BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26828_g1_i1 len=2053 path=[1:0-2052]

Length=2053
                                                                      Score     E

ref|XP_009797086.1|  PREDICTED: cationic amino acid transporter 6...    726   0.0      
ref|XP_009629399.1|  PREDICTED: cationic amino acid transporter 6...    723   0.0      
ref|XP_006359260.1|  PREDICTED: cationic amino acid transporter 6...    706   0.0      
ref|XP_004300325.1|  PREDICTED: cationic amino acid transporter 6...    696   0.0      
ref|XP_009346156.1|  PREDICTED: cationic amino acid transporter 6...    677   0.0      
ref|XP_007210584.1|  hypothetical protein PRUPE_ppa015187mg             672   0.0      
ref|XP_007039671.1|  Cationic amino acid transporter, putative          671   0.0      
ref|XP_008373647.1|  PREDICTED: cationic amino acid transporter 6...    669   0.0      
ref|XP_011047557.1|  PREDICTED: cationic amino acid transporter 6...    668   0.0      
gb|KHG24252.1|  Cationic amino acid transporter 6, chloroplastic ...    667   0.0      
gb|KHG28946.1|  Cationic amino acid transporter 7, chloroplastic ...    667   0.0      
ref|XP_006440163.1|  hypothetical protein CICLE_v10019477mg             667   0.0      
gb|KDO57032.1|  hypothetical protein CISIN_1g007861mg                   667   0.0      
ref|XP_006477566.1|  PREDICTED: cationic amino acid transporter 6...    667   0.0      
ref|XP_002531231.1|  cationic amino acid transporter, putative          662   0.0      Ricinus communis
gb|KHG11086.1|  Cationic amino acid transporter 7, chloroplastic ...    660   0.0      
ref|XP_006385572.1|  hypothetical protein POPTR_0003s08200g             656   0.0      
ref|XP_004148384.1|  PREDICTED: cationic amino acid transporter 6...    650   0.0      
ref|XP_008377513.1|  PREDICTED: cationic amino acid transporter 6...    649   0.0      
ref|XP_010677143.1|  PREDICTED: cationic amino acid transporter 7...    649   0.0      
ref|XP_011031981.1|  PREDICTED: cationic amino acid transporter 6...    649   0.0      
ref|XP_004508965.1|  PREDICTED: cationic amino acid transporter 6...    647   0.0      
ref|XP_004162422.1|  PREDICTED: cationic amino acid transporter 6...    645   0.0      
ref|XP_003549952.1|  PREDICTED: cationic amino acid transporter 6...    642   0.0      
ref|XP_010053544.1|  PREDICTED: cationic amino acid transporter 6...    642   0.0      
ref|XP_003525587.1|  PREDICTED: cationic amino acid transporter 6...    637   0.0      
gb|KHN33269.1|  Cationic amino acid transporter 6, chloroplastic        636   0.0      
ref|XP_008794928.1|  PREDICTED: cationic amino acid transporter 6...    632   0.0      
ref|XP_007155719.1|  hypothetical protein PHAVU_003G225700g             631   0.0      
ref|XP_009383017.1|  PREDICTED: cationic amino acid transporter 6...    630   0.0      
ref|XP_010919915.1|  PREDICTED: cationic amino acid transporter 6...    629   0.0      
ref|XP_010274503.1|  PREDICTED: cationic amino acid transporter 7...    627   0.0      
emb|CAN83060.1|  hypothetical protein VITISV_010305                     627   0.0      Vitis vinifera
emb|CDP08331.1|  unnamed protein product                                624   0.0      
gb|KEH31609.1|  cationic amino acid transporter                         619   0.0      
ref|XP_007156591.1|  hypothetical protein PHAVU_002G001800g             615   0.0      
emb|CDY09649.1|  BnaC07g34120D                                          608   0.0      
ref|XP_010269827.1|  PREDICTED: cationic amino acid transporter 6...    608   0.0      
ref|XP_006283404.1|  hypothetical protein CARUB_v10004452mg             605   0.0      
ref|XP_009136823.1|  PREDICTED: cationic amino acid transporter 6...    602   0.0      
ref|XP_010110562.1|  Cationic amino acid transporter 6                  593   0.0      
ref|XP_009136822.1|  PREDICTED: cationic amino acid transporter 6...    588   0.0      
emb|CAE04272.2|  OSJNBb0103I08.20                                       580   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010434728.1|  PREDICTED: cationic amino acid transporter 6...    581   0.0      
ref|XP_010440066.1|  PREDICTED: cationic amino acid transporter 6...    580   0.0      
ref|XP_010449682.1|  PREDICTED: cationic amino acid transporter 6...    579   0.0      
ref|XP_008663434.1|  PREDICTED: cationic amino acid transporter 6...    576   0.0      
ref|XP_006653631.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    571   0.0      
ref|XP_006838495.1|  hypothetical protein AMTR_s00002p00166780          567   0.0      
ref|XP_004978161.1|  PREDICTED: cationic amino acid transporter 6...    564   0.0      
gb|EAY95030.1|  hypothetical protein OsI_16839                          565   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008663435.1|  PREDICTED: cationic amino acid transporter 6...    560   0.0      
ref|XP_010540809.1|  PREDICTED: cationic amino acid transporter 7...    549   0.0      
ref|XP_008663436.1|  PREDICTED: cationic amino acid transporter 6...    536   1e-180   
ref|XP_003581477.1|  PREDICTED: cationic amino acid transporter 6...    535   2e-179   
ref|XP_002448255.1|  hypothetical protein SORBIDRAFT_06g024120          531   7e-178   Sorghum bicolor [broomcorn]
gb|KFK26763.1|  hypothetical protein AALP_AA8G290600                    518   1e-174   
gb|KEH31610.1|  cationic amino acid transporter                         503   1e-169   
ref|XP_002975704.1|  hypothetical protein SELMODRAFT_103397             498   1e-164   
ref|XP_002973649.1|  hypothetical protein SELMODRAFT_173423             498   3e-164   
ref|XP_008663437.1|  PREDICTED: cationic amino acid transporter 6...    491   5e-164   
gb|EAZ31508.1|  hypothetical protein OsJ_15645                          494   3e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010646375.1|  PREDICTED: cationic amino acid transporter 6...    487   6e-162   
ref|XP_001756602.1|  predicted protein                                  480   1e-157   
ref|XP_004250472.1|  PREDICTED: cationic amino acid transporter 7...    468   6e-153   
ref|XP_006367241.1|  PREDICTED: cationic amino acid transporter 7...    466   2e-152   
ref|XP_009799957.1|  PREDICTED: cationic amino acid transporter 7...    463   2e-151   
gb|EYU19824.1|  hypothetical protein MIMGU_mgv1a003376mg                463   4e-151   
ref|XP_006398930.1|  hypothetical protein EUTSA_v10013075mg             462   9e-151   
gb|KEH31611.1|  cationic amino acid transporter                         455   4e-150   
ref|XP_006407531.1|  hypothetical protein EUTSA_v10020371mg             459   8e-150   
ref|XP_009591737.1|  PREDICTED: cationic amino acid transporter 7...    459   1e-149   
ref|XP_002882687.1|  hypothetical protein ARALYDRAFT_317861             459   1e-149   
ref|NP_187671.1|  cationic amino acid transporter 7                     459   2e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871112.1|  ATCAT6/CAT6                                        458   3e-149   
ref|XP_006445758.1|  hypothetical protein CICLE_v10014713mg             458   4e-149   
ref|XP_004497134.1|  PREDICTED: cationic amino acid transporter 7...    457   5e-149   
ref|XP_002269556.1|  PREDICTED: cationic amino acid transporter 6...    457   7e-149   Vitis vinifera
ref|NP_196097.1|  cationic amino acid transporter 6                     457   8e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122720.1|  PREDICTED: cationic amino acid transporter 7...    457   9e-149   
ref|XP_006836089.1|  hypothetical protein AMTR_s00114p00137590          456   2e-148   
ref|XP_009407333.1|  PREDICTED: cationic amino acid transporter 7...    457   2e-148   
ref|XP_010486672.1|  PREDICTED: cationic amino acid transporter 7...    455   5e-148   
ref|XP_010464736.1|  PREDICTED: cationic amino acid transporter 7...    455   7e-148   
gb|KFK24917.1|  hypothetical protein AALP_AA8G041700                    455   7e-148   
ref|XP_001765563.1|  predicted protein                                  454   1e-147   
ref|XP_006299116.1|  hypothetical protein CARUB_v10015257mg             452   8e-147   
ref|XP_009130837.1|  PREDICTED: cationic amino acid transporter 6...    452   1e-146   
ref|XP_006378822.1|  hypothetical protein POPTR_0010s24730g             452   1e-146   
ref|XP_010494590.1|  PREDICTED: cationic amino acid transporter 7...    451   2e-146   
ref|XP_008784057.1|  PREDICTED: cationic amino acid transporter 7...    451   2e-146   
ref|XP_008345866.1|  PREDICTED: cationic amino acid transporter 7...    451   2e-146   
ref|XP_010452377.1|  PREDICTED: cationic amino acid transporter 6...    451   2e-146   
ref|XP_010490998.1|  PREDICTED: cationic amino acid transporter 6...    450   6e-146   
ref|XP_009341581.1|  PREDICTED: cationic amino acid transporter 7...    449   7e-146   
ref|XP_010931100.1|  PREDICTED: cationic amino acid transporter 6...    449   2e-145   
ref|XP_007214662.1|  hypothetical protein PRUPE_ppa003270mg             448   3e-145   
ref|XP_011076844.1|  PREDICTED: cationic amino acid transporter 7...    448   3e-145   
ref|XP_010423539.1|  PREDICTED: cationic amino acid transporter 6...    447   6e-145   
gb|KFK38452.1|  hypothetical protein AALP_AA3G115100                    446   1e-144   
ref|XP_008799668.1|  PREDICTED: cationic amino acid transporter 6...    447   1e-144   
gb|EYU37209.1|  hypothetical protein MIMGU_mgv1a024374mg                446   1e-144   
ref|XP_010912336.1|  PREDICTED: cationic amino acid transporter 6...    446   1e-144   
ref|XP_008231821.1|  PREDICTED: cationic amino acid transporter 6...    446   2e-144   
gb|KEH44284.1|  cationic amino acid transporter                         445   3e-144   
ref|NP_001053455.1|  Os04g0543600                                       439   6e-144   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011024173.1|  PREDICTED: cationic amino acid transporter 6...    444   9e-144   
gb|KDP43675.1|  hypothetical protein JCGZ_24133                         444   1e-143   
ref|XP_009416875.1|  PREDICTED: cationic amino acid transporter 7...    443   5e-143   
ref|XP_002316491.1|  cationic amino acid transporter 6 family pro...    442   5e-143   Populus trichocarpa [western balsam poplar]
ref|XP_011032916.1|  PREDICTED: cationic amino acid transporter 6...    441   1e-142   
ref|XP_006287349.1|  hypothetical protein CARUB_v10000547mg             441   2e-142   
ref|XP_004308176.1|  PREDICTED: cationic amino acid transporter 7...    439   6e-142   
ref|XP_007142869.1|  hypothetical protein PHAVU_007G023700g             439   8e-142   
ref|XP_010558926.1|  PREDICTED: cationic amino acid transporter 6...    436   8e-141   
ref|XP_008345869.1|  PREDICTED: cationic amino acid transporter 7...    436   1e-140   
ref|XP_010695076.1|  PREDICTED: cationic amino acid transporter 6...    435   4e-140   
ref|XP_007010450.1|  Cationic amino acid transporter 7                  436   5e-140   
gb|KGN46047.1|  hypothetical protein Csa_6G046250                       433   1e-139   
ref|XP_004140991.1|  PREDICTED: cationic amino acid transporter 7...    433   5e-139   
gb|KHG16483.1|  Cationic amino acid transporter 7, chloroplastic ...    431   1e-138   
gb|EPS66398.1|  cationic amino acid transporter                         429   3e-138   
ref|XP_010031295.1|  PREDICTED: cationic amino acid transporter 6...    425   2e-136   
ref|XP_008456609.1|  PREDICTED: cationic amino acid transporter 6...    427   2e-136   
gb|KHG26942.1|  Cationic amino acid transporter 7, chloroplastic ...    425   2e-136   
ref|XP_003637200.1|  High affinity cationic amino acid transporter      426   4e-136   
emb|CDO99923.1|  unnamed protein product                                422   9e-136   
ref|XP_003555221.1|  PREDICTED: cationic amino acid transporter 7...    422   2e-135   
gb|EEC68890.1|  hypothetical protein OsI_37534                          422   7e-135   Oryza sativa Indica Group [Indian rice]
emb|CBI25025.3|  unnamed protein product                                417   5e-134   
emb|CDY11308.1|  BnaA03g01440D                                          417   6e-134   
emb|CDX80920.1|  BnaC03g01740D                                          415   3e-133   
ref|XP_003577030.2|  PREDICTED: cationic amino acid transporter 6...    412   7e-132   
ref|XP_002515785.1|  cationic amino acid transporter, putative          413   8e-132   Ricinus communis
ref|XP_008679437.1|  PREDICTED: cationic amino acid transporter 6...    401   7e-127   
ref|XP_002441854.1|  hypothetical protein SORBIDRAFT_08g003530          397   3e-126   Sorghum bicolor [broomcorn]
ref|XP_002442832.1|  hypothetical protein SORBIDRAFT_08g003570          395   2e-125   Sorghum bicolor [broomcorn]
gb|ABA96501.1|  Amino acid permease family protein, expressed           392   3e-124   Oryza sativa Japonica Group [Japonica rice]
emb|CBI40921.3|  unnamed protein product                                386   8e-124   
gb|EEC67700.1|  hypothetical protein OsI_35169                          391   4e-123   Oryza sativa Indica Group [Indian rice]
ref|XP_006368940.1|  hypothetical protein POPTR_0001s150802g            383   5e-123   
ref|XP_004978714.1|  PREDICTED: cationic amino acid transporter 6...    387   3e-122   
ref|XP_002449017.1|  hypothetical protein SORBIDRAFT_05g003440          387   1e-121   Sorghum bicolor [broomcorn]
gb|KEH31612.1|  cationic amino acid transporter                         375   5e-121   
ref|XP_008465895.1|  PREDICTED: cationic amino acid transporter 6...    375   1e-120   
ref|XP_006445759.1|  hypothetical protein CICLE_v10014713mg             375   6e-119   
gb|EMT15465.1|  High affinity cationic amino acid transporter 1         376   5e-118   
ref|NP_001065789.2|  Os11g0155500                                       375   3e-116   Oryza sativa Japonica Group [Japonica rice]
gb|KDO40957.1|  hypothetical protein CISIN_1g0398001mg                  364   1e-115   
ref|XP_006379455.1|  hypothetical protein POPTR_0008s01700g             367   2e-115   
ref|XP_004169173.1|  PREDICTED: cationic amino acid transporter 6...    355   8e-112   
gb|EMS63824.1|  Low affinity cationic amino acid transporter 2          355   2e-111   
ref|XP_004977353.1|  PREDICTED: cationic amino acid transporter 6...    360   3e-111   
ref|XP_010088818.1|  Cationic amino acid transporter 6                  362   3e-111   
ref|XP_010537818.1|  PREDICTED: cationic amino acid transporter 1       354   4e-109   
ref|XP_010923669.1|  PREDICTED: cationic amino acid transporter 1...    352   4e-108   
ref|XP_010241176.1|  PREDICTED: cationic amino acid transporter 1...    352   4e-108   
ref|XP_011085217.1|  PREDICTED: cationic amino acid transporter 1...    352   7e-108   
gb|AAX92723.1|  amino acid transporter-like protein                     349   1e-107   Oryza sativa Japonica Group [Japonica rice]
ref|NP_193844.2|  amino acid transporter 1                              350   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794464.1|  PREDICTED: cationic amino acid transporter 1...    350   2e-107   
ref|XP_010923711.1|  PREDICTED: cationic amino acid transporter 1...    350   2e-107   
ref|XP_003535010.1|  PREDICTED: cationic amino acid transporter 1...    348   1e-106   
ref|XP_002869906.1|  hypothetical protein ARALYDRAFT_329490             348   2e-106   
ref|XP_006836312.1|  hypothetical protein AMTR_s00092p00050170          347   2e-106   
ref|XP_011096669.1|  PREDICTED: cationic amino acid transporter 1...    348   2e-106   
ref|XP_011096668.1|  PREDICTED: cationic amino acid transporter 1...    348   3e-106   
ref|XP_010051968.1|  PREDICTED: cationic amino acid transporter 1...    347   4e-106   
ref|XP_004253188.1|  PREDICTED: cationic amino acid transporter 1...    346   6e-106   
ref|XP_009408749.1|  PREDICTED: cationic amino acid transporter 1...    346   1e-105   
ref|XP_006342695.1|  PREDICTED: cationic amino acid transporter 1...    345   1e-105   
ref|XP_011041665.1|  PREDICTED: cationic amino acid transporter 1...    345   1e-105   
ref|XP_009407711.1|  PREDICTED: cationic amino acid transporter 1...    345   1e-105   
ref|XP_002321859.2|  cationic amino acid transporter 1 family pro...    345   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_004964213.1|  PREDICTED: cationic amino acid transporter 1...    345   2e-105   
ref|XP_011096667.1|  PREDICTED: cationic amino acid transporter 1...    348   3e-105   
ref|XP_006468282.1|  PREDICTED: cationic amino acid transporter 1...    345   3e-105   
ref|XP_010449114.1|  PREDICTED: cationic amino acid transporter 1...    344   3e-105   
ref|XP_002526614.1|  cationic amino acid transporter, putative          343   4e-105   Ricinus communis
ref|XP_002281463.1|  PREDICTED: cationic amino acid transporter 1       344   5e-105   Vitis vinifera
gb|EPS73601.1|  cationic amino acid transporter                         342   6e-105   
gb|KDO75318.1|  hypothetical protein CISIN_1g007398mg                   344   6e-105   
ref|XP_010905430.1|  PREDICTED: cationic amino acid transporter 1...    343   7e-105   
gb|KDP34956.1|  hypothetical protein JCGZ_09244                         342   1e-104   
ref|XP_010434234.1|  PREDICTED: cationic amino acid transporter 1       342   1e-104   
gb|KFK28695.1|  hypothetical protein AALP_AA7G034300                    342   2e-104   
ref|XP_010439517.1|  PREDICTED: cationic amino acid transporter 1       342   4e-104   
ref|XP_002319043.2|  cationic amino acid transporter 1 family pro...    342   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002464178.1|  hypothetical protein SORBIDRAFT_01g013690          341   4e-104   Sorghum bicolor [broomcorn]
ref|XP_006448936.1|  hypothetical protein CICLE_v10014647mg             342   5e-104   
ref|XP_008784883.1|  PREDICTED: cationic amino acid transporter 1...    340   6e-104   
ref|XP_009600414.1|  PREDICTED: cationic amino acid transporter 1...    341   7e-104   
gb|KDP34958.1|  hypothetical protein JCGZ_09246                         340   1e-103   
gb|EYU19131.1|  hypothetical protein MIMGU_mgv1a003219mg                340   2e-103   
ref|XP_007214130.1|  hypothetical protein PRUPE_ppa018024mg             338   7e-103   
emb|CDY58484.1|  BnaA03g58530D                                          338   8e-103   
ref|XP_009362250.1|  PREDICTED: cationic amino acid transporter 1...    338   9e-103   
ref|NP_001050746.1|  Os03g0641200                                       338   1e-102   Oryza sativa Japonica Group [Japonica rice]
gb|KHN10383.1|  Cationic amino acid transporter 7, chloroplastic        333   1e-102   
ref|XP_009340268.1|  PREDICTED: cationic amino acid transporter 5...    337   1e-102   
emb|CDP05623.1|  unnamed protein product                                337   2e-102   
ref|XP_007041134.1|  Amino acid transporter 1                           337   2e-102   
ref|XP_009137166.1|  PREDICTED: cationic amino acid transporter 1       337   2e-102   
ref|XP_011023494.1|  PREDICTED: cationic amino acid transporter 1...    337   3e-102   
ref|XP_008372219.1|  PREDICTED: cationic amino acid transporter 1...    337   3e-102   
ref|XP_008383266.1|  PREDICTED: cationic amino acid transporter 5...    336   3e-102   
ref|XP_004141615.1|  PREDICTED: cationic amino acid transporter 1...    335   8e-102   
ref|XP_004156240.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    335   1e-101   
gb|EPS73602.1|  hypothetical protein M569_01155                         335   1e-101   
ref|XP_006413819.1|  hypothetical protein EUTSA_v10024732mg             335   1e-101   
ref|XP_003559648.1|  PREDICTED: cationic amino acid transporter 1...    335   2e-101   
ref|XP_004135553.1|  PREDICTED: cationic amino acid transporter 1...    334   2e-101   
ref|XP_004293998.1|  PREDICTED: cationic amino acid transporter 1...    335   2e-101   
ref|XP_008225625.1|  PREDICTED: cationic amino acid transporter 1...    334   2e-101   
ref|XP_009419637.1|  PREDICTED: cationic amino acid transporter 1...    333   3e-101   
ref|XP_008225925.1|  PREDICTED: cationic amino acid transporter 5...    333   3e-101   
ref|XP_004293997.1|  PREDICTED: cationic amino acid transporter 1...    334   5e-101   
emb|CAA17531.1|  amino acid transport protein AAT1                      331   6e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002443551.1|  hypothetical protein SORBIDRAFT_08g021380          332   1e-100   Sorghum bicolor [broomcorn]
ref|XP_009344397.1|  PREDICTED: cationic amino acid transporter 1...    333   1e-100   
ref|XP_004233142.1|  PREDICTED: cationic amino acid transporter 1...    332   1e-100   
ref|XP_002318265.2|  cationic amino acid transporter 1 family pro...    332   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_010051967.1|  PREDICTED: cationic amino acid transporter 1...    332   2e-100   
emb|CDX94024.1|  BnaC07g36580D                                          331   4e-100   
ref|XP_006352988.1|  PREDICTED: cationic amino acid transporter 1...    331   4e-100   
gb|KDP34945.1|  hypothetical protein JCGZ_09233                         330   5e-100   
ref|XP_004504162.1|  PREDICTED: cationic amino acid transporter 1...    330   5e-100   
emb|CDY43646.1|  BnaA04g20450D                                          329   9e-100   
ref|XP_010687038.1|  PREDICTED: cationic amino acid transporter 1...    329   1e-99    
ref|XP_010056965.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    329   1e-99    
ref|XP_009141413.1|  PREDICTED: cationic amino acid transporter 5       328   2e-99    
ref|XP_007214132.1|  hypothetical protein PRUPE_ppa018037mg             329   2e-99    
ref|XP_006664195.1|  PREDICTED: cationic amino acid transporter 1...    329   2e-99    
ref|XP_007138538.1|  hypothetical protein PHAVU_009G217500g             328   3e-99    
ref|XP_008372220.1|  PREDICTED: cationic amino acid transporter 1...    329   3e-99    
ref|XP_009108509.1|  PREDICTED: cationic amino acid transporter 1...    328   3e-99    
ref|XP_008382964.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    328   4e-99    
ref|XP_004137314.1|  PREDICTED: cationic amino acid transporter 8...    328   4e-99    
ref|XP_009591377.1|  PREDICTED: cationic amino acid transporter 1...    328   6e-99    
emb|CDY64649.1|  BnaAnng19530D                                          327   6e-99    
ref|XP_003579146.1|  PREDICTED: cationic amino acid transporter 1...    327   6e-99    
ref|XP_010051809.1|  PREDICTED: cationic amino acid transporter 5...    328   7e-99    
ref|XP_008445160.1|  PREDICTED: cationic amino acid transporter 1...    327   7e-99    
ref|XP_010687039.1|  PREDICTED: cationic amino acid transporter 1...    328   7e-99    
