILEQFPDQFSPF  49
               +G  ++E+F DQF P 
Sbjct  2734  SLIGNDLVERFRDQFLPM  2751


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  LPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
            LP +S ++PG RI +V    L  + DQ SP+  FGCD++ PF+GTLF
Sbjct  7    LPNVSAANPGKRIDYVSSTALTLYSDQLSPYRAFGCDMKVPFQGTLF  53



>ref|XP_006286874.1| hypothetical protein CARUB_v10000018mg [Capsella rubella]
 gb|EOA19772.1| hypothetical protein CARUB_v10000018mg [Capsella rubella]
Length=4672

 Score =   459 bits (1180),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 224/285 (79%), Positives = 253/285 (89%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdss--ngSAMALHAK  676
             AQ L++ QF  D++ +YLPDVS RLF ++DLVYNDAPWL  SD  +SS    S M L+AK
Sbjct  1276  AQQLAEAQFL-DKVTLYLPDVSGRLFPSSDLVYNDAPWLTASDTGNSSFNAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISN+VAEKLGVRS RR+LLAESADSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTMQKFVHGNISNEVAEKLGVRSLRRVLLAESADSMNFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMADWQGPALYCFNNS+
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDKTHYGTSSLLSPEMADWQGPALYCFNNSI  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRNILDQFPDQFAPFLHFGCDLEHTFPGTLF  1559


 Score =   205 bits (521),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 127/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +G+ S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVRLCLDRRVHGSGSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI +VG   L Q+ DQF P+  FGCD+++PF GTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDYVGSSALSQYKDQFLPYCAFGCDMKSPFHGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score =   100 bits (250),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 126/259 (49%), Gaps = 31/259 (12%)
 Frame = -1

Query  816   DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISN  637
             D+  + +PD +  L    DLVYNDAPW+            + +L  K    RFVH +I+N
Sbjct  2707  DKNSVLVPDSAGFLVPLEDLVYNDAPWV-----------DSSSLSGK----RFVHPSINN  2751

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             D+A +LG++S R + L ++  + +L                T+L+ +L +Y     +LF+
Sbjct  2752  DMANRLGIQSLRCISLVDNDITQDLPCME-----------FTKLKELLSLYGSKDFLLFD  2800

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRI  280
             L++ A+     K+ F+ DK ++   ++L   + ++QGPAL   F     + +D+  +  +
Sbjct  2801  LLELADCCRVKKLHFIFDKREHSCKTLLQHNLGEFQGPALVAIFEGVTLTREDVCNLQLL  2860

Query  279   GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
              Q     +      +GLG  S Y   D+ + VSG    MFDP   +L   +   P  ++ 
Sbjct  2861  SQWRVKGETL---NYGLGLLSCYFMCDLLSIVSGGYFYMFDPQGATLSASTTQAPAAKMF  2917

Query  102   KFVGRRILEQFPDQFSPFL  46
               +G  ++E+F DQF P L
Sbjct  2918  SLIGTNLVERFSDQFIPML  2936



>ref|XP_006847865.1| hypothetical protein AMTR_s00029p00083380 [Amborella trichopoda]
 gb|ERN09446.1| hypothetical protein AMTR_s00029p00083380 [Amborella trichopoda]
Length=4752

 Score =   456 bits (1172),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/283 (77%), Positives = 252/283 (89%), Gaps = 0/283 (0%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QH++++QF + ++ I+LPDVS RLF A DLVYNDAPWLLDS++  + N S + L  ++ 
Sbjct  1283  VQHMAELQFPDQEMLIFLPDVSSRLFPAKDLVYNDAPWLLDSENGGAQNISKVYLAPRRK  1342

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +Q+FVHGNISNDV E+LGVRS R +LLAESADSMNL LS AAEAFGQHE+LTTRLRHI+E
Sbjct  1343  VQKFVHGNISNDVVERLGVRSLRGLLLAESADSMNLGLSEAAEAFGQHEALTTRLRHIVE  1402

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             MYADGPG+L+ELVQNA+DA A++V+FLLDK+QYGTSS+LSPEMADWQG ALYC+NNSVFS
Sbjct  1403  MYADGPGILYELVQNADDARATEVSFLLDKTQYGTSSILSPEMADWQGCALYCYNNSVFS  1462

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
               DLYAISRIGQ+SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LPGI
Sbjct  1463  QHDLYAISRIGQDSKLEKPFAIGRFGLGFNCVYHFTDIPCFVSGENIVMFDPHASYLPGI  1522

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRIKFVGR ILEQFPDQFSPFLHFGCDL++PF GT+F
Sbjct  1523  SPSHPGLRIKFVGRGILEQFPDQFSPFLHFGCDLKDPFPGTIF  1565


 Score =   196 bits (497),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A KV   LD   +G  S+LS +
Sbjct  12   EDFGQKVDLTRRIREVLANYPEGTTVLKELIQNADDAGAKKVCLCLDHRSHGVDSLLSSK  71

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A+WQGPAL  +N++ F+  D  +ISRIG   KL + +  GRFG+GFNSVYH TD+P+FV
Sbjct  72   LAEWQGPALLAYNDAEFTEDDFVSISRIGGSKKLGQAWKTGRFGVGFNSVYHLTDLPSFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG R+ +V    +    DQFSP+  FGCD++ PF GTL
Sbjct  132  SGKYVVLFDPQGNYLPNVSAANPGKRLNYVTSAAIVHHKDQFSPYCAFGCDMKVPFHGTL  191

Query  3    F  1
            F
Sbjct  192  F  192


 Score = 89.7 bits (221),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/272 (27%), Positives = 127/272 (47%), Gaps = 40/272 (15%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             + +PD S  L    D+VYNDAPW+                 +    + FVH +ISND+A 
Sbjct  2735  LLIPDSSGVLVCGADVVYNDAPWME---------------KSSFNTKHFVHSSISNDLAN  2779

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LG++S R + L +   + +L                +++  ++ +Y     +LF+L++ 
Sbjct  2780  RLGIQSLRYLSLVDEEMTKDLPCME-----------YSKICDLMALYGQDDLLLFDLLEL  2828

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQES  268
             A+   A K+  + DK ++   S+L P + ++QGPAL      ++ S +++  +       
Sbjct  2829  ADCCQARKLHVIFDKREHPRLSLLHPSLGEFQGPALVVVLEGAILSTEEISNL-------  2881

Query  267   KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
             +L  P+ +      +GLG  S Y   D+P+ +S     MFDP   +L   S   P  +I 
Sbjct  2882  QLLPPWKLRGTTLNYGLGLLSCYQICDLPSIISDGCFYMFDPLGLALSAPSNHVPCAKIY  2941

Query  102   KFVGRRILEQFPDQFSPFLHFGCDLQNPFRGT  7
                G  ++E+F DQF P L  G D+     G+
Sbjct  2942  SLNGANLMERFRDQFHPLL-IGQDVACSLSGS  2972



>emb|CDY02207.1| BnaA03g39600D [Brassica napus]
Length=4340

 Score =   455 bits (1171),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 222/285 (78%), Positives = 251/285 (88%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsdd--pdssngSAMALHAK  676
             AQ L++ QF  D++ IYLPDVS RLF ++DLVYNDAPWL  SD+     S  S M L+AK
Sbjct  1276  AQQLAESQFL-DKVTIYLPDVSGRLFPSSDLVYNDAPWLTASDNHNSSFSAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGN+SN+VAEKLG RS RR+LLAESADSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTMQKFVHGNLSNEVAEKLGARSLRRVLLAESADSMNFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLD++ YGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDRTHYGTSSLLSPEMADWQGPALYCFNNSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQGSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRNILDQFPDQFAPFLHFGCDLEHTFPGTLF  1559


 Score =   204 bits (519),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A++V   LD+   GT S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATRVRLCLDRRANGTDSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI FVG   L  + DQF P+  FGCD++ PF+GTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDFVGSSALSHYEDQFLPYCAFGCDMKTPFQGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 127/259 (49%), Gaps = 31/259 (12%)
 Frame = -1

Query  816   DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISN  637
             D+  + +PD +  L    DLVYNDAPW+            + +L  K    RFVH +ISN
Sbjct  2707  DRNLVLVPDSAGLLVPLDDLVYNDAPWV-----------DSSSLSGK----RFVHPSISN  2751

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             D+A KLG++S R + L ++  + +L                T+L  +L +Y     +LF+
Sbjct  2752  DMANKLGIQSLRCISLVDNDITQDLPCME-----------FTKLNELLSLYGSKDFLLFD  2800

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRI  280
             L++ A+     K+  + DK ++   S+L   + ++QGPAL      +  + +++ ++  +
Sbjct  2801  LLELADCCKVKKLHIIFDKREHSRKSLLQHNLGEFQGPALLAILEGATLTREEVCSLQLL  2860

Query  279   GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
              Q     +      +GLG  S +   D+ + VSG N  MFDP   +L   +   P  ++ 
Sbjct  2861  SQWRVKGETL---NYGLGLLSCFFMCDLLSIVSGGNFYMFDPQGATLSASTTQAPAAKMF  2917

Query  102   KFVGRRILEQFPDQFSPFL  46
               +G  ++E+F DQF+P L
Sbjct  2918  SLIGTNLVERFSDQFNPML  2936



>ref|XP_006394579.1| hypothetical protein EUTSA_v10003499mg [Eutrema salsugineum]
 gb|ESQ31865.1| hypothetical protein EUTSA_v10003499mg [Eutrema salsugineum]
Length=4706

 Score =   455 bits (1171),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 222/285 (78%), Positives = 250/285 (88%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsdd--pdssngSAMALHAK  676
             AQ L++ QF  D++ IYLPDVS RLF ++DLVYNDAPWL  SD+     S  S M L+AK
Sbjct  1276  AQQLAEAQFL-DRVTIYLPDVSGRLFPSSDLVYNDAPWLTASDNHNSSFSAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T Q+FVHGNISN+VAEKLGVRS RR+LLAESADSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTTQKFVHGNISNEVAEKLGVRSLRRVLLAESADSMNFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLD++ YGTSS+LSPEMADWQGPALYCFN+SV
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDRTHYGTSSLLSPEMADWQGPALYCFNDSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQASKLEKPFAIGRFGLGFNCVYHFTDIPAFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLH GCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRNILDQFPDQFAPFLHLGCDLEHTFPGTLF  1559


 Score =   209 bits (531),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 128/181 (71%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A++V   LD+  +G+ S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATRVRLCLDRRVHGSGSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI FVG   L Q+ DQF+P+  FGCD++NPF GTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDFVGSSALSQYEDQFTPYCTFGCDMKNPFHGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score =   104 bits (260),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/259 (28%), Positives = 124/259 (48%), Gaps = 31/259 (12%)
 Frame = -1

Query  816   DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISN  637
             D+  + +PD+S  L    DLVYNDAPW+            + +L  K    RFVH +I+N
Sbjct  2707  DKNLLLVPDISGLLVPLEDLVYNDAPWV-----------DSSSLSGK----RFVHPSINN  2751

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             D+A +LG++S R + L ++  + +L                T+L  +L +Y     + F+
Sbjct  2752  DMANRLGIQSLRCISLVDNDITQDLPCME-----------FTKLNELLSLYGSKDFLFFD  2800

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRI  280
             L++ A+     K+  + DK ++   S+L   + ++QGPAL      +  + +++ ++  +
Sbjct  2801  LLELADCCRVKKLHIIFDKREHSRKSLLQHNLGEFQGPALVAILEGATLTREEVCSLQLL  2860

Query  279   GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHP-GLRI  103
              Q     +      +GLG  S Y   D+   VSG    MFDP   +L   +   P G   
Sbjct  2861  SQWRVKGETL---NYGLGLLSCYFMCDLLYIVSGGYFYMFDPRGATLSASTTQAPAGKMF  2917

Query  102   KFVGRRILEQFPDQFSPFL  46
               +G  ++E+F DQF+P L
Sbjct  2918  SLIGTNLVERFTDQFNPML  2936



>ref|XP_009136390.1| PREDICTED: sacsin [Brassica rapa]
Length=4690

 Score =   455 bits (1170),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 222/285 (78%), Positives = 251/285 (88%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsdd--pdssngSAMALHAK  676
             AQ L++ QF  D++ IYLPDVS RLF ++DLVYNDAPWL  SD+     S  S M L+AK
Sbjct  1276  AQQLAESQFL-DKVTIYLPDVSGRLFPSSDLVYNDAPWLTASDNHNSSFSADSTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGN+SN+VAEKLG RS RR+LLAESADSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTMQKFVHGNLSNEVAEKLGARSLRRVLLAESADSMNFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLD++ YGTSS+LSPEMADWQGPALYCFNNSV
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDRTHYGTSSLLSPEMADWQGPALYCFNNSV  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKPFAIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQGSKLEKPFAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRNILDQFPDQFAPFLHFGCDLEHTFPGTLF  1559


 Score =   204 bits (518),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A++V   LD+   GT S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATRVRLCLDRRANGTDSLLSES  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI FVG   L  + DQF P+  FGCD++ PF+GTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDFVGSSALSHYEDQFLPYCAFGCDMKTPFQGTL  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 127/259 (49%), Gaps = 31/259 (12%)
 Frame = -1

Query  816   DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISN  637
             D+  + +PD +  L    DLVYNDAPW+            + +L  K    RFVH +ISN
Sbjct  2706  DRNLVLVPDSAGLLVPLDDLVYNDAPWV-----------DSSSLSGK----RFVHPSISN  2750

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             D+A KLG++S R + L ++  + +L                T+L  +L +Y     +LF+
Sbjct  2751  DMANKLGIQSLRCISLVDNDITQDLPCME-----------FTKLNELLSLYGSKDFLLFD  2799

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRI  280
             L++ A+     K+  + DK ++   S+L   + ++QGPAL      +  + +++ ++  +
Sbjct  2800  LLELADCCKVKKLHIIFDKREHSRKSLLQHNLGEFQGPALLAILEGATLTREEVCSLQLL  2859

Query  279   GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI-  103
              Q     +      +GLG  S +   D+ + VSG N  MFDP   +L   +   P  ++ 
Sbjct  2860  SQWRVKGETL---NYGLGLLSCFFMCDLLSIVSGGNFYMFDPQGATLSASTTQAPAAKMF  2916

Query  102   KFVGRRILEQFPDQFSPFL  46
               +G  ++E+F DQF+P L
Sbjct  2917  SLIGTNLVERFSDQFNPML  2935



>gb|KFK27634.1| hypothetical protein AALP_AA8G408700 [Arabis alpina]
Length=4715

 Score =   455 bits (1170),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 222/285 (78%), Positives = 250/285 (88%), Gaps = 3/285 (1%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsdd--pdssngSAMALHAK  676
             AQ L++ QF  D++ IYLPDVS RL  ++DLVYNDAPWL  SD+     S  S M L+AK
Sbjct  1276  AQQLAEAQFL-DKVTIYLPDVSGRLVPSSDLVYNDAPWLTASDNHNSSFSAESTMLLNAK  1334

Query  675   QTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHI  496
             +T+Q+FVHGNISN+VAEKLGVRS RR+LLAESADSMN SLSGAAEAFGQHE+LTTRL+HI
Sbjct  1335  RTMQKFVHGNISNEVAEKLGVRSLRRVLLAESADSMNFSLSGAAEAFGQHEALTTRLKHI  1394

Query  495   LEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV  316
             LEMYADGPG+LFELVQNAEDA AS+V FLLDK+ YGTSS+LSPEMADWQGPALYCFNNS+
Sbjct  1395  LEMYADGPGILFELVQNAEDAGASEVTFLLDKTHYGTSSLLSPEMADWQGPALYCFNNSI  1454

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
             F+ QD+YAISRIGQ SKLEKP AIGRFGLGFN VYHFTDIP FVSGEN+VMFDPHA  LP
Sbjct  1455  FTQQDMYAISRIGQASKLEKPLAIGRFGLGFNCVYHFTDIPGFVSGENIVMFDPHANHLP  1514

Query  135   GISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             GISP+HPGLRIKF GR IL+QFPDQF+PFLHFGCDL++ F GTLF
Sbjct  1515  GISPTHPGLRIKFAGRNILDQFPDQFAPFLHFGCDLEHTFPGTLF  1559


 Score =   200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 126/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A++V   LD+  +G+ S++S  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATRVRLCLDRRVHGSGSLISDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI FVG   L Q+ DQF P+  FGCD+++ F GT+
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDFVGSSALSQYEDQFVPYCAFGCDMKSSFDGTI  186

Query  3    F  1
            F
Sbjct  187  F  187


 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/259 (28%), Positives = 126/259 (49%), Gaps = 31/259 (12%)
 Frame = -1

Query  816   DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISN  637
             D+  + +PD +  L    DLVYNDAPW+            + +L  K    RFVH +I+N
Sbjct  2707  DKDSVLVPDSAGFLVPLEDLVYNDAPWV-----------DSSSLSGK----RFVHPSINN  2751

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             D+A +LG++S R + L ++  + +L                T+L+ +L +Y     +LF+
Sbjct  2752  DMANRLGIQSLRCISLVDNDITQDLPCME-----------FTKLKELLSLYGSKDFLLFD  2800

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-FSPQDLYAISRI  280
             L++ A+     K+  + DK ++   S+L   + ++QGPAL      V  + +++ ++  +
Sbjct  2801  LLELADCCRVRKLHIIFDKREHSRKSLLQHNLGEFQGPALVAILEGVTLTREEVCSLQLL  2860

Query  279   GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHP-GLRI  103
              Q     +      +GLG  S Y   D+ + +SG    MFDP   +L   +   P G   
Sbjct  2861  SQWRVKGETL---NYGLGLLSCYFMCDLLSILSGGYFYMFDPQGATLSASTTQAPAGKMF  2917

Query  102   KFVGRRILEQFPDQFSPFL  46
               +G  ++E+F DQF+P L
Sbjct  2918  SLIGTNLIERFSDQFNPML  2936



>gb|KDP43312.1| hypothetical protein JCGZ_24233 [Jatropha curcas]
Length=3429

 Score =   435 bits (1118),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 204/231 (88%), Positives = 221/231 (96%), Gaps = 0/231 (0%)
 Frame = -1

Query  693  MALHAKQTIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLT  514
            MAL+AK+T+Q+FVHGNISN+VA+KLGV S RR+LLAESADSMN  LSGAAEAFGQHE+LT
Sbjct  1    MALNAKRTVQKFVHGNISNEVADKLGVCSLRRILLAESADSMNFGLSGAAEAFGQHEALT  60

Query  513  TRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALY  334
            TRL+HILEMYADGPG+LFELVQNAEDA AS+V FLLDK+QYGTSSVLSPEMADWQGPALY
Sbjct  61   TRLKHILEMYADGPGILFELVQNAEDAGASEVIFLLDKTQYGTSSVLSPEMADWQGPALY  120

Query  333  CFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDP  154
            CFN+SVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFN VYH TDIPTFVSGEN+VMFDP
Sbjct  121  CFNDSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNCVYHLTDIPTFVSGENIVMFDP  180

Query  153  HACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
            HA +LPGISPSHPGLRIKFVGR+ILEQFPDQFSPFLHFGCDLQ+PF GTLF
Sbjct  181  HANNLPGISPSHPGLRIKFVGRKILEQFPDQFSPFLHFGCDLQHPFPGTLF  231


 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 141/287 (49%), Gaps = 42/287 (15%)
 Frame = -1

Query  840   LSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQR  661
             L D         + +P+ S  L ++ DLVYNDAPW+              AL  K     
Sbjct  1387  LDDSMLEASSTSLLMPNSSGVLMHSGDLVYNDAPWM-----------ENSALVGKD----  1431

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             FVH +ISND+A +LGV+S R + L +  + MN  L     A         ++  +LE+Y 
Sbjct  1432  FVHPSISNDLANRLGVKSLRCLALVD--EDMNKDLPCMDFA---------KISDLLELYG  1480

Query  480   DGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQD  301
             +   +LF+L++ A+   A ++   LDK ++   S+L P + ++QGPAL    + V     
Sbjct  1481  NNDFLLFDLLELADCCKAKRLHLTLDKREHPRQSLLQPNLGEFQGPALVAILDGV-----  1535

Query  300   LYAISRIGQES-KLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP  136
               +++R    S +L  P+ +      +GLG  S Y   D+ + +SG +  MFDP   +L 
Sbjct  1536  --SLTREEVSSLQLLPPWRLRGNTLNYGLGLLSCYFVCDLLSIISGGHFYMFDPCGLAL-  1592

Query  135   GISPSH-PGLRI-KFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             G+  SH P  ++   +G  + E+F DQF P L  G ++ + F  T+ 
Sbjct  1593  GVPSSHTPAAKVFSLIGTNLTERFCDQFDPMLA-GENMSSSFDSTII  1638



>ref|XP_001765706.1| predicted protein [Physcomitrella patens]
 gb|EDQ69545.1| predicted protein [Physcomitrella patens]
Length=4642

 Score =   395 bits (1015),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 190/282 (67%), Positives = 228/282 (81%), Gaps = 2/282 (1%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             QHL+D+ F   ++  ++PD +  L  A +LVYNDAPWL +S+     N +      +   
Sbjct  1271  QHLADLHFNSQEVVAFVPDSNSVLVPALELVYNDAPWLHNSEGSIGGNLTGPTKSVRGP-  1329

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
              RFVH  IS DVAE+LGVRS RRMLLAESADSM+L L  AAEAFGQHE+LTTRL+HI+EM
Sbjct  1330  -RFVHAKISTDVAERLGVRSLRRMLLAESADSMDLGLHDAAEAFGQHEALTTRLKHIVEM  1388

Query  486   YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
             Y+DGPG+L ELVQNA+DA A +V FLLD+S++GTSSVLSP MADWQGPALYC N+SVF+ 
Sbjct  1389  YSDGPGILCELVQNADDAGAREVNFLLDRSEFGTSSVLSPSMADWQGPALYCQNDSVFTS  1448

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGIS  127
             +DLYAISRIGQ+SKLE+P AIGRFGLGFNSVYHFTDIP F+SG N+VMFDPHAC+LPG++
Sbjct  1449  RDLYAISRIGQDSKLERPSAIGRFGLGFNSVYHFTDIPGFISGSNLVMFDPHACNLPGVT  1508

Query  126   PSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             PSHPGL+I FVGR +LEQFPDQ  P+L FGCDLQ  + GTLF
Sbjct  1509  PSHPGLKISFVGRGLLEQFPDQLRPYLIFGCDLQRSYPGTLF  1550


 Score =   207 bits (526),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = -1

Query  552  GAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVL  373
            G AE FGQ   LT R+R +L  Y +G  +L EL+QNA+DA A++V+F LD+ ++GT+S+ 
Sbjct  7    GFAEDFGQKVDLTQRIREVLANYPEGTTILKELIQNADDAGATRVSFCLDRRRHGTNSLA  66

Query  372  SPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIP  193
               +A+WQGPAL  FNN+ F  +D  +ISRIG   K  + +  GRFG+GFNSVYH +D+P
Sbjct  67   YGPLAEWQGPALLAFNNATFVEEDFVSISRIGDSKKRGQAWKTGRFGVGFNSVYHLSDLP  126