emb|CDY65339.1|  BnaC03g64380D                                          327   7e-99    
ref|XP_009362249.1|  PREDICTED: cationic amino acid transporter 1...    328   1e-98    
ref|XP_004164930.1|  PREDICTED: cationic amino acid transporter 8...    328   1e-98    
ref|XP_010241173.1|  PREDICTED: cationic amino acid transporter 1...    326   2e-98    
ref|XP_008383406.1|  PREDICTED: cationic amino acid transporter 1...    327   2e-98    
ref|XP_008356194.1|  PREDICTED: cationic amino acid transporter 8...    326   2e-98    
emb|CDX76419.1|  BnaA08g09810D                                          326   2e-98    
ref|XP_008440316.1|  PREDICTED: cationic amino acid transporter 5       326   2e-98    
ref|XP_004145133.1|  PREDICTED: cationic amino acid transporter 5...    326   3e-98    
gb|AES65106.2|  cationic amino acid transporter                         326   3e-98    
ref|XP_010260734.1|  PREDICTED: cationic amino acid transporter 5...    326   3e-98    
ref|XP_002303714.2|  cationic amino acid transporter 5 family pro...    326   3e-98    Populus trichocarpa [western balsam poplar]
ref|XP_007211385.1|  hypothetical protein PRUPE_ppa003107mg             326   3e-98    
ref|XP_009354858.1|  PREDICTED: cationic amino acid transporter 8...    325   4e-98    
ref|XP_009367760.1|  PREDICTED: cationic amino acid transporter 8...    325   4e-98    
ref|XP_002300432.2|  cationic amino acid transporter 8 family pro...    326   4e-98    Populus trichocarpa [western balsam poplar]
gb|KEH40544.1|  cationic amino acid transporter                         325   5e-98    
ref|XP_006850457.1|  hypothetical protein AMTR_s00035p00052900          325   6e-98    
ref|XP_001761522.1|  predicted protein                                  325   7e-98    
ref|XP_002976452.1|  hypothetical protein SELMODRAFT_104889             325   7e-98    
ref|XP_004293806.1|  PREDICTED: cationic amino acid transporter 5...    325   8e-98    
ref|XP_011045597.1|  PREDICTED: cationic amino acid transporter 8...    325   8e-98    
ref|XP_003630015.1|  High affinity cationic amino acid transporter      325   9e-98    
ref|XP_008372218.1|  PREDICTED: cationic amino acid transporter 1...    325   1e-97    
gb|KDP46791.1|  hypothetical protein JCGZ_11162                         323   1e-97    
ref|NP_001148009.1|  cationic amino acid transporter 4                  324   1e-97    Zea mays [maize]
dbj|BAJ85357.1|  predicted protein                                      324   2e-97    
gb|EMT33624.1|  High affinity cationic amino acid transporter 1         324   2e-97    
ref|XP_008225561.1|  PREDICTED: cationic amino acid transporter 1...    325   2e-97    
ref|XP_006663225.1|  PREDICTED: cationic amino acid transporter 6...    318   2e-97    
ref|XP_009766110.1|  PREDICTED: cationic amino acid transporter 1...    324   2e-97    
ref|XP_002987271.1|  hypothetical protein SELMODRAFT_269243             323   3e-97    
ref|XP_003533631.1|  PREDICTED: cationic amino acid transporter 5...    323   3e-97    
ref|XP_009795094.1|  PREDICTED: cationic amino acid transporter 1...    323   3e-97    
ref|XP_009795093.1|  PREDICTED: cationic amino acid transporter 1...    323   4e-97    
gb|KHN26606.1|  Cationic amino acid transporter 5                       322   8e-97    
ref|XP_008459518.1|  PREDICTED: cationic amino acid transporter 1...    322   9e-97    
ref|XP_009612551.1|  PREDICTED: cationic amino acid transporter 1...    322   1e-96    
ref|XP_003534865.1|  PREDICTED: cationic amino acid transporter 5...    321   1e-96    
gb|KDP34957.1|  hypothetical protein JCGZ_09245                         321   1e-96    
ref|XP_009612550.1|  PREDICTED: cationic amino acid transporter 1...    322   1e-96    
ref|XP_003635611.1|  PREDICTED: cationic amino acid transporter 6...    310   1e-96    
ref|XP_011022320.1|  PREDICTED: cationic amino acid transporter 5       321   2e-96    
ref|XP_007159614.1|  hypothetical protein PHAVU_002G252100g             322   2e-96    
gb|KHN41447.1|  Cationic amino acid transporter 1                       318   2e-96    
gb|EAY83876.1|  hypothetical protein OsI_39096                          321   2e-96    
ref|XP_010028233.1|  PREDICTED: cationic amino acid transporter 5...    321   2e-96    
ref|XP_010062739.1|  PREDICTED: cationic amino acid transporter 8...    321   2e-96    
ref|XP_008451786.1|  PREDICTED: cationic amino acid transporter 8...    321   2e-96    
ref|XP_008661460.1|  PREDICTED: uncharacterized protein LOC100194...    321   3e-96    
gb|ABA99390.1|  Amino acid permease family protein                      320   4e-96    
ref|XP_007138855.1|  hypothetical protein PHAVU_009G243100g             320   4e-96    
ref|XP_008356146.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    320   4e-96    
ref|XP_010915551.1|  PREDICTED: cationic amino acid transporter 5...    320   4e-96    
ref|XP_009627441.1|  PREDICTED: cationic amino acid transporter 1...    320   6e-96    
ref|XP_009604320.1|  PREDICTED: cationic amino acid transporter 8...    320   7e-96    
ref|XP_010915550.1|  PREDICTED: cationic amino acid transporter 5...    320   8e-96    
ref|XP_002273828.1|  PREDICTED: cationic amino acid transporter 5       319   8e-96    
ref|XP_009795092.1|  PREDICTED: cationic amino acid transporter 1...    320   9e-96    
ref|XP_004251831.1|  PREDICTED: cationic amino acid transporter 8...    320   9e-96    
ref|XP_010245195.1|  PREDICTED: cationic amino acid transporter 1...    319   1e-95    
ref|XP_007040997.1|  Cationic amino acid transporter 5                  318   1e-95    
ref|XP_002890204.1|  hypothetical protein ARALYDRAFT_471910             318   2e-95    
ref|XP_007211395.1|  hypothetical protein PRUPE_ppa003337mg             318   2e-95    
ref|XP_006416741.1|  hypothetical protein EUTSA_v10007175mg             318   2e-95    
ref|XP_009783431.1|  PREDICTED: cationic amino acid transporter 8...    319   2e-95    
ref|XP_009409403.1|  PREDICTED: cationic amino acid transporter 5...    318   2e-95    
ref|XP_010040721.1|  PREDICTED: cationic amino acid transporter 5...    317   3e-95    
gb|KEH20726.1|  cationic amino acid transporter-like protein            318   3e-95    
ref|XP_008226236.1|  PREDICTED: cationic amino acid transporter 8...    317   4e-95    
ref|XP_010540618.1|  PREDICTED: cationic amino acid transporter 5       317   4e-95    
ref|XP_010915549.1|  PREDICTED: cationic amino acid transporter 5...    318   4e-95    
ref|XP_003630017.1|  High affinity cationic amino acid transporter      318   4e-95    
ref|XP_006468283.1|  PREDICTED: cationic amino acid transporter 1...    317   5e-95    
emb|CBI27231.3|  unnamed protein product                                320   6e-95    
gb|ADB92669.1|  cationic amino acid transporter 5                       316   1e-94    
gb|KDO45644.1|  hypothetical protein CISIN_1g007913mg                   316   1e-94    
ref|XP_010498053.1|  PREDICTED: cationic amino acid transporter 8...    316   1e-94    
ref|XP_003531311.1|  PREDICTED: cationic amino acid transporter 1...    316   1e-94    
ref|XP_002274916.1|  PREDICTED: cationic amino acid transporter 1...    316   2e-94    
ref|XP_004233878.1|  PREDICTED: cationic amino acid transporter 1...    316   2e-94    
ref|XP_009117725.1|  PREDICTED: cationic amino acid transporter 8...    315   2e-94    
ref|XP_006363175.1|  PREDICTED: cationic amino acid transporter 5...    315   2e-94    
ref|XP_006477927.1|  PREDICTED: cationic amino acid transporter 8...    316   2e-94    
ref|XP_010476848.1|  PREDICTED: cationic amino acid transporter 8...    315   2e-94    
emb|CDX81804.1|  BnaC08g37970D                                          315   3e-94    
ref|XP_006349994.1|  PREDICTED: cationic amino acid transporter 8...    316   3e-94    
emb|CDY21764.1|  BnaA09g45150D                                          315   3e-94    
emb|CAN73404.1|  hypothetical protein VITISV_010051                     315   4e-94    
ref|XP_006307083.1|  hypothetical protein CARUB_v10008669mg             315   5e-94    
gb|KCW73889.1|  hypothetical protein EUGRSUZ_E02481                     314   5e-94    
ref|XP_010459277.1|  PREDICTED: cationic amino acid transporter 8...    314   8e-94    
ref|XP_007138860.1|  hypothetical protein PHAVU_009G243600g             313   2e-93    
ref|NP_173155.1|  cationic amino acid transporter 8                     313   2e-93    
ref|XP_004498422.1|  PREDICTED: cationic amino acid transporter 1...    313   3e-93    
ref|XP_006410652.1|  hypothetical protein EUTSA_v10016446mg             312   3e-93    
ref|NP_181041.1|  cationic amino acid transporter 5                     311   3e-93    
ref|XP_010241177.1|  PREDICTED: cationic amino acid transporter 1...    311   4e-93    
ref|XP_006650336.1|  PREDICTED: cationic amino acid transporter 1...    310   4e-93    
gb|ACJ85737.1|  unknown                                                 310   4e-93    
ref|XP_006353075.1|  PREDICTED: cationic amino acid transporter 1...    312   5e-93    
ref|XP_002518795.1|  cationic amino acid transporter, putative          311   5e-93    
ref|XP_010519076.1|  PREDICTED: cationic amino acid transporter 1...    311   6e-93    
ref|XP_010092669.1|  Cationic amino acid transporter 1                  312   6e-93    
ref|XP_011082871.1|  PREDICTED: cationic amino acid transporter 8...    312   7e-93    
ref|XP_004232627.2|  PREDICTED: cationic amino acid transporter 5       311   8e-93    
gb|KFK36400.1|  hypothetical protein AALP_AA4G119400                    310   1e-92    
ref|XP_002881367.1|  hypothetical protein ARALYDRAFT_482460             310   2e-92    
ref|XP_009778011.1|  PREDICTED: cationic amino acid transporter 1...    310   2e-92    
dbj|BAJ88234.1|  predicted protein                                      311   3e-92    
gb|KFK43902.1|  hypothetical protein AALP_AA1G188800                    310   3e-92    
ref|XP_003576816.1|  PREDICTED: cationic amino acid transporter 5...    310   3e-92    
ref|XP_007041135.1|  Amino acid transporter 1                           310   4e-92    
ref|XP_003565484.1|  PREDICTED: cationic amino acid transporter 5       309   1e-91    
ref|XP_009617281.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    308   1e-91    
ref|XP_004301950.1|  PREDICTED: cationic amino acid transporter 8...    308   2e-91    
ref|XP_008801990.1|  PREDICTED: cationic amino acid transporter 5...    307   2e-91    
gb|KCW44978.1|  hypothetical protein EUGRSUZ_L01436                     306   2e-91    
ref|XP_003533107.2|  PREDICTED: cationic amino acid transporter 1...    308   2e-91    
ref|XP_006587247.1|  PREDICTED: cationic amino acid transporter 1...    308   2e-91    
ref|XP_006836311.1|  hypothetical protein AMTR_s00092p00049320          307   3e-91    
ref|XP_010540127.1|  PREDICTED: cationic amino acid transporter 8...    307   3e-91    
gb|KEH19497.1|  cationic amino acid transporter                         306   6e-91    
ref|XP_006468574.1|  PREDICTED: cationic amino acid transporter 5...    306   8e-91    
ref|XP_004497371.1|  PREDICTED: cationic amino acid transporter 8...    306   9e-91    
ref|XP_010062740.1|  PREDICTED: cationic amino acid transporter 8...    305   1e-90    
emb|CDP18179.1|  unnamed protein product                                305   1e-90    
tpg|DAA52890.1|  TPA: hypothetical protein ZEAMMB73_769223              306   1e-90    
gb|EYU45055.1|  hypothetical protein MIMGU_mgv1a003403mg                305   2e-90    
ref|XP_010678963.1|  PREDICTED: cationic amino acid transporter 5       304   3e-90    
ref|XP_002278606.1|  PREDICTED: cationic amino acid transporter 8...    303   6e-90    
ref|XP_008673559.1|  PREDICTED: cationic amino acid transporter 5       306   8e-90    
ref|XP_008801991.1|  PREDICTED: cationic amino acid transporter 5...    303   9e-90    
ref|XP_004982336.1|  PREDICTED: uncharacterized protein LOC101754459    315   1e-89    
ref|XP_009765076.1|  PREDICTED: cationic amino acid transporter 5       303   1e-89    
ref|XP_010092716.1|  Cationic amino acid transporter 8                  302   2e-89    
ref|XP_008781696.1|  PREDICTED: cationic amino acid transporter 5...    302   3e-89    
ref|XP_006448600.1|  hypothetical protein CICLE_v10014698mg             301   4e-89    
ref|XP_010911512.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    301   4e-89    
ref|XP_010694567.1|  PREDICTED: cationic amino acid transporter 8...    302   4e-89    
ref|XP_002523204.1|  cationic amino acid transporter, putative          300   5e-89    
ref|XP_006295596.1|  hypothetical protein CARUB_v10024707mg             301   6e-89    
gb|KDP25932.1|  hypothetical protein JCGZ_22837                         301   7e-89    
ref|XP_010509683.1|  PREDICTED: cationic amino acid transporter 5...    300   7e-89    
ref|XP_010279630.1|  PREDICTED: cationic amino acid transporter 8...    300   9e-89    
ref|XP_009405465.1|  PREDICTED: cationic amino acid transporter 1...    300   1e-88    
ref|XP_004295609.1|  PREDICTED: cationic amino acid transporter 1...    298   1e-88    
ref|XP_010028234.1|  PREDICTED: cationic amino acid transporter 5...    300   1e-88    
ref|XP_010504987.1|  PREDICTED: cationic amino acid transporter 5       299   2e-88    
emb|CDP18177.1|  unnamed protein product                                300   2e-88    
ref|XP_010276879.1|  PREDICTED: cationic amino acid transporter 1...    298   3e-88    
gb|EEE51670.1|  hypothetical protein OsJ_33015                          296   5e-88    
ref|XP_010092666.1|  Cationic amino acid transporter 1                  293   5e-88    
ref|XP_005647970.1|  amino acid permease family protein                 298   8e-88    
ref|XP_011085215.1|  PREDICTED: cationic amino acid transporter 1...    298   1e-87    
ref|XP_010516664.1|  PREDICTED: cationic amino acid transporter 5...    296   2e-87    
emb|CAN78727.1|  hypothetical protein VITISV_020011                     295   4e-87    
ref|XP_009362248.1|  PREDICTED: cationic amino acid transporter 1...    296   4e-87    
gb|EMT25036.1|  Putative cationic amino acid transporter                294   5e-87    
ref|XP_006448934.1|  hypothetical protein CICLE_v10018362mg             294   2e-86    
gb|KHN11451.1|  Cationic amino acid transporter 7, chloroplastic        293   2e-86    
emb|CBI30990.3|  unnamed protein product                                295   2e-86    
ref|XP_007133375.1|  hypothetical protein PHAVU_011G174000g             295   2e-86    
emb|CDX90490.1|  BnaA03g42910D                                          283   2e-86    
emb|CDP06088.1|  unnamed protein product                                295   2e-86    
emb|CBI27075.3|  unnamed protein product                                300   5e-86    
ref|XP_004968601.1|  PREDICTED: cationic amino acid transporter 5...    293   1e-85    
ref|XP_009409402.1|  PREDICTED: cationic amino acid transporter 5...    290   6e-85    
ref|XP_003534729.1|  PREDICTED: cationic amino acid transporter 8...    290   8e-85    
ref|XP_010644794.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    290   1e-84    
ref|XP_002454959.1|  hypothetical protein SORBIDRAFT_03g002130          289   3e-84    
ref|XP_007022159.1|  Cationic amino acid transporter 8                  291   3e-84    
gb|EPS74420.1|  hypothetical protein M569_00333                         289   4e-84    
ref|XP_006368941.1|  hypothetical protein POPTR_0001s150801g            275   4e-84    
ref|XP_003594855.1|  High affinity cationic amino acid transporter      286   1e-83    
gb|EMS56571.1|  putative amino acid permease YhdG                       280   5e-83    
gb|EPS61395.1|  hypothetical protein M569_13402                         277   9e-82    
ref|XP_004504191.1|  PREDICTED: cationic amino acid transporter 1...    279   4e-81    
emb|CBI14847.3|  unnamed protein product                                268   5e-81    
dbj|BAJ88072.1|  predicted protein                                      280   8e-81    
emb|CDM82248.1|  unnamed protein product                                279   2e-80    
ref|XP_006445757.1|  hypothetical protein CICLE_v10014713mg             270   3e-80    
ref|XP_003630016.1|  Cationic amino acid transporter                    276   1e-79    
ref|XP_004487906.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    275   2e-79    
ref|XP_006580236.1|  PREDICTED: cationic amino acid transporter 1...    275   4e-79    
ref|XP_010931101.1|  PREDICTED: cationic amino acid transporter 6...    266   9e-79    
ref|XP_005648323.1|  amino acid transporter                             271   2e-78    
ref|XP_004965550.1|  PREDICTED: cationic amino acid transporter 8...    273   2e-78    
ref|XP_002437109.1|  hypothetical protein SORBIDRAFT_10g021160          273   3e-78    
ref|XP_002310990.1|  hypothetical protein POPTR_0008s01800g             262   3e-77    
ref|XP_008649162.1|  PREDICTED: cationic amino acid transporter 8...    268   2e-76    
gb|KCW77857.1|  hypothetical protein EUGRSUZ_D02134                     263   8e-76    
ref|NP_001057802.1|  Os06g0539400                                       266   1e-75    
gb|EAZ01252.1|  hypothetical protein OsI_23277                          265   2e-75    
ref|XP_010436466.1|  PREDICTED: cationic amino acid transporter 1...    261   3e-75    
ref|XP_005649322.1|  amino acid transporter                             263   3e-75    
ref|XP_010941816.1|  PREDICTED: cationic amino acid transporter 1...    264   4e-75    
ref|XP_006285137.1|  hypothetical protein CARUB_v10006478mg             261   5e-75    
gb|AAL91292.1|  At2g34960/F19I3.19                                      260   5e-75    
ref|XP_006645624.1|  PREDICTED: cationic amino acid transporter 5...    263   7e-75    
emb|CDX90489.1|  BnaA03g42920D                                          254   7e-75    
ref|XP_003532802.2|  PREDICTED: cationic amino acid transporter 1...    263   1e-74    
ref|XP_004158089.1|  PREDICTED: LOW QUALITY PROTEIN: cationic ami...    259   2e-74    
ref|XP_003560703.1|  PREDICTED: cationic amino acid transporter 8...    261   9e-74    
ref|XP_005842818.1|  hypothetical protein CHLNCDRAFT_7483               256   4e-73    
ref|XP_011085216.1|  PREDICTED: cationic amino acid transporter 1...    254   1e-72    
ref|XP_001689684.1|  cationic amino acid transporter 2                  255   2e-71    
ref|XP_011030189.1|  PREDICTED: cationic amino acid transporter 1...    249   9e-71    
ref|XP_001753423.1|  predicted protein                                  252   1e-70    
ref|XP_002953996.1|  hypothetical protein VOLCADRAFT_64294              248   7e-70    
gb|KDO45646.1|  hypothetical protein CISIN_1g007913mg                   243   2e-69    
ref|NP_001042365.1|  Os01g0209800                                       246   2e-68    
gb|EEE52800.1|  hypothetical protein OsJ_35284                          239   3e-68    
gb|KDO45645.1|  hypothetical protein CISIN_1g007913mg                   242   9e-68    
ref|XP_006442252.1|  hypothetical protein CICLE_v10019753mg             241   2e-67    
gb|EMS53631.1|  putative amino acid permease YfnA                       235   3e-67    
gb|EMT10508.1|  Putative amino acid permease yfnA                       241   3e-67    
ref|XP_010325527.1|  PREDICTED: cationic amino acid transporter 6...    231   5e-67    
ref|XP_002526615.1|  cationic amino acid transporter, putative          236   4e-66    
emb|CBI33021.3|  unnamed protein product                                239   6e-66    
ref|XP_007214017.1|  hypothetical protein PRUPE_ppa016270mg             234   9e-65    
ref|XP_007153299.1|  hypothetical protein PHAVU_003G023300g             232   3e-64    
gb|AAT85283.1|  amino acid permease domain containing protein           229   9e-64    
gb|AFW56082.1|  hypothetical protein ZEAMMB73_659926                    223   3e-63    
ref|XP_002506683.1|  amino acid-polyamine-organocation family           227   6e-63    
ref|XP_004983495.1|  PREDICTED: cationic amino acid transporter 5...    226   4e-61    
ref|XP_001690454.1|  cationic amino acid transporter                    217   5e-58    
gb|ABF46817.1|  putative cationic amino acid transporter 5              206   9e-57    
gb|EEC67701.1|  hypothetical protein OsI_35170                          207   2e-56    
gb|ABF46815.1|  putative cationic amino acid transporter 5              203   2e-55    
gb|ABF46816.1|  putative cationic amino acid transporter 5              202   3e-55    
ref|XP_001421369.1|  APC family transporter: amino acid                 205   3e-54    
ref|XP_006664352.1|  PREDICTED: cationic amino acid transporter 6...    201   3e-53    
ref|XP_006590230.1|  PREDICTED: cationic amino acid transporter 7...    199   2e-52    
ref|XP_005645608.1|  amino acid transporter                             199   4e-52    
gb|KHN34891.1|  Cationic amino acid transporter 6, chloroplastic        187   2e-50    
ref|XP_009111523.1|  PREDICTED: cationic amino acid transporter 9...    189   2e-48    
ref|XP_006385370.1|  hypothetical protein POPTR_0003s031602g            176   2e-48    
emb|CAN73583.1|  hypothetical protein VITISV_038273                     194   7e-48    
ref|XP_009111524.1|  PREDICTED: cationic amino acid transporter 9...    187   8e-48    
emb|CEG01657.1|  Amino acid/polyamine transporter I                     187   1e-47    
ref|XP_007953147.1|  PREDICTED: low affinity cationic amino acid ...    187   2e-47    
ref|XP_006664762.1|  PREDICTED: cationic amino acid transporter 2...    187   3e-47    
ref|XP_007432371.1|  PREDICTED: high affinity cationic amino acid...    185   9e-47    
gb|AET04492.2|  cationic amino acid transporter                         181   2e-46    
emb|CDY51753.1|  BnaA05g32770D                                          184   2e-46    
ref|NP_563754.1|  cationic amino acid transporter 9                     182   4e-46    
ref|XP_004493214.1|  PREDICTED: cationic amino acid transporter 4...    183   5e-46    
ref|XP_010592331.1|  PREDICTED: high affinity cationic amino acid...    182   5e-46    
ref|XP_009130387.1|  PREDICTED: cationic amino acid transporter 4...    182   6e-46    
ref|XP_009130386.1|  PREDICTED: cationic amino acid transporter 4...    183   8e-46    
gb|EAW63812.1|  solute carrier family 7 (cationic amino acid tran...    182   1e-45    
ref|WP_036378462.1|  amino acid permease                                179   1e-45    
ref|XP_006396195.1|  hypothetical protein EUTSA_v10028547mg             180   1e-45    
ref|XP_006396197.1|  hypothetical protein EUTSA_v10028547mg             181   1e-45    
emb|CDY29954.1|  BnaC01g40540D                                          181   2e-45    



>ref|XP_009797086.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Nicotiana sylvestris]
Length=565

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/571 (79%), Positives = 500/571 (88%), Gaps = 9/571 (2%)
 Frame = -2

Query  2022  IFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlg  1843
             +FSTYL+S S+TP+KLKKR LATWTPDQELNKVRLRSGADMKRKLTWYDLVALGVGGMLG
Sbjct  2     VFSTYLHSFSKTPQKLKKRMLATWTPDQELNKVRLRSGADMKRKLTWYDLVALGVGGMLG  61

Query  1842  vgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGE  1663
             VGVFVTTGPVARKT+GPSVFISYI+A +SALLSSLCYTEFSV+VPVAGGAFSYLR+TFGE
Sbjct  62    VGVFVTTGPVARKTSGPSVFISYIIAAISALLSSLCYTEFSVDVPVAGGAFSYLRVTFGE  121

Query  1662  FVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPav  1483
             FVGYFAGANILM+YVLSNAAVSRSFTEYLS A G  +P+ WRV V GLM+GYNMLDF AV
Sbjct  122   FVGYFAGANILMEYVLSNAAVSRSFTEYLSCAFGRNDPNSWRVHVHGLMDGYNMLDFSAV  181

Query  1482  aliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGV  1303
             ALII+LTI LCHSTKESS+LNLVMT+FHVVFFGFIIIAGF  G  +NLVK GG +AP+GV
Sbjct  182   ALIIVLTICLCHSTKESSMLNLVMTMFHVVFFGFIIIAGFCNGRVENLVKPGG-IAPYGV  240

Query  1302  RGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllL  1123
             RG+LDGAAIVYFSYIGYD+VSTMAEEI NPSK+LPVGIVGSVLIVSALYCLMALSLCLL+
Sbjct  241   RGILDGAAIVYFSYIGYDTVSTMAEEIRNPSKTLPVGIVGSVLIVSALYCLMALSLCLLV  300