Query  192  TFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFR  13
            +FVSG  VVMFDPH   LP +S ++PG RI FV    L+ + DQFSP+  FGCD+++P+ 
Sbjct  127  SFVSGRYVVMFDPHCKFLPRVSSANPGKRIDFVSTGALKMYRDQFSPYCAFGCDMESPYP  186

Query  12   GTLF  1
            GTLF
Sbjct  187  GTLF  190


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 125/266 (47%), Gaps = 35/266 (13%)
 Frame = -1

Query  834   DVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFV  655
             +V+ +     + +PD +  L  A DL+YNDAPWL              +      ++R V
Sbjct  2675  NVEAHSILASVVMPDDTGILALAKDLIYNDAPWL------------TKSASGMTGMRRLV  2722

Query  654   HGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADG  475
             H +I N++AE+LG +S R + L +   + NL               T+ +  IL    + 
Sbjct  2723  HPDIDNELAERLGAKSLRYLSLVDQEMTSNLPCPD-----------TSTISDILSERENR  2771

Query  474   PGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA-DWQGPAL-YCFNNSVFSPQD  301
               ++F+L++ A+   A KV F+ DK ++   S+L P +   +QGPAL   F  +V + ++
Sbjct  2772  SLLMFDLLEIADCCKARKVHFMYDKREHPRQSLLQPNLGCVFQGPALTVAFEGAVLTTEE  2831

Query  300   LYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--IS  127
             + ++ + G  SKL       ++G G    Y+ T++   VS   + +FDP     PG  ++
Sbjct  2832  ICSL-QTGMPSKLRGQSC--QYGTGLLGAYYVTELLFIVSSGCLYLFDP-----PGQVLA  2883

Query  126   PSHPGLRIKFVGRRILEQFPDQFSPF  49
              S    R       + ++F DQF P 
Sbjct  2884  ASPNDARATVSDTDLAQRFSDQFRPL  2909



>ref|XP_002988476.1| hypothetical protein SELMODRAFT_159510 [Selaginella moellendorffii]
 gb|EFJ10566.1| hypothetical protein SELMODRAFT_159510 [Selaginella moellendorffii]
Length=4500

 Score =   370 bits (949),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 178/284 (63%), Positives = 217/284 (76%), Gaps = 18/284 (6%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             QHL+D  F E   +I +PD    L  ++ LVYNDAPWL+                A + I
Sbjct  1259  QHLADTNFGEQGKEIVIPDCDGILLPSSQLVYNDAPWLV----------------ASKDI  1302

Query  666   --QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL  493
               ++ VH  ISNDVAEK+G+ S R  LLA+SAD ++L L G  EAFGQ ESLT+RL+HI+
Sbjct  1303  PNKKLVHSKISNDVAEKVGIASVRESLLAKSADFVDLGLHGGMEAFGQSESLTSRLKHIV  1362

Query  492   EMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVF  313
             EMYADGPG LFEL+QNA+DA A++V+FLLDKS +GT+SVLS +MADWQGPALYC+N+SVF
Sbjct  1363  EMYADGPGTLFELLQNADDAGATEVSFLLDKSSFGTNSVLSRQMADWQGPALYCYNDSVF  1422

Query  312   SPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG  133
              P+D YAISRIGQ SKL+KP AIGRFGLGFNSVYHFTD+P+FVSG  +V+ DPHA +LPG
Sbjct  1423  KPEDFYAISRIGQNSKLDKPSAIGRFGLGFNSVYHFTDVPSFVSGSTIVLLDPHAGNLPG  1482

Query  132   ISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             ISP+ PGL+I FVG+ +L+QFPDQF  FL FGCDLQ PF GTLF
Sbjct  1483  ISPAQPGLKINFVGKELLKQFPDQFESFLLFGCDLQKPFLGTLF  1526


 Score =   205 bits (521),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  +L E++QNA+DA AS+V F +D+ ++   S++SP 
Sbjct  2    EDFGQKVDLTQRIREVLLNYPEGTTILKEMIQNADDAGASQVCFCVDRRRHAVDSLVSPP  61

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +NN+ F+ +D  +ISRIG   K  + +  GRFG+GFNSVYH +D+P+FV
Sbjct  62   LAQWQGPALLAYNNAAFTEEDFQSISRIGDSKKRGQAWKTGRFGIGFNSVYHLSDLPSFV  121

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG +VV FDP    LP +S  +PG RI FV    LE FPDQFSP+  FGCD++ PF GTL
Sbjct  122  SGSHVVFFDPQCQFLPSVSSLNPGKRIDFVASTALENFPDQFSPYCVFGCDMRRPFGGTL  181

Query  3    F  1
            F
Sbjct  182  F  182


 Score = 86.3 bits (212),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 120/275 (44%), Gaps = 42/275 (15%)
 Frame = -1

Query  837   SDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRF  658
             +D   YE    I +PD + +L  A  LVYNDAPWL            A  L       R 
Sbjct  2610  ADRSIYE---SILIPDAASQLVPAKALVYNDAPWL------SEDGSQAGGL-------RL  2653

Query  657   VHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYAD  478
             VH ++ N++A +LG RS R + + +   + +L   G             ++  +L  +  
Sbjct  2654  VHPDVDNNLARQLGARSLRYLSVVDQEMTSSLPCLGIG-----------KINELLAKFGA  2702

Query  477   GPG---VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPA-LYCFNNSVFS  310
             G     +LF+L++ A+   A KV F+ D++ +   S+L P M+D+QGPA L  F     +
Sbjct  2703  GGDEEMLLFDLLEVADCCQARKVHFVYDQTDHPKQSLLQPNMSDFQGPALLVAFEGVNLT  2762

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL-PG  133
              ++   I  +     ++      R+G G    Y  TD+   +S   + +FDP    L P 
Sbjct  2763  TEE---ICSLHTSPPVKFHGRACRYGTGLFGSYQITDLLMVISMGCLYLFDPSGQVLAPA  2819

Query  132   ISPSHP-------GLRIKFVGRRILEQFPDQFSPF  49
             ++           G      G  + E+F DQF PF
Sbjct  2820  LADGRKDPTGNPIGKAFSLQGTGLSERFSDQFHPF  2854



>ref|XP_002978873.1| hypothetical protein SELMODRAFT_152901 [Selaginella moellendorffii]
 gb|EFJ19830.1| hypothetical protein SELMODRAFT_152901 [Selaginella moellendorffii]
Length=4493

 Score =   369 bits (946),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 178/284 (63%), Positives = 216/284 (76%), Gaps = 18/284 (6%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             QHL+D  F E   +I +PD    L  ++ LVYNDAPWL+                A + I
Sbjct  1259  QHLADTNFGEQGKEIVIPDCDGILLPSSQLVYNDAPWLV----------------ASKDI  1302

Query  666   --QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL  493
               ++ VH  ISNDVAEK+G+ S R  LLA+SAD ++L L G  EAFGQ ESLT+RL+HI+
Sbjct  1303  PNKKLVHSKISNDVAEKVGIASVRESLLAKSADFVDLGLHGGMEAFGQSESLTSRLKHIV  1362

Query  492   EMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVF  313
             EMYADGPG LFEL+QNA+DA A++V+FLLDKS +GT+SVLS +MADWQGPALYC+N+SVF
Sbjct  1363  EMYADGPGTLFELLQNADDAGATEVSFLLDKSSFGTNSVLSRQMADWQGPALYCYNDSVF  1422

Query  312   SPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG  133
              P+D YAISRIGQ SKL+KP AIGRFGLGFNSVYHFTD+P+FVSG  +V+ DPHA +LPG
Sbjct  1423  KPEDFYAISRIGQNSKLDKPSAIGRFGLGFNSVYHFTDVPSFVSGSTIVLLDPHADNLPG  1482

Query  132   ISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             ISP+ PGL+I FVG+ +L QFPDQF  FL FGCDLQ PF GTLF
Sbjct  1483  ISPAQPGLKINFVGKELLNQFPDQFESFLLFGCDLQKPFLGTLF  1526


 Score =   206 bits (523),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  +L E++QNA+DA AS+V F +D+ ++   S++SP 
Sbjct  2    EDFGQKVDLTQRIREVLLNYPEGTTILKEMIQNADDAGASQVCFCVDRRRHAVDSLVSPP  61

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +NN+ F+ +D  +ISRIG   K  + +  GRFG+GFNSVYH +D+P+FV
Sbjct  62   LAQWQGPALLAYNNAAFTEEDFQSISRIGDSKKRGQAWKTGRFGIGFNSVYHLSDLPSFV  121

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG +VV FDP    LP IS  +PG RI FV    LE FPDQFSP+  FGCD++ PF GTL
Sbjct  122  SGSHVVFFDPQCQFLPSISSLNPGKRIDFVTSTALENFPDQFSPYCAFGCDMRRPFGGTL  181

Query  3    F  1
            F
Sbjct  182  F  182


 Score = 85.1 bits (209),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 119/275 (43%), Gaps = 42/275 (15%)
 Frame = -1

Query  837   SDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRF  658
             +D   YE    I +PD   +L  A  LVYNDAPWL            A  L       R 
Sbjct  2610  ADRSIYE---SILIPDAVSQLVPAKALVYNDAPWL------SEDGSQAGGL-------RL  2653

Query  657   VHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYAD  478
             VH ++ N++A +LG RS R + + +   + +L   G             ++  +L  +  
Sbjct  2654  VHPDVDNNLARQLGARSLRYLSVVDQEMTSSLPCLGIG-----------KINELLAKFGA  2702

Query  477   GPG---VLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPA-LYCFNNSVFS  310
             G     +LF+L++ A+   A KV F+ D++ +   S+L P M+D+QGPA L  F     +
Sbjct  2703  GGDEEMLLFDLLEVADCCQARKVHFVYDQTDHPKQSLLQPNMSDFQGPALLVAFEGVNLT  2762

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL-PG  133
              ++   I  +     ++      R+G G    Y  TD+   +S   + +FDP    L P 
Sbjct  2763  TEE---ICSLHTSPPVKFHGRACRYGTGLFGSYQITDLLMVISMGCLYLFDPSGQVLAPA  2819

Query  132   ISPSHP-------GLRIKFVGRRILEQFPDQFSPF  49
             ++           G      G  + E+F DQF PF
Sbjct  2820  LADGRKDPTGNPIGKAFSLQGTGLSERFSDQFHPF  2854



>ref|XP_005650565.1| hypothetical protein COCSUDRAFT_46461 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26021.1| hypothetical protein COCSUDRAFT_46461 [Coccomyxa subellipsoidea 
C-169]
Length=5698

 Score =   326 bits (836),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 206/282 (73%), Gaps = 21/282 (7%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q LSD++   D  K+Y+ D    L  A+DLVYNDAPW+                   Q I
Sbjct  1167  QALSDMRVNAD--KLYILDSRSVLAPASDLVYNDAPWV-----------------PDQQI  1207

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
              RFVH  +SN+V+EKLGV+S RRM+LA+SAD++ L L  + EAFGQ E+LTTRL+HI++ 
Sbjct  1208  -RFVHPKLSNEVSEKLGVKSLRRMMLADSADTVPLGLH-SVEAFGQSEALTTRLKHIIDD  1265

Query  486   YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
             YADGPG+L EL+QNA+DA AS+V+FLLD  QYGT+SVL+P MA WQGPAL CFN++VF+P
Sbjct  1266  YADGPGILMELLQNADDAGASEVSFLLDNQQYGTNSVLAPRMAAWQGPALLCFNDAVFTP  1325

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGIS  127
              D   ISRIGQ++K+++P   GRFGLGFN+VYH+TD+P FVSG+ +VMFDPHA  LPG S
Sbjct  1326  SDFRNISRIGQDTKVDRPATTGRFGLGFNAVYHWTDLPAFVSGDYLVMFDPHAKWLPGTS  1385

Query  126   PSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             P+ PGL+I F    +L QFPD F PFLHF C L++ + GTLF
Sbjct  1386  PAQPGLKIAFQRANLLSQFPDAFQPFLHFNCSLRDTYPGTLF  1427


 Score =   181 bits (459),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 117/179 (65%), Gaps = 0/179 (0%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   L  R+R IL  Y +G  VL EL+QNA+DA A+ + F LD+ Q+ T  + +  +A
Sbjct  7    FGQKIDLAVRIRDILHDYPEGTSVLKELIQNADDAGATTIRFCLDERQHKTDRLAAQSLA  66

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSG  178
             +QGPAL  +N++VFS  D  +IS IGQ  K E+    GRFG+GFN+ YH +D+ +F+SG
Sbjct  67   SFQGPALLAYNDAVFSEADFQSISSIGQSVKREQKGKTGRFGVGFNASYHLSDVVSFISG  126

Query  177  ENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
              +V+FDPH   LP I+P +PG RI FV        PDQF+P+  FGCD ++ FRGT+F
Sbjct  127  SQLVIFDPHCTYLPNITPQNPGKRIDFVQSSAAAAHPDQFAPYQAFGCDAKSYFRGTIF  185


 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 113/260 (43%), Gaps = 37/260 (14%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +++LPD    +  A  + ++DAPWL                      QR VH +I NDVA
Sbjct  2541  QVWLPDSEGVMALARHIFFDDAPWLAGGG------------------QRLVHRDIPNDVA  2582

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             E LG +S R      +  + +L  + A+       +    + H           L ++ +
Sbjct  2583  EALGCQSLRYHHQVNTRMTADLPCAPASMIAPLLTAAAEDMAH----------ALLDIAE  2632

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSPQDLYAISRIGQE  271
              A+   A  +   LD  Q+G  S+L P +AD+QGPA+       V S ++L  +   G  
Sbjct  2633  LADAVGAETMEVTLDYRQHGVESLLLPGLADFQGPAICITLPGVVLSREELCQLQCPGTP  2692

Query  270   SKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGL----RI  103
              ++       R G G  S Y+ TD+P  +SG+++ ++DPH   L        G     + 
Sbjct  2693  YRVRGRNC--RCGTGLLSSYNLTDLPMAISGDSLYIWDPHGHHLSASGKKGTGASAAKQY  2750

Query  102   KFVGRR--ILEQFPDQFSPF  49
             + VG    ++ +F DQFS +
Sbjct  2751  QHVGGESDLVARFADQFSAW  2770



>ref|XP_002953889.1| hypothetical protein VOLCADRAFT_118510 [Volvox carteri f. nagariensis]
 gb|EFJ44918.1| hypothetical protein VOLCADRAFT_118510 [Volvox carteri f. nagariensis]
Length=5796

 Score =   306 bits (784),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 156/283 (55%), Positives = 188/283 (66%), Gaps = 15/283 (5%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
             AQ L+D+      I IYLPD    L  A DL +NDAPWL              A      
Sbjct  1653  AQALADLTLPAGAI-IYLPDERGVLARAGDLAFNDAPWL--------------AGQPSAA  1697

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
               R VH  IS  VA +LG  S RR+LLA SAD M L   G AEAFGQ E+LTTRLRHI+ 
Sbjct  1698  SVRLVHPRISAHVAARLGTPSLRRLLLAASADCMALGTVGGAEAFGQSEALTTRLRHIIA  1757

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
              Y +GPGVL EL+QNA+DA A+ +  LLD + Y  SS+LSP MA WQGPAL   N++VFS
Sbjct  1758  DYPEGPGVLMELLQNADDAGATSLELLLDDTTYPASSILSPAMAVWQGPALLVANDAVFS  1817

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             P D   ISRIGQ+SK  +P +IGRFGLGFN+VYHFTD+P FVSG+ +VMFDPHA  LPG+
Sbjct  1818  PADFANISRIGQDSKASRPTSIGRFGLGFNAVYHFTDLPCFVSGDYLVMFDPHAKYLPGV  1877

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             S + PGL+I F   ++L+QFPD F+PF H GC++Q  F GTLF
Sbjct  1878  SAAQPGLKIAFARAQLLQQFPDAFTPFTHLGCNMQERFMGTLF  1920


 Score =   177 bits (450),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 119/176 (68%), Gaps = 2/176 (1%)
 Frame = -1

Query  549  AAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLS  370
            A + FGQ   LT R+R IL  Y +G  +L ELVQNA+DA A+ + F LD  Q+GT S+LS
Sbjct  5    AWQDFGQKVDLTARIREILLNYPEGTSILKELVQNADDARATCIKFCLDCRQHGTRSLLS  64

Query  369  PEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPT  190
            P MA +QGPAL  FN+ VFS +DL +ISRIG   K ++    GRFG+GFNS YH TD+P+
Sbjct  65   PAMAPFQGPALLAFNDGVFSDRDLESISRIGDSKKKDEEGKTGRFGVGFNSCYHLTDVPS  124

Query  189  FVSGENVVMFDPHACSLPGISPSHPGLRIKFVG-RRILEQFPDQFSPFL-HFGCDL  28
            FVSG ++V+FDPH   LP IS ++PG RI FV    +  Q+ DQ +P+   FGC L
Sbjct  125  FVSGRHLVIFDPHCRHLPNISSTNPGKRIDFVQYGDVAAQYADQVAPYAGAFGCTL  180


 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 60/234 (26%), Positives = 94/234 (40%), Gaps = 40/234 (17%)
 Frame = -1

Query  801   YLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEK  622
             ++PD +  +    +L +NDA WL              A H +       HG +    AE 
Sbjct  3409  FVPDAAAVMTPGPELFFNDAEWL-------------DARHVQ-----MAHGALPQTTAEA  3450

Query  621   LGVRSFRRMLLAESA--------------DSMNLSLSGAAEAFGQHESLTTRLRHILEMY  484
             LGVRS R     E+               + + L+ + A+E  G  +             
Sbjct  3451  LGVRSLRYAHEVEAQLTAALPCPSPGELRERLGLAAAQASEGRGVADPSGASAAGASAGE  3510

Query  483   ADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL-YCFNNSVFSP  307
             A     LFEL++ A+      V  +LD  Q+   S+L P +A +QGPAL       V S 
Sbjct  3511  AAAATFLFELLEVADALGLRGVRLVLDVRQHPAQSLLQPALAAFQGPALCVVLPEVVLST  3570

Query  306   QDLYAISRIGQESKLEKPFAIGR---FGLGFNSVYHFTDIPTFVSGENVVMFDP  154
             +++  +      S+ + P   GR   +  G  S +  ++I   VSG+   MFDP
Sbjct  3571  EEVAGL----LCSRAQPPSIRGRVAAYSAGLQSAFLVSEILQVVSGDTTYMFDP  3620



>gb|EWM29613.1| Ubiquitin-associated/translation elongation factor EF1B [Nannochloropsis 
gaditana]
Length=5587

 Score =   299 bits (765),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 194/283 (69%), Gaps = 14/283 (5%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q LSD        +I+ PD   +L  ATDLVY+DAPWL            +  +  +  I
Sbjct  1592  QRLSDEIIQVSDWEIFAPDEGGKLARATDLVYDDAPWL------------SKKIQRRPDI  1639

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGA-AEAFGQHESLTTRLRHILE  490
              R+ H  IS+   EKLG+RS RR+L+   AD+M+  LSGA AEAFGQ E+LT+RLRHILE
Sbjct  1640  -RYAHPKISSVTGEKLGIRSVRRLLMETHADTMDFGLSGAEAEAFGQSEALTSRLRHILE  1698

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             +Y +GP +L EL+QNA+DA AS V  L  + +YGTSS+L  +MADWQGPALY +N+++FS
Sbjct  1699  LYPEGPSILSELIQNADDAGASTVRVLYSERRYGTSSLLGQKMADWQGPALYFYNDAIFS  1758

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQD   I+RIGQ SKL+K  + GRFGLG N+VYH TD+P+FVSGE++V+FDPH   LPG 
Sbjct  1759  PQDFQNIARIGQASKLDKQNSTGRFGLGVNAVYHSTDLPSFVSGEHLVIFDPHVKFLPGA  1818

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             +   PG++I+FV   +L QFP QF P+  FGC LQ  F GTLF
Sbjct  1819  TRQQPGIKIRFVDTDLLSQFPHQFEPYTVFGCTLQQTFSGTLF  1861


 Score =   172 bits (435),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 121/192 (63%), Gaps = 13/192 (7%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  EL+QNA+DA A +V  +LD  Q+ T  + SP MA
Sbjct  8    FGQKVDLTARIREILRNYPEGTSIFKELLQNADDAGAREVRLVLDTRQHPTDRLASPSMA  67

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKP--FAIGRFGLGFNSVYHFTDIPTFV  184
              QGPAL C+N++ FS  D  +I RIG   K  +      GRFG G+N++YH T++P FV
Sbjct  68   SLQGPALLCWNDAEFSDLDFESIQRIGDSLKRAESQGAKTGRFGQGYNAIYHLTEVPIFV  127

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL------  28
            SG+N+VMFDP A  LP ++P++PG  I F+  R++LE +PDQF PF   +GC++      
Sbjct  128  SGQNIVMFDPQASYLPNVNPANPGKMIDFIKHRQVLEAYPDQFLPFQGIYGCNIVKGGDD  187

Query  27   ---QNPFRGTLF  1
                +P+R TLF
Sbjct  188  NKSGSPYRATLF  199


 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 76/171 (44%), Gaps = 24/171 (14%)
 Frame = -1

Query  825   FYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGN  646
               ED + +Y P     +    +L + DAPWLL             A+   Q   +FVHG 
Sbjct  3225  LQEDGVTVYAPAEDGTMHRIDELCFGDAPWLLA------------AMPQGQINLKFVHGG  3272

Query  645   ISNDVAEKLGVRSFRRMLLA--------ESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
             +  D+A  LG RS R  LLA          A S ++ LS    A         R R   E
Sbjct  3273  VKKDIARSLGARSLREALLAIQGVMASIPCACSQDI-LSILTPALLHASQDEGRSRITAE  3331

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPAL  337
             +   G   + +LV+ A+D    ++  LLD+ ++   S+L P +A+ QGPAL
Sbjct  3332  L---GYQAIMDLVELADDVGCPELEMLLDEREHKKESLLHPRLAETQGPAL  3379



>ref|XP_002509303.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70561.1| predicted protein [Micromonas sp. RCC299]
Length=5379

 Score =   292 bits (748),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/280 (50%), Positives = 194/280 (69%), Gaps = 18/280 (6%)
 Frame = -1

Query  837   SDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRF  658
             SD     +   + +PD S  L  A+++ +NDAPWL                 A     R 
Sbjct  1403  SDDAVGSEGSSLPVPDASGALVPASEVRFNDAPWL-----------------APPEGVRL  1445

Query  657   VHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYAD  478
              H  + +  AE +GVRS R  LLAE+++ +++ L G+AEAFGQHE+LTTRL+HIL+ YAD
Sbjct  1446  SHPKLPSQTAEAVGVRSLRLALLAEASEDIDVQLHGSAEAFGQHEALTTRLKHILDAYAD  1505

Query  477   GPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDL  298
             GPGV+ ELVQNA+DA A++V  LLD+++ G  S+L P+MA WQGPAL  +N++VFSP+D 
Sbjct  1506  GPGVVSELVQNADDAGATEVRLLLDQTRGGDKSLLGPKMARWQGPALVAWNDAVFSPEDF  1565

Query  297   YAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSH  118
             + I+RIGQ+SK+++P A GRFGLGFN+VYHFTD+P+FVSG+ +VMFDPHA  LPG +P+ 
Sbjct  1566  HNIARIGQDSKIDRPAAAGRFGLGFNAVYHFTDLPSFVSGDYLVMFDPHATHLPGATPAR  1625