Query  1122  PYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVP  943
             PYN+IPE  SFSA F+ MGWKWASNVVGVGA LGIVASLLVAMLGQARYLCV+GRARLVP
Sbjct  301   PYNMIPEGASFSAVFQQMGWKWASNVVGVGACLGIVASLLVAMLGQARYLCVIGRARLVP  360

Query  942   SWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrry  763
             SW A+VHP+TGTPLNATI LGICQAS+ALFTEL+IVIE+ISIGTL+VFYLV+ ALI+RRY
Sbjct  361   SWFAQVHPTTGTPLNATIVLGICQASIALFTELEIVIEMISIGTLLVFYLVSNALIFRRY  420

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVP--C  589
              I++ NPP   L FLFL+S +S  FSL+WKL LQWWNL LF  LT+S T +F  LVP   
Sbjct  421   VILSKNPPLHTLFFLFLLSCTSFAFSLAWKLKLQWWNLLLFATLTISMTFIFQYLVPLVV  480

Query  588   VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKv  409
             V+RP+SW VPLMPWPA +SIFLNVFLMTTL + AYKRFGIW  L++LFYVVYGVHSTY  
Sbjct  481   VQRPDSWLVPLMPWPATISIFLNVFLMTTLKMVAYKRFGIWAALITLFYVVYGVHSTYH-  539

Query  408   eemevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
                    +     V+NN +T Q  K+EIQVL
Sbjct  540   -----AEEMEMVVVDNNVNTQQTAKVEIQVL  565



>ref|XP_009629399.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=565

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/570 (78%), Positives = 495/570 (87%), Gaps = 7/570 (1%)
 Frame = -2

Query  2022  IFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlg  1843
             +FSTYL S S+TP+KLKKR LATWTPDQELNKVRLRSGADMKRKLTWYDLVALGVGGMLG
Sbjct  2     VFSTYLQSFSKTPQKLKKRMLATWTPDQELNKVRLRSGADMKRKLTWYDLVALGVGGMLG  61

Query  1842  vgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGE  1663
             VGVFVTTGPVARKT+GPSVFISYI+A +SALLSSLCYTEFSV+VPVAGGAFSYLR+TFGE
Sbjct  62    VGVFVTTGPVARKTSGPSVFISYIIAAISALLSSLCYTEFSVDVPVAGGAFSYLRVTFGE  121

Query  1662  FVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPav  1483
             FVGYFAGANILM+YVLSNAAVSRSFTEYLS A G  +P+ WRV V GLM+GYNMLDF AV
Sbjct  122   FVGYFAGANILMEYVLSNAAVSRSFTEYLSCAFGRNDPNSWRVHVHGLMDGYNMLDFSAV  181

Query  1482  aliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGV  1303
             ALII+LTI LCHSTKESS+LNLVMT+FHVVFFGFIIIAGF  G  +NLVK GG +AP+GV
Sbjct  182   ALIIVLTICLCHSTKESSMLNLVMTMFHVVFFGFIIIAGFCNGRVENLVKPGG-IAPYGV  240

Query  1302  RGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllL  1123
             RG+LDGAAIVYFSYIGYD+VSTMAEEI NPSK+LPVGIVGSVLIVSALYCLMALSLCLL+
Sbjct  241   RGILDGAAIVYFSYIGYDTVSTMAEEIRNPSKTLPVGIVGSVLIVSALYCLMALSLCLLV  300

Query  1122  PYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVP  943
             PYN+IPE  SFSA F+ MGWKWASNVVG GA LGIVASLLVAMLGQARYLCV+GRARLVP
Sbjct  301   PYNMIPEGASFSAVFQQMGWKWASNVVGAGACLGIVASLLVAMLGQARYLCVIGRARLVP  360

Query  942   SWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrry  763
             SW A+VHP+TGTPLNATI LGICQAS+ALFTEL IVIE+ISIGTL+VFYLV+ ALI+RRY
Sbjct  361   SWFAQVHPTTGTPLNATIVLGICQASIALFTELDIVIEMISIGTLLVFYLVSNALIFRRY  420

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVP-CV  586
              I++ NPP   L FLFL+S +S  FSL+WKL LQWWNL L   LT+S T +F  LVP  V
Sbjct  421   VILSKNPPLHTLFFLFLLSCTSFAFSLAWKLKLQWWNLLLIATLTISMTVIFQYLVPLVV  480

Query  585   RRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKve  406
             RRP+SW VP MPWPA +SIFLNVFLMTTL + AYKRFGIW G +++FYV+YGVHSTY+  
Sbjct  481   RRPDSWLVPFMPWPATISIFLNVFLMTTLKMVAYKRFGIWAGFITIFYVIYGVHSTYR--  538

Query  405   emevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
                         V+NN +T Q  K+EIQVL
Sbjct  539   ---AEEIMEMVVVDNNVNTQQTAKVEIQVL  565



>ref|XP_006359260.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Solanum tuberosum]
Length=570

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/536 (81%), Positives = 479/536 (89%), Gaps = 3/536 (1%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             TYLNSLS+TP+KLKKR LATWTPDQELNKVRLRSGADMKRKLTWYDLVALGVGGMLGVGV
Sbjct  5     TYLNSLSKTPQKLKKRMLATWTPDQELNKVRLRSGADMKRKLTWYDLVALGVGGMLGVGV  64

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVTTGPVARKT+GPSVFISYI+A +SALLSSLCYTEFSV+VPVAGGAFSYLR+TFGEFVG
Sbjct  65    FVTTGPVARKTSGPSVFISYIIAAVSALLSSLCYTEFSVDVPVAGGAFSYLRVTFGEFVG  124

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             YFAGANILM+YVLSNAAVSRSFTEYLS A G  +P+ WR+   GLM+GYNMLDFPAVALI
Sbjct  125   YFAGANILMEYVLSNAAVSRSFTEYLSCAFGRNDPNSWRIHAHGLMQGYNMLDFPAVALI  184

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
             I+LTI LCHSTKESS+LNL+MT FHVVFFGFIIIAGF  G  +NLVK GG +AP+GVRG+
Sbjct  185   IVLTICLCHSTKESSMLNLIMTAFHVVFFGFIIIAGFCNGKVENLVKPGG-IAPYGVRGI  243

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
             LDGAAIVYFSYIGYD+VSTMAEEI NPSK+LP+GIVGSVLIVSALYCLMALSLCLLLPYN
Sbjct  244   LDGAAIVYFSYIGYDTVSTMAEEIKNPSKTLPLGIVGSVLIVSALYCLMALSLCLLLPYN  303

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
             +IPE  SFSA F++MGWKWASNVVGVGASLGIVASLLVAMLGQARYLCV+GRARLVPSW 
Sbjct  304   MIPEGASFSAVFELMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVIGRARLVPSWF  363

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiI  754
             AKVHP+TGTPLNATI LGICQAS+ALFTEL IV+E+ISIGTL+VFYLV+ ALI+RRY I+
Sbjct  364   AKVHPTTGTPLNATIVLGICQASIALFTELDIVMEMISIGTLLVFYLVSNALIFRRYVIL  423

Query  753   NGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCV--RR  580
             + NPP   LLFLFL+SS+S  FSLSW+  L WWNL LF  LT S T +F   VP +   R
Sbjct  424   SKNPPLHTLLFLFLLSSTSFAFSLSWQFKLHWWNLMLFAGLTFSATVIFQYFVPMIIMER  483

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              ESW VP MPWPA +SIFLNVFLMTTL + AYKRFGIW G++++FYV+YGVHSTY 
Sbjct  484   QESWLVPFMPWPATISIFLNVFLMTTLKMVAYKRFGIWAGVITIFYVLYGVHSTYH  539



>ref|XP_004300325.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=583

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/568 (76%), Positives = 488/568 (86%), Gaps = 5/568 (1%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS YL+SLSQTP +L+KR LATWTPDQELN+VR RSGADMKRKL WYDL+ALGVGGMLGV
Sbjct  21    FSNYLHSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKRKLKWYDLMALGVGGMLGV  80

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA KTAGPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGAFSYLR+TFGEF
Sbjct  81    GVFVTTGSVAHKTAGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTFGEF  140

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFTEYLS A G+ +P  WRV+VDGL++GYNMLDFPAVA
Sbjct  141   VGYFAGANILMEYVLSNAAVARSFTEYLSSAFGQDDPKIWRVEVDGLIKGYNMLDFPAVA  200

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             LI+LLT  LCHSTKESS LNL+MT+FHVVFFGFIIIAGF  GS++NLVK  G LAPFGVR
Sbjct  201   LILLLTFCLCHSTKESSTLNLIMTVFHVVFFGFIIIAGFCIGSTNNLVKPKG-LAPFGVR  259

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAAIVYFSYIGYDS STMAEEI NPS+SLPVGI+GSV+I S LYCLMALSLC ++P
Sbjct  260   GVLDGAAIVYFSYIGYDSASTMAEEIQNPSQSLPVGIIGSVVITSLLYCLMALSLCFMVP  319

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I E+ SFS AF+ +GW WASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  320   YNKIAEKVSFSVAFRQIGWDWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  379

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHP+TGTPLNAT+FLG+C AS+ALFT+L+IVIE+ISIGTL+VFYLVA ALIYRRY 
Sbjct  380   WLAKVHPATGTPLNATLFLGLCTASIALFTDLEIVIEMISIGTLLVFYLVANALIYRRYV  439

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             II  NPPFQ LLFLFL+SSS++GFS+SWKLN Q W LPLFG  T++  A F  +VPCV  
Sbjct  440   IITNNPPFQTLLFLFLLSSSAIGFSMSWKLNQQRWGLPLFGMSTVTIIAFFKYMVPCVCN  499

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKveem  400
             P  WS+P MPWPAALSIFLNVFLMTTL   +++RF IW   ++LFY++YGVHSTYK    
Sbjct  500   PTGWSMPFMPWPAALSIFLNVFLMTTLKKFSFERFAIWACFITLFYLLYGVHSTYK----  555

Query  399   evmvdnnnnhvnnnNSTTQPIKLEIQVL  316
                 +       N  +  Q IKLEIQVL
Sbjct  556   AEEREGTGIDEVNPRTAVQQIKLEIQVL  583



>ref|XP_009346156.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Pyrus x bretschneideri]
Length=601

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/536 (76%), Positives = 475/536 (89%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS YL+SLSQTP +L++R LATWTPD+ELN+VR RSGADMKRKL WYDL+ALGVGGMLGV
Sbjct  39    FSKYLHSLSQTPHRLRRRMLATWTPDEELNQVRQRSGADMKRKLNWYDLMALGVGGMLGV  98

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTGPVA +TAGPSVFISYIVAG+SALLSSLCY EFSV++PVAGGAFSYLR+TFGEF
Sbjct  99    GVFVTTGPVAHQTAGPSVFISYIVAGMSALLSSLCYAEFSVQIPVAGGAFSYLRLTFGEF  158

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFTEYLS   GE +P  WRV+V+GL++GY+MLDFPAVA
Sbjct  159   VGYFAGANILMEYVLSNAAVARSFTEYLSSTFGENDPRTWRVEVNGLVKGYDMLDFPAVA  218

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             ++++LT+ LCHSTKESSLLNL+MT+FHVVFFGFIIIAGF  G++ NL+K  G +AP+GVR
Sbjct  219   VVLILTLCLCHSTKESSLLNLIMTVFHVVFFGFIIIAGFCNGTTKNLMKPKG-IAPYGVR  277

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAA VYFSYIGYDS STMAEEI NP  SLP+GIVGSV+I S LYCLMALSLCL++P
Sbjct  278   GVLDGAARVYFSYIGYDSASTMAEEIQNPLTSLPIGIVGSVVITSVLYCLMALSLCLMVP  337

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I E+ +FS AF+ +GW WASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  338   YNKITEKVAFSTAFQEIGWGWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  397

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHPSTGTPLNAT+FLG+C AS+ALFT+L+IVIE+ISIGTL+VFYLVA ALIYRRY 
Sbjct  398   WLAKVHPSTGTPLNATLFLGLCTASIALFTDLEIVIEMISIGTLLVFYLVANALIYRRYV  457

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             II+ NPPFQ LLFLFL+SSS++GFS+SWK   QWW LPLFG  T++  A F+  VPCVR 
Sbjct  458   IISNNPPFQTLLFLFLLSSSAIGFSMSWKFQQQWWGLPLFGVSTVTIIAFFNYAVPCVRH  517

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
                WS+P MPWPAALSIFLNVFLMTTL   +++RF IWT  ++LFY++YGVHSTY+
Sbjct  518   QIGWSMPFMPWPAALSIFLNVFLMTTLKKFSFERFAIWTCFITLFYLLYGVHSTYQ  573



>ref|XP_007210584.1| hypothetical protein PRUPE_ppa015187mg [Prunus persica]
 gb|EMJ11783.1| hypothetical protein PRUPE_ppa015187mg [Prunus persica]
Length=580

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/536 (77%), Positives = 475/536 (89%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS YL+SLSQTP +L+KR LATWTPDQELN+VR RSGADMKRKL WYDLVALGVGGMLGV
Sbjct  18    FSKYLHSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKRKLKWYDLVALGVGGMLGV  77

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA +T+GPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGAFSYLR+TFGEF
Sbjct  78    GVFVTTGQVAFETSGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRLTFGEF  137

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+R+FT+YLS A GE +P  WRVKVDGL+EG NMLDFPAVA
Sbjct  138   VGYFAGANILMEYVLSNAAVARNFTDYLSSAFGENDPKTWRVKVDGLVEGCNMLDFPAVA  197

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             LI+LLT+ LCHSTKESSLLNL+MT+FHVVFFGFIII GF KGS++NLVK  G LAP+GVR
Sbjct  198   LILLLTLCLCHSTKESSLLNLIMTVFHVVFFGFIIIVGFCKGSTNNLVKPKG-LAPYGVR  256

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAA VY SYIGYDSVSTMAEEI NPSKSLP+GIVGSV+I S LYCLMALSLCL++P
Sbjct  257   GVLDGAAKVYLSYIGYDSVSTMAEEIQNPSKSLPIGIVGSVVITSVLYCLMALSLCLMVP  316

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I    +FS AF+ +GW+WASN+VG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  317   YNEISRNVAFSMAFRQIGWEWASNLVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  376

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHPSTGTPLNAT+FLG+C AS+ALFT+L+IVI++ISIGTL+VFYLVA ALIYRRY 
Sbjct  377   WLAKVHPSTGTPLNATLFLGLCTASIALFTDLEIVIDMISIGTLLVFYLVANALIYRRYV  436

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
              I+ NPPFQ LLFLFL+SSS++GFS+SWK   Q W LPLFG  T++  A F+  VPC+R 
Sbjct  437   TISNNPPFQTLLFLFLLSSSAIGFSMSWKFKQQRWGLPLFGVSTITIIAFFNYTVPCLRH  496

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
                WS+P MPWPAALSIFLNVFLMTTL   +++RF +W  L++LFY++YGVHSTY+
Sbjct  497   STGWSMPFMPWPAALSIFLNVFLMTTLKQFSFERFAVWACLITLFYLLYGVHSTYQ  552



>ref|XP_007039671.1| Cationic amino acid transporter, putative [Theobroma cacao]
 gb|EOY24172.1| Cationic amino acid transporter, putative [Theobroma cacao]
Length=603

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/536 (76%), Positives = 474/536 (88%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  YL SLSQTP++L+KR LATWTPDQELN VRLRSGADMKRKL WY+LVALGVGGMLG 
Sbjct  42    FFNYLQSLSQTPRRLRKRMLATWTPDQELNHVRLRSGADMKRKLRWYELVALGVGGMLGA  101

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VAR  +GPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGAFSYLR+TFGEF
Sbjct  102   GVFVTTGHVARNNSGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTFGEF  161

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANIL++YVLSNAAV+RSFTEYL+ ALG  +PD WRV V GL+EG+N LDF AVA
Sbjct  162   VGYFAGANILLEYVLSNAAVARSFTEYLAAALGVSDPDSWRVGVPGLLEGWNKLDFTAVA  221

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             L++LLT+ LCHSTKESS+LNL+MTIFHVVFFGFIII GF  GS DNLVK GG LAP GVR
Sbjct  222   LVLLLTLCLCHSTKESSILNLIMTIFHVVFFGFIIIVGFCNGSVDNLVKPGG-LAPNGVR  280

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+LDGAAIVYFSYIGYDSVST+AEEI NP  SLPVGIVGSVLIVSALYCLMAL+LC+++P
Sbjct  281   GILDGAAIVYFSYIGYDSVSTLAEEIQNPPVSLPVGIVGSVLIVSALYCLMALALCVMVP  340

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I ++ S+S AF+ +GWKWA NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  341   YNQIDDKASYSIAFQKIGWKWAGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  400

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WL+KVHPSTGTPLNAT+FLG+C AS+ALFT+LKIV+E+I+IGTL+VFYLVA ALIYR+Y 
Sbjct  401   WLSKVHPSTGTPLNATLFLGLCTASIALFTDLKIVLEMINIGTLLVFYLVANALIYRKYV  460

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             I + NPPF+ L FLFL+++S++ FS+SWKL  Q W LPLFG + ++ TA F  +VPC+R+
Sbjct  461   IRSKNPPFRTLSFLFLLTASAIAFSISWKLKQQRWGLPLFGGIMITITAFFQYMVPCLRQ  520

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             P  WSVP MPWPAA+SIFLNVFLMTTL + A++RF IW  L+++FYV+YGVHSTY+
Sbjct  521   PSEWSVPFMPWPAAISIFLNVFLMTTLKMLAFQRFAIWACLITVFYVLYGVHSTYE  576



>ref|XP_008373647.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Malus domestica]
Length=601

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/536 (77%), Positives = 475/536 (89%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS YL+SLSQTP +L++R LATWTPD+ELN+VR RSGADMKRKL WYDL+ALGVGGMLGV
Sbjct  39    FSKYLHSLSQTPHRLRRRMLATWTPDEELNQVRQRSGADMKRKLKWYDLMALGVGGMLGV  98

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTGPVA +TAGPSVFISYIVAG+SALLSSLCY EFSV++PVAGGAFSYLR+TFGEF
Sbjct  99    GVFVTTGPVAHQTAGPSVFISYIVAGMSALLSSLCYAEFSVQIPVAGGAFSYLRLTFGEF  158

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFTEYLS   GE +P  WRV+V+GL++GY+MLDFPAVA
Sbjct  159   VGYFAGANILMEYVLSNAAVARSFTEYLSSTFGENDPRTWRVEVNGLVKGYDMLDFPAVA  218

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             L++LLT+ LCHSTKESSLLNL+MT+FHVVFFGFIIIAGF  G+S NLVK  G +AP+GVR
Sbjct  219   LVLLLTLCLCHSTKESSLLNLIMTVFHVVFFGFIIIAGFCNGTSKNLVKPKG-IAPYGVR  277

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAA VYFSYIGYDS STMAEEI +P  SLP+GIVGSV+I S LYCLMALSLCL++P
Sbjct  278   GVLDGAARVYFSYIGYDSASTMAEEIQSPLTSLPIGIVGSVVITSVLYCLMALSLCLMVP  337

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I E+ +FS AFK +GW WASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  338   YNKITEKVTFSTAFKEIGWGWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  397

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHPSTGTPLNAT+FLG+C AS+ALFT+L+IV+E+ISIGTL+VFYLVA ALIYRRY 
Sbjct  398   WLAKVHPSTGTPLNATLFLGLCTASIALFTDLEIVMEMISIGTLLVFYLVANALIYRRYV  457

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             II+ NPPFQ LLFLFL+SSS++GFS+SWK + QWW LPLFG  T++  A F+  +PCVR 
Sbjct  458   IISNNPPFQTLLFLFLLSSSAIGFSMSWKFHQQWWGLPLFGVSTVTIIAFFNYAIPCVRH  517

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
                WS+P MPWPAALSIFLNVFLMTTL   +++RF IW   ++LFY++YGVHSTY+
Sbjct  518   QIGWSMPFMPWPAALSIFLNVFLMTTLKKFSFERFAIWACFITLFYLLYGVHSTYQ  573



>ref|XP_011047557.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Populus euphratica]
Length=588

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/569 (73%), Positives = 488/569 (86%), Gaps = 8/569 (1%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS YL SLSQTP +L+KR LATWTPDQELN+VRLRSGADM RKL WYDLVALG+GGMLGV
Sbjct  27    FSNYLKSLSQTPHRLRKRMLATWTPDQELNQVRLRSGADMMRKLKWYDLVALGIGGMLGV  86

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTGPVA K +GPSVFISYI+AG+SAL SSLCYTEFSV++PVAGGAFSYLR+TFGEF
Sbjct  87    GVFVTTGPVALKISGPSVFISYIIAGISALFSSLCYTEFSVQIPVAGGAFSYLRVTFGEF  146

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             +GYFAGANILM+YVLSNAAV+RSFTEYL +A+GE NP  WR++VDG+ EGYNMLDFPAVA
Sbjct  147   IGYFAGANILMEYVLSNAAVARSFTEYLCHAVGE-NPSSWRIEVDGVAEGYNMLDFPAVA  205

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             LI+LLT+ LC+STK+SS+LNL MT+FHV+FFGFIII GF KGS+ NLV+ GG LAPFGV+
Sbjct  206   LILLLTLCLCYSTKKSSILNLTMTVFHVIFFGFIIIVGFSKGSARNLVEPGG-LAPFGVK  264

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAAIVYFSYIGYDSVSTMAEEI NP+KSLPVGI+GSVLIV+ LYCLMALSLCLL+P
Sbjct  265   GVLDGAAIVYFSYIGYDSVSTMAEEIQNPAKSLPVGILGSVLIVTGLYCLMALSLCLLVP  324

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             +N+I ++ SFS AF+ +GWKWASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  325   FNMIEKDASFSVAFEKIGWKWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  384

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             W AKV+PSTGTPLNAT+FLG+C AS+ALFTEL I++E+ISI TL+VFY+VA ALIYRRY 
Sbjct  385   WFAKVNPSTGTPLNATLFLGLCTASIALFTELSIILEMISISTLLVFYMVANALIYRRYV  444

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             +I+ NPP Q LLFL L+SS+++GFS+SWKL+ +WW LP+ G   ++ TA F  +VP V +
Sbjct  445   VISHNPPSQTLLFLVLLSSTTIGFSMSWKLDERWWALPVLGGFMIAITAFFQYMVPSVCQ  504

Query  579   P-ESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKvee  403
             P E WSVP MPWPA  SIFLNVFLMTTL   +++RFGIW   ++LFYV+YGVHSTY+   
Sbjct  505   PNEEWSVPFMPWPAVTSIFLNVFLMTTLKAMSFQRFGIWAFFITLFYVLYGVHSTYR---  561

Query  402   mevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
                          +++ + Q  KL+IQVL
Sbjct  562   --AEEMEVGVGEISHHPSIQQTKLDIQVL  588



>gb|KHG24252.1| Cationic amino acid transporter 6, chloroplastic -like protein 
[Gossypium arboreum]
Length=572

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/534 (75%), Positives = 471/534 (88%), Gaps = 1/534 (0%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              YL SLSQTP +L+KR LATWTPDQELN+VRLRSGADMKRKL WYDLVALG+GGMLGVGV
Sbjct  15    NYLQSLSQTPHRLRKRMLATWTPDQELNQVRLRSGADMKRKLKWYDLVALGIGGMLGVGV  74

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVTTG VAR  +GP+VFISYI+AG+SALLSSLCYTEFSV++PVAGGAFSYLR+TFGEFVG
Sbjct  75    FVTTGRVARYNSGPAVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTFGEFVG  134

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             YFAGANILM+YVLSNAAV+RSFTEYL  A G  +P+ WRV+V GL+EGYN LDF AVAL+
Sbjct  135   YFAGANILMEYVLSNAAVARSFTEYLCSAFGVSDPNSWRVEVHGLLEGYNKLDFTAVALV  194

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
             +LLT+ LCHSTKESS LNL+MTIFHV+FFGFIII GF  GS DNLVK  G +AP G+RGV
Sbjct  195   LLLTLCLCHSTKESSTLNLIMTIFHVIFFGFIIIVGFCNGSVDNLVKPNG-IAPHGIRGV  253

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
             LDGAAIVYFSYIGYDSVST+AEEI NPS SLPVGIVGSVLIVSALYCLMAL+LC+++PYN
Sbjct  254   LDGAAIVYFSYIGYDSVSTLAEEIQNPSVSLPVGIVGSVLIVSALYCLMALALCMMVPYN  313

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I  + S+S AF+ +GWKWA NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSWL
Sbjct  314   QIAAKASYSMAFQNIGWKWAGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSWL  373

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiI  754
             + VHPSTGTPLNAT+FLG+C AS+ALFT+L IV+E+ISIGTL+VFYLVA A IYR+Y I 
Sbjct  374   SNVHPSTGTPLNATLFLGLCTASIALFTDLDIVLEMISIGTLLVFYLVANATIYRKYVIK  433

Query  753   NGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRRPE  574
             + NPP + L FLFL++SS++GFS+SWKL  QWW LPLFG L ++ TA F  +VPC+R+P 
Sbjct  434   SQNPPLRTLSFLFLLTSSAMGFSISWKLKQQWWGLPLFGGLMVTMTAFFQYMVPCIRQPS  493

Query  573   SWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              WS+P MPWPAA+SIFLNVFLMTTL++ +++RFG+W  L+++FY++YGVHST++
Sbjct  494   EWSIPFMPWPAAISIFLNVFLMTTLSMLSFQRFGVWACLITVFYLLYGVHSTFE  547



>gb|KHG28946.1| Cationic amino acid transporter 7, chloroplastic -like protein 
[Gossypium arboreum]
Length=574

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/545 (74%), Positives = 467/545 (86%), Gaps = 1/545 (0%)
 Frame = -2

Query  2049  TAVSRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlv  1870
             T  S+    IF  Y  SLSQTP +L+KR LATWTPDQELN+VRLRSGADMKRKL WYDLV
Sbjct  3     TIQSKDNKTIFFNYFKSLSQTPHRLRKRMLATWTPDQELNQVRLRSGADMKRKLRWYDLV  62

Query  1869  algvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAF  1690
             ALGVGGMLGVGVFVTTGPVAR  +GPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGAF
Sbjct  63    ALGVGGMLGVGVFVTTGPVARNHSGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAF  122

Query  1689  SYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEG  1510
             SYLR+TFGEFVGYFAGANILM+YVLSNAAV+RSFTEYL  A G  +P+ WRV+V GL++G
Sbjct  123   SYLRVTFGEFVGYFAGANILMEYVLSNAAVARSFTEYLCSAFGISDPNSWRVEVPGLLQG  182

Query  1509  YNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKS  1330
             YN LDF AVAL+++LT  LCHSTKESS+LNL+MT FH+VFFGFIII GF  GS +NLVK 
Sbjct  183   YNKLDFSAVALVLILTFCLCHSTKESSILNLIMTAFHIVFFGFIIIIGFCNGSVENLVKP  242

Query  1329  GGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalycl  1150
              G L P G+RGVLDGAAIVYFSYIGYDSVST+AEEI NP  +LPVGI+GSV IVS LYCL
Sbjct  243   TG-LTPNGIRGVLDGAAIVYFSYIGYDSVSTLAEEIQNPPVTLPVGIIGSVFIVSGLYCL  301

Query  1149  malslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLC  970
             MAL+LC+++PYN I E+ S+S AF+ +GWKWA N+VG GASLGIVASLLVAMLGQARYLC
Sbjct  302   MALALCVMVPYNQIAEKASYSMAFQRIGWKWAGNIVGAGASLGIVASLLVAMLGQARYLC  361

Query  969   VVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylv  790
             V+GRARLVPSWL+KVHPSTGTPLNAT+FLG+C AS+ALFT+L IVIEIISIGTL+VFYLV
Sbjct  362   VIGRARLVPSWLSKVHPSTGTPLNATLFLGLCTASIALFTDLDIVIEIISIGTLLVFYLV  421

Query  789   aaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTAL  610
             A ALIYR+Y + + NPPF  L FLFL++S ++GFS+SWKL  QWW LPLFG + +  TA 
Sbjct  422   ANALIYRKYVLTSKNPPFPTLSFLFLITSCAIGFSISWKLEQQWWGLPLFGGIIMVVTAF  481

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
             F   VPC+ +P  WSVP MPWPAA+SIFLNVFLMTTL + +++RF +W  L++LFYV+YG
Sbjct  482   FQYTVPCLGQPSEWSVPFMPWPAAVSIFLNVFLMTTLKMLSFQRFALWGLLITLFYVLYG  541

Query  429   VHSTY  415
             VHST+
Sbjct  542   VHSTF  546



>ref|XP_006440163.1| hypothetical protein CICLE_v10019477mg [Citrus clementina]
 gb|ESR53403.1| hypothetical protein CICLE_v10019477mg [Citrus clementina]
Length=576

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/536 (76%), Positives = 471/536 (88%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F+ YL SL+QTP +L+KR LATWTPDQELN+VRLRSGADMKRKL WYDLVALGVGGMLGV
Sbjct  16    FTKYLQSLTQTPHRLRKRMLATWTPDQELNRVRLRSGADMKRKLMWYDLVALGVGGMLGV  75

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTGPVA + +GPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGAFSYLR+TFGEF
Sbjct  76    GVFVTTGPVALQISGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTFGEF  135

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFT+YL +A+GE +P+ WRV+VDGL +GYNMLDFPAVA
Sbjct  136   VGYFAGANILMEYVLSNAAVARSFTDYLCHAVGENDPNSWRVEVDGLFKGYNMLDFPAVA  195

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             L++LLT+ LCH TKESS+LNL+MTIFHVVFFGFIIIAGF  GS  NLVK GG LAPFGV+
Sbjct  196   LVLLLTLCLCHGTKESSILNLIMTIFHVVFFGFIIIAGFCNGSVQNLVKPGG-LAPFGVK  254

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G++DGAA VYFSYIGYDSVST+AEEI NPSKSLP+GIVGSVLIVS LY LMALSLCL++P
Sbjct  255   GIVDGAATVYFSYIGYDSVSTLAEEIQNPSKSLPLGIVGSVLIVSLLYSLMALSLCLMVP  314

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I ++ SFS AF+ +GW WASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVP+
Sbjct  315   YNKILKDASFSMAFRNIGWAWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPT  374

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHPSTGTPLNAT+FLG+C AS+ALFTEL IV+E+ISI TL+VFYLVA ALIYRRY 
Sbjct  375   WLAKVHPSTGTPLNATLFLGLCTASIALFTELNIVLEMISISTLLVFYLVANALIYRRYV  434

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             +I+ NPP   LLFLFL+S  ++ FSLS K+  Q W LPLFG L L  TA FH  +  V  
Sbjct  435   MISNNPPSHTLLFLFLLSFCAICFSLSLKIQQQLWGLPLFGGLMLIVTAFFHYSMSRVSH  494

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             P  WSVP MPWPAA+SIFLNVFLMTTL + +Y+RF +WT L++LFYV+YGVHSTY+
Sbjct  495   PTGWSVPFMPWPAAISIFLNVFLMTTLKLLSYQRFAMWTCLITLFYVLYGVHSTYE  550



>gb|KDO57032.1| hypothetical protein CISIN_1g007861mg [Citrus sinensis]
Length=587

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/536 (76%), Positives = 471/536 (88%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F+ YL SL+QTP +L+KR LATWTPDQELN+VRLRSGADMKRKL WYDLVALGVGGMLGV
Sbjct  27    FTKYLQSLTQTPHRLRKRMLATWTPDQELNRVRLRSGADMKRKLMWYDLVALGVGGMLGV  86

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTGPVA + +GPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGAFSYLR+TFGEF
Sbjct  87    GVFVTTGPVALQISGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTFGEF  146

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFT+YL +A+GE +P+ WRV+VDGL +GYNMLDFPAVA
Sbjct  147   VGYFAGANILMEYVLSNAAVARSFTDYLCHAVGENDPNSWRVEVDGLFKGYNMLDFPAVA  206

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             L++LLT+ LCH TKESS+LNL+MTIFHVVFFGFIIIAGF  GS  NLVK GG LAPFGV+
Sbjct  207   LVLLLTLCLCHGTKESSILNLIMTIFHVVFFGFIIIAGFCNGSVQNLVKPGG-LAPFGVK  265

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G++DGAA VYFSYIGYDSVST+AEEI NPSKSLP+GIVGSVLIVS LY LMALSLCL++P
Sbjct  266   GIVDGAATVYFSYIGYDSVSTLAEEIQNPSKSLPLGIVGSVLIVSLLYSLMALSLCLMVP  325

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I ++ SFS AF+ +GW WASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVP+
Sbjct  326   YNKILKDASFSMAFRNIGWAWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPT  385

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHPSTGTPLNAT+FLG+C AS+ALFTEL IV+E+ISI TL+VFYLVA ALIYRRY 
Sbjct  386   WLAKVHPSTGTPLNATLFLGLCTASIALFTELNIVLEMISISTLLVFYLVANALIYRRYV  445

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             +I+ NPP   LLFLFL+S  ++ FSLS K+  Q W LPLFG L L  TA FH  +  V  
Sbjct  446   MISNNPPSHTLLFLFLLSFCAICFSLSLKIQQQLWGLPLFGGLMLIVTAFFHYSMSRVSH  505