Query  117   PGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGL+I F    +L QFPDQF+ ++  FGCDL   +  T+F
Sbjct  1626  PGLKIAFGASPLLSQFPDQFAGYIDTFGCDLTASYPATMF  1665


 Score =   181 bits (459),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 116/179 (65%), Gaps = 0/179 (0%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT RLR IL  Y +G  +L ELVQNA+DA A  V   LD+  +GT ++    +A
Sbjct  13   FGQKVDLTARLREILLNYPEGTSILKELVQNADDAGARTVKVCLDERSHGTETLAYDGLA  72

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSG  178
             +QGP+L  FN+S F   D  +ISRIG   K  +    GRFG+GFNSVYH TD+P+FVSG
Sbjct  73   QFQGPSLLVFNDSTFKESDFESISRIGDSVKRTQVGKTGRFGVGFNSVYHLTDMPSFVSG  132

Query  177  ENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             + V FDPH   LP ++ ++PG R+ FV   +  + PDQ++PF+ FGCD++  F GT+F
Sbjct  133  RHAVFFDPHCEFLPNVTAANPGKRVDFVANDVFSRHPDQWAPFVAFGCDVRGEFAGTMF  191


 Score = 85.9 bits (211),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 113/260 (43%), Gaps = 32/260 (12%)
 Frame = -1

Query  798   LPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEKL  619
             LPD    +  A +LV NDA WLL+               A+ TI R VH ++S   AE L
Sbjct  3038  LPDHVGVMAPAAELVNNDADWLLE--------------GARGTI-RLVHPSVSQATAEVL  3082

Query  618   GVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAE  439
             G RS R M   +   +  L    A             LR +L MY D    L ++ + A+
Sbjct  3083  GARSLRDMFAVDKRSTDRLPCPSA-----------QTLRRLLPMYNDSAFFLADVAEVAD  3131

Query  438   DANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYC-FNNSVFSPQDLYAISRIGQESKL  262
              A A  +   LD + Y   S+L P++A +QGPA+   F  +   P+++  +       KL
Sbjct  3132  AAGARGIEVALDANTYPARSLLLPQLAAFQGPAVTVKFTGAPLQPEEIAQLLSAAAPFKL  3191

Query  261   EKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIK---FVG  91
              +   + RFG G  +  H TD    VS   + +FDP   +L G          K     G
Sbjct  3192  RR--RVVRFGNGLVTACHVTDAVFAVSAGRLCVFDPTGQALGGSKEGGSDGSAKSYSLDG  3249

Query  90    RRILEQFPDQFSPFLHFGCD  31
               +  +F DQF+PF+  G D
Sbjct  3250  GELAARFIDQFAPFIAAGAD  3269



>ref|XP_005840977.1| hypothetical protein GUITHDRAFT_100248 [Guillardia theta CCMP2712]
 gb|EKX53997.1| hypothetical protein GUITHDRAFT_100248 [Guillardia theta CCMP2712]
Length=4444

 Score =   292 bits (748),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/283 (51%), Positives = 194/283 (69%), Gaps = 15/283 (5%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              Q ++D +F+  +I+I+ PD    L  AT L YNDAPW              MA  A   
Sbjct  1297  VQFVADDRFHSSEIEIFAPDSDNVLKPATSLTYNDAPW--------------MAPSAIAD  1342

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
                FVH  IS +VA+++GV S R+ LL +++D ++L L  + E+FGQ ESLT RL+HILE
Sbjct  1343  EIEFVHPKISIEVADRVGVASLRKQLLFQTSDLVDLGLQDS-ESFGQSESLTGRLKHILE  1401

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             +Y +GPG++ EL+QNA+DA A++ + +++K  Y TSS+LSP MA WQGPA+Y  NNS+FS
Sbjct  1402  LYPEGPGIMNELIQNADDAQATEFSIIVNKCTYSTSSLLSPRMASWQGPAIYFHNNSIFS  1461

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             P D   I +IGQ SKL+    IGRFGLGFN+VYHFTD+P+FVSG+ +V FDPH   LPG 
Sbjct  1462  PDDFKNICKIGQGSKLDFLNKIGRFGLGFNAVYHFTDVPSFVSGDYLVYFDPHTKYLPGA  1521

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             +  HPG+RIKF   ++L+QFPDQF P+L  GCDL N + GTLF
Sbjct  1522  NIQHPGIRIKFTRNKVLDQFPDQFKPYLLLGCDLTNRYEGTLF  1564


 Score =   175 bits (444),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 116/184 (63%), Gaps = 0/184 (0%)
 Frame = -1

Query  552  GAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVL  373
            G  E FGQ   LT R+R IL  Y  G  +L E +QNA+DA A ++   LD+  + +SS+ 
Sbjct  18   GFGEDFGQQVDLTGRIREILVNYPPGATILKEFIQNADDAGAQQIKICLDERSFPSSSLA  77

Query  372  SPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIP  193
             P++  +Q  +L  +N++VFS +D  +I RIGQ SK   P   GRFG+GFNS YH T++P
Sbjct  78   DPKLGQFQQSSLLVYNDAVFSDEDFDSIQRIGQSSKQAHPTKTGRFGIGFNSCYHLTELP  137

Query  192  TFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFR  13
            TF+S  ++VMFDP A  LP ++P++PG RI F+   I   +PDQ +P+ +FG      F 
Sbjct  138  TFLSRSSIVMFDPQAKYLPNVNPANPGKRINFLSEEIQRNYPDQIAPYFNFGARSDKAFN  197

Query  12   GTLF  1
            GTLF
Sbjct  198  GTLF  201


 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 83/281 (30%), Positives = 127/281 (45%), Gaps = 49/281 (17%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I+LPD    +  A+ LVY+DAPWL                 +      FVH  I N+ A
Sbjct  2663  EIFLPDADSFMRPASQLVYDDAPWL----------------SSTMNDVLFVHHEIGNEAA  2706

Query  627   EKLGVRSFRRMLLAESADSMNL---SLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             + LG++S R++L++   +  +L   S S         ES    L H+++ +AD  G    
Sbjct  2707  QSLGLKSVRKLLISGQLNLKDLPCPSPSMIGSTLRDFESHGQMLSHLVD-FADTLG----  2761

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
                      + +V FL D   + + S+L P ++  QGP+L  +   V    +   ISR+ 
Sbjct  2762  ---------SREVCFLFDFRTHNSQSLLQPNLSSLQGPSLIMYIKGVKLGAE--QISRLQ  2810

Query  276   -QESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHAC--------SLPGISP  124
              Q   L+      + G G N++YHFTD+P  VSGE +  FDP  C            +  
Sbjct  2811  CQNQDLQGLHRSVKNGPGLNAMYHFTDVPCIVSGEGLYFFDPQGCYFMDQDQKKARAVGK  2870

Query  123   SHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             +H      +V   +  +F DQF PF  FG + +  F GTLF
Sbjct  2871  AH-----LYVNSDLSNKFADQFVPFQVFGFNAEREFHGTLF  2906



>ref|XP_003061457.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54087.1| predicted protein [Micromonas pusilla CCMP1545]
Length=5511

 Score =   286 bits (731),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 184/267 (69%), Gaps = 18/267 (7%)
 Frame = -1

Query  798   LPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAEKL  619
             +PDV   L  A D+ +NDAPWL                HA + +    H  + +  AE +
Sbjct  1406  VPDVGGVLRGADDVRFNDAPWL----------------HAPEGVT-LSHPKLPSSTAEAV  1448

Query  618   GVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAE  439
             GVRS R  LLAES++ + + L G A+AFGQ E+LTTRL+HIL+ YADGPGV+ ELVQNA+
Sbjct  1449  GVRSLRLALLAESSEDIGVHLHGTAQAFGQSEALTTRLKHILDAYADGPGVISELVQNAD  1508

Query  438   DANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLE  259
             DA AS+V  +LD    G+ S+L+P++  WQGPAL  +N++VFSP D + I+RIGQ+SK++
Sbjct  1509  DAGASEVRLMLDMRTGGSKSLLAPKLERWQGPALVAWNDAVFSPADFHNIARIGQDSKVD  1568

Query  258   KPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGRRIL  79
             +P A GRFGLGFN++YHFTD+P+FVSGE +VMFDPHA  LPG + + PGL+I F    +L
Sbjct  1569  RPAAAGRFGLGFNAIYHFTDLPSFVSGEYLVMFDPHATHLPGATAARPGLKIAFADSPLL  1628

Query  78    EQFPDQFSPFL-HFGCDLQNPFRGTLF  1
              QFPDQFS +  HFGCDL   +  TLF
Sbjct  1629  RQFPDQFSTYRGHFGCDLSKAYDATLF  1655


 Score =   193 bits (490),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 120/181 (66%), Gaps = 2/181 (1%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT RLR IL  Y +G  +L ELVQNA+DA A+ V   LD   +GTS+++SP +A
Sbjct  15   FGQKVDLTARLREILLNYPEGTSILKELVQNADDAGATVVKVCLDARSHGTSTLVSPALA  74

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSG  178
             +QGPAL   N+SVF+  D  +ISR+G   K  +    GRFG+GFNSVYH TD+P+FVSG
Sbjct  75   PFQGPALLVHNDSVFAEADFVSISRVGDSVKRTQVGKTGRFGVGFNSVYHLTDVPSFVSG  134

Query  177  ENVVMFDPHACSLPGISPSHPGLRIKFV--GRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
             +VV FDPHAC LP    ++PG R+ FV  G  +     DQF+PF+ FGCD +  +RGT 
Sbjct  135  RHVVFFDPHACHLPNADAANPGKRVDFVGGGGDVTRTHADQFAPFIAFGCDARTEYRGTT  194

Query  3    F  1
            F
Sbjct  195  F  195


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 77/287 (27%), Positives = 118/287 (41%), Gaps = 42/287 (15%)
 Frame = -1

Query  798   LPDVSCRLFNATDLVYNDAPWLLdsddpdss------ngSAMALHAKQTIQRFVHGNISN  637
             LPD +  +  A+ LV+NDA WLL   D             A +     +  R  H ++  
Sbjct  3018  LPDGAGVMAPASALVHNDAEWLLGGGDAADDDDDDDAKTRASSGGVDVSALRLTHPSVPC  3077

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
              +AE LG RS R +   + + +  L    AA            LR +L  Y D      +
Sbjct  3078  AIAEALGARSLRALYAVDKSSTDRLPCPSAAT-----------LRRLLPAYDDRAHAFSD  3126

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
             + + A+   A  +   LD   Y + S+L P++A +QGPA+     ++  P    A   I 
Sbjct  3127  VAEVADVVCARGLEISLDLKTYKSRSLLLPQLAQFQGPAV-----TIRLPGVSLAADEIA  3181

Query  276   QESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGL  109
                    PF +     RFG GF S  HF+D+ T  +   + +FDP   +L G      G 
Sbjct  3182  TLLTAAAPFKLRKRAIRFGNGFVSCVHFSDVFTAATAGQLCVFDPTGVALGGGGGGSSGA  3241

Query  108   RI--KFVG-----------RRILEQFPDQFSPFLHFGCDLQNPFRGT  7
             +   +  G             +  +F DQF+PF+  G D   P RG+
Sbjct  3242  KRDERAAGGSAKAYSYGANGELAARFADQFAPFVAAGLD---PSRGS  3285



>gb|ETM49653.1| hypothetical protein L914_06148 [Phytophthora parasitica]
Length=2014

 Score =   280 bits (715),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   177 bits (449),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETP47728.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=4928

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETP47727.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=4929

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETL96494.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=4928

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETL96493.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=4929

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETI50016.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
Length=4928

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETP47729.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=4921

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1431  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1476

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1477  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1533

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1534  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1593

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1594  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1653

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1654  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1700


 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 100/185 (54%), Gaps = 33/185 (18%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            +VQNA+DA A++V   LD  Q+  + +   ++A +QGP+L   NN+ FS  D  +I RIG
Sbjct  1    MVQNADDAGATEVNLCLDYRQHAATGLAYEKLASFQGPSLLVHNNATFSDADFQSIQRIG  60

Query  276  QESKLE--KPFAIGRFGLGFNS------------------------------VYHFTDIP  193
               K +  K +  GRFG+GFNS                              VYH TD+P
Sbjct  61   DSLKKDNSKGWKTGRFGVGFNSGTIICIPWICFLQQKGQHLNVLVFLVCFDAVYHVTDLP  120

Query  192  TFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPF  16
             FVSG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF
Sbjct  121  AFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPF  180

Query  15   RGTLF  1
             GT+F
Sbjct  181  SGTIF  185



>gb|ETK89913.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=4929

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETO78749.1| hypothetical protein, variant 4 [Phytophthora parasitica P1976]
Length=4891

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1401  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1446

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1447  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1503

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1504  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1563

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1564  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1623

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1624  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1670


 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            +VQNA+DA A++V   LD  Q+  + +   ++A +QGP+L   NN+ FS  D  +I RIG
Sbjct  1    MVQNADDAGATEVNLCLDYRQHAATGLAYEKLASFQGPSLLVHNNATFSDADFQSIQRIG  60

Query  276  QESKLE--KPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI  103
               K +  K +  GRFG+GFNSVYH TD+P FVSG  +V FDP AC LP ++PS+PG  I
Sbjct  61   DSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMI  120

Query  102  KFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             ++    ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  121  DYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  155



>gb|ETP19794.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=4928

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETO78747.1| hypothetical protein, variant 2 [Phytophthora parasitica P1976]
Length=4928

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>ref|XP_008891782.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETN22534.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
Length=4928

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETK89914.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=4928

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETP19793.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=4929

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETL43313.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=4928

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>ref|XP_008891781.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETN22533.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
Length=4929

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETL43312.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=4929

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETI50015.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
Length=4929

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETO78746.1| hypothetical protein, variant 1 [Phytophthora parasitica P1976]
Length=4929

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1439  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1484

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1485  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1541

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1542  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1601

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1602  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1661

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1662  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1708


 Score =   178 bits (451),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+P FV
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193



>gb|ETP47730.1| hypothetical protein, variant 4 [Phytophthora parasitica P10297]
Length=4891

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1401  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1446

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1447  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1503

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1504  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1563

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1564  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1623

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1624  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1670


 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            +VQNA+DA A++V   LD  Q+  + +   ++A +QGP+L   NN+ FS  D  +I RIG
Sbjct  1    MVQNADDAGATEVNLCLDYRQHAATGLAYEKLASFQGPSLLVHNNATFSDADFQSIQRIG  60

Query  276  QESKLE--KPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI  103
               K +  K +  GRFG+GFNSVYH TD+P FVSG  +V FDP AC LP ++PS+PG  I
Sbjct  61   DSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMI  120

Query  102  KFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             ++    ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  121  DYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  155



>gb|ETP19796.1| hypothetical protein, variant 4 [Phytophthora parasitica CJ01A1]
Length=4891

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1401  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1446

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1447  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1503

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1504  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1563

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1564  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1623

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1624  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1670


 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            +VQNA+DA A++V   LD  Q+  + +   ++A +QGP+L   NN+ FS  D  +I RIG
Sbjct  1    MVQNADDAGATEVNLCLDYRQHAATGLAYEKLASFQGPSLLVHNNATFSDADFQSIQRIG  60

Query  276  QESKLE--KPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI  103
               K +  K +  GRFG+GFNSVYH TD+P FVSG  +V FDP AC LP ++PS+PG  I
Sbjct  61   DSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMI  120

Query  102  KFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             ++    ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  121  DYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  155



>ref|XP_008891783.1| hypothetical protein, variant 4 [Phytophthora parasitica INRA-310]
 gb|ETN22536.1| hypothetical protein, variant 4 [Phytophthora parasitica INRA-310]
Length=4891

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1401  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1446

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1447  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1503

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1504  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1563

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1564  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1623

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1624  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1670


 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            +VQNA+DA A++V   LD  Q+  + +   ++A +QGP+L   NN+ FS  D  +I RIG
Sbjct  1    MVQNADDAGATEVNLCLDYRQHAATGLAYEKLASFQGPSLLVHNNATFSDADFQSIQRIG  60

Query  276  QESKLE--KPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRI  103
               K +  K +  GRFG+GFNSVYH TD+P FVSG  +V FDP AC LP ++PS+PG  I
Sbjct  61   DSLKKDNSKGWKTGRFGVGFNSVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMI  120

Query  102  KFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             ++    ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  121  DYIAHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  155



>gb|ETP47726.1| hypothetical protein F442_06378 [Phytophthora parasitica P10297]
Length=4959

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1469  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1514

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1515  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1571

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1572  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1631

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1632  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1691

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1692  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1738


 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNS-----------  217
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNS           
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSGTIICIPWICF  131

Query  216  -------------------VYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFV  94
                               VYH TD+P FVSG  +V FDP AC LP ++PS+PG  I ++
Sbjct  132  LQQKGQHLNVLVFLVCFDAVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYI  191

Query  93   GR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  192  AHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  223



>gb|ETP47731.1| hypothetical protein, variant 5 [Phytophthora parasitica P10297]
Length=4773

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1283  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1328

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1329  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1385

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1386  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1445

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1446  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1505

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1506  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1552



>gb|ETO78750.1| hypothetical protein, variant 5 [Phytophthora parasitica P1976]
Length=4773

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1283  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1328

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1329  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1385

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1386  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1445

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1446  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1505

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1506  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1552



>ref|XP_008891780.1| hypothetical protein, variant 5 [Phytophthora parasitica INRA-310]
 gb|ETN22537.1| hypothetical protein, variant 5 [Phytophthora parasitica INRA-310]
Length=4773

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1283  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1328

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1329  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1385

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1386  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1445

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1446  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1505

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1506  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1552



>gb|ETO78748.1| hypothetical protein, variant 3 [Phytophthora parasitica P1976]
Length=4921

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1431  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1476

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1477  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1533

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1534  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1593

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1594  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1653

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1654  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1700


 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 100/185 (54%), Gaps = 33/185 (18%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            +VQNA+DA A++V   LD  Q+  + +   ++A +QGP+L   NN+ FS  D  +I RIG
Sbjct  1    MVQNADDAGATEVNLCLDYRQHAATGLAYEKLASFQGPSLLVHNNATFSDADFQSIQRIG  60

Query  276  QESKLE--KPFAIGRFGLGFNS------------------------------VYHFTDIP  193
               K +  K +  GRFG+GFNS                              VYH TD+P
Sbjct  61   DSLKKDNSKGWKTGRFGVGFNSGTIICIPWICFLQQKGQHLNVLVFLVCFDAVYHVTDLP  120

Query  192  TFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPF  16
             FVSG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF
Sbjct  121  AFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPF  180

Query  15   RGTLF  1
             GT+F
Sbjct  181  SGTIF  185



>gb|ETP19797.1| hypothetical protein, variant 5 [Phytophthora parasitica CJ01A1]
Length=4773

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1283  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1328

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1329  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1385

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1386  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1445

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1446  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1505

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1506  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1552



>gb|ETL43311.1| hypothetical protein L916_06149 [Phytophthora parasitica]
Length=4959

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1469  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1514

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1515  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1571

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1572  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1631

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1632  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1691

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1692  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1738


 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNS-----------  217
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNS           
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSGTIICIPWICF  131

Query  216  -------------------VYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFV  94
                               VYH TD+P FVSG  +V FDP AC LP ++PS+PG  I ++
Sbjct  132  LQQKGQHLNVLVFLVCFDAVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYI  191

Query  93   GR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  192  AHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  223



>gb|ETP19792.1| hypothetical protein F441_06343 [Phytophthora parasitica CJ01A1]
Length=4959

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1469  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1514

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1515  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1571

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1572  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1631

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1632  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1691

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1692  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1738


 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNS-----------  217
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNS           
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSGTIICIPWICF  131

Query  216  -------------------VYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFV  94
                               VYH TD+P FVSG  +V FDP AC LP ++PS+PG  I ++
Sbjct  132  LQQKGQHLNVLVFLVCFDAVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYI  191

Query  93   GR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  192  AHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  223



>ref|XP_008891779.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETN22535.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=4921

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1431  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1476

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1477  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1533

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1534  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1593

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1594  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1653

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1654  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1700


 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 100/185 (54%), Gaps = 33/185 (18%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            +VQNA+DA A++V   LD  Q+  + +   ++A +QGP+L   NN+ FS  D  +I RIG
Sbjct  1    MVQNADDAGATEVNLCLDYRQHAATGLAYEKLASFQGPSLLVHNNATFSDADFQSIQRIG  60

Query  276  QESKLE--KPFAIGRFGLGFNS------------------------------VYHFTDIP  193
               K +  K +  GRFG+GFNS                              VYH TD+P
Sbjct  61   DSLKKDNSKGWKTGRFGVGFNSGTIICIPWICFLQQKGQHLNVLVFLVCFDAVYHVTDLP  120

Query  192  TFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPF  16
             FVSG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF
Sbjct  121  AFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPF  180

Query  15   RGTLF  1
             GT+F
Sbjct  181  SGTIF  185



>gb|ETP19795.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
Length=4921

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1431  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1476

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1477  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1533

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1534  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1593

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1594  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1653

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1654  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1700


 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 100/185 (54%), Gaps = 33/185 (18%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            +VQNA+DA A++V   LD  Q+  + +   ++A +QGP+L   NN+ FS  D  +I RIG
Sbjct  1    MVQNADDAGATEVNLCLDYRQHAATGLAYEKLASFQGPSLLVHNNATFSDADFQSIQRIG  60

Query  276  QESKLE--KPFAIGRFGLGFNS------------------------------VYHFTDIP  193
               K +  K +  GRFG+GFNS                              VYH TD+P
Sbjct  61   DSLKKDNSKGWKTGRFGVGFNSGTIICIPWICFLQQKGQHLNVLVFLVCFDAVYHVTDLP  120

Query  192  TFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPF  16
             FVSG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ SPF  FGC+   PF
Sbjct  121  AFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPNLVSNFPDQISPFRCFGCNFSEPF  180

Query  15   RGTLF  1
             GT+F
Sbjct  181  SGTIF  185



>gb|ETI50014.1| hypothetical protein F443_06336 [Phytophthora parasitica P1569]
Length=4958

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1469  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1514

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1515  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1571

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1572  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1631

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1632  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1691

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1692  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1738


 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNS-----------  217
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNS           
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSGTIICIPWICF  131

Query  216  -------------------VYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFV  94
                               VYH TD+P FVSG  +V FDP AC LP ++PS+PG  I ++
Sbjct  132  LQQKGQHLNVLVFLVCFDAVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYI  191

Query  93   GR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  192  AHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  223



>gb|ETK89912.1| hypothetical protein L915_06212 [Phytophthora parasitica]
Length=4958

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1469  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1514

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1515  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1571

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1572  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1631

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1632  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1691

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1692  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1738


 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNS-----------  217
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNS           
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSGTIICIPWICF  131

Query  216  -------------------VYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFV  94
                               VYH TD+P FVSG  +V FDP AC LP ++PS+PG  I ++
Sbjct  132  LQQKGQHLNVLVFLVCFDAVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYI  191

Query  93   GR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  192  AHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  223



>gb|ETO78745.1| hypothetical protein F444_06398 [Phytophthora parasitica P1976]
Length=4959

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1469  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1514

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1515  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1571

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1572  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1631

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1632  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1691

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1692  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1738


 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNS-----------  217
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNS           
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSGTIICIPWICF  131

Query  216  -------------------VYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFV  94
                               VYH TD+P FVSG  +V FDP AC LP ++PS+PG  I ++
Sbjct  132  LQQKGQHLNVLVFLVCFDAVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYI  191

Query  93   GR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  192  AHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  223



>ref|XP_008891778.1| hypothetical protein PPTG_02450 [Phytophthora parasitica INRA-310]
 gb|ETN22532.1| hypothetical protein PPTG_02450 [Phytophthora parasitica INRA-310]
Length=4959

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1469  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1514

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1515  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1571

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1572  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1631

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1632  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1691

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1692  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1738


 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNS-----------  217
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNS           
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSGTIICIPWICF  131

Query  216  -------------------VYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFV  94
                               VYH TD+P FVSG  +V FDP AC LP ++PS+PG  I ++
Sbjct  132  LQQKGQHLNVLVFLVCFDAVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYI  191

Query  93   GR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  192  AHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  223



>gb|ETL96492.1| hypothetical protein L917_06027 [Phytophthora parasitica]
Length=4958

 Score =   280 bits (716),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 191/287 (67%), Gaps = 22/287 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L Y+DAPWL +              H  +T 
Sbjct  1469  QLISDTLQHHSDYELFAPDRDGVLEFAASLTYDDAPWLDE--------------HDYETS  1514

Query  666   Q---RFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRH  499
                 RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ H
Sbjct  1515  SGSIRFIHPKISNEVAAKIGSRSLRNQLLNESGHEAMSF---GDVEAFGQTEALTKRIAH  1571

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y DGP ++ EL+QNA+DA A++VA L +   YGTSS+LSP MA WQGPALYC+N++
Sbjct  1572  ILEQYPDGPNIISELIQNADDAGATRVAVLYNNCTYGTSSLLSPAMAKWQGPALYCYNDA  1631

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              FS  D   ++RIGQ SKL++    GRFGLGFNSVYHFTD+P+ VS +++VMFDPHA  L
Sbjct  1632  EFSDGDFINLARIGQASKLQRAATTGRFGLGFNSVYHFTDLPSIVSAKSIVMFDPHATHL  1691

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             PGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1692  PGISAVNPGIKIRFANANIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1738


 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 115/212 (54%), Gaps = 33/212 (16%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNS-----------  217
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNS           
Sbjct  72   SFQGPSLLVHNNATFSDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSGTIICIPWICF  131

Query  216  -------------------VYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFV  94
                               VYH TD+P FVSG  +V FDP AC LP ++PS+PG  I ++
Sbjct  132  LQQKGQHLNVLVFLVCFDAVYHVTDLPAFVSGSQLVFFDPQACHLPNVNPSNPGKMIDYI  191

Query  93   GR-RILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                ++  FPDQ SPF  FGC+   PF GT+F
Sbjct  192  AHPNLVSNFPDQISPFRCFGCNFSEPFSGTIF  223



>ref|XP_005765974.1| hypothetical protein EMIHUDRAFT_212654 [Emiliania huxleyi CCMP1516]
 gb|EOD13545.1| hypothetical protein EMIHUDRAFT_212654 [Emiliania huxleyi CCMP1516]
Length=3116

 Score =   276 bits (705),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 137/272 (50%), Positives = 195/272 (72%), Gaps = 3/272 (1%)
 Frame = -1

Query  810   IKIYLPDVSCRLFNATDLVYNDAPWLLds--ddpdssngSAMALHAKQTIQRFVHGNISN  637
              +IYLPD +C +  A +L+++D PWL DS      ++ G A ++ +  + +R VH +I++
Sbjct  1122  TQIYLPDTACAMVVAHELLFDDTPWLSDSLAGGQQAAGGQAASILSSASKRRRVHPSIAH  1181

Query  636   DVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFE  457
             + A +LG +S R  LL  +AD+  L      EAFGQ+ESLT+RL +ILE+YADG G+L E
Sbjct  1182  ETAARLGAQSLRLWLLGRNADTFALGQENV-EAFGQYESLTSRLHNILELYADGVGILHE  1240

Query  456   LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
             L+QN++DA A++V+F+ D++Q+G  S+LSP M +WQGPAL  FNN+ F+P+DL  I  IG
Sbjct  1241  LIQNSDDAGATEVSFIFDQAQHGDQSLLSPSMREWQGPALCVFNNAQFTPRDLRNICSIG  1300

Query  276   QESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKF  97
               +KL    A GRFGLGFN+VYHFTD+P+F+SG ++V FDP A  LPG + ++PGL+IKF
Sbjct  1301  SNAKLAAGNATGRFGLGFNAVYHFTDVPSFISGSHLVFFDPAAQFLPGATANNPGLKIKF  1360

Query  96    VGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
              G   LEQFPDQF+P+L  GCD+ +P+ GTLF
Sbjct  1361  AGESFLEQFPDQFAPYLLCGCDMVSPYNGTLF  1392


 Score =   125 bits (315),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 109/185 (59%), Gaps = 4/185 (2%)
 Frame = -1

Query  549  AAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLS  370
            A   FGQ   +  R++ +L+ Y +G  +L E+VQNA+DA AS    LLD   +G+S +  
Sbjct  2    AVRDFGQKVDVCRRIKEVLKNYEEG-SLLKEMVQNADDAGASVFDVLLDLRTHGSSELAL  60

Query  369  PEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKL-EKPFAIGRFGLGFNSVYHFTDIP  193
            P  A +QGPAL   N++VF+  DL +I +IG   K   +    GRFG+GF S YH TD+P
Sbjct  61   PGTAAFQGPALVTHNDAVFADSDLESIQQIGGSQKAGSRSTKTGRFGVGFCSCYHATDLP  120

Query  192  TFVSGENVVMFDPHACSLPGISPSHPGLRIKFV-GRRILEQFPDQFSPFLHFGCDLQNPF  16
            +F+S + +V+ DPH C+    + S PG  + F+   + +    D F P+  FGC LQ+ +
Sbjct  121  SFLSRDFLVVLDPH-CAHVSDNRSEPGKMLCFLEDPKTVASSRDTFEPYRVFGCSLQHSY  179

Query  15   RGTLF  1
             GT+F
Sbjct  180  PGTIF  184


 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 123/285 (43%), Gaps = 43/285 (15%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             ++LPD    L  + +L +NDAPW+                 A Q   RFVHG++  ++AE
Sbjct  2428  VFLPDADGILRPSPELTFNDAPWMPS---------------AGQAGTRFVHGSVEPELAE  2472

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             +LG         A+S   + L      + F    S  T+++  L  +     VL +L++ 
Sbjct  2473  RLG---------AQSLRQLLLLRDKFTDTFPCPSS--TQIQEALAGFGHESNVLLDLLEV  2521

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSV-FSPQDLYAISRIGQES  268
             A+   A  V F  D+  + + S+L P + ++QGPAL  F   V  + ++L  + +   + 
Sbjct  2522  ADVLGAKGVHFCCDRRLHPSESLLFPTLVEFQGPALCVFMPGVALTTEELCLLHQHSADR  2581

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLP-------------GIS  127
               +      RFG  F S Y   ++   VSG  + + DP    LP             G  
Sbjct  2582  WFKLRGRTPRFGRRFASAYALGEVSGLVSGGQMFLCDPSGRYLPPGASGRAAEEADTGAP  2641

Query  126   PSHPGLRI-KFVGRRILEQFPDQFSPFLHFGCDL--QNPFRGTLF  1
              S P  R+   V   +  +FPDQF+PF  FG D     P  GT+ 
Sbjct  2642  TSLPVGRVYPLVPGDLPRRFPDQFAPFSMFGFDALSGKPLDGTIL  2686



>emb|CBI27138.3| unnamed protein product [Vitis vinifera]
Length=3960

 Score =   269 bits (687),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 164/283 (58%), Gaps = 106/283 (37%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
              QHL++VQF+E + KIYLPDVS RL                                   
Sbjct  888   VQHLAEVQFHEHKAKIYLPDVSGRLLPV--------------------------------  915

Query  669   IQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILE  490
                           +KLGV S RR LLAE                               
Sbjct  916   --------------KKLGVCSLRRTLLAE-------------------------------  930

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
                +GPG+LFELVQNAEDA AS+V FLLDK+QYGTSS+LSPEMADWQGPALYCFN+SVFS
Sbjct  931   ---NGPGILFELVQNAEDAGASEVIFLLDKTQYGTSSILSPEMADWQGPALYCFNDSVFS  987

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             PQDLYAISRI                          DIPTFVSGEN+VMFDPHAC+LPGI
Sbjct  988   PQDLYAISRI--------------------------DIPTFVSGENIVMFDPHACNLPGI  1021

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             SPSHPGLRI++VGRRILEQFPDQFSPFLHFGCDLQNPF GTLF
Sbjct  1022  SPSHPGLRIRYVGRRILEQFPDQFSPFLHFGCDLQNPFPGTLF  1064


 Score =   199 bits (506),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 127/181 (70%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A+KV   LD+  +G+ S+LS +
Sbjct  18   EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATKVCLCLDRRVHGSESLLSEK  77

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGPAL  +NN+ F+ +D  +ISRIG  +K  + +  GRFG+GFNSVYH TD+P+FV
Sbjct  78   LAQWQGPALLAYNNAEFTEEDFVSISRIGGSNKHGQAWKTGRFGVGFNSVYHLTDLPSFV  137

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP +S ++PG RI++V    +  + DQF P+  FGCD+++PF GTL
Sbjct  138  SGKYVVLFDPQGVYLPNVSTANPGKRIEYVSSSAISLYKDQFLPYCAFGCDMKHPFSGTL  197

Query  3    F  1
            F
Sbjct  198  F  198


 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 86/275 (31%), Positives = 135/275 (49%), Gaps = 40/275 (15%)
 Frame = -1

Query  849   AQHLSDVQFYE-DQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQ  673
             A   SD   +E     + LPD S  L  A DLVYNDAPW+              AL  K 
Sbjct  2070  ADCCSDKPLFEASNTPLLLPDSSGVLICAGDLVYNDAPWM-----------ENNALVGKH  2118

Query  672   TIQRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHIL  493
                 FVH +ISND+A +LGV+S R + L +   + +L        +G       ++  +L
Sbjct  2119  ----FVHPSISNDLANRLGVQSLRCLSLVDEEMTKDL----PCMDYG-------KISELL  2163

Query  492   EMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCF-NNSV  316
               Y D   +LF+L++ A+   A K+  + DK ++   S+L   + ++QGPAL      + 
Sbjct  2164  VSYGDRDFLLFDLLELADCCKAKKLHLIFDKREHPRQSLLQHNLGEFQGPALVAIMEGAS  2223

Query  315   FSPQDLYAISRIGQESKLEKPFAIG----RFGLGFNSVYHFTDIPTFVSGENVVMFDPHA  148
              S +++ ++       +L  P+ +      +GLG  S Y  +D+P+ VSG    +FDPH 
Sbjct  2224  LSREEVSSL-------QLLPPWRLRGDTLNYGLGLLSCYSISDLPSIVSGGYFYIFDPHG  2276

Query  147   CSLPGISPSHPGLRI-KFVGRRILEQFPDQFSPFL  46
              +LPG S   P  ++   +G  + E+F DQF+P L
Sbjct  2277  LALPGSSSHGPTAKVFSLIGTNLTERFCDQFNPML  2311



>emb|CBI39913.3| unnamed protein product [Vitis vinifera]
Length=1311

 Score =   266 bits (679),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -1

Query  471   GVLFELVQNAEDANASKV-AFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLY  295
             GV FE     ++A  + + A LLD   YGTSS+LSPEMADWQG ALYCFN+SVFSPQDLY
Sbjct  1055  GVKFEGHGQIQEALTAYINALLLDPGYYGTSSILSPEMADWQGSALYCFNDSVFSPQDLY  1114

Query  294   AISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHP  115
             AISRIGQESKLEKPFAIGRFGLGFN VYHFTDIPTFVSGEN+VMFDPHAC+LPGI PSHP
Sbjct  1115  AISRIGQESKLEKPFAIGRFGLGFNCVYHFTDIPTFVSGENIVMFDPHACNLPGIYPSHP  1174

Query  114   GLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
              LRI++VGRRILEQFPDQF PFLHFG DLQNPF GT+F
Sbjct  1175  SLRIRYVGRRILEQFPDQFFPFLHFGYDLQNPFPGTVF  1212



>gb|KDO29648.1| hypothetical protein SPRG_05600 [Saprolegnia parasitica CBS 223.65]
Length=4440

 Score =   246 bits (629),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/286 (47%), Positives = 172/286 (60%), Gaps = 22/286 (8%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
             AQ LSD       + +YLP  S  L  A+ L++NDAPWL                 A+  
Sbjct  1303  AQTLSDE--VSTGLDVYLPTASNALQVASSLLFNDAPWL-----------------AQPP  1343

Query  669   IQRFVHGNISNDVAEKLGV---RSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRH  499
                FVH  +SN VA KLG    RS      + + D +         AFGQ E LT RL H
Sbjct  1344  GLVFVHPQLSNVVAGKLGAVSFRSSLLRSSSTALDGLEPEALDGVTAFGQSEPLTRRLAH  1403

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y +G  VL ELVQNA+DA A++V+  L+ + Y TSS+LS  MA WQGPALYC+NN+
Sbjct  1404  ILEQYPEGTSVLHELVQNADDAGATRVSVCLNLATYATSSLLSAPMAAWQGPALYCYNNA  1463

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              F  +D   ++RIGQ SKL +    GRFGLGFNSVYH TD+P+ VSG ++VMFDPHA  +
Sbjct  1464  AFQERDFMNLARIGQGSKLHRVSTTGRFGLGFNSVYHLTDLPSIVSGSSLVMFDPHATFV  1523

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             P  + + PG++I F    ++ QFPDQF+P+  FGC L+ P+ GTLF
Sbjct  1524  PNATATQPGIKINFTSSNVIAQFPDQFAPYKLFGCTLEEPYHGTLF  1569


 Score =   157 bits (396),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 113/181 (62%), Gaps = 9/181 (5%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  VL E+VQNA+DA A+ ++F LDK  +G   +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSVLKEMVQNADDAGATTISFCLDKRTHGAEHLAYTKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIG-RFGLGFNSVYHFTDIPTFVS  181
             +QGP+L   N++ F+  D  +I RIG    L+K  + G + GL    V H         
Sbjct  72   SFQGPSLLVHNDARFTDADFASIQRIGD--SLKKDASQGWKTGLASTRVRH-----QHAY  124

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRR-ILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            G ++VMFDPHAC LP ++PS+PG  I F+ RR +LEQ+PDQF PF  FGCDL++PF GT 
Sbjct  125  GSHIVMFDPHACHLPNVNPSNPGKMINFMTRRDLLEQYPDQFCPFEGFGCDLRSPFDGTT  184

Query  3    F  1
            F
Sbjct  185  F  185



>ref|XP_008607680.1| hypothetical protein SDRG_03814 [Saprolegnia diclina VS20]
 gb|EQC38856.1| hypothetical protein SDRG_03814 [Saprolegnia diclina VS20]
Length=4469

 Score =   246 bits (627),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/286 (47%), Positives = 172/286 (60%), Gaps = 22/286 (8%)
 Frame = -1

Query  849   AQHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQT  670
             AQ LSD       + +YLP  S  L  A+ L++NDAPWL                 A+ +
Sbjct  1332  AQTLSDEM--STGLDVYLPTASNVLELASSLLFNDAPWL-----------------AQPS  1372

Query  669   IQRFVHGNISNDVAEKLGV---RSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRH  499
                FVH  +SN VA KLG    RS      + + D +         AFGQ E LT RL H
Sbjct  1373  GLVFVHPQLSNVVAGKLGAVSFRSSLLRSSSTALDGLEPEALDGVTAFGQSEPLTRRLAH  1432

Query  498   ILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNS  319
             ILE Y +G  VL ELVQNA+DA A++V+  L+ + Y TSS+LS  MA WQGPALYC+NN+
Sbjct  1433  ILEQYPEGTSVLHELVQNADDAGATRVSVCLNLATYATSSLLSAPMAAWQGPALYCYNNA  1492

Query  318   VFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL  139
              F  +D   ++RIGQ SKL +    GRFGLGFNSVYH TD+P+ VSG ++VMFDPHA  +
Sbjct  1493  AFQERDFMNLARIGQGSKLHRVSTTGRFGLGFNSVYHLTDLPSIVSGSSLVMFDPHATFV  1552

Query  138   PGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
             P  + + PG++I F    ++ QFPDQF+P+  FGC L  P+ GTLF
Sbjct  1553  PNATTTQPGIKINFTSSNVIAQFPDQFAPYKLFGCTLDEPYHGTLF  1598


 Score =   199 bits (505),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 127/182 (70%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  VL E+VQNA+DA A+ ++F LDK  +G   +   ++A
Sbjct  13   FGQKIDLTVRIREILRNYPEGTSVLKEMVQNADDAGATTISFCLDKRTHGAEHLAYTKLA  72

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   N++ F+  D  +I RIG   K +  + +  GRFG+GFNSVYH TD+PTF+
Sbjct  73   SFQGPSLLVHNDARFTDADFASIQRIGDSLKKDASQGWKTGRFGIGFNSVYHMTDLPTFI  132

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRR-ILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG ++VMFDPHAC LP ++PS+PG  I F+ RR +LEQ+PDQF PF  FGCDL++PF GT
Sbjct  133  SGSHIVMFDPHACHLPNVNPSNPGKMINFMTRRDLLEQYPDQFCPFEGFGCDLRSPFDGT  192

Query  6    LF  1
             F
Sbjct  193  TF  194



>emb|CBN79498.1| conserved unknown protein [Ectocarpus siliculosus]
Length=2674

 Score =   238 bits (606),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 168/282 (60%), Gaps = 54/282 (19%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q LSD       +++++PD S  L  +T L+Y+DAPWL                  KQ +
Sbjct  1002  QVLSDESIRVSDLEVWVPDASGVLALSTALLYDDAPWL-----------------TKQNL  1044

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
              R                              ++  L    E+FGQ ESLT RL+HILEM
Sbjct  1045  SR------------------------------LDFDLGVPGESFGQQESLTPRLKHILEM  1074

Query  486   YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
             Y  GP       QNA+DA A  V  +L+  +YG  S+LSP M++WQGP+LY +N++VF+ 
Sbjct  1075  YPGGP-------QNADDAGARTVRVMLNTREYGDGSLLSPAMSNWQGPSLYVYNDAVFTE  1127

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGIS  127
             +D   +++IGQ SKL+K  A GRFGLGFN+VYHFTD+P+FVSGE++VMFDPH   +PG +
Sbjct  1128  RDFQNLAKIGQASKLDKLAATGRFGLGFNAVYHFTDLPSFVSGEHLVMFDPHTKYVPGAT  1187

Query  126   PSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
                PG++I+F    +L+QFPDQFSP+L FGC+L+  F+GTLF
Sbjct  1188  HVQPGIKIRFADTDLLDQFPDQFSPYLFFGCELKKHFKGTLF  1229



>ref|XP_008864357.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETW06282.1| hypothetical protein, variant [Aphanomyces invadans]
Length=4406

 Score =   229 bits (583),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 166/283 (59%), Gaps = 22/283 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q LSD+        +Y+P  +  L  AT L +NDAPW+                      
Sbjct  1283  QALSDMPRPSTGRPVYMPSANATLQEATTLAFNDAPWVDPPPPHLV--------------  1328

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
               FVH  ISN VA  LG  SFR  L+  +++ +        E+FGQ E LT RL  ILE 
Sbjct  1329  --FVHSQISNVVAASLGCISFRSCLVLATSEHLQ-----GVESFGQSEPLTRRLASILEQ  1381

Query  486   YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
             Y +G  +L ELVQNA+DA A++ +    +  + +SS+LS  +  WQG ALYC+N++VF  
Sbjct  1382  YPEGTSILNELVQNADDAQATQFSICYSRKTFKSSSLLSAPLGLWQGAALYCYNDAVFRD  1441

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGIS  127
              D   ++RIGQ SKL      GRFGLGFNSVYH TD+P+ VSGE++VMFDPHA ++P  +
Sbjct  1442  SDFANLARIGQGSKLGNLSTTGRFGLGFNSVYHLTDVPSLVSGESLVMFDPHATNVPNAT  1501

Query  126   PSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDL-QNPFRGTLF  1
              +HPG++I+     ++  FPDQF+P+  FGCD+  + F GTLF
Sbjct  1502  ATHPGIKIRLTNSSLVGHFPDQFAPYALFGCDVASHRFDGTLF  1544


 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 123/182 (68%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  VL E+VQNA+DA A++++F LDK  + + ++   ++A
Sbjct  16   FGQKIDLTVRIREILRNYPEGTSVLKEMVQNADDAGATEISFCLDKRTHASDNLAYTKLA  75

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ F+  D  +I RIG   K +  K +  GRFG+GFNSVYH TD PTFV
Sbjct  76   VFQGPSLLVHNNAEFTDVDFESIQRIGDSLKKDSSKGWKTGRFGIGFNSVYHLTDFPTFV  135

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRR-ILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +VMFDP A  LP ++PS+PG  I F+ R+ +L QFP+QF+PF  FGC+L   F GT
Sbjct  136  SGRRIVMFDPQATHLPNVNPSNPGKLIDFLARQDLLAQFPNQFAPFKGFGCNLAAHFHGT  195

Query  6    LF  1
            +F
Sbjct  196  MF  197



>ref|XP_008864356.1| hypothetical protein H310_02575 [Aphanomyces invadans]
 gb|ETW06281.1| hypothetical protein H310_02575 [Aphanomyces invadans]
Length=4409

 Score =   229 bits (583),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 166/283 (59%), Gaps = 22/283 (8%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q LSD+        +Y+P  +  L  AT L +NDAPW+                      
Sbjct  1283  QALSDMPRPSTGRPVYMPSANATLQEATTLAFNDAPWVDPPPPHLV--------------  1328

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
               FVH  ISN VA  LG  SFR  L+  +++ +        E+FGQ E LT RL  ILE 
Sbjct  1329  --FVHSQISNVVAASLGCISFRSCLVLATSEHLQ-----GVESFGQSEPLTRRLASILEQ  1381

Query  486   YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
             Y +G  +L ELVQNA+DA A++ +    +  + +SS+LS  +  WQG ALYC+N++VF  
Sbjct  1382  YPEGTSILNELVQNADDAQATQFSICYSRKTFKSSSLLSAPLGLWQGAALYCYNDAVFRD  1441

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGIS  127
              D   ++RIGQ SKL      GRFGLGFNSVYH TD+P+ VSGE++VMFDPHA ++P  +
Sbjct  1442  SDFANLARIGQGSKLGNLSTTGRFGLGFNSVYHLTDVPSLVSGESLVMFDPHATNVPNAT  1501

Query  126   PSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDL-QNPFRGTLF  1
              +HPG++I+     ++  FPDQF+P+  FGCD+  + F GTLF
Sbjct  1502  ATHPGIKIRLTNSSLVGHFPDQFAPYALFGCDVASHRFDGTLF  1544