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             P  WSVP MPWPAA+SIFLNVFLMTTL + +Y+RF +WT L++LFYV+YGVHSTY+
Sbjct  506   PTGWSVPFMPWPAAISIFLNVFLMTTLKLLSYQRFAMWTCLITLFYVLYGVHSTYE  561



>ref|XP_006477566.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Citrus sinensis]
Length=576

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/536 (76%), Positives = 471/536 (88%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F+ YL SL+QTP +L+KR LATWTPDQELN+VRLRSGADMKRKL WYDLVALGVGGMLGV
Sbjct  16    FTKYLQSLTQTPHRLRKRMLATWTPDQELNRVRLRSGADMKRKLMWYDLVALGVGGMLGV  75

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTGPVA + +GPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGAFSYLR+TFGEF
Sbjct  76    GVFVTTGPVALQISGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTFGEF  135

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFT+YL +A+GE +P+ WRV+VDGL +GYNMLDFPAVA
Sbjct  136   VGYFAGANILMEYVLSNAAVARSFTDYLCHAVGENDPNSWRVEVDGLFKGYNMLDFPAVA  195

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             L++LLT+ LCH TKESS+LNL+MTIFHVVFFGFIIIAGF  GS  NLVK GG LAPFGV+
Sbjct  196   LVLLLTLCLCHGTKESSILNLIMTIFHVVFFGFIIIAGFCNGSVQNLVKPGG-LAPFGVK  254

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G++DGAA VYFSYIGYDSVST+AEEI NPSKSLP+GIVGSVLIVS LY LMALSLCL++P
Sbjct  255   GIVDGAATVYFSYIGYDSVSTLAEEIQNPSKSLPLGIVGSVLIVSLLYSLMALSLCLMVP  314

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I ++ SFS AF+ +GW WASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVP+
Sbjct  315   YNKILKDASFSMAFRNIGWAWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPN  374

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHPSTGTPLNAT+FLG+C AS+ALFTEL IV+E+ISI TL+VFYLVA ALIYRRY 
Sbjct  375   WLAKVHPSTGTPLNATLFLGLCTASIALFTELNIVLEMISISTLLVFYLVANALIYRRYV  434

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             +I+ NPP   LLFLFL+S  ++ FS+S K+  Q W LPLFG L L  TA FH  +  V  
Sbjct  435   MISDNPPSHTLLFLFLLSFCAICFSISLKIQQQLWGLPLFGGLMLIVTAFFHYSMSRVSH  494

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             P  WSVP MPWPAA+SIFLNVFLMTTL + +Y+RF +WT L++LFYV+YGVHSTY+
Sbjct  495   PTGWSVPFMPWPAAISIFLNVFLMTTLKLLSYQRFAMWTCLITLFYVLYGVHSTYE  550



>ref|XP_002531231.1| cationic amino acid transporter, putative [Ricinus communis]
 gb|EEF31167.1| cationic amino acid transporter, putative [Ricinus communis]
Length=584

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/579 (70%), Positives = 487/579 (84%), Gaps = 7/579 (1%)
 Frame = -2

Query  2049  TAVSRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlv  1870
             T  + S    FS YL+SLSQTP +LKKR LATWTP QELN+VRLRSGADMKRKL W+DL+
Sbjct  12    TNTNTSASSFFSDYLHSLSQTPYRLKKRMLATWTPAQELNQVRLRSGADMKRKLKWHDLI  71

Query  1869  algvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAF  1690
             ALG+GGMLGVGVFVTTG VA +  GP+VFISYI+AG+SALLSSLCYTEFSV++PVAGGAF
Sbjct  72    ALGIGGMLGVGVFVTTGSVALEDTGPAVFISYIIAGISALLSSLCYTEFSVQIPVAGGAF  131

Query  1689  SYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEG  1510
             SYLR+TFGEF+GYFAGANILM+YVLSNAAV+R+FT+YL   +GE N + WRV+V+GL+EG
Sbjct  132   SYLRVTFGEFIGYFAGANILMEYVLSNAAVARTFTDYLCRTVGENNSNSWRVEVNGLVEG  191

Query  1509  YNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKS  1330
             YN LDF AVAL++LLT+ LCHSTKESS LNLVMT+FHV+FF FIIIAG YKGS  NLV+ 
Sbjct  192   YNKLDFTAVALVLLLTLCLCHSTKESSTLNLVMTVFHVIFFAFIIIAGIYKGSVKNLVEP  251

Query  1329  GGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalycl  1150
             GG +AP+GV+G+++GAAIVYFSYIGYDSVSTMAEEI NPSKSLP+GI+GSVLIV  LYCL
Sbjct  252   GG-IAPYGVKGIINGAAIVYFSYIGYDSVSTMAEEIQNPSKSLPIGILGSVLIVCLLYCL  310

Query  1149  malslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLC  970
             MALSLC+++PYN+IP+E +FS  F+ +GW WASNVVG GASLGIVASLLVAMLGQARYLC
Sbjct  311   MALSLCVMMPYNMIPKEAAFSMVFQKIGWNWASNVVGAGASLGIVASLLVAMLGQARYLC  370

Query  969   VVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylv  790
             V+GRARLVPSWLAKV+PSTGTPLNAT+FLG+C AS+ALFTEL IV+E+ISI TL+VFYLV
Sbjct  371   VIGRARLVPSWLAKVNPSTGTPLNATLFLGLCTASIALFTELPIVLEMISISTLLVFYLV  430

Query  789   aaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTAL  610
             A ALIYRRY II+ NPP   LLFLFL+S +++GFS+SWKL  Q W LPLFG +T++ TA 
Sbjct  431   ANALIYRRYVIISKNPPSHTLLFLFLLSFTAIGFSISWKLEEQKWGLPLFGLITVAITAF  490

Query  609   FHRLVPCVRRP-ESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVY  433
             F  +VP + +P E WSVPLMPWPAALSIFLNVFL TTL + A++RF +W  L+++FYV+Y
Sbjct  491   FQYMVPSISQPNEEWSVPLMPWPAALSIFLNVFLTTTLKLLAFQRFAVWACLITIFYVLY  550

Query  432   GVHSTYKveemevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
             GVHSTY+                  + + Q  KL+IQV+
Sbjct  551   GVHSTYQ-----AEDMELGVDQMQQHPSIQQSKLDIQVI  584



>gb|KHG11086.1| Cationic amino acid transporter 7, chloroplastic -like protein 
[Gossypium arboreum]
Length=580

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/536 (74%), Positives = 464/536 (87%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  Y  SLSQ P +L+KR LATWTPDQELN++RLRSGADMKRKL W+DLVALGVGGMLGV
Sbjct  13    FFNYFQSLSQIPHRLRKRMLATWTPDQELNRIRLRSGADMKRKLKWFDLVALGVGGMLGV  72

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VAR T GPSVFISYIVAG+SALLSSLCYTEFSV+VPVAGGAFSYLR+TFGEF
Sbjct  73    GVFVTTGNVARNTTGPSVFISYIVAGISALLSSLCYTEFSVQVPVAGGAFSYLRVTFGEF  132

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFTEYL  A G  +P+ WRV+V GL++GYN LDF AVA
Sbjct  133   VGYFAGANILMEYVLSNAAVARSFTEYLCSAFGVSDPNSWRVEVHGLLQGYNKLDFIAVA  192

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             +++LLT+ L HSTKESS+LNL+MTIFH+VFFGFIIIAGFY G+ +NLVK  G LAP+GVR
Sbjct  193   VVLLLTLCLSHSTKESSMLNLIMTIFHIVFFGFIIIAGFYNGNVNNLVKPKG-LAPYGVR  251

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAAIVYFSYIGYDSVST+AEEI NP +SLPVGIVGSVLIVS LYCLMAL+LC+++P
Sbjct  252   GVLDGAAIVYFSYIGYDSVSTLAEEIQNPRQSLPVGIVGSVLIVSGLYCLMALALCMMVP  311

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  I E  S+S AF+ +GWKWA NVVG GASLGI+ASLLVAMLGQARYLCV+GRARLVP 
Sbjct  312   YQQIAETASYSMAFQRIGWKWAGNVVGAGASLGIIASLLVAMLGQARYLCVIGRARLVPL  371

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WL+KVHPSTGTPLNAT+FLG+C AS++LFT+L+IVIE+ISIGTL+VFYLVA ALIYR+Y 
Sbjct  372   WLSKVHPSTGTPLNATLFLGLCTASISLFTDLEIVIEMISIGTLLVFYLVANALIYRKYV  431

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             I   NPPF  L FL  ++ +++GFS+SWK+  QWW LPLFG + +  TALFH +VP   +
Sbjct  432   IQAKNPPFPTLSFLCFLTLTAIGFSISWKMEHQWWGLPLFGGIMVIITALFHYMVPRFGQ  491

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
                WSVPLMPWPAA+SIFLNVFLMTTL   ++KRF IW  L+++FYV+YGVHST++
Sbjct  492   SSEWSVPLMPWPAAISIFLNVFLMTTLKTMSFKRFAIWGCLITVFYVLYGVHSTFE  547



>ref|XP_006385572.1| hypothetical protein POPTR_0003s08200g [Populus trichocarpa]
 gb|ERP63369.1| hypothetical protein POPTR_0003s08200g [Populus trichocarpa]
Length=573

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/580 (73%), Positives = 496/580 (86%), Gaps = 11/580 (2%)
 Frame = -2

Query  2046  AVSRSMPE--IFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDl  1873
             A  RS P    FS YL SLSQTP +L+KR LATWTPDQELN+VRLRSGADM RKL WYDL
Sbjct  2     ATIRSTPTNVSFSNYLQSLSQTPHRLRKRMLATWTPDQELNQVRLRSGADMMRKLKWYDL  61

Query  1872  valgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGA  1693
             +ALG+GGMLGVGVFVTTG VA + +GPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGA
Sbjct  62    IALGIGGMLGVGVFVTTGLVAHQISGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGA  121

Query  1692  FSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLME  1513
             FSYLR+TFGEFVGYFAGANILM+YVLSNAAV+R+FTEYL +A+GE NP+ WR +VDGL+E
Sbjct  122   FSYLRVTFGEFVGYFAGANILMEYVLSNAAVARTFTEYLCHAVGE-NPNSWRFEVDGLVE  180

Query  1512  GYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVK  1333
             GYN LDFPAVALI+LLT+ LCHSTKESS+LNLVMT+FH++FFGFIIIAGFYKGS+ NLV+
Sbjct  181   GYNKLDFPAVALILLLTLCLCHSTKESSVLNLVMTVFHLIFFGFIIIAGFYKGSAKNLVE  240

Query  1332  SGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyc  1153
              GG LAPFGV+G+LDGAA VYFSYIGYDSVSTMAEEI NP+KSLPVGIVGSVLIV+ LYC
Sbjct  241   PGG-LAPFGVKGILDGAATVYFSYIGYDSVSTMAEEIRNPAKSLPVGIVGSVLIVTGLYC  299

Query  1152  lmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYL  973
             L+ALSLC L+PYN+I ++ SFS AF+ +GWKWA NVVG GASLGIVASLLVAMLGQARYL
Sbjct  300   LVALSLCFLVPYNMIDKDASFSVAFQKIGWKWAGNVVGAGASLGIVASLLVAMLGQARYL  359

Query  972   CVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFyl  793
             CV+GRARLVPSWLAKV+PSTGTPLNAT+FLG+C AS+ALFTEL I+I+IISI TL+VFYL
Sbjct  360   CVIGRARLVPSWLAKVNPSTGTPLNATLFLGLCTASIALFTELHIIIDIISISTLLVFYL  419

Query  792   vaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTA  613
             VA ALIYRRY I++ NPP Q LLFLFL+SS S+GFS+SWKL  QWW LP+FG   ++ TA
Sbjct  420   VANALIYRRYVIVSHNPPSQTLLFLFLLSSCSIGFSMSWKLEEQWWVLPVFGGFMITITA  479

Query  612   LFHRLVPCV-RRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
              F  +VP + +  E WSVP MPWPA  SIFLNVFL+T+L + +++RFGIW  L++LFYV+
Sbjct  480   FFQYMVPSICQTNEEWSVPFMPWPAVASIFLNVFLVTSLKIPSFQRFGIWACLITLFYVL  539

Query  435   YGVHSTYKveemevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
             YGVHSTY+        +      + ++ +TQ  KL+IQ+L
Sbjct  540   YGVHSTYR------AEEMEVGVGDISHPSTQQSKLDIQLL  573



>ref|XP_004148384.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Cucumis sativus]
Length=570

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/579 (72%), Positives = 478/579 (83%), Gaps = 12/579 (2%)
 Frame = -2

Query  2049  TAVSRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlv  1870
             TAVS +       YL SLSQTP +L+KR LATWTPDQELN+VR RSGADMKRKL W+DLV
Sbjct  3     TAVSSTF---LRRYLYSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKRKLKWFDLV  59

Query  1869  algvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAF  1690
             ALGVGGMLGVGVFVTTGPVA    GP+VF+SYI+AG+SALLSSLCYTEFSV V  AGGAF
Sbjct  60    ALGVGGMLGVGVFVTTGPVALHVTGPAVFLSYIIAGISALLSSLCYTEFSVHVSAAGGAF  119

Query  1689  SYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEG  1510
             SYLR+TFGEFVGYFAGANI+M+YVLSNAAV+RSFTEYL  A GE  P+ WRV+V GL+ G
Sbjct  120   SYLRLTFGEFVGYFAGANIIMEYVLSNAAVARSFTEYLCVAFGESEPNAWRVEVHGLLNG  179

Query  1509  YNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKS  1330
             YNMLDFPAV LI+LLT+ LCHSTKESS LNL+MTIFHV+FFGFII  G YKGS+ NLVK 
Sbjct  180   YNMLDFPAVGLILLLTLCLCHSTKESSTLNLIMTIFHVIFFGFIIGCGMYKGSAKNLVKP  239

Query  1329  GGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalycl  1150
              G +APFGV+GVLDGAAIVYFSYIGYDS ST+AEEI NP+KSLP+GIVGSV+I SALYCL
Sbjct  240   DG-VAPFGVKGVLDGAAIVYFSYIGYDSASTLAEEIQNPTKSLPIGIVGSVIITSALYCL  298

Query  1149  malslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLC  970
             MALSL L+LPYN I E+ +FS AF+ +GWKWASN++G GASLGIVASLLVAMLGQARYLC
Sbjct  299   MALSLSLMLPYNQISEKAAFSIAFQRIGWKWASNLIGGGASLGIVASLLVAMLGQARYLC  358

Query  969   VVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylv  790
              +GRARLVPSWLAKVHPSTGTPLNAT+FLG+C AS+ALFTEL IVIE+ISIGTL+VFYLV
Sbjct  359   AIGRARLVPSWLAKVHPSTGTPLNATLFLGLCTASIALFTELYIVIEMISIGTLMVFYLV  418

Query  789   aaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-NLPLFGFLTLSFTA  613
             A A IYRRYA+++ +PP ++LLFL L+S S++GFSLSWKLN QWW  L  F   T+    
Sbjct  419   ANATIYRRYAMVSKHPPSRILLFLLLLSCSAIGFSLSWKLNQQWWPGLLFFSVSTIFIIT  478

Query  612   LFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVY  433
              FH   P     ++WSVP MPWPAA SIFLNVFLMTTL + +++RF IW+ L++LFYVVY
Sbjct  479   FFHYKFPSHNSSDAWSVPYMPWPAATSIFLNVFLMTTLRMLSFQRFAIWSCLITLFYVVY  538

Query  432   GVHSTYKveemevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
             GVHSTYK        +     VNN NST Q  KL+IQVL
Sbjct  539   GVHSTYK-------AEEIIMEVNNMNSTIQQSKLDIQVL  570



>ref|XP_008377513.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Malus domestica]
Length=583

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/536 (76%), Positives = 469/536 (88%), Gaps = 2/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS YL+SLSQTP +L++R LATWTPD+ELN+VR RSGADMKRKL WYDLVALGVGGMLGV
Sbjct  22    FSKYLHSLSQTPHRLRRRMLATWTPDEELNQVRQRSGADMKRKLKWYDLVALGVGGMLGV  81

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTGPVAR TAGPSVFISYI+AG+SALLSSLCY EFSV++PVAGGAFSYLR+TFGEF
Sbjct  82    GVFVTTGPVARXTAGPSVFISYIIAGISALLSSLCYAEFSVQIPVAGGAFSYLRLTFGEF  141

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFTEYLS A GE N   WRV+V+GL++GY+MLDFPAVA
Sbjct  142   VGYFAGANILMEYVLSNAAVARSFTEYLSSAFGE-NSXIWRVEVNGLVKGYDMLDFPAVA  200