 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 123/182 (68%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  VL E+VQNA+DA A++++F LDK  + + ++   ++A
Sbjct  16   FGQKIDLTVRIREILRNYPEGTSVLKEMVQNADDAGATEISFCLDKRTHASDNLAYTKLA  75

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ F+  D  +I RIG   K +  K +  GRFG+GFNSVYH TD PTFV
Sbjct  76   VFQGPSLLVHNNAEFTDVDFESIQRIGDSLKKDSSKGWKTGRFGIGFNSVYHLTDFPTFV  135

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRR-ILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +VMFDP A  LP ++PS+PG  I F+ R+ +L QFP+QF+PF  FGC+L   F GT
Sbjct  136  SGRRIVMFDPQATHLPNVNPSNPGKLIDFLARQDLLAQFPNQFAPFKGFGCNLAAHFHGT  195

Query  6    LF  1
            +F
Sbjct  196  MF  197



>ref|XP_009040882.1| hypothetical protein AURANDRAFT_67157 [Aureococcus anophagefferens]
 gb|EGB04495.1| hypothetical protein AURANDRAFT_67157 [Aureococcus anophagefferens]
Length=4616

 Score =   216 bits (551),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 128/280 (46%), Positives = 163/280 (58%), Gaps = 26/280 (9%)
 Frame = -1

Query  810   IKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDV  631
             + +  PD +  L    +LV++DAPWL                 AK    R  H  ++   
Sbjct  1375  MDVVAPDEAGALRPCRELVFDDAPWLR---------------DAKADF-RVTHPTVAAAH  1418

Query  630   AEKLGVRSFRRMLLAE--SADSMNLSLSG---AAEAFGQHESLTTRLRHILEMYADGPGV  466
             A+KLG RS RR LL    +A +   S+ G     EAFGQ ESLT RL HIL++Y +G G+
Sbjct  1419  AKKLGARSLRRALLDRGLAAGAEKASIFGDNVETEAFGQRESLTRRLAHILQLYPEGSGI  1478

Query  465   LFELVQNAEDANASKVAFLLDK---SQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLY  295
             L ELVQNA+DA AS+V  LLD    +  G  S+LS  +A WQGPAL   N++ F+  D  
Sbjct  1479  LNELVQNADDAGASEVRVLLDARSAATRGAQSLLSAGLAAWQGPALCVSNDAGFTESDWR  1538

Query  294   AISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL-PGISPSH  118
              + R+GQ SKLE     GRFGLGFNSVYH TD+P   SG++V+  DPHA  L PG +P  
Sbjct  1539  NLVRVGQGSKLENFKTTGRFGLGFNSVYHLTDVPQVASGDHVLFLDPHADGLVPGATPQR  1598

Query  117   PGLRIKFVGRRIL-EQFPDQFSPFLHFGCDLQNPFRGTLF  1
             PGLR+KF G   L   FPDQF+ +   GCDL+ P  GTLF
Sbjct  1599  PGLRVKFTGGADLPAAFPDQFASWADCGCDLEKPLEGTLF  1638


 Score =   135 bits (339),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 73/181 (40%), Positives = 99/181 (55%), Gaps = 2/181 (1%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   L  R+R IL  Y +G  ++ ELVQNA+DA A  VA  +D  ++   S  S    
Sbjct  9    FGQRIDLAVRIREILRNYPEGTSIVKELVQNADDAGARTVAICVDARRHAARSCASAAAE  68

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSG  178
            + QGPAL C+N+++F   D  +I R+G   K       GRFG+GFNSVYH T++P+F SG
Sbjct  69   ELQGPALLCYNDALFREADFASIQRLGDSVKRSDTTKTGRFGIGFNSVYHLTEVPSFASG  128

Query  177  ENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFL-HFGCDLQNPFRGTL  4
              VV FDP    LP + P +PG  +  +    +L    D F+ F   FG      + GTL
Sbjct  129  SKVVWFDPQCAFLPDVDPRNPGKMVDILKNPDVLRSSADMFAGFDGAFGWTGGESYAGTL  188

Query  3    F  1
            F
Sbjct  189  F  189


 Score = 60.8 bits (146),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 72/284 (25%), Positives = 107/284 (38%), Gaps = 51/284 (18%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             +  PD   RL  A  L  +DAPWL           + M  +A   + R  HG ++ D A 
Sbjct  2675  VLAPDSEGRLAPARRLAVDDAPWL----------SARMRENAVGAL-RLCHGAVAGDAAL  2723

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
              +G RS R +LLAE   +             Q             + A  P V   L   
Sbjct  2724  AVGARSLRALLLAEVEAT-------------QAVPCPAAPAAGDALEAALPDV---LAAA  2767

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
                  A  VA + D   +G +S++ P +A  QGPAL  + +    P    A+ R+     
Sbjct  2768  DGALGARSVALVFDARTHGAASLVHPALAGAQGPALVLWVDHD-GPVGTEALVRLLSPGA  2826

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL-----PGISPSHPGLRIK  100
                  A+GR   G    +  +D    ++ + + +FDP    L         P   G R +
Sbjct  2827  A----AVGR---GLAGAFSLSDCLFALNRDTLHVFDPSGAFLDDGGGEKRPPGPAGRRYQ  2879

Query  99    FVGRRILEQFPDQFSPFLHF-----------GCDLQNPFRGTLF  1
                  ++ +FP+QF PF H            G  L+ P RG  F
Sbjct  2880  LGDGDLMRKFPNQFEPFAHLPFGVSERGIAAGTILRLPLRGDFF  2923



>emb|CDY66470.1| BnaC07g49850D, partial [Brassica napus]
Length=1116

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 0/181 (0%)
 Frame = -1

Query  543  EAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPE  364
            E FGQ   LT R+R +L  Y +G  VL EL+QNA+DA A++V   LD+  + T S+LS  
Sbjct  7    EDFGQKVDLTRRIREVLLNYPEGTTVLKELIQNADDAGATRVRLCLDRRAHRTDSLLSDS  66

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            +A WQGP+L  +N++VF+ +D  +ISRIG   K  + +  GRFG+GFNSVYH TDIP+FV
Sbjct  67   LAQWQGPSLLAYNDAVFTEEDFVSISRIGGSGKHGQAWKTGRFGVGFNSVYHLTDIPSFV  126

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ VV+FDP    LP IS ++PG RI FVG   L  + DQF P+  FGCD++ PFRGTL
Sbjct  127  SGKYVVLFDPQGAYLPNISAANPGKRIDFVGSSALSHYEDQFLPYCAFGCDMKTPFRGTL  186

Query  3    F  1
            F
Sbjct  187  F  187



>emb|CAN68779.1| hypothetical protein VITISV_043379 [Vitis vinifera]
Length=309

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 108/138 (78%), Gaps = 14/138 (10%)
 Frame = -1

Query  570  MNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQY  391
            MNLSL GA EAFG HE+LT RL+HIL+MY DGPG+LF LV+NAED  A +V FLL+K+QY
Sbjct  1    MNLSLPGATEAFGHHEALTIRLKHILKMYTDGPGILFGLVKNAEDVGALEVIFLLEKTQY  60

Query  390  GTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVY  211
            GTS+++SPEMAD               PQDLYAIS+IGQE+KLEKPFAIGRFGLGFN VY
Sbjct  61   GTSTIISPEMAD--------------CPQDLYAISQIGQENKLEKPFAIGRFGLGFNYVY  106

Query  210  HFTDIPTFVSGENVVMFD  157
            H TDIPTFVS EN+ + D
Sbjct  107  HPTDIPTFVSEENISIED  124



>ref|XP_001690195.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09933.1| predicted protein [Chlamydomonas reinhardtii]
Length=2852

 Score =   187 bits (474),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 129/195 (66%), Gaps = 10/195 (5%)
 Frame = -1

Query  555  SGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSV  376
            S A + FGQ   LT R+R IL  Y +G  +L ELVQNA+DA AS + F LD+ Q+GT S+
Sbjct  5    SEAWQDFGQKVDLTARIREILLNYPEGTSILKELVQNADDARASCIKFCLDRRQHGTGSL  64

Query  375  LSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDI  196
            LSP M+ +QGPAL  +N+ VFS +DL +ISRIG   K E+    GRFG+GFNS YH TD+
Sbjct  65   LSPAMSAFQGPALLAYNDGVFSDRDLESISRIGDSKKKEEEGKTGRFGVGFNSCYHLTDV  124

Query  195  PTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVG-RRILEQFPDQFSPFL-HFGCDL--  28
            P+FVSG ++V+FDPH   LP IS ++PG RI FV    +  Q+ DQ +P+   FGC L  
Sbjct  125  PSFVSGRHLVIFDPHCRHLPNISATNPGKRIDFVTYSDVAAQYRDQVAPYSGAFGCSLGA  184

Query  27   ------QNPFRGTLF  1
                  Q P++GTLF
Sbjct  185  PQQQGEQGPWQGTLF  199


 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 74/152 (49%), Gaps = 46/152 (30%)
 Frame = -1

Query  456  LVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIG  277
            L+QNA+DA AS +  LLD+  Y T S+LSP MA WQGPAL   N++VFSP D   ISRIG
Sbjct  595  LLQNADDAGASSLTLLLDECSYPTRSILSPAMAVWQGPALLVANDAVFSPADFTNISRIG  654

Query  276  QESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKF  97
            Q                                              G+S + PGL+I F
Sbjct  655  Q----------------------------------------------GVSAAQPGLKIAF  668

Query  96   VGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
               ++L+QFPD F+PF   GC L   + GTLF
Sbjct  669  ARAQLLQQFPDAFTPFTQLGCSLSEKYMGTLF  700



>ref|XP_004992090.1| hypothetical protein PTSG_06697 [Salpingoeca rosetta]
 gb|EGD75633.1| hypothetical protein PTSG_06697 [Salpingoeca rosetta]
Length=5949

 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 161/294 (55%), Gaps = 23/294 (8%)
 Frame = -1

Query  843   HLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQ  664
             H+S V+       + +PD    +  A+ LVYND+ +  +          A       T  
Sbjct  1854  HISKVRDVGSDFCVAVPDDRAVMTAASQLVYNDSVYSHNPSASSRVAALATPTTPATTPP  1913

Query  663   -------RFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRL  505
                    + VH NISN VA  +GVRS    +L    D+           +GQ E LT RL
Sbjct  1914  TASGFDVQEVHPNISNTVAAVVGVRSLMSSVLGN--DTFT--------PYGQVEKLTARL  1963

Query  504   RHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFN  325
             R+++  Y DGP +  EL+QNA+DA A+ +  +  + QYG+ S+ S EM  WQGPALY +N
Sbjct  1964  RNLVTNYPDGPAIFKELLQNADDAGATTMTIVYSRRQYGSQSLFSTEMGRWQGPALYVYN  2023

Query  324   NSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHAC  145
             +++F  +D   ++ + Q  K + P   GRFG+GFNS+YHFTD+P  +SG++ V+ DPH  
Sbjct  2024  DALFRDRDFENLANLAQSKKKDDPATTGRFGVGFNSIYHFTDVPFILSGDDFVILDPHKR  2083

Query  144   SL-PGISPSHPGLRIKFVGRRILEQ-FPDQFSPFL---HFGCDL-QNPFRGTLF  1
              L P I+   PG +++  GR ++++ F DQF+PF      G DL +  FRGTLF
Sbjct  2084  YLPPAITVLGPGTKMRLKGRPLVQRNFADQFAPFAGRHDAGADLSRQRFRGTLF  2137


 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 111/180 (62%), Gaps = 6/180 (3%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ  SLT ++R IL  Y +G  V+ EL+QNA+DA A+ V   LDK Q+GT  +  P+  
Sbjct  13   FGQQVSLTGQIRQILCDYPEGTSVIKELIQNADDAEATCVRIALDKRQFGTEKLRFPDTG  72

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSG  178
             +QGPAL C+N+SVFS +D  +I  I + SK      +GRFGLGFNSVYH TD+P+FVS 
Sbjct  73   KFQGPALLCYNDSVFSDEDFTSIKNICRSSKQADTTKVGRFGLGFNSVYHITDLPSFVSR  132

Query  177  ENVVMFDPHACSLPGISPSHPGLRIKFVGRRILE-QFPDQFSPFLHFGCDLQNPFRGTLF  1
               V+FDPH  SL        G R+KF  +   + ++ D ++    FGC +   F+GTLF
Sbjct  133  NYYVVFDPHKSSL-----GTEGRRVKFTSKHERDGKYEDTWATMRAFGCTMTADFKGTLF  187



>ref|XP_009519246.1| hypothetical protein PHYSODRAFT_479380 [Phytophthora sojae]
 gb|EGZ23958.1| hypothetical protein PHYSODRAFT_479380 [Phytophthora sojae]
Length=4858

 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 116/182 (64%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A++V   LD  Q+ ++ +   ++ 
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATEVNLCLDYRQHASTGLAYEKLG  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ F+  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+PTFV
Sbjct  72   SFQGPSLLVHNNATFTDADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPTFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    ++  FPDQ +PF  FGC+   PF GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPDLVNNFPDQIAPFRCFGCNFSEPFSGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193


 Score =   136 bits (343),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 96/284 (34%), Positives = 133/284 (47%), Gaps = 81/284 (29%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ P+ +  L  A +L Y+DAPWL                    T 
Sbjct  1440  QLISDTLQHHSDYELFAPNRNGVLEFAANLTYDDAPWL-----------DKCDYENSSTS  1488

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRHILE  490
              RF+H  ISN+VA K+G RS R  LL+ES  ++M+    G  EAFGQ E+LT R+ HILE
Sbjct  1489  TRFIHPKISNEVAAKIGSRSLRSQLLSESGHEAMSFGGEGDVEAFGQTEALTKRIAHILE  1548

Query  489   MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
              Y DGP ++ EL+QNA+DA A++V  L +   YGTSS+L                  +F 
Sbjct  1549  QYPDGPNIISELIQNADDAGATRVCVLYNSCTYGTSSLL-----------------MMFD  1591

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
             P                                H T +P  +S  N           PGI
Sbjct  1592  P--------------------------------HATHLPG-ISAAN-----------PGI  1607

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
                    +I+F    I+ QFPDQF+PF + FGCDL++ + GTLF
Sbjct  1608  -------KIRFANANIVRQFPDQFAPFKNVFGCDLEHHYNGTLF  1644



>gb|AFM84533.1| sacsin, partial [Coturnix coturnix]
Length=736

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804  IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
            I LPD    L  A  L YND PW+                  K T  ++ H +I  +VA 
Sbjct  329  ILLPDTRLSLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVAV  372

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
            KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  373  KLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  430

Query  444  AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
            A+DA A+++ F+ D  Q+ T  +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  431  ADDAKATEICFVFDPRQHPTDRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  490

Query  264  LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
            +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  491  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLDA  550

Query  87   RILEQFPDQFSPFL--HFGCDLQNPFR  13
                QF D    +L  HF  D    FR
Sbjct  551  DFRTQFSDVLDLYLGDHFKLDNCTMFR  577



>gb|AFM84519.1| sacsin, partial [Anas platyrhynchos]
Length=736

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804  IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
            I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  329  ILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  372

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
            KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  373  KLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  430

Query  444  AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
            A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  431  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  490

Query  264  LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
            +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  491  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLDA  550

Query  87   RILEQFPDQFSPFL--HFGCDLQNPFR  13
                QF D    +L  HF  D    FR
Sbjct  551  DFRTQFSDVLDLYLGNHFKLDNCTMFR  577



>gb|AFM84529.1| sacsin, partial [Columba livia]
Length=736

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804  IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
            I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  329  ILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  372

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
            KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  373  KLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  430

Query  444  AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
            A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  431  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  490

Query  264  LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
            +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  491  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLDA  550

Query  87   RILEQFPDQFSPFL--HFGCDLQNPFR  13
                QF D    +L  HF  D    FR
Sbjct  551  DFRTQFSDVLDLYLGDHFKLDNCTMFR  577



>ref|XP_003382377.1| PREDICTED: sacsin-like [Amphimedon queenslandica]
Length=3279

 Score =   172 bits (436),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 104/275 (38%), Positives = 144/275 (52%), Gaps = 25/275 (9%)
 Frame = -1

Query  804  IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
            +YLP   C +  A D  Y+D  W+               + A  +  +FVH  I    A+
Sbjct  233  VYLPTTDCLILPAKDCTYDDREWI------------RKRVGAGISKYKFVHEKIPPVAAK  280

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
              GV    + +    A SM L L+      GQ E +T R+  I+  Y+    V  EL+QN
Sbjct  281  YFGVEPLSKKV----APSMGLELTYTKA--GQSERVTRRIGGIVRDYSGNIDVFKELIQN  334

Query  444  AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
            A+DA ASKV  L+D   +GT SV++ EM+ WQGPAL  +NN+ FS QD   I  +  ESK
Sbjct  335  ADDAGASKVKLLIDWRHHGTESVIAEEMSQWQGPALIAYNNATFSDQDFKNICELAAESK  394

Query  264  LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL-PGISPSHPGLRIKFV-G  91
            ++ P   GRFG+GF + Y  TD+P+FVS  ++ +FDPH   L   ++ + PG+RI  V  
Sbjct  395  MKDPMKTGRFGVGFCACYSLTDVPSFVSRHSITIFDPHTKYLGDRVTHNEPGMRINLVEN  454

Query  90   RRILEQFPDQFSPFLH-FGCDL----QNPFRGTLF  1
            R  L  + DQF PF   FGC +       F GTLF
Sbjct  455  REDLTVYKDQFVPFDGLFGCHIFELTGEGFDGTLF  489


 Score =   119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 109/218 (50%), Gaps = 20/218 (9%)
 Frame = -1

Query  663   RFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMY  484
             R ++  I  + A +LG R     ++    D   L  +     FGQ E L  RL  IL+ Y
Sbjct  1282  RPIYPKIPRETALRLGARPLLDTIVKHIEDENFLDDTD----FGQSEDLVDRLNGILKKY  1337

Query  483   ADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQG----PALYCFNNSV  316
                  +  E +QNA+DA A+++ F+LD         L  E  +W      PAL  +NN  
Sbjct  1338  PADTSIFREYIQNADDAKATEIVFVLDHRSKHPQEKLLTEGTEWASLQRVPALCIYNNRQ  1397

Query  315   FSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS------GENVVMFDP  154
             F  +D+  I ++G+  K +    IGRFG+GFN  YH TD PTFVS       +++ +FDP
Sbjct  1398  FMEEDIKGICKLGRGGKGDTADTIGRFGIGFNVSYHLTDCPTFVSFDSHGHPKDLCVFDP  1457

Query  153   --HACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
                 C+       +PG R K V +R + QFPDQF PFL
Sbjct  1458  LKKYCNK---KKGNPGRRWK-VNQRHMNQFPDQFKPFL  1491



>gb|AFM84514.1| sacsin, partial [Calotes versicolor]
Length=736

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/263 (36%), Positives = 136/263 (52%), Gaps = 19/263 (7%)
 Frame = -1

Query  807  KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
            +I LPD+   L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  328  EILLPDIHLALLPANSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  371

Query  627  EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  372  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  429

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NA+DA A++V F+ D  Q+ +  +   + A  QGPAL  FNN  F+  D+  I  +G+ +
Sbjct  430  NADDAKATEVCFVFDPRQHPSDRIFDEKWAPLQGPALCVFNNQPFTEDDIRGIQNLGKGT  489

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
            K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  490  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  549

Query  90   RRILEQFPDQFSPFLHFGCDLQN  22
                 QF D  + +L     LQN
Sbjct  550  ADFRTQFSDVLNLYLGDHFKLQN  572



>ref|XP_002589277.1| hypothetical protein BRAFLDRAFT_102519 [Branchiostoma floridae]
 gb|EEN45288.1| hypothetical protein BRAFLDRAFT_102519 [Branchiostoma floridae]
Length=4368

 Score =   172 bits (436),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 137/228 (60%), Gaps = 13/228 (6%)
 Frame = -1

Query  663   RFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMY  484
             R +H +IS  +A+ LG+ S    L+  +A      L    + FGQ E +T RL+ I++ Y
Sbjct  1291  RTLHQSISPKMAKLLGIPSLTHRLVQPTA------LGPGMQLFGQKEPITRRLKTIIDEY  1344

Query  483   ADGPGVLFELVQNAEDANASKVAFLLDKSQYGT--SSVLSPEMADWQGPALYCFNNSVFS  310
              +GPG+ +EL+QNA+DA A++V F +D  Q      S+LSP MA  QGPAL+ +NN VF+
Sbjct  1345  KEGPGIFYELIQNADDAGATEVKFAVDWRQNTQVRKSLLSPGMAACQGPALWAYNNKVFT  1404

Query  309   PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL-PG  133
              +D+  I+ I   +K      IGRFGLGFNSVYH TD+P+FVS    V FDPH   L P 
Sbjct  1405  DEDIQNITEISGATKKTDTNKIGRFGLGFNSVYHMTDVPSFVSRHYFVCFDPHTTHLAPM  1464

Query  132   ISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQN---PFRGTLF  1
             ++   PG++I++    I   + DQF P+   FGC++ N   P+  TLF
Sbjct  1465  VNRLEPGMKIEWNREEIQNIYTDQFKPYDGIFGCNIFNSDTPYPATLF  1512


 Score =   158 bits (400),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 148/284 (52%), Gaps = 29/284 (10%)
 Frame = -1

Query  843   HLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQ  664
             + S VQ   D  +++LPD    L   + L YNDA WL                    +I 
Sbjct  2221  YFSGVQMPLD--RVFLPDREGTLRLVSQLAYNDARWL----------------PEDPSIP  2262

Query  663   RFVHGNISNDVAEKL-GVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
              +VH NI   +A K  GV++ R  L+ ++A           + FGQ E LT R++ ILE 
Sbjct  2263  YYVHDNIPFKLAVKFFGVKTVRSQLVDQTAGD----FCDIGQDFGQGEELTDRIKGILES  2318

Query  486   YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
             Y+ G  +  EL+QNA+DA A++V F+ D   +    +   E    QGP+L  +NN  FS 
Sbjct  2319  YSTGIDIFKELLQNADDAGATEVKFIYDTRCHSDKKIFDKEWKYLQGPSLLVYNNRTFSQ  2378

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS-GENVVMFDPHACSLPGI  130
              D+ AI +IG+ +K EK   IG+FG+GFN+VYH TD P+F++  E + +FDPHA  +PG 
Sbjct  2379  SDIDAIQKIGRGNKQEKGSTIGQFGVGFNAVYHLTDCPSFITDSETMCIFDPHARYVPGA  2438

Query  129   SPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRG-TLF  1
             +   PG  I      + E+FPD    F  F  + + P  G TLF
Sbjct  2439  TMRRPGRLIPM--ETLEEKFPDVLKTF--FVPNEEAPLEGSTLF  2478


 Score =   128 bits (322),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 87/130 (67%), Gaps = 7/130 (5%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLS--PE  364
            F QH        +IL+ Y D   +L EL+QNA+DA+A++V+FLLD + Y T  V    PE
Sbjct  18   FAQHLK-----ENILQKYPDSGQILKELIQNADDADATEVSFLLDHTDYNTRGVRCRYPE  72

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            + ++QGPALY FNN VF+ QD   I    Q +K + PF IGRFG+GFNSVYH TD+P+ +
Sbjct  73   LQEYQGPALYAFNNGVFTEQDWEGIRATEQGAKRKDPFRIGRFGVGFNSVYHITDLPSVM  132

Query  183  SGENVVMFDP  154
            SG+ +++ DP
Sbjct  133  SGDYILILDP  142



>gb|AFM84526.1| sacsin, partial [Struthio camelus]
Length=736

 Score =   168 bits (426),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807  KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
            +I LPD    L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  328  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  371

Query  627  EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  372  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  429

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  430  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  489

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
            K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  490  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  549

Query  90   RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D +  FR
Sbjct  550  ADFRTQFSDVLDLYLGNHFKLDNRTMFR  577



>gb|AFM84516.1| sacsin, partial [Zosterops japonicus]
Length=736

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807  KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
            +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  328  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  371

Query  627  EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  372  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  429

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  430  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  489

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
            K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  490  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  549

Query  90   RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  550  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  577



>ref|XP_002901723.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY57113.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=4807

 Score =   171 bits (434),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 113/182 (62%), Gaps = 3/182 (2%)
 Frame = -1

Query  537  FGQHESLTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMA  358
            FGQ   LT R+R IL  Y +G  +  E+VQNA+DA A+ V   LD  Q+  + +   ++A
Sbjct  12   FGQKIDLTVRIREILRNYPEGTSIFKEMVQNADDAGATDVNLCLDYRQHAATGLAYEKLA  71

Query  357  DWQGPALYCFNNSVFSPQDLYAISRIGQESKLE--KPFAIGRFGLGFNSVYHFTDIPTFV  184
             +QGP+L   NN+ FS  D  +I RIG   K +  K +  GRFG+GFNSVYH TD+PTFV
Sbjct  72   SFQGPSLLVHNNATFSAADFQSIQRIGDSLKKDNSKGWKTGRFGVGFNSVYHVTDLPTFV  131

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGR-RILEQFPDQFSPFLHFGCDLQNPFRGT  7
            SG  +V FDP AC LP ++PS+PG  I ++    +++ FP Q  PF  FGC+    F GT
Sbjct  132  SGSQLVFFDPQACHLPNVNPSNPGKMIDYIAHPDLVDNFPAQIDPFRCFGCNFSESFAGT  191

Query  6    LF  1
            +F
Sbjct  192  IF  193


 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 82/147 (56%), Gaps = 15/147 (10%)
 Frame = -1

Query  846   QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
             Q +SD   +    +++ PD    L  A  L ++DAPWL           +          
Sbjct  1434  QLISDTLQHHSDYELFAPDRDGVLEFAASLTFDDAPWL-----------NERDYETSSGS  1482

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESA-DSMNLSLSGAAEAFGQHESLTTRLRHILE  490
              RF+H  ISN+VA K+G RS R  LL ES  ++M+    G  EAFGQ E+LT R+ HILE
Sbjct  1483  TRFIHPKISNEVAAKIGCRSLRNQLLHESGHEAMSF---GDVEAFGQTEALTKRIAHILE  1539

Query  489   MYADGPGVLFELVQNAEDANASKVAFL  409
              Y DGP ++ EL+QNA+DA A++VA L
Sbjct  1540  QYPDGPNIISELIQNADDAGATRVAVL  1566


 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -1

Query  174   NVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNPFRGTLF  1
             N +MFDPHA  LPGIS  +PG++I+F    I++QFPDQF+PF   FGCDL++ ++GTLF
Sbjct  1568  NGLMFDPHATHLPGISAVNPGIKIRFANASIVKQFPDQFAPFKGVFGCDLEHHYKGTLF  1626



>ref|XP_010163801.1| PREDICTED: sacsin [Caprimulgus carolinensis]
Length=3831

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 138/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  1702  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  1745

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1746  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1803

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+ T  +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1804  NADDAKATEICFVFDPRQHPTDRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  1863

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  1864  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  1923

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1924  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  1951


 Score =   149 bits (375),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  671  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  722

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  723  SISDIFKELLQNADDANATECNFLIDMRRNMDIRETLLDPGMAACHGPALWSFNNSEFSD  782

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  783  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  842

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  843  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  894



>gb|KFZ46646.1| Sacsin, partial [Caprimulgus carolinensis]
Length=3853

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 138/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  1724  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  1767

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1768  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1825

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+ T  +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1826  NADDAKATEICFVFDPRQHPTDRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  1885

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  1886  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  1945

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1946  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  1973


 Score =   149 bits (375),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  693  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  744

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  745  SISDIFKELLQNADDANATECNFLIDMRRNMDIRETLLDPGMAACHGPALWSFNNSEFSD  804

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  805  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  864

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  865  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  916



>gb|ELK09292.1| Sacsin [Pteropus alecto]
Length=3445

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  1431  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  1474

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1475  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1532

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    V   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1533  NADDAKATEICFVFDPRQHPADRVFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  1592

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  1593  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSMSPGRMFRDLD  1652

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1653  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  1680


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 127/217 (59%), Gaps = 14/217 (6%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  S ++M        E  GQ E LT R+++ILE Y 
Sbjct  724  LVHEDIPMKTAEWLKVPCLSTRLI--SPENMGF------EQSGQREPLTVRIQNILEEYP  775

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  776  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  835

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  836  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  895

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
               S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  896  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCRL  932



>ref|XP_006915912.1| PREDICTED: sacsin [Pteropus alecto]
Length=4538

 Score =   170 bits (431),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2426  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2469

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2470  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2527

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    V   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2528  NADDAKATEICFVFDPRQHPADRVFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2587

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2588  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSMSPGRMFRDLD  2647

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2648  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2675


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 112/185 (61%), Gaps = 8/185 (4%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  164  FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSKDM  223

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QG ALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   S
Sbjct  224  AQYQGAALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIFS  283

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNPF  16
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+  FG      +   F
Sbjct  284  GDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LSDQFAPFIGIFGSSKETFINGNF  341

Query  15   RGTLF  1
             GT F
Sbjct  342  PGTFF  346


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 127/217 (59%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  S ++M        E  GQ E LT R+++ILE Y 
Sbjct  1397  LVHEDIPMKTAEWLKVPCLSTRLI--SPENMGF------EQSGQREPLTVRIQNILEEYP  1448

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1449  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1508

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1509  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1568

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1569  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCRL  1605



>ref|XP_009288519.1| PREDICTED: sacsin [Aptenodytes forsteri]
Length=4441

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2312  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2355

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2356  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2413

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2414  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2473

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2474  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2533

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    FL  HF  D    FR
Sbjct  2534  ADFRTQFSDVLDLFLGNHFKLDNCTMFR  2561


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1281  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1332

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1333  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1392

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1393  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1452

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1453  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1504


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|KFV63988.1| Sacsin, partial [Picoides pubescens]
Length=4523

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2394  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2437

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2438  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2495

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A++V F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2496  NADDAKATEVCFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2555

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2556  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLD  2615

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2616  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2643


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1363  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1414

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1415  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1474

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1475  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1534

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1535  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1586


 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  195



>gb|KFQ05946.1| Sacsin, partial [Haliaeetus albicilla]
Length=4523

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 137/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L +A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2395  ILLPDTRLALLSAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2438

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2439  KLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2496

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2497  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2556

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2557  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLDA  2616

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2617  DFRTQFSDVLDLYLGNHFKLDNCTMFR  2643


 Score =   149 bits (377),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1363  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1414

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1415  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1474

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1475  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1534

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  F+GTLF
Sbjct  1535  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSFKGTLF  1586


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  195



>ref|XP_010086209.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Pterocles gutturalis]
Length=4428

 Score =   170 bits (430),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 138/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2299  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2342

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2343  VKLGAIPKRHKALERYAS--NICFTALGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2400

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+ +  +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2401  NADDAKATEICFVFDPRQHPSDRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2460

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2461  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2520

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2521  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2548


 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 136/232 (59%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNSVFS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSVFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|KFM02372.1| Sacsin, partial [Aptenodytes forsteri]
Length=4574

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2445  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2488

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2489  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2546

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2547  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2606

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2607  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2666

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    FL  HF  D    FR
Sbjct  2667  ADFRTQFSDVLDLFLGNHFKLDNCTMFR  2694


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1414  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1465

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1466  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1525

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1526  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1585

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1586  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1637


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  84   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  143

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  144  AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  203

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  204  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  246



>gb|ELK36851.1| Sacsin [Myotis davidii]
Length=2206

 Score =   169 bits (429),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807  KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
            KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  711  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  754

Query  627  EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  755  VKLGAVPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  812

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  813  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTDDDVRGIQNLGKGT  872

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
            K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  873  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  932

Query  90   RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  933  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  960



>ref|XP_009919582.1| PREDICTED: sacsin [Haliaeetus albicilla]
Length=4432

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 137/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L +A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2304  ILLPDTRLALLSAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2347

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2348  KLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2405

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2406  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2465

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2466  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLDA  2525

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2526  DFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  F+GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSFKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_009894365.1| PREDICTED: sacsin [Picoides pubescens]
Length=4432

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A++V F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEVCFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2552


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_010570952.1| PREDICTED: sacsin [Haliaeetus leucocephalus]
Length=4432

 Score =   170 bits (430),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 137/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L +A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2304  ILLPDTRLALLSAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2347

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2348  KLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2405

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2406  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2465

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2466  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLDA  2525

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2526  DFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   149 bits (377),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  F+GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSFKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_006754952.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Myotis davidii]
Length=4405

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2279  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2322

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2323  VKLGAVPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2380

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2381  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTDDDVRGIQNLGKGT  2440

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2441  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2500

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2501  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2528


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 127/217 (59%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1282  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1333

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1334  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1393

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1394  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1453

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1454  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQL  1490


 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 72/126 (57%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QG ALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGSALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K     I E   DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSEEISE-LSDQFAPFIGIFGSSKETFINGH  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>ref|XP_005883195.1| PREDICTED: sacsin-like [Myotis brandtii]
Length=3830

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  1700  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  1743

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1744  VKLGAVPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1801

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1802  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTDDDVRGIQNLGKGT  1861

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  1862  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  1921

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1922  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  1949


 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  671  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  722

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  723  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  782

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  783  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  842

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  843  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVETPYSYSGTLF  894



>gb|EPQ18244.1| Sacsin [Myotis brandtii]
Length=3781

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  1651  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  1694

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1695  VKLGAVPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1752

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1753  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTDDDVRGIQNLGKGT  1812

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  1813  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  1872

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1873  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  1900


 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  622  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  673

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  674  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  733

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  734  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  793

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  794  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVETPYSYSGTLF  845



>ref|XP_010000200.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Chaetura pelagica]
Length=4448

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2319  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2362

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2363  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2420

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2421  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2480

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2481  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLD  2540

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2541  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2568


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1281  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1332

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1333  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1392

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1393  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1452

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1453  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1504


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_006083668.1| PREDICTED: sacsin isoform X1 [Myotis lucifugus]
Length=4441

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2311  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2354

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2355  VKLGAVPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2412

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2413  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTDDDVRGIQNLGKGT  2472

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2473  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2532

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2533  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2560


 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1282  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1333

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1334  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1393

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1394  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1453

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1454  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVETPYSYSGTLF  1505


 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 72/126 (57%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QG ALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGSALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K     I E   DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSEEISE-LSDQFAPFIGIFGSSKETFINGH  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>gb|AFM84537.1| sacsin, partial [Naja atra]
Length=736

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 134/268 (50%), Gaps = 21/268 (8%)
 Frame = -1

Query  807  KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
            +I LPD    L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  328  EILLPDTRLALLPANSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  371

Query  627  EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  372  VKLGTIPKRHKALERYAS--NICFTAPGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  429

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NA+DA A++V F+ D  Q+    +   + +  QGPAL  FNN  F+  D+  I  +G+ +
Sbjct  430  NADDAKATEVCFVFDPRQHPVDRIFDEKWSPLQGPALCVFNNQPFTEDDIRGIQNLGKGT  489

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
            K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  490  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  549

Query  90   RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  550  ADFRTQFSDVLDLYLGGHFKLDNCTMFR  577



>ref|XP_006083669.1| PREDICTED: sacsin isoform X2 [Myotis lucifugus]
Length=4432

 Score =   169 bits (429),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2302  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2345

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2346  VKLGAVPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2403

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2404  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTDDDVRGIQNLGKGT  2463

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2464  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2523

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2524  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2551


 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1273  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1324

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1325  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1384

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1385  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1444

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1445  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVETPYSYSGTLF  1496


 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 72/126 (57%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QG ALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGSALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K     I E   DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSEEISE-LSDQFAPFIGIFGSSKETFINGH  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>gb|AFM84521.1| sacsin, partial [Hemidactylus bowringii]
Length=736

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/268 (36%), Positives = 134/268 (50%), Gaps = 21/268 (8%)
 Frame = -1

Query  807  KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
            KI LPD    L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  328  KILLPDTRLALLPADSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  371

Query  627  EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             KLG    R   L   A   N+  +     FGQ E+LT R++ IL  Y     +L EL+Q
Sbjct  372  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKETLTGRIKSILNAYPSEKEMLKELLQ  429

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NA+DA A++V F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  430  NADDAKATEVCFVFDPRQHPVDRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  489

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
            K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  490  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  549

Query  90   RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  550  SDFRTQFSDVLDLYLGDHFKLDNCTMFR  577



>ref|XP_004604552.1| PREDICTED: sacsin [Sorex araneus]
Length=4566

 Score =   169 bits (428),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2436  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2479

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2480  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2537

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2538  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVKGIQNLGKGT  2597

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2598  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2657

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2658  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2685


 Score =   146 bits (368),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1407  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1458

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1459  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1518

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1519  SDFLNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1578

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1579  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDIFGCQLPLTVEAPYSYNGTLF  1630


 Score =   142 bits (357),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 104/165 (63%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  81   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSKDM  140

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QG ALY +N++VF+ +D   I  I +  K + P  +GRFG+GFNSVYH TD+P   S
Sbjct  141  APYQGAALYVYNDAVFTVEDWCGIQEIARSRKRDDPLKVGRFGIGFNSVYHITDVPCIFS  200

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G+  S     +K   + I E   DQF+PF+
Sbjct  201  GDQIGMLDPHQ-TLFGLHESGQCWNLKDDSKEISE-LSDQFAPFV  243



>ref|XP_008157701.1| PREDICTED: sacsin isoform X2 [Eptesicus fuscus]
Length=4432

 Score =   169 bits (428),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2302  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2345

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2346  VKLGAIPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2403

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2404  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTDDDVRGIQNLGKGT  2463

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2464  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2523

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2524  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2551


 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1273  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1324

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1325  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1384

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1385  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1444

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1445  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVETPYSYSGTLF  1496


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QG ALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGSALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E  PDQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LPDQFAPFI  104



>gb|KFU92814.1| Sacsin, partial [Chaetura pelagica]
Length=4523

 Score =   169 bits (428),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2394  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2437

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2438  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2495

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2496  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2555

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2556  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLD  2615

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2616  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2643


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1363  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1414

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1415  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1474

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1475  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1534

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1535  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1586


 Score =   145 bits (367),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++Q+GT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQHGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  195



>ref|XP_008157700.1| PREDICTED: sacsin isoform X1 [Eptesicus fuscus]
Length=4579

 Score =   169 bits (428),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2449  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2492

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2493  VKLGAIPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2550

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2551  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTDDDVRGIQNLGKGT  2610

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2611  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2670

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2671  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2698


 Score =   151 bits (382),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  89   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSKDM  148

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QG ALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   S
Sbjct  149  AQYQGSALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIFS  208

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E  PDQF+PF+
Sbjct  209  GDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LPDQFAPFI  251


 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1420  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1471

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1472  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1531

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1532  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1591

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1592  KDRSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVETPYSYSGTLF  1643



>ref|XP_009950489.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Leptosomus discolor]
Length=4514

 Score =   169 bits (428),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2385  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2428

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2429  VKLGAIPKRHKALERYAS--NICFTTLGSEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2486

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2487  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2546

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2547  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2606

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2607  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2634


 Score =   149 bits (375),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 136/234 (58%), Gaps = 20/234 (9%)
 Frame = -1

Query  666   QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
             +  VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE 
Sbjct  1354  EXLVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEE  1405

Query  486   YADGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVF  313
             Y     +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS F
Sbjct  1406  YPSISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEF  1465

Query  312   SPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG  133
             S  D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +  
Sbjct  1466  SDSDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISK  1525

Query  132   --ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                  S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1526  HIRDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1579


 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  28   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  87

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  88   AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  147

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  148  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LSDQFAPFI  190



>gb|AFM84512.1| sacsin, partial [Alligator sinensis]
Length=736

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 133/267 (50%), Gaps = 21/267 (8%)
 Frame = -1

Query  804  IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
            I LPD    L +A  L YND PW+                  K T  ++ H +I  +VA 
Sbjct  329  ILLPDTRLALLSAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVAV  372

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
            KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  373  KLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  430

Query  444  AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
            A+DA A+++ F+ D   +    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  431  ADDAKATEICFVFDPRHHPVDRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  490

Query  264  LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
               P   G++G+GFNSVYH TD P+F+SG N++ +FDPHA   PG +   PG   + +  
Sbjct  491  EGNPCKTGQYGIGFNSVYHITDCPSFISGNNILCIFDPHARYAPGATSVSPGRMFRDLDA  550

Query  87   RILEQFPDQFSPFL--HFGCDLQNPFR  13
                QF D    +L  HF  D    FR
Sbjct  551  DFRTQFSDVLDLYLGDHFKLDNCTMFR  577



>gb|AFM84531.1| sacsin, partial [Trachemys scripta]
Length=736

 Score =   166 bits (419),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 139/281 (49%), Gaps = 25/281 (9%)
 Frame = -1

Query  846  QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
            Q L + ++ E    I LPD    L  A  L YND PW+                  K T 
Sbjct  319  QELCEKKYGE----ILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTT  358

Query  666  QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
             ++ H +I  +VA KLG    R   L   A   N+  +     FGQ E LT+R++ IL  
Sbjct  359  VKYCHADIPREVAVKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNA  416

Query  486  YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
            Y     +L EL+QNA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+ 
Sbjct  417  YPSEKEMLKELLQNADDAKATEICFVFDSRQHPVDRIFDEKWAPLQGPALCVYNNQPFTE  476

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGI  130
             D+  I  +G+ +K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG 
Sbjct  477  DDIRGIQNLGKGTKEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGA  536

Query  129  SPSHPGLRIKFVGRRILEQFPDQFSPFL--HFGCDLQNPFR  13
            +   PG   + +      QF D    +L  HF  D    FR
Sbjct  537  TSVSPGRMFRDLDADFRTQFSDVLDLYLGNHFKMDNCTMFR  577



>ref|XP_009475086.1| PREDICTED: sacsin [Nipponia nippon]
Length=3831

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  1702  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  1745

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1746  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1803

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1804  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  1863

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  1864  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  1923

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1924  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  1951


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  671  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  722

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  723  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  782

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  783  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  842

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  843  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCHLPLTVESPYSYKGTLF  894



>gb|KFZ68285.1| Sacsin, partial [Podiceps cristatus]
Length=3869

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  1740  EILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  1783

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1784  VKLGAIPKRHKALERYAS--NICFTSLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1841

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1842  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  1901

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  1902  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  1961

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1962  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  1989


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  709  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  760

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  761  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  820

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  821  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  880

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  881  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  932



>gb|AFM84538.1| sacsin, partial [Pelodiscus sinensis]
Length=736

 Score =   166 bits (419),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 139/281 (49%), Gaps = 25/281 (9%)
 Frame = -1

Query  846  QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
            Q L + ++ E    I LPD    L  A  L YND PW+                  K T 
Sbjct  319  QELCEKKYGE----ILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTT  358

Query  666  QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
             ++ H +I  +VA KLG    R   L   A   N+  +     FGQ E LT+R++ IL  
Sbjct  359  VKYCHADIPREVAVKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNA  416

Query  486  YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
            Y     +L EL+QNA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+ 
Sbjct  417  YPSEKEMLKELLQNADDAKATEICFVFDSRQHPVDRIFDEKWAPLQGPALCVYNNQPFTE  476

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGI  130
             D+  I  +G+ +K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG 
Sbjct  477  DDIRGIQNLGKGTKEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGA  536

Query  129  SPSHPGLRIKFVGRRILEQFPDQFSPFL--HFGCDLQNPFR  13
            +   PG   + +      QF D    +L  HF  D    FR
Sbjct  537  TSMSPGRMFRDLDADFRTQFSDVLDLYLGNHFKMDNCTMFR  577



>ref|XP_005022634.1| PREDICTED: sacsin [Anas platyrhynchos]
Length=4432

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2304  ILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2347

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2348  KLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2405

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2406  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2465

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2466  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLDA  2525

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2526  DFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score =   100 bits (249),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDLPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SGE + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGEQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|EOA99087.1| Sacsin, partial [Anas platyrhynchos]
Length=4493

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2365  ILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2408

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2409  KLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2466

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2467  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2526

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2527  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLDA  2586

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2587  DFRTQFSDVLDLYLGNHFKLDNCTMFR  2613


 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  3    FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  62

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  63   AQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDLPSIFS  122

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            GE + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  123  GEQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  165


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1333  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1384

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1385  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1444

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1445  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1504

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1505  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1556



>ref|XP_009888919.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Charadrius vociferus]
Length=4412

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2283  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2326

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2327  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2384

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2385  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2444

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2445  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2504

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2505  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2532


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1268  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1319

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1320  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1379

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1380  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1439

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1440  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1491


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_010138377.1| PREDICTED: sacsin [Buceros rhinoceros silvestris]
Length=4432

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEISE-LTDQFAPFI  104



>gb|KFP21003.1| Sacsin, partial [Egretta garzetta]
Length=4523

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2394  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2437

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2438  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2495

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2496  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2555

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2556  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2615

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2616  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2643


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1363  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1414

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1415  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1474

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1475  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1534

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1535  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1586


 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  195



>gb|KFV57297.1| Sacsin, partial [Tyto alba]
Length=4516

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2387  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2430

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2431  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2488

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2489  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2548

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2549  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2608

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2609  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2636


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1360  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1411

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1412  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1471

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1472  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1531

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1532  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1583


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFV  195



>ref|XP_010306927.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Balearica regulorum gibbericeps]
Length=4432

 Score =   169 bits (427),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_009326039.1| PREDICTED: sacsin [Pygoscelis adeliae]
Length=4442

 Score =   169 bits (427),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2313  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2356

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2357  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2414

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2415  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2474

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2475  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2534

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2535  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2562


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1281  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1332

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1333  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1392

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1393  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1452

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1453  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1504


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_009813779.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Gavia stellata]
Length=4367

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2238  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2281

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2282  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2339

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2340  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2399

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2400  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2459

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2460  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2487


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1205  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1256

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1257  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1316

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1317  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1376

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1377  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1428



>ref|XP_009643181.1| PREDICTED: sacsin [Egretta garzetta]
Length=4432

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_005446509.1| PREDICTED: sacsin [Falco cherrug]
Length=4432

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLSVESPYSYKGTLF  1495


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGSHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_009941509.1| PREDICTED: sacsin [Opisthocomus hoazin]
Length=4432