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             LI+LLT+ LCHSTKESSLLNL+MT+FHVVFFGFIIIAGF  G+S NLVK  G +AP+GV 
Sbjct  201   LILLLTLCLCHSTKESSLLNLIMTVFHVVFFGFIIIAGFCNGTSKNLVKPQG-IAPYGVT  259

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAA VYFSYIGYDS STMAEEI NP  SLPVGI+GSV+I S LYCLMALSLCL++P
Sbjct  260   GVLDGAARVYFSYIGYDSASTMAEEIQNPLTSLPVGIIGSVVITSVLYCLMALSLCLMVP  319

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I E  +FS AFK +GW+WASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  320   YNKITENVAFSNAFKEIGWEWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  379

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHPSTGTPLNAT+FLG+C AS+ALFT+L+IVI++ISIGTL+VFYLVA AL+YRRY 
Sbjct  380   WLAKVHPSTGTPLNATLFLGLCTASIALFTDLEIVIDMISIGTLLVFYLVANALVYRRYV  439

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             II+ NPPFQ LLFLFL+SSS++GFS+S K   Q W LPLFG  T+   + F+  VPCVR 
Sbjct  440   IISKNPPFQTLLFLFLLSSSAIGFSMSLKFKRQRWGLPLFGVSTIIIISFFNYAVPCVRH  499

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
                WS+P MPWPAALSIFLNV LMTTL   +++RF IW+  ++LFY +YGVHSTY+
Sbjct  500   HIGWSMPFMPWPAALSIFLNVSLMTTLKKFSFERFAIWSCFITLFYXLYGVHSTYQ  555



>ref|XP_010677143.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=580

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/578 (70%), Positives = 485/578 (84%), Gaps = 1/578 (0%)
 Frame = -2

Query  2052  ETAVSRSMPEI-FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYD  1876
             E A++ S   I F +YL+SLSQTP KL+KR LATWTPDQELN+VRLRSG+DMKRKL+ +D
Sbjct  2     ENAMNPSSNNICFCSYLHSLSQTPYKLRKRLLATWTPDQELNQVRLRSGSDMKRKLSLFD  61

Query  1875  lvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGG  1696
             LVALG+GGMLGVGVFVTTGPVAR T+GP+VFISYI+AG+SALLSS+CYTEFS+ +PVAGG
Sbjct  62    LVALGLGGMLGVGVFVTTGPVARSTSGPAVFISYIIAGISALLSSMCYTEFSIAIPVAGG  121

Query  1695  AFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLM  1516
             AFSYLR+TFGEFVGY AGANILM+YVLSNAAV+RSFTEY S   G  +P+ WR+++ G +
Sbjct  122   AFSYLRVTFGEFVGYLAGANILMEYVLSNAAVARSFTEYFSGTFGVEDPNSWRIEIHGFI  181

Query  1515  EGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV  1336
             +GYN LDF AVALI+LLT+ LCHSTKESS+LNL MTIFHV+FFGFIIIAGF  G+  NLV
Sbjct  182   DGYNKLDFSAVALILLLTLFLCHSTKESSMLNLTMTIFHVIFFGFIIIAGFLIGNPKNLV  241

Query  1335  KSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsaly  1156
              S GGLAPFGV+GV+DGAAIVYFSYIGYDSVST+AEEI +PS++LPVGIVGSVL+VS++Y
Sbjct  242   SSPGGLAPFGVKGVVDGAAIVYFSYIGYDSVSTLAEEIKDPSRNLPVGIVGSVLVVSSIY  301

Query  1155  clmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARY  976
             CLM L+LC+++PYN I +  SF+ AF  +GWKWAS+ V VGASLGIVASLLVAMLGQARY
Sbjct  302   CLMGLALCVMVPYNEISKRASFAMAFHKLGWKWASHFVSVGASLGIVASLLVAMLGQARY  361

Query  975   LCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFy  796
             LCV+ RARLVP WLAKVHPSTGTPLNAT+FLGIC AS+ALFT+L IV+++ISIGTL+VFY
Sbjct  362   LCVIARARLVPVWLAKVHPSTGTPLNATLFLGICTASIALFTDLDIVLDLISIGTLLVFY  421

Query  795   lvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFT  616
             LVA ALIYRRY I++ NPP  +LLFL  +++ SLGF+ SWK   Q W LPLFG   ++ T
Sbjct  422   LVANALIYRRYVIVSSNPPLHILLFLLFLTTLSLGFAFSWKYEQQMWGLPLFGGSLITIT  481

Query  615   ALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
             A+FH  VP  R+   WSVPLMPWPAA+SIFLNVFL+TTL + +++RFG WT  + LFYV+
Sbjct  482   AIFHYTVPSSRQELEWSVPLMPWPAAISIFLNVFLITTLKILSFQRFGAWTCFLILFYVL  541

Query  435   YGVHSTYKveemevmvdnnnnhvnnnNSTTQPIKLEIQ  322
             YGVHSTY+ EEME+ +    N    N   +Q  K++IQ
Sbjct  542   YGVHSTYRAEEMEIEMVTEINGAGTNLGVSQERKIDIQ  579



>ref|XP_011031981.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Populus euphratica]
Length=573

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/569 (73%), Positives = 487/569 (86%), Gaps = 9/569 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS YL SLSQTP +L+KR LATWTPDQELN+VRLRSGADM RKL WYDL+ALG+GGMLGV
Sbjct  13    FSNYLQSLSQTPHRLRKRMLATWTPDQELNQVRLRSGADMMRKLKWYDLIALGIGGMLGV  72

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA + +GPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGAFSYLR+TFGEF
Sbjct  73    GVFVTTGLVAHQISGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTFGEF  132

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFTEYL +A+GE NP+ WR +VDGL+EGYN LDFPAVA
Sbjct  133   VGYFAGANILMEYVLSNAAVARSFTEYLCHAVGE-NPNSWRFEVDGLLEGYNKLDFPAVA  191

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             LI+LLT+ LCHSTKESS+LNLVMT+FH++FFGFIIIAGFYKGS+ NLV+ GG LAPFGV+
Sbjct  192   LILLLTLCLCHSTKESSVLNLVMTVFHLIFFGFIIIAGFYKGSAKNLVEPGG-LAPFGVK  250

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+LDGAA+VYFSYIGYDSVSTMAEEI NP+KSLPVGI GSVLIV+ LYCL+ALSLC ++P
Sbjct  251   GILDGAAMVYFSYIGYDSVSTMAEEIRNPAKSLPVGIAGSVLIVTGLYCLVALSLCFMVP  310

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN+I ++ SFS AF+ +GWKWA NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  311   YNMIDKDASFSVAFQKIGWKWAGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  370

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKV+PSTGTPLNAT+FLG+C AS+ALFTEL I+++IISI TL+VFYLVA ALIYRRY 
Sbjct  371   WLAKVNPSTGTPLNATLFLGLCTASIALFTELSIILDIISISTLLVFYLVANALIYRRYV  430

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCV-R  583
             I++ NPP Q LLFLFL+SS S+GFS+SWKL  QWW LP+FG   +  TA F  +VP + +
Sbjct  431   IVSHNPPSQTLLFLFLLSSCSIGFSMSWKLEEQWWVLPVFGGFMIMITAFFQYMVPSICQ  490

Query  582   RPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKvee  403
               E WSVP MPWPA  SI LNVFL+T+L + +++RFGIW  L++LFYV+YGVHSTY+   
Sbjct  491   TNEGWSVPFMPWPAVASISLNVFLVTSLKIPSFQRFGIWACLITLFYVLYGVHSTYR---  547

Query  402   mevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
                  +        +  + Q  KLE+QVL
Sbjct  548   ---AEEMEVGVGEISRPSIQQSKLEVQVL  573



>ref|XP_004508965.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Cicer arietinum]
Length=575

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/543 (72%), Positives = 458/543 (84%), Gaps = 7/543 (1%)
 Frame = -2

Query  2022  IFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlg  1843
             + S YL SLSQTP +L+KR LATWTPDQE N+VR RSGADMKRKL WYDL+ALGVGGMLG
Sbjct  3     MLSNYLYSLSQTPHRLRKRMLATWTPDQEFNQVRQRSGADMKRKLKWYDLIALGVGGMLG  62

Query  1842  vgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGE  1663
             VGVFVTTGPVA   +GPSVFISYI+AG+SALLSSLCYTEF+V+VPVAGGAFSYLR+TFGE
Sbjct  63    VGVFVTTGPVALHQSGPSVFISYIIAGISALLSSLCYTEFAVQVPVAGGAFSYLRLTFGE  122

Query  1662  FVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPav  1483
             F+GYFAGANILM+YV SNAAV+RSFTEYLS+A GE NP+ WRV+V GL + YNMLDFPAV
Sbjct  123   FMGYFAGANILMEYVFSNAAVARSFTEYLSFAFGENNPNVWRVEVHGLPKDYNMLDFPAV  182

Query  1482  aliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGV  1303
             ALI+LLT+ LCHSTKESS+LNL+MT+FHV+FFGFII+AG+Y GSS NLV   G +AP+GV
Sbjct  183   ALILLLTLCLCHSTKESSILNLIMTVFHVIFFGFIIVAGYYNGSSKNLVNPKG-IAPYGV  241

Query  1302  RGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllL  1123
             RGVLDGAAIVYFSYIGYDS STMAEE+ +P+KSLP+GI+GSVLI + LYCLMALSLC+++
Sbjct  242   RGVLDGAAIVYFSYIGYDSASTMAEEVKDPNKSLPIGILGSVLITTLLYCLMALSLCMMV  301

Query  1122  PYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVP  943
             PYN I E+ S+S AF  + W WASN+VG GASLGIVASLLVAMLGQARYLCV+GRARLVP
Sbjct  302   PYNKISEKASYSMAFIKISWNWASNIVGAGASLGIVASLLVAMLGQARYLCVIGRARLVP  361

Query  942   SWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrry  763
             SWLAKVHPSTGTPLNAT+FLG C A++ALFTEL I+IE+ISIGTL+VFY+VA ALIYRRY
Sbjct  362   SWLAKVHPSTGTPLNATVFLGFCTATIALFTELDIIIELISIGTLMVFYMVANALIYRRY  421

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPC--  589
              I N  PP   LLFLFL+S +SL FS+ WK   QWW L LFG + ++ T  F  +VPC  
Sbjct  422   VITNHTPPLHTLLFLFLLSLASLCFSIVWKFKQQWWGLLLFGAIMITITTFFQHMVPCNN  481

Query  588   ----VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
                  +    W VP MPWP ++SIFLNVFLMTTL   +++RF +W   +++FYV+YGVHS
Sbjct  482   NLVQQQYANCWYVPFMPWPPSMSIFLNVFLMTTLKTLSFQRFALWACFITMFYVLYGVHS  541

Query  420   TYK  412
             TY+
Sbjct  542   TYQ  544



>ref|XP_004162422.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Cucumis sativus]
 gb|KGN60458.1| hypothetical protein Csa_3G912900 [Cucumis sativus]
Length=586

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/588 (72%), Positives = 487/588 (83%), Gaps = 14/588 (2%)
 Frame = -2

Query  2049  TAVSRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlv  1870
             TAVS +       YL SLSQTP +L+KR LATWTPDQELN+VR RSGADMKRKL W+DLV
Sbjct  3     TAVSSTF---LRRYLYSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKRKLKWFDLV  59

Query  1869  algvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAF  1690
             ALGVGGMLGVGVFVTTGPVA    GP+VF+SYI+AG+SALLSSLCYTEFSV V  AGGAF
Sbjct  60    ALGVGGMLGVGVFVTTGPVALHVTGPAVFLSYIIAGISALLSSLCYTEFSVHVSAAGGAF  119

Query  1689  SYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEG  1510
             SYLR+TFGEFVGYFAGANI+M+YVLSNAAV+RSFTEYL  A GE  P+ WRV+V GL+ G
Sbjct  120   SYLRLTFGEFVGYFAGANIIMEYVLSNAAVARSFTEYLCVAFGESEPNAWRVEVHGLLNG  179

Query  1509  YNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKS  1330
             YNMLDFPAV LI+LLT+ LCHSTKESS LNL+MTIFHV+FFGFII  G YKGS+ NLVK 
Sbjct  180   YNMLDFPAVGLILLLTLCLCHSTKESSTLNLIMTIFHVIFFGFIIGCGMYKGSAKNLVKP  239

Query  1329  GGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalycl  1150
              G +APFGV+GVLDGAAIVYFSYIGYDS ST+AEEI NP+KSLP+GIVGSV+I SALYCL
Sbjct  240   DG-VAPFGVKGVLDGAAIVYFSYIGYDSASTLAEEIQNPTKSLPIGIVGSVIITSALYCL  298

Query  1149  malslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLC  970
             MALSL L+LPYN I E+ +FS AF+ +GWKWASN++G GASLGIVASLLVAMLGQARYLC
Sbjct  299   MALSLSLMLPYNQISEKAAFSIAFQRIGWKWASNLIGGGASLGIVASLLVAMLGQARYLC  358

Query  969   VVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylv  790
              +GRARLVPSWLAKVHPSTGTPLNAT+FLG+C AS+ALFTEL IVIE+ISIGTL+VFYLV
Sbjct  359   AIGRARLVPSWLAKVHPSTGTPLNATLFLGLCTASIALFTELYIVIEMISIGTLMVFYLV  418

Query  789   aaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-NLPLFGFLTLSFTA  613
             A A IYRRYA+++ +PP ++LLFL L+S S++GFSLSWKLN QWW  L  F   T+    
Sbjct  419   ANATIYRRYAMVSKHPPSRILLFLLLLSCSAIGFSLSWKLNQQWWPGLLFFSVSTIFIIT  478

Query  612   LFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVY  433
              FH   P     ++WSVP MPWPAA SIFLNVFLMTTL + +++RF IW+ L++LFYVVY
Sbjct  479   FFHYKFPSHNSSDAWSVPYMPWPAATSIFLNVFLMTTLRMLSFQRFAIWSCLITLFYVVY  538

Query  432   GVHSTYKveemev---------mvdnnnnhvnnnNSTTQPIKLEIQVL  316
             GVHSTYK EE+ +         + +NNNN+ NN NST Q  KL+IQVL
Sbjct  539   GVHSTYKAEEIIMEVNNNRVGEVTNNNNNNNNNVNSTIQQSKLDIQVL  586



>ref|XP_003549952.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Glycine max]
 gb|KHN01635.1| Cationic amino acid transporter 6, chloroplastic [Glycine soja]
Length=573

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/536 (73%), Positives = 457/536 (85%), Gaps = 1/536 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
              S+YL+SLSQTP +L+KR LATWTP+QE N+VR RSGADMKRKL W+DLVALGVGGMLGV
Sbjct  14    LSSYLHSLSQTPHRLRKRMLATWTPEQEFNQVRHRSGADMKRKLKWHDLVALGVGGMLGV  73

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA   +GPSVFISYI+AG+SALLSSLCYTEF+V+VPVAGGAFSYLR+TFGEF
Sbjct  74    GVFVTTGSVALHHSGPSVFISYIIAGISALLSSLCYTEFAVQVPVAGGAFSYLRLTFGEF  133

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             +GYFAGANILM+YV SNAAV+RSFTEYLS A GE +P+ WRV+V GL + YNMLDFPAVA
Sbjct  134   LGYFAGANILMEYVFSNAAVARSFTEYLSIAFGENDPNVWRVEVPGLPKDYNMLDFPAVA  193

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             LI++LT+ LCHSTKESS+LNL+MT FH++FFGFIIIAG+  GS+ NLV S  GLAPFG R
Sbjct  194   LILILTLFLCHSTKESSMLNLIMTAFHIIFFGFIIIAGYCNGSAKNLV-SPKGLAPFGAR  252

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAAIVYFSYIGYDS STMAEE+T+P KSLP+GIVGSVLI + LYCLMALSLC+++P
Sbjct  253   GVLDGAAIVYFSYIGYDSASTMAEEVTDPFKSLPIGIVGSVLITTLLYCLMALSLCMMVP  312

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I E+ SFS AF  +GW WASN+VG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  313   YNKISEKASFSIAFLKIGWNWASNLVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPS  372

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLAKVHPSTGTPLNAT+FLG+C A++ LFTEL I+IE+ISIGTL+VFY+VA ALIYRRY 
Sbjct  373   WLAKVHPSTGTPLNATVFLGLCTATITLFTELDIIIELISIGTLLVFYMVANALIYRRYV  432

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
             I +  PP   L+FLFL+S S+L FSL+WK   QWW L LFG   ++ TA F  +V     
Sbjct  433   ITSHAPPTHTLVFLFLLSLSALCFSLAWKFKQQWWVLLLFGGFMIAITAFFQHVVLTTTT  492