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|KFO92165.1| Sacsin, partial [Buceros rhinoceros silvestris]
Length=4512

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2383  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2426

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2427  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2484

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2485  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2544

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2545  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2604

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2605  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2632


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1363  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1414

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1415  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1474

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1475  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1534

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1535  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1586


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEISE-LTDQFAPFI  195



>gb|KFW69747.1| Sacsin, partial [Pygoscelis adeliae]
Length=4524

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2395  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2438

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2439  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2496

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2497  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2556

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2557  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2616

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2617  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2644


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1363  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1414

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1415  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1474

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1475  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1534

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1535  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1586


 Score =   145 bits (367),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D+++YGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETRYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  195



>ref|XP_005244639.1| PREDICTED: LOW QUALITY PROTEIN: spastic ataxia of Charlevoix-Saguenay 
(sacsin) [Falco peregrinus]
Length=4432

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2552


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 126/217 (58%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQL  1480


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGSHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_009486035.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Pelecanus crispus]
Length=3836

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  1707  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  1750

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1751  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1808

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1809  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  1868

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  1869  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  1928

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1929  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  1956


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  671  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  722

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  723  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  782

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  783  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  842

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  843  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  894



>ref|XP_010198542.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Colius striatus]
Length=4428

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2299  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2342

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2343  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2400

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2401  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2460

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2461  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2520

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2521  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2548


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDNKEINE-LTDQFAPFI  104



>gb|KFR17487.1| Sacsin, partial [Opisthocomus hoazin]
Length=4523

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2394  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2437

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2438  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2495

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2496  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2555

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2556  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2615

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2616  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2643


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1363  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1414

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1415  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1474

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1475  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1534

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1535  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1586


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  195



>gb|KFV46567.1| Sacsin, partial [Gavia stellata]
Length=4368

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2239  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2282

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2283  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2340

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2341  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2400

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2401  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2460

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2461  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2488


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1218  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1269

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1270  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1329

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1330  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1389

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1390  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1441



>ref|XP_010191687.1| PREDICTED: sacsin isoform X1 [Mesitornis unicolor]
Length=4432

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|KFQ57525.1| Sacsin, partial [Pelecanus crispus]
Length=3849

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  1720  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  1763

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1764  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1821

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1822  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  1881

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  1882  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  1941

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1942  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  1969


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  697  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  748

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  749  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  808

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  809  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  868

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  869  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  920



>ref|XP_010295867.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Phaethon lepturus]
Length=4442

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2313  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2356

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2357  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2414

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2415  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2474

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2475  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2534

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2535  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2562


 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1278  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1329

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1330  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1389

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1390  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1449

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1450  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1501


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEISE-LTDQFAPFI  104



>ref|XP_010191688.1| PREDICTED: sacsin isoform X2 [Mesitornis unicolor]
Length=4423

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2294  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2337

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2338  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2395

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2396  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2455

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2456  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2515

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2516  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2543


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1263  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1314

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1315  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1374

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1375  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1434

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1435  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1486


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|KFP53043.1| Sacsin, partial [Cathartes aura]
Length=3832

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  1703  EILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  1746

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1747  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1804

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1805  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  1864

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  1865  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  1924

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1925  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  1952


 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 126/217 (58%), Gaps = 14/217 (6%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  693  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  744

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  745  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  804

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  805  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  864

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
               S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  865  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQL  901



>gb|KFQ92839.1| Sacsin, partial [Nipponia nippon]
Length=4535

 Score =   169 bits (427),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2406  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2449

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2450  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2507

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2508  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2567

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2568  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2627

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2628  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2655


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1375  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1426

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1427  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1486

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1487  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1546

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1547  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCHLPLTVESPYSYKGTLF  1598


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  195



>ref|XP_009970016.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Tyto alba]
Length=4439

 Score =   169 bits (427),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2310  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2353

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2354  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2411

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2412  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2471

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2472  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2531

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2532  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2559


 Score =   148 bits (373),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFV  104



>ref|XP_009504976.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Phalacrocorax carbo]
Length=4441

 Score =   169 bits (427),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2312  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2355

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2356  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2413

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2414  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2473

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2474  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2533

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2534  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2561


 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 126/217 (58%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P M+   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMSACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQL  1480


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_009571237.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Fulmarus glacialis]
Length=4359

 Score =   169 bits (427),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2230  EILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2273

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2274  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2331

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2332  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2391

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2392  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2451

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2452  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2479


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1206  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1257

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1258  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1317

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1318  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1377

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1378  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1429



>gb|KFQ84776.1| Sacsin, partial [Phoenicopterus ruber ruber]
Length=4559

 Score =   169 bits (427),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2430  EILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2473

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2474  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2531

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2532  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2591

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2592  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2651

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2652  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2679


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1399  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1450

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1451  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1510

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1511  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1570

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1571  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1622


 Score =   146 bits (368),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++Q+GT ++ S +M
Sbjct  78   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQHGTETLWSKDM  137

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  138  AQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  197

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  198  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  240



>ref|XP_009867454.1| PREDICTED: sacsin [Apaloderma vittatum]
Length=4432

 Score =   169 bits (427),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEREMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score =   100 bits (248),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEISE-LTDQFAPFI  104



>ref|XP_010013957.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Nestor notabilis]
Length=4429

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2300  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTIKYCHGDIPREVA  2343

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2344  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2401

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2402  NADDAKATEICFVFDPRQHPVDRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2461

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2462  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2521

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2522  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2549


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 97.4 bits (241),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            M  +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MVQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|KFP88474.1| Sacsin, partial [Apaloderma vittatum]
Length=4523

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2394  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2437

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2438  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEREMLKELLQ  2495

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2496  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2555

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2556  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2615

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2616  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2643


 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEISE-LTDQFAPFI  195


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1363  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1414

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1415  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1474

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1475  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1534

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1535  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1586



>gb|AFM84527.1| sacsin, partial [Melopsittacus undulatus]
Length=736

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 135/268 (50%), Gaps = 21/268 (8%)
 Frame = -1

Query  807  KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
            +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  328  EILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTIKYCHGDIPREVA  371

Query  627  EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL Q
Sbjct  372  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELPQ  429

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  430  NADDAKATEICFVFDPRQHPVDRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  489

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
            K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG   + PG   + + 
Sbjct  490  KVGNPCKTGQYGIGFNSVYHVTDCPSFLSGNDILCIFDPHARYAPGSISTSPGRMFRDLD  549

Query  90   RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  550  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  577



>ref|XP_005501499.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Columba livia]
Length=4434

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2306  ILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2349

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2350  KLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2407

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2408  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2467

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2468  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLDA  2527

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2528  DFRTQFSDVLDLYLGDHFKLDNCTMFR  2554


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1281  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1332

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1333  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1392

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1393  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1452

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1453  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1504


 Score = 99.8 bits (247),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEISE-LTDQFAPFI  104



>gb|AFM84535.1| sacsin, partial [Podocnemis unifilis]
Length=736

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 134/268 (50%), Gaps = 21/268 (8%)
 Frame = -1

Query  807  KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
            +I LPD    L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  328  EILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  371

Query  627  EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  372  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  429

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  430  NADDAKATEICFVFDSRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  489

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
            K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  490  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSMSPGRMFRDLD  549

Query  90   RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  550  ADFRTQFSDVLDLYLGNHFKMDNCTMFR  577



>gb|KFQ24452.1| Sacsin, partial [Merops nubicus]
Length=4459

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2330  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2373

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2374  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2431

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2432  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2491

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2492  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2551

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2552  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2579


 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1299  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1350

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1351  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1410

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1411  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1470

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1471  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1522


 Score =   137 bits (345),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -1

Query  459  ELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRI  280
            EL+QNAEDA A++V FL D++QYGT ++ S +MA +QGPA Y +N++VF+P+D + I  I
Sbjct  2    ELIQNAEDAGATEVRFLYDETQYGTETLWSKDMAQYQGPAFYAYNDAVFTPEDWHGIQEI  61

Query  279  GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIK  100
             +  K + P  +GRFG+GFNSVYH TD+P+  SG+ + M DPH  +L G   S     +K
Sbjct  62   ARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFSGDQIGMLDPHQ-TLFGPHESGQCWNLK  120

Query  99   FVGRRILEQFPDQFSPFL  46
               + I E   DQF+PF+
Sbjct  121  EDSKEINE-LTDQFAPFI  137



>ref|XP_005516322.1| PREDICTED: sacsin [Pseudopodoces humilis]
Length=4580

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2451  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2494

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2495  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2552

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2553  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2612

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2613  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2672

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2673  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2700


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1420  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1471

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1472  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1531

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1532  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1591

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1592  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1643


 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  90   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  149

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  150  AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  209

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  210  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  252



>ref|XP_008948241.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Merops nubicus]
Length=4437

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2308  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2351

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2352  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2409

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2410  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2469

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2470  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2529

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2530  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2557


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1277  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1328

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1329  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1388

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1389  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1448

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1449  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1500


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_010949933.1| PREDICTED: sacsin [Camelus bactrianus]
Length=4339

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2209  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2252

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2253  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2310

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2311  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2370

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2371  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2430

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2431  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2458


 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1180  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1231

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1232  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1291

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1292  SDFVNITRLGESLKRAEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1351

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1352  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYSGTLF  1403


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K   + I  +  DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEI-SKLSDQFAPFIGIFGSTKETFINGS  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>gb|AFM84536.1| sacsin, partial [Scincella reevesii]
Length=736

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/281 (35%), Positives = 140/281 (50%), Gaps = 25/281 (9%)
 Frame = -1

Query  846  QHLSDVQFYEDQIKIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTI  667
            Q L + ++ E    I LPD    L  A  L YND PW+                  K T 
Sbjct  319  QELCEKKYGE----ILLPDTRLALLPANSLCYNDCPWI----------------KVKDTT  358

Query  666  QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEM  487
             ++ HG+I  +VA KLG    R   L   A   N+  +     FGQ E LT R++ IL  
Sbjct  359  VKYCHGDIPREVAVKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTGRIKSILNA  416

Query  486  YADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
            Y     +L EL+QNA+DA A++V F+ D  Q+ +  +   + +  QGPAL  FNN  F+ 
Sbjct  417  YPSEKEMLKELLQNADDAKATEVCFVFDPRQHPSDRIFDEKWSPLQGPALCVFNNQPFTE  476

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGI  130
             D+  I  +G+ +K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG 
Sbjct  477  DDIRGIQNLGKGTKEGNPGKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGA  536

Query  129  SPSHPGLRIKFVGRRILEQFPDQFSPFL--HFGCDLQNPFR  13
            +   PG   + +      QF D    +L  HF  +    FR
Sbjct  537  TSLSPGRMFRDLDTDFRTQFSDVLDLYLGDHFKLENCTMFR  577



>ref|XP_009564744.1| PREDICTED: sacsin [Cuculus canorus]
Length=4429

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2300  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2343

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2344  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2401

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2402  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2461

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2462  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2521

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2522  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2549


 Score =   149 bits (375),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1269  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1320

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1321  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1380

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1381  SDFLNITRLGESLKRSEADKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1440

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1441  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1492


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_005038141.1| PREDICTED: sacsin [Ficedula albicollis]
Length=4432

 Score =   168 bits (426),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|EKC22471.1| Sacsin [Crassostrea gigas]
Length=3200

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 143/230 (62%), Gaps = 19/230 (8%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             FVH ++S+D A KLGV S    LL+E+            + +GQ E LT R++++L+ Y 
Sbjct  1236  FVHEDVSSDTAAKLGVPSLTENLLSETE---------GIQEWGQKEPLTRRIKNLLKDYK  1286

Query  480   DGPGVLFELVQNAEDANASKVAFLLDKSQYG--TSSVLSPEMADWQGPALYCFNNSVFSP  307
             DG  V  ELVQNA+DA A+K+ FL D+ +     + ++   MA  QGPAL+ FN+++FS 
Sbjct  1287  DGFVVPKELVQNADDAKATKICFLYDERENKDCRTRLIDENMASCQGPALWAFNDALFSQ  1346

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSL-PGI  130
             +DL  I+++   +K      +G+FGLGF SVY+ TD+P+F++G N+V+FDPHA  +   +
Sbjct  1347  KDLENITKLSGATKANDLTKVGKFGLGFCSVYNLTDVPSFITGSNMVIFDPHAKYIGKAV  1406

Query  129   SPSHPGLRIKFVGRR---ILEQFPDQFSPFLH-FGCDL--QNP-FRGTLF  1
               ++PGL+I     +   ++ +  +QF PF   FGC+L  +NP F GTLF
Sbjct  1407  KRNNPGLKIDLTATKNKILIRRMKNQFKPFNGIFGCNLDTENPSFTGTLF  1456


 Score =   137 bits (346),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 125/228 (55%), Gaps = 19/228 (8%)
 Frame = -1

Query  663   RFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMY  484
             +F+H  I    AE LGV+S       + + S+  +     + FGQ E L+ R++ IL+ Y
Sbjct  2261  KFIHPRIRGKDAETLGVQS-------KISGSLVQNYIMKLKPFGQKEELSDRIKRILQQY  2313

Query  483   ADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQ  304
                  VL E++QNA+DANAS+V F+ D + Y T      +    QGPAL  +NNS F+  
Sbjct  2314  PVSEAVLKEMLQNADDANASEVMFITDFNTYKTEKTFESKWHPLQGPALLVYNNSYFTDD  2373

Query  303   DLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSG------ENVVMFDPHACS  142
             D+  I  +G+ SK + P   G++G+GFN+VYH TD+P+F+S       + + + DPH   
Sbjct  2374  DIAGIQHLGRGSKGDDPTKTGQYGVGFNAVYHITDVPSFLSKSPDKDCDTLCVMDPHCKY  2433

Query  141   LPGISPSHPGLRIKFVGRRILEQ-FPDQFSPFLHFGCDLQNPFRGTLF  1
              PG   + PG R  F+    L + FPD F+ + H    LQ+   GTLF
Sbjct  2434  APGADENSPGAR--FIDLDDLRKSFPDVFTCY-HENTLLQSS--GTLF  2476


 Score = 89.0 bits (219),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 77/244 (32%), Positives = 113/244 (46%), Gaps = 20/244 (8%)
 Frame = -1

Query  693  MALHAKQTIQRFVHGNISNDVAEK----LGVRSFRRMLLAESADSMNLSLSGAAEAFGQH  526
            M L   +   RF +   S D AE     +   S++   +   AD ++       E  G  
Sbjct  105  MWLEEAKYDMRFAYQ--SEDRAESYFSWICFTSYQSESVVNMADDVDTESDDEIECSGMI  162

Query  525  ES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDK--SQYGTSSVLSPEMAD  355
            +  L  +L+ IL  Y D   +L EL+QNAEDA AS++  L D   +    S+  +P    
Sbjct  163  QPPLIKQLQTILSEYPDDGQILKELIQNAEDAGASEMKILYDDRPAVQEPSTKRAPFRKY  222

Query  354  WQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGE  175
            ++GPAL  +NN+ F   D   I  +    K      +GRFGLGF SV+H TD P  +SG+
Sbjct  223  FKGPALVVYNNAEFIEADWTGIKMLYSSIKEFDKTKVGRFGLGFKSVFHITDHPVIISGD  282

Query  174  NVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQNP-----FR  13
             +++ DPH  S    S     +++K + R    +  D    F   FG D QN      F 
Sbjct  283  QLLVLDPHQDS----SKVCQTMKLKKLHRYKKMKVEDCLKAFSGVFGFD-QNTLECGHFN  337

Query  12   GTLF  1
            GT+F
Sbjct  338  GTIF  341



>gb|EFB22146.1| hypothetical protein PANDA_009473 [Ailuropoda melanoleuca]
Length=4582

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2452  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2495

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2496  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2553

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2554  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2613

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2614  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2673

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2674  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2701


 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 117/194 (60%), Gaps = 6/194 (3%)
 Frame = -1

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHES-LTTRLRHILEMYADGPGVLFELVQ  448
            K+G  +F+   L  +  S  L   G    FGQ    L   L+ IL  Y +G  +L EL+Q
Sbjct  68   KIGDLTFKNCHLFVNLQSKGLKGGGR---FGQTTPPLVDFLKDILRRYPEGGQILKELIQ  124

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NAEDA A++V FL D++QYGT ++ S +MA +QGPALY +NN+VF+P+D + I  I +  
Sbjct  125  NAEDAGATEVKFLYDETQYGTETLWSKDMAQYQGPALYVYNNAVFTPEDWHGIQEIARSR  184

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR  88
            K + P  +GRFG+GFNSVYH TD+P   SG+ + M DPH  +L G   S     +K   +
Sbjct  185  KKDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSK  243

Query  87   RILEQFPDQFSPFL  46
             I E   DQF+PF+
Sbjct  244  EISE-LSDQFAPFI  256


 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1423  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1474

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1475  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1534

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1535  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1594

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1595  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1646



>ref|XP_005417740.1| PREDICTED: sacsin [Geospiza fortis]
Length=4580

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2451  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2494

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2495  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2552

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2553  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2612

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2613  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2672

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2673  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2700


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1420  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1471

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1472  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1531

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1532  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1591

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1592  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1643


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  90   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  149

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  150  AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  209

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  210  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  252



>gb|EPY87075.1| sacsin [Camelus ferus]
Length=4063

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  1933  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  1976

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1977  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2034

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2035  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2094

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2095  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2154

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2155  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2182


 Score =   151 bits (382),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 113/185 (61%), Gaps = 8/185 (4%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  118  FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSEDM  177

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   S
Sbjct  178  AQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIFS  237

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNPF  16
            G+ + M DPH  +L G   S     +K   + I  +  DQF+PF+  FG      +   F
Sbjct  238  GDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEI-SKLSDQFAPFIGIFGSTKETFINGSF  295

Query  15   RGTLF  1
             GT F
Sbjct  296  PGTFF  300


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 69/127 (54%), Gaps = 10/127 (8%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1230  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1281

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1282  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1341

Query  306   QDLYAIS  286
              D   I+
Sbjct  1342  SDFVNIT  1348



>ref|XP_009071198.1| PREDICTED: sacsin [Acanthisitta chloris]
Length=4424

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2294  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2337

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2338  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2395

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2396  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2455

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2456  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2515

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2516  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2543


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCDLQN----P  19
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+  FG   +      
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFIGVFGSTKETFKNGS  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>ref|XP_008918914.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Manacus vitellinus]
Length=4419

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2291  ILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2334

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2335  KLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2392

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2393  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2452

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2453  VGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLDA  2512

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2513  DFRTQFSDVLDLYLGDHFKLDNCTMFR  2539


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 126/217 (58%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQL  1480


 Score = 99.4 bits (246),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>gb|KFP07409.1| Sacsin, partial [Calypte anna]
Length=4510

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2383  ILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2426

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2427  KLGAIPKRHKALERYAS--NICFTPLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2484

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2485  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2544

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2545  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLDA  2604

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2605  DFRTQFSDVLDLYLGNHFKLDNCTMFR  2631


 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  93   AQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  195


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 126/217 (58%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1362  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1413

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1414  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1473

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1474  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1533

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1534  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQL  1570



>ref|XP_007074470.1| PREDICTED: sacsin [Panthera tigris altaica]
Length=4354

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2224  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2267

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2268  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2325

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2326  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2385

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2386  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2445

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2446  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2473


 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1195  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1246

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1247  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1306

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1307  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1366

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNPFR--GTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P+   GTLF
Sbjct  1367  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCRLPLTVEAPYSYDGTLF  1418


 Score =   103 bits (257),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K  G+ + E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDGKEMSE-LSDQFAPFI  104



>gb|KFV11891.1| Sacsin, partial [Tauraco erythrolophus]
Length=4449

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2320  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2363

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2364  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2421

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2422  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2481

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2482  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2541

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2542  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2569


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1306  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1357

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1358  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1417

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1418  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1477

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1478  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1529


 Score =   136 bits (343),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 93/138 (67%), Gaps = 2/138 (1%)
 Frame = -1

Query  459  ELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRI  280
            EL+QNAEDA A++V FL D++QYGT ++ S +MA +QGPA Y +N+++F+P+D + I  I
Sbjct  4    ELIQNAEDAGATEVRFLYDETQYGTETLWSKDMAQYQGPAFYAYNDAIFTPEDWHGIQEI  63

Query  279  GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIK  100
             +  K + P  +GRFG+GFNSVYH TD+P+  SG+ + M DPH  +L G   S     +K
Sbjct  64   ARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFSGDQIGMLDPHQ-TLFGPHESGQCWNLK  122

Query  99   FVGRRILEQFPDQFSPFL  46
               + I E   DQF+PF+
Sbjct  123  EDSKEINE-LTDQFAPFI  139



>ref|XP_006176630.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Camelus ferus]
Length=4389

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2259  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2302

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2303  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2360

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2361  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2420

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2421  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2480

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2481  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2508


 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1230  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1281

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1282  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1341

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1342  SDFVNITRLGESLKRAEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1401

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1402  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYSGTLF  1453


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K   + I  +  DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEI-SKLSDQFAPFIGIFGSTKETFINGS  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>ref|XP_005635602.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Canis lupus familiaris]
Length=4578

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2448  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2491

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2492  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2549

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2550  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2609

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2610  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2669

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2670  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2697


 Score =   151 bits (382),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  89   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSKDM  148

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   S
Sbjct  149  AQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIFS  208

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  209  GDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LSDQFAPFI  251


 Score =   149 bits (377),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1419  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1470

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1471  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1530

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1531  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1590

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1591  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYSGTLF  1642



>ref|XP_010157366.1| PREDICTED: LOW QUALITY PROTEIN: sacsin-like [Eurypyga helias]
Length=4427

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2298  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2341

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2342  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2399

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   +    QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2400  NADDAKATEICFVFDPRQHPADRIFDEKWTPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2459

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2460  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLD  2519

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2520  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2547


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 126/217 (58%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQL  1480


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLHFGCDLQNPFRGTL  4
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+      +  F+   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFIGVFGSTKETFKNAN  118

Query  3    F  1
            F
Sbjct  119  F  119



>ref|XP_006927228.1| PREDICTED: sacsin [Felis catus]
Length=4431

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2301  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2344

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2345  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2402

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2403  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2462

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2463  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2522

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2523  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2550


 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1384  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNPFR--GTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P+   GTLF
Sbjct  1444  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCRLPLTVEAPYSYDGTLF  1495


 Score =   101 bits (251),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + + E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEMSE-LSDQFAPFI  104



>ref|XP_008582381.1| PREDICTED: sacsin [Galeopterus variegatus]
Length=4216

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2236  KILLPDTNLMLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2279

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2280  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2337

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2338  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2397

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2398  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2457

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2458  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2485


 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1207  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1258

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1259  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1318

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1319  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1378

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1379  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDIFGCQLPLTVEAPYSYNGTLF  1430



>ref|XP_004186247.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Taeniopygia guttata]
Length=4432

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_004774405.1| PREDICTED: sacsin isoform X6 [Mustela putorius furo]
Length=4374

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2244  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2287

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2288  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2345

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2346  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2405

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2406  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2465

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2466  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2493


 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1215  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1266

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1267  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1326

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1327  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1386

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1387  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1438



>ref|XP_002920712.1| PREDICTED: sacsin-like [Ailuropoda melanoleuca]
Length=4608

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2478  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2521

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2522  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2579

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2580  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2639

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2640  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2699

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2700  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2727


 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 117/194 (60%), Gaps = 6/194 (3%)
 Frame = -1

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHES-LTTRLRHILEMYADGPGVLFELVQ  448
            K+G  +F+   L  +  S  L   G    FGQ    L   L+ IL  Y +G  +L EL+Q
Sbjct  94   KIGDLTFKNCHLFVNLQSKGLKGGGR---FGQTTPPLVDFLKDILRRYPEGGQILKELIQ  150

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NAEDA A++V FL D++QYGT ++ S +MA +QGPALY +NN+VF+P+D + I  I +  
Sbjct  151  NAEDAGATEVKFLYDETQYGTETLWSKDMAQYQGPALYVYNNAVFTPEDWHGIQEIARSR  210

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR  88
            K + P  +GRFG+GFNSVYH TD+P   SG+ + M DPH  +L G   S     +K   +
Sbjct  211  KKDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSK  269

Query  87   RILEQFPDQFSPFL  46
             I E   DQF+PF+
Sbjct  270  EISE-LSDQFAPFI  282


 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1449  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1500

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1501  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1560

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1561  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1620

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1621  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1672



>ref|XP_009978816.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Tauraco erythrolophus]
Length=4431

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2302  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2345

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2346  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2403

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2404  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2463

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2464  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2523

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2524  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2551


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1275  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1326

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1327  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1386

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1387  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1446

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1447  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1498


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_005482576.1| PREDICTED: sacsin [Zonotrichia albicollis]
Length=4432

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2303  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2465  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2552


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1272  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1323

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1324  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1383

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1384  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1443

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1444  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1495


 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_004774402.1| PREDICTED: sacsin isoform X3 [Mustela putorius furo]
 ref|XP_004825174.1| PREDICTED: sacsin isoform X4 [Mustela putorius furo]
Length=4584

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2454  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2497

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2498  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2555

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2556  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2615

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2616  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2675

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2676  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2703


 Score =   154 bits (389),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 117/194 (60%), Gaps = 6/194 (3%)
 Frame = -1

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHES-LTTRLRHILEMYADGPGVLFELVQ  448
            K+G  +F+   L  +  S  L   G    FGQ    L   L+ IL  Y +G  +L EL+Q
Sbjct  60   KIGDLTFKNCHLFVNLQSKGLKGGGR---FGQTTPPLVDFLKDILRRYPEGGQILKELIQ  116

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NAEDA A++V FL D++QYGT ++ S EMA +QGPALY +NN+VF+P+D + I  I +  
Sbjct  117  NAEDAGATEVKFLYDETQYGTETLWSKEMAQYQGPALYVYNNAVFTPEDWHGIQEIARSR  176

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR  88
            K + P  +GRFG+GFNSVYH TD+P   SG+ + M DPH  +L G   S     +K   +
Sbjct  177  KKDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSK  235

Query  87   RILEQFPDQFSPFL  46
             I E   DQF+PF+
Sbjct  236  EISE-LSDQFAPFI  248


 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1425  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1476

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1477  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1536

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1537  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1596

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1597  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1648



>ref|XP_004774400.1| PREDICTED: sacsin isoform X1 [Mustela putorius furo]
 ref|XP_004774401.1| PREDICTED: sacsin isoform X2 [Mustela putorius furo]
 ref|XP_004825171.1| PREDICTED: sacsin isoform X1 [Mustela putorius furo]
 ref|XP_004825172.1| PREDICTED: sacsin isoform X2 [Mustela putorius furo]
 ref|XP_004825173.1| PREDICTED: sacsin isoform X3 [Mustela putorius furo]
Length=4592

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2462  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2505

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2506  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2563

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2564  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2623

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2624  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2683

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2684  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2711


 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 117/194 (60%), Gaps = 6/194 (3%)
 Frame = -1

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHES-LTTRLRHILEMYADGPGVLFELVQ  448
            K+G  +F+   L  +  S  L   G    FGQ    L   L+ IL  Y +G  +L EL+Q
Sbjct  68   KIGDLTFKNCHLFVNLQSKGLKGGGR---FGQTTPPLVDFLKDILRRYPEGGQILKELIQ  124

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NAEDA A++V FL D++QYGT ++ S EMA +QGPALY +NN+VF+P+D + I  I +  
Sbjct  125  NAEDAGATEVKFLYDETQYGTETLWSKEMAQYQGPALYVYNNAVFTPEDWHGIQEIARSR  184

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR  88
            K + P  +GRFG+GFNSVYH TD+P   SG+ + M DPH  +L G   S     +K   +
Sbjct  185  KKDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSK  243

Query  87   RILEQFPDQFSPFL  46
             I E   DQF+PF+
Sbjct  244  EISE-LSDQFAPFI  256


 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1433  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1484

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1485  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1544

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1545  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1604

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1605  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1656



>ref|XP_010987049.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Camelus dromedarius]
Length=4419

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2289  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2332

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2333  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2390

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2391  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2450

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2451  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2510

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2511  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2538


 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1260  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1311

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1312  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1371

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1372  SDFVNITRLGESLKRAEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1431

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1432  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYSGTLF  1483


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K   + I  +  DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEI-SKLSDQFAPFIGIFGSTKETFINGS  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>ref|XP_004774404.1| PREDICTED: sacsin isoform X5 [Mustela putorius furo]
 ref|XP_004825176.1| PREDICTED: sacsin isoform X6 [Mustela putorius furo]
Length=4440

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2310  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2353

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2354  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2411

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2412  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2471

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2472  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2531

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2532  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2559


 Score =   150 bits (378),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1281  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1332

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1333  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1392

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1393  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1452

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1453  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1504


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LSDQFAPFI  104



>gb|KFW12164.1| Sacsin, partial [Eurypyga helias]
Length=4456

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2327  EILLPDTRLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2370

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2371  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2428

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   +    QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2429  NADDAKATEICFVFDPRQHPADRIFDEKWTPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2488

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2489  KVGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSTSPGRMFRDLD  2548

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2549  ADFRTQFSDVLDLYLGNHFKLDNCTMFR  2576


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 126/217 (58%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1307  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1358

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1359  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1418

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1419  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1478

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1479  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQL  1515


 Score =   137 bits (344),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 97/153 (63%), Gaps = 2/153 (1%)
 Frame = -1

Query  459  ELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRI  280
            EL+QNAEDA A++V FL D++QYGT ++ S +MA +QGPA Y +N+++F+P+D + I  I
Sbjct  4    ELIQNAEDAGATEVRFLYDETQYGTETLWSKDMAQYQGPAFYAYNDAIFTPEDWHGIQEI  63

Query  279  GQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIK  100
             +  K + P  +GRFG+GFNSVYH TD+P+  SG+ + M DPH  +L G   S     +K
Sbjct  64   ARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFSGDQIGMLDPHQ-TLFGPHESGQCWNLK  122

Query  99   FVGRRILEQFPDQFSPFLHFGCDLQNPFRGTLF  1
               + I E   DQF+PF+      +  F+   F
Sbjct  123  EDSKEINE-LTDQFAPFIGVFGSTKETFKNANF  154



>ref|XP_006216298.1| PREDICTED: sacsin [Vicugna pacos]
Length=4432

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2302  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2345

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2346  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2403

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2404  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2463

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2464  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2523

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2524  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2551


 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1273  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1324

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1325  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1384

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1385  SDFVNITRLGESLKRAEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1444

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1445  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYSGTLF  1496


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAQYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K   + I  +  DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEI-SKLSDQFAPFIGIFGSTKETFINGS  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>ref|XP_010398799.1| PREDICTED: sacsin isoform X1 [Corvus cornix cornix]
 ref|XP_010398800.1| PREDICTED: sacsin isoform X1 [Corvus cornix cornix]
 ref|XP_010398801.1| PREDICTED: sacsin isoform X1 [Corvus cornix cornix]
 ref|XP_010398802.1| PREDICTED: sacsin isoform X1 [Corvus cornix cornix]
 ref|XP_010398804.1| PREDICTED: sacsin isoform X1 [Corvus cornix cornix]
 ref|XP_010398805.1| PREDICTED: sacsin isoform X1 [Corvus cornix cornix]
Length=4580

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2451  EILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2494

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2495  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2552

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2553  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2612

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2613  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2672

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2673  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2700


 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1420  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1471

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1472  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1531

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1532  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1591

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1592  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1643


 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  90   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  149

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  150  AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  209

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  210  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  252



>ref|XP_004774403.1| PREDICTED: sacsin isoform X4 [Mustela putorius furo]
 ref|XP_004825175.1| PREDICTED: sacsin isoform X5 [Mustela putorius furo]
Length=4583

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD + +L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2453  KILLPDTNLKLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2496

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2497  VKLGAVPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2554

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2555  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2614

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2615  KEGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSVSPGRMFRDLD  2674

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2675  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2702


 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 117/194 (60%), Gaps = 6/194 (3%)
 Frame = -1

Query  624  KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHES-LTTRLRHILEMYADGPGVLFELVQ  448
            K+G  +F+   L  +  S  L   G    FGQ    L   L+ IL  Y +G  +L EL+Q
Sbjct  68   KIGDLTFKNCHLFVNLQSKGLKGGGR---FGQTTPPLVDFLKDILRRYPEGGQILKELIQ  124

Query  447  NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
            NAEDA A++V FL D++QYGT ++ S EMA +QGPALY +NN+VF+P+D + I  I +  
Sbjct  125  NAEDAGATEVKFLYDETQYGTETLWSKEMAQYQGPALYVYNNAVFTPEDWHGIQEIARSR  184

Query  267  KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGISPSHPGLRIKFVGR  88
            K + P  +GRFG+GFNSVYH TD+P   SG+ + M DPH  +L G   S     +K   +
Sbjct  185  KKDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSK  243

Query  87   RILEQFPDQFSPFL  46
             I E   DQF+PF+
Sbjct  244  EISE-LSDQFAPFI  256


 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1424  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1475

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +F++D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1476  SVSDIFKELLQNADDANATECSFMIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1535

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K E+   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1536  SDFVNITRLGESLKREEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1595

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1596  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1647



>ref|XP_010398806.1| PREDICTED: sacsin isoform X2 [Corvus cornix cornix]
Length=4573

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 137/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             +I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA
Sbjct  2444  EILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVA  2487

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2488  VKLGAIPKRHKALERYAS--NICFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2545

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2546  NADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGT  2605

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K+  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + + 
Sbjct  2606  KVGNPCKTGQYGIGFNSVYHITDCPSFLSGNDILCIFDPHARYAPGSTSTSPGRMFRDLD  2665

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2666  ADFRTQFSDVLDLYLGDHFKLDNCTMFR  2693


 Score =   148 bits (374),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 135/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1413  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1464

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1465  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1524

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1525  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1584

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    ++P  ++GTLF
Sbjct  1585  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQLPLTVESPYSYKGTLF  1636


 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 106/165 (64%), Gaps = 3/165 (2%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  83   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVRFLYDETQYGTETLWSKDM  142

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPA Y +N+++F+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  S
Sbjct  143  AQYQGPAFYAYNDAIFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIFS  202

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  203  GDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  245



>ref|XP_008500549.1| PREDICTED: sacsin [Calypte anna]
Length=4430

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/267 (36%), Positives = 136/267 (51%), Gaps = 21/267 (8%)
 Frame = -1

Query  804   IYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVAE  625
             I LPD    L  A  L YND PW+                  K T  ++ HG+I  +VA 
Sbjct  2303  ILLPDTHLALLPAKSLCYNDCPWI----------------KVKDTTVKYCHGDIPREVAV  2346

Query  624   KLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQN  445
             KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+QN
Sbjct  2347  KLGAIPKRHKALERYAS--NICFTPLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQN  2404

Query  444   AEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQESK  265
             A+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +K
Sbjct  2405  ADDAKATEICFVFDPRQHPADRIFDEKWAPLQGPALCVYNNQPFTEDDIRGIQNLGKGTK  2464

Query  264   LEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVGR  88
             +  P   G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG + + PG   + +  
Sbjct  2465  VGNPCKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGSTSTSPGRMFRDLDA  2524

Query  87    RILEQFPDQFSPFL--HFGCDLQNPFR  13
                 QF D    +L  HF  D    FR
Sbjct  2525  DFRTQFSDVLDLYLGNHFKLDNCTMFR  2551


 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 126/217 (58%), Gaps = 14/217 (6%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1271  LVHEDIPMKTAEWLNVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1322

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++  FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1323  SISDIFKELLQNADDANATECNFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSEFSD  1382

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TD+P  +S E ++MFDP+   +    
Sbjct  1383  SDFLNITRLGESLKRSEVDKVGKFGLGFNSVYHITDVPIILSREFMIMFDPNVNHISKHI  1442

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL  28
                S+PG++I +   ++ L +FP+QF PF+  FGC L
Sbjct  1443  RDKSNPGIKINWSKQQKRLRKFPNQFKPFIGVFGCQL  1479


 Score = 99.4 bits (246),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPA Y +N++VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P+  
Sbjct  1    MAQYQGPAFYAYNDAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPSIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFL  46
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKEDSKEINE-LTDQFAPFI  104



>ref|XP_004088146.1| PREDICTED: sacsin [Nomascus leucogenys]
Length=4527

 Score =   168 bits (425),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2398  KILLPDTNLMLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2441

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2442  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2499

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2500  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2559

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2560  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2619

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2620  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2647


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1369  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1420

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1421  SVSDIFKELLQNADDANATECSFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1480

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1481  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1540

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1541  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1592


 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 76/185 (41%), Gaps = 57/185 (31%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +M
Sbjct  86   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSKDM  145

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +Q                                                 D+P   S
Sbjct  146  APYQ-------------------------------------------------DVPCIFS  156

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNPF  16
            G+ + M DPH  +L G   S     +K   + I     DQF+PF+  FG      +   F
Sbjct  157  GDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEI-SDLSDQFAPFIGIFGSTKETFINGNF  214

Query  15   RGTLF  1
             GT F
Sbjct  215  PGTFF  219



>gb|AAF31262.1|AF193556_1 sacsin [Homo sapiens]
 gb|EAX08322.1| hCG1774880 [Homo sapiens]
Length=3829

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  1700  KILLPDTNLMLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  1743

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1744  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1801

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1802  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  1861

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  1862  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  1921

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1922  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  1949


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  671  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  722

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++ +FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  723  SVSDIFKELLQNADDANATECSFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  782

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  783  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  842

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  843  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  894



>ref|XP_008019908.1| PREDICTED: sacsin isoform X4 [Chlorocebus sabaeus]
Length=3829

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  1700  KILLPDTNLMLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  1743

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  1744  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  1801

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  1802  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  1861

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  1862  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  1921

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  1922  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  1949


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660  FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
             VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  671  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  722

Query  480  DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                +  EL+QNA+DANA++ +FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  723  SVSDIFKELLQNADDANATECSFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  782

Query  306  QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
             D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  783  SDFVNITRLGESLKRAEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  842

Query  132  ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
               S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  843  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  894



>ref|XP_009425000.1| PREDICTED: sacsin isoform X2 [Pan troglodytes]
Length=4432

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2303  KILLPDTNLMLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2465  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2552


 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1274  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1325

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1326  SVSDIFKELLQNADDANATECSFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1385

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1386  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1445

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1446  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1497


 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAPYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LSDQFAPFVGIFGSTKETFINGN  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>ref|XP_008956773.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Pan paniscus]
Length=4432

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2303  KILLPDTNLMLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2346

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2347  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2404

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2405  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2464

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2465  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2524

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2525  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2552


 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1274  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1325

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1326  SVSDIFKELLQNADDANATECSFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1385

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1386  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1445

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1446  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1497


 Score =   101 bits (252),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 74/126 (59%), Gaps = 7/126 (6%)
 Frame = -1

Query  363  MADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFV  184
            MA +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   
Sbjct  1    MAPYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIF  60

Query  183  SGENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNP  19
            SG+ + M DPH  +L G   S     +K   + I E   DQF+PF+  FG      +   
Sbjct  61   SGDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LSDQFAPFVGIFGSTKETFINGN  118

Query  18   FRGTLF  1
            F GT F
Sbjct  119  FPGTFF  124



>ref|XP_008996285.1| PREDICTED: LOW QUALITY PROTEIN: sacsin [Callithrix jacchus]
Length=4500

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2371  KILLPDTNLTLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2414

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2415  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2472

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2473  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2532

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2533  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2592

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2593  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2620


 Score =   151 bits (381),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 127/228 (56%), Gaps = 11/228 (5%)
 Frame = -1

Query  666  QRFVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHES-LTTRLRHILE  490
            QR  HG        K+G  + +   L  +  S  L   G    FGQ    L   L+ IL 
Sbjct  49   QRLWHGGRELSDWIKIGDLTSKNGHLFVNLQSKGLKGGGR---FGQTTPPLVDFLKDILR  105

Query  489  MYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFS  310
             Y +G  +L EL+QNAEDA A++V FL D++QYGT ++ S +MA +QGPALY +NN+VF+
Sbjct  106  RYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTETLWSKDMAPYQGPALYVYNNAVFT  165

Query  309  PQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPGI  130
            P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   SG+ + M DPH  +L G 
Sbjct  166  PEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQ-TLFGP  224

Query  129  SPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNPFRGTLF  1
              S     +K   + I E   DQF+PF+  FG      +   F GT F
Sbjct  225  HESGQCWNLKDDSKEISE-LSDQFAPFIGIFGSTKETFMNGNFPGTFF  271


 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1421  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1472

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1473  SVSDIFKELLQNADDANATECSFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1532

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1533  SDFVNITRLGESLKRGEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1592

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1593  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1644



>gb|EHH28888.1| DnaJ-like protein subfamily C member 29, partial [Macaca mulatta]
Length=4523

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2394  KILLPDTNLMLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2437

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2438  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2495

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2496  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2555

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2556  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2615

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2616  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2643


 Score =   152 bits (383),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 113/185 (61%), Gaps = 8/185 (4%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT S+ S +M
Sbjct  33   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTESLWSKDM  92

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   S
Sbjct  93   APYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIFS  152

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNPF  16
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+  FG      +   F
Sbjct  153  GDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LSDQFAPFIGIFGSTKETFINGNF  210

Query  15   RGTLF  1
             GT F
Sbjct  211  PGTFF  215


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1365  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1416

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1417  SVSDIFKELLQNADDANATECSFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1476

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1477  SDFVNITRLGESLKRAEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1536

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1537  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1588



>ref|XP_008019906.1| PREDICTED: sacsin isoform X2 [Chlorocebus sabaeus]
Length=4579

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 136/268 (51%), Gaps = 21/268 (8%)
 Frame = -1

Query  807   KIYLPDVSCRLFNATDLVYNDAPWLLdsddpdssngSAMALHAKQTIQRFVHGNISNDVA  628
             KI LPD +  L  A  L YND PW+                  K T  ++ H +I  +VA
Sbjct  2450  KILLPDTNLMLLPAKSLCYNDCPWI----------------KVKDTTVKYCHADIPREVA  2493

Query  627   EKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYADGPGVLFELVQ  448
              KLG    R   L   A   N+  +     FGQ E LT+R++ IL  Y     +L EL+Q
Sbjct  2494  VKLGAVPKRHKALERYAS--NVCFTTLGTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQ  2551

Query  447   NAEDANASKVAFLLDKSQYGTSSVLSPEMADWQGPALYCFNNSVFSPQDLYAISRIGQES  268
             NA+DA A+++ F+ D  Q+    +   + A  QGPAL  +NN  F+  D+  I  +G+ +
Sbjct  2552  NADDAKATEICFVFDPRQHPVDRIFDDKWAPLQGPALCVYNNQPFTEDDVRGIQNLGKGT  2611

Query  267   KLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVV-MFDPHACSLPGISPSHPGLRIKFVG  91
             K   P+  G++G+GFNSVYH TD P+F+SG +++ +FDPHA   PG +   PG   + + 
Sbjct  2612  KEGNPYKTGQYGIGFNSVYHITDCPSFISGNDILCIFDPHARYAPGATSISPGRMFRDLD  2671

Query  90    RRILEQFPDQFSPFL--HFGCDLQNPFR  13
                  QF D    +L  HF  D    FR
Sbjct  2672  ADFRTQFSDVLDLYLGTHFKLDNCTMFR  2699


 Score =   152 bits (383),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 113/185 (61%), Gaps = 8/185 (4%)
 Frame = -1

Query  537  FGQHES-LTTRLRHILEMYADGPGVLFELVQNAEDANASKVAFLLDKSQYGTSSVLSPEM  361
            FGQ    L   L+ IL  Y +G  +L EL+QNAEDA A++V FL D++QYGT S+ S +M
Sbjct  89   FGQTTPPLVDFLKDILRRYPEGGQILKELIQNAEDAGATEVKFLYDETQYGTESLWSKDM  148

Query  360  ADWQGPALYCFNNSVFSPQDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVS  181
            A +QGPALY +NN+VF+P+D + I  I +  K + P  +GRFG+GFNSVYH TD+P   S
Sbjct  149  APYQGPALYVYNNAVFTPEDWHGIQEIARSRKKDDPLKVGRFGIGFNSVYHITDVPCIFS  208

Query  180  GENVVMFDPHACSLPGISPSHPGLRIKFVGRRILEQFPDQFSPFLH-FGCD----LQNPF  16
            G+ + M DPH  +L G   S     +K   + I E   DQF+PF+  FG      +   F
Sbjct  209  GDQIGMLDPHQ-TLFGPHESGQCWNLKDDSKEISE-LSDQFAPFIGIFGSTKETFINGNF  266

Query  15   RGTLF  1
             GT F
Sbjct  267  PGTFF  271


 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 20/232 (9%)
 Frame = -1

Query  660   FVHGNISNDVAEKLGVRSFRRMLLAESADSMNLSLSGAAEAFGQHESLTTRLRHILEMYA  481
              VH +I    AE L V      L+  + ++M        E  GQ E LT R+++ILE Y 
Sbjct  1421  LVHEDIPMKTAEWLKVPCLSTRLI--NPENMGF------EQSGQREPLTVRIKNILEEYP  1472

Query  480   DGPGVLFELVQNAEDANASKVAFLLD--KSQYGTSSVLSPEMADWQGPALYCFNNSVFSP  307
                 +  EL+QNA+DANA++ +FL+D  ++     ++L P MA   GPAL+ FNNS FS 
Sbjct  1473  SVSDIFKELLQNADDANATECSFLIDMRRNMDIRENLLDPGMAACHGPALWSFNNSQFSD  1532

Query  306   QDLYAISRIGQESKLEKPFAIGRFGLGFNSVYHFTDIPTFVSGENVVMFDPHACSLPG--  133
              D   I+R+G+  K  +   +G+FGLGFNSVYH TDIP  +S E ++MFDP+   +    
Sbjct  1533  SDFVNITRLGESLKRAEVDKVGKFGLGFNSVYHITDIPIIMSREFMIMFDPNINHISKHI  1592

Query  132   ISPSHPGLRIKFVG-RRILEQFPDQFSPFLH-FGCDL----QNP--FRGTLF  1
                S+PG++I +   ++ L +FP+QF PF+  FGC L    + P  + GTLF
Sbjct  1593  KDKSNPGIKINWSKQQKRLRKFPNQFKPFIDVFGCQLPLTVEAPYSYNGTLF  1644



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1664082826224