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
                WSVP MPWP A+SIFLNVFLMTTL + +++RF IW  L+++FYV+YGVH+TY+
Sbjct  493   TIHWSVPFMPWPPAMSIFLNVFLMTTLKILSFQRFAIWACLITIFYVLYGVHNTYE  548



>ref|XP_010053544.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Eucalyptus grandis]
Length=587

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/584 (70%), Positives = 490/584 (84%), Gaps = 8/584 (1%)
 Frame = -2

Query  2052  ETAVSRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDl  1873
             +T  +++    F+ YL+SLSQTP +L+KR LATWTPDQELN VRLRSGADMKRKL WYDL
Sbjct  5     QTLPTKNTSSSFAHYLHSLSQTPHRLRKRMLATWTPDQELNHVRLRSGADMKRKLQWYDL  64

Query  1872  valgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGA  1693
             +ALGVGGMLGVGVFVTTG VA   AGPSVFISYI+AG+SALLSSLCYTEFSV++PVAGGA
Sbjct  65    IALGVGGMLGVGVFVTTGRVANSMAGPSVFISYIIAGVSALLSSLCYTEFSVQIPVAGGA  124

Query  1692  FSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLME  1513
             FSYLR+TFGEFVGYFAGANILM+YVLSNAAV+R+FT+YL  ALGE +  CWR++V+GLM+
Sbjct  125   FSYLRVTFGEFVGYFAGANILMEYVLSNAAVARNFTDYLCRALGENDATCWRIEVEGLMK  184

Query  1512  GYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVK  1333
             GYNMLDFPAVAL++LLT+ LC STKESS+LNL+MT+FHVVFFGFIIIAGFY G+  NLV+
Sbjct  185   GYNMLDFPAVALVLLLTLCLCRSTKESSILNLIMTVFHVVFFGFIIIAGFYNGNGKNLVR  244

Query  1332  SGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyc  1153
              GG LAPFGV+GVL+GAA VYFSYIGYDSVST+AEEI NPSKSLP+GIVGS++IVS LYC
Sbjct  245   PGG-LAPFGVKGVLNGAATVYFSYIGYDSVSTLAEEIQNPSKSLPIGIVGSMVIVSLLYC  303

Query  1152  lmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYL  973
             LMALSLC+++PYN I ++ SFS AF+ +GW WASN+VG GASLGIVASL+VAMLGQARYL
Sbjct  304   LMALSLCIMVPYNEISKDASFSVAFEKIGWGWASNLVGAGASLGIVASLVVAMLGQARYL  363

Query  972   CVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFyl  793
             CV+GR+ LVPSWLAKVHPSTGTPLNAT+FLGIC A +ALFT+L+IV E+IS+GTL+VFYL
Sbjct  364   CVIGRSHLVPSWLAKVHPSTGTPLNATLFLGICTALIALFTDLEIVFELISLGTLMVFYL  423

Query  792   vaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTA  613
             VA ALIYRR+ I +  PP   +LFLFL+SS+SLGFS+SWKL  +WW   LF  L    TA
Sbjct  424   VANALIYRRHVITSCRPPLHTILFLFLLSSASLGFSVSWKLE-KWWGSALFSSLAAITTA  482

Query  612   LFHRLVPCVRRPE-SWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
              FHR+VP     +  WSVPLMPWPA+ SIFLN+FLMT L   +++RFGIW  ++SLFYV+
Sbjct  483   SFHRMVPFHGGGDLQWSVPLMPWPASASIFLNIFLMTRLKAISFRRFGIWACVISLFYVL  542

Query  435   YGVHSTYKveemevmvdnnnnhvnnnNSTTQPI-----KLEIQV  319
             YGVHSTY+ EE E    ++      ++S+ Q +     KL++QV
Sbjct  543   YGVHSTYEAEETEKEAGSDGIVNTISSSSIQQVVFANNKLDVQV  586



>ref|XP_003525587.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Glycine max]
Length=575

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/545 (72%), Positives = 463/545 (85%), Gaps = 4/545 (1%)
 Frame = -2

Query  2040  SRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalg  1861
             + SM ++ S+YL+SLSQTP +L+KR LATWTPDQE N+VR RSGADMKRKL W+DLVALG
Sbjct  8     TNSMKKL-SSYLHSLSQTPHRLRKRMLATWTPDQEFNQVRHRSGADMKRKLKWHDLVALG  66

Query  1860  vggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYL  1681
             VGGMLGVGVFVTTG VA   +GPSVFISYI+AG+SALLSSLCYTEF+V+VPVAGGAFSYL
Sbjct  67    VGGMLGVGVFVTTGSVALHHSGPSVFISYIIAGISALLSSLCYTEFAVQVPVAGGAFSYL  126

Query  1680  RITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNM  1501
             R+TFGEF+GYFAGANILM+YV SNAAV+RSFTEYLS A GE +P+ WRV+V GL + Y+M
Sbjct  127   RLTFGEFLGYFAGANILMEYVFSNAAVARSFTEYLSIAFGENDPNVWRVEVPGLPKDYSM  186

Query  1500  LDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGG  1321
             LDFPAVALI++LT+ LCHSTKESS+LNL+MT FHV+FFGFIIIAG+  GS+ NLV S  G
Sbjct  187   LDFPAVALILILTLFLCHSTKESSMLNLIMTAFHVIFFGFIIIAGYCNGSAKNLV-SPKG  245

Query  1320  LAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmal  1141
             LAPFG RGVLDGAAIVYFSYIGYDS STMAEE+ +P KSLP+GIVGSVLI + LYCLMAL
Sbjct  246   LAPFGARGVLDGAAIVYFSYIGYDSASTMAEEVKDPFKSLPIGIVGSVLITTLLYCLMAL  305

Query  1140  slcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVG  961
             SLC+++PYN I E+ SFS AF  +GW WASN+VG GASLGIVASLLVAMLGQARYLCV+G
Sbjct  306   SLCMMVPYNKISEKASFSIAFLKIGWNWASNLVGAGASLGIVASLLVAMLGQARYLCVIG  365

Query  960   RARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaa  781
             RARLVPSWLAKVHPSTGTP+NAT+FLG+C A++ALFTEL I+IE+ISIGTL+VFY+VA A
Sbjct  366   RARLVPSWLAKVHPSTGTPMNATVFLGLCTATIALFTELDIIIELISIGTLLVFYMVANA  425

Query  780   liyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHR  601
             LIYRRY I +  PP   L+FLFL+S S+L FSL+WK   QWW L LFG   ++ TA F  
Sbjct  426   LIYRRYVITSHAPPTHTLVFLFLLSLSALCFSLAWKFKQQWWGLVLFGGFMIAITAFFQH  485

Query  600   LVP--CVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
             +V         +WSVP MPWP A+SIFLNVFLMTTL + +++RF IW  L+++FYV+YGV
Sbjct  486   VVSTTTTTTTTNWSVPFMPWPPAMSIFLNVFLMTTLKILSFQRFAIWACLITIFYVLYGV  545

Query  426   HSTYK  412
             H+TY+
Sbjct  546   HNTYE  550



>gb|KHN33269.1| Cationic amino acid transporter 6, chloroplastic [Glycine soja]
Length=575

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/545 (72%), Positives = 463/545 (85%), Gaps = 4/545 (1%)
 Frame = -2

Query  2040  SRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalg  1861
             + SM ++ S+YL+SLSQTP +L+KR LATWTP+QE N+VR RSGADMKRKL W+DLVALG
Sbjct  8     TNSMKKL-SSYLHSLSQTPHRLRKRMLATWTPEQEFNQVRHRSGADMKRKLKWHDLVALG  66

Query  1860  vggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYL  1681
             VGGMLGVGVFVTTG VA   +GPSVFISYI+AG+SALLSSLCYTEF+V+VPVAGGAFSYL
Sbjct  67    VGGMLGVGVFVTTGSVALHHSGPSVFISYIIAGISALLSSLCYTEFAVQVPVAGGAFSYL  126

Query  1680  RITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNM  1501
             R+TFGEF+GYFAGANILM+YV SNAAV+RSFTEYLS A GE +P+ WRV+V GL + Y+M
Sbjct  127   RLTFGEFLGYFAGANILMEYVFSNAAVARSFTEYLSIAFGENDPNVWRVEVPGLPKDYSM  186

Query  1500  LDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGG  1321
             LDFPAVALI++LT+ LCHSTKESS+LNL+MT FHV+FFGFIIIAG+  GS+ NLV S  G
Sbjct  187   LDFPAVALILILTLFLCHSTKESSMLNLIMTAFHVIFFGFIIIAGYCNGSAKNLV-SPKG  245

Query  1320  LAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmal  1141
             LAPFG RGVLDGAAIVYFSYIGYDS STMAEE+ +P KSLP+GIVGSVLI + LYCLMAL
Sbjct  246   LAPFGARGVLDGAAIVYFSYIGYDSASTMAEEVKDPFKSLPIGIVGSVLITTLLYCLMAL  305

Query  1140  slcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVG  961
             SLC+++PYN I E+ SFS AF  +GW WASN+VG GASLGIVASLLVAMLGQARYLCV+G
Sbjct  306   SLCMMVPYNKISEKASFSIAFLKIGWNWASNLVGAGASLGIVASLLVAMLGQARYLCVIG  365

Query  960   RARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaa  781
             RARLVPSWLAKVHPSTGTP+NAT+FLG+C A++ALFTEL I+IE+ISIGTL+VFY+VA A
Sbjct  366   RARLVPSWLAKVHPSTGTPMNATVFLGLCTATIALFTELDIIIELISIGTLLVFYMVANA  425

Query  780   liyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHR  601
             LIYRRY I +  PP   L+FLFL+S S+L FSL+WK   QWW L LFG   ++ TA F  
Sbjct  426   LIYRRYVITSHAPPTHTLVFLFLLSLSALCFSLAWKFKQQWWGLVLFGGFMIAITAFFQH  485

Query  600   LVP--CVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
             +V         +WSVP MPWP A+SIFLNVFLMTTL + +++RF IW  L+++FYV+YGV
Sbjct  486   VVSTTTTTTTTNWSVPFMPWPPAMSIFLNVFLMTTLKILSFQRFAIWACLITIFYVLYGV  545

Query  426   HSTYK  412
             H+TY+
Sbjct  546   HNTYE  550



>ref|XP_008794928.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Phoenix dactylifera]
Length=577

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/538 (74%), Positives = 453/538 (84%), Gaps = 3/538 (1%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FST L+SLSQTP +L++RAL TWTP+QELN+VR RSGADMKRKL WYDLV+LGVGGMLG 
Sbjct  8     FSTILHSLSQTPHRLRRRALVTWTPEQELNQVRERSGADMKRKLEWYDLVSLGVGGMLGA  67

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA K  GP+VF+SYIVAG+SALLSSLCYTEFSVE PVAGGAFSYLRITFGEF
Sbjct  68    GVFVTTGRVAHKVTGPAVFVSYIVAGISALLSSLCYTEFSVEAPVAGGAFSYLRITFGEF  127

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYF GANILM+YVLSNAAVSRSFTEYLS ALG  NP+ WRV+V GL +GYN LDFPAV 
Sbjct  128   VGYFGGANILMEYVLSNAAVSRSFTEYLSSALGSQNPNSWRVEVHGLAKGYNQLDFPAVV  187

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             L++LLT+ LCH TKESS+LNLVMT+FHV+FFGF+I+AGF  GS  NLVK   GL PFG R
Sbjct  188   LVLLLTLCLCHGTKESSMLNLVMTVFHVIFFGFVIVAGFCNGSPRNLVKP-KGLLPFGAR  246

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+LDGAAIVYFSYIGYDSVSTMAEEI NPSKSLP+GI GSVLIVS LYCL+AL+LC ++P
Sbjct  247   GILDGAAIVYFSYIGYDSVSTMAEEIRNPSKSLPIGIAGSVLIVSTLYCLLALALCSMIP  306

Query  1119  YNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVP  943
             YN I  + SFS+AF K +GWKWASN +G GASLGIVASLLVAMLGQARYLCV+ RARLVP
Sbjct  307   YNEISAKASFSSAFQKKVGWKWASNTIGAGASLGIVASLLVAMLGQARYLCVIARARLVP  366

Query  942   SWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrry  763
              WLAKVHPSTGTP+NATI LG+  AS+ALF +L+IV+E+ISIGTL+VFYLV  AL+YRRY
Sbjct  367   LWLAKVHPSTGTPMNATILLGLFTASIALFMDLEIVLEMISIGTLLVFYLVGNALVYRRY  426

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNL-QWWNLPLFGFLTLSFTALFHRLVPCV  586
               +  N P   LLFL L++SSS+GFSLSWKL    WW L LFG   +  TA FH  VPC 
Sbjct  427   VRVGRNRPLPTLLFLLLLTSSSIGFSLSWKLEEGYWWGLALFGGALVLITAFFHYRVPCH  486

Query  585   RRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              RP  WSVP MPWPAA SIFLNVFLMTTL  KA++RF +W+ +++LFYV+YGVHSTY 
Sbjct  487   HRPPEWSVPFMPWPAAASIFLNVFLMTTLKAKAFERFAVWSFVITLFYVLYGVHSTYH  544



>ref|XP_007155719.1| hypothetical protein PHAVU_003G225700g [Phaseolus vulgaris]
 gb|ESW27713.1| hypothetical protein PHAVU_003G225700g [Phaseolus vulgaris]
Length=585

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/548 (70%), Positives = 458/548 (84%), Gaps = 7/548 (1%)
 Frame = -2

Query  2040  SRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalg  1861
             ++SM ++ S+YL+SLSQTP +L+KR LATWTPDQE N+VR RSGADMKRKL WYDLVALG
Sbjct  8     TKSMKKL-SSYLHSLSQTPHRLRKRMLATWTPDQEFNQVRHRSGADMKRKLNWYDLVALG  66

Query  1860  vggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYL  1681
             VGGMLGVGVFVTTG VA   +GPSVFISYI+AG+SALLSSLCYTEF+V++PVAGGAFSYL
Sbjct  67    VGGMLGVGVFVTTGSVALHHSGPSVFISYIIAGISALLSSLCYTEFAVQLPVAGGAFSYL  126

Query  1680  RITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNM  1501
             R+TFGEF GYFAGANIL++YV SNAAV+RSFTEYLS A GE +P+ WRV+V GL + YNM
Sbjct  127   RLTFGEFSGYFAGANILLEYVFSNAAVARSFTEYLSVAFGENDPNVWRVEVHGLPKDYNM  186

Query  1500  LDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGG  1321
             LDFPAVA+I++LT+ LCHSTKESS+LNL+MT FHV+FFGFIIIAG+  GS+ NLV    G
Sbjct  187   LDFPAVAVILILTLFLCHSTKESSVLNLIMTAFHVIFFGFIIIAGYCNGSAKNLVNP-KG  245

Query  1320  LAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmal  1141
             +APFGVRGVLDGAAIVYFSYIGYDS STMAEE+ +P KSLP+GIVGSVL  + LYCLM+L
Sbjct  246   IAPFGVRGVLDGAAIVYFSYIGYDSASTMAEEVKDPFKSLPIGIVGSVLTTTLLYCLMSL  305

Query  1140  slcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVG  961
             SLC+++PYN I E+ SFS AF  +GW WASN+VG GASLGIVASLLVAMLGQARYLCV+G
Sbjct  306   SLCMMVPYNKISEKASFSIAFLRIGWSWASNLVGAGASLGIVASLLVAMLGQARYLCVIG  365

Query  960   RARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaa  781
             RARLVPSWLAKVHPSTGTPLNAT+FLGIC A +ALFTEL I+IE+ISIGTL+VFY+VA A
Sbjct  366   RARLVPSWLAKVHPSTGTPLNATVFLGICTACIALFTELDIIIELISIGTLLVFYMVANA  425

Query  780   liyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHR  601
             LIY RY I    P    LLFLFL+S S+L FS++WK   QWW L LFG   ++ TA +  
Sbjct  426   LIYHRYVITGQTPSSHTLLFLFLLSLSALCFSIAWKFKQQWWGLVLFGGFMIAITAFYQH  485

Query  600   LVPCVR-----RPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
             +V         + + WSVP MPWP +LSIFLNVFL+TTL   +++RF IW  L+++FYV+
Sbjct  486   VVLNATTAQHAQQQHWSVPFMPWPPSLSIFLNVFLITTLKTLSFQRFAIWACLITIFYVL  545

Query  435   YGVHSTYK  412
             YGVH+TY+
Sbjct  546   YGVHNTYE  553



>ref|XP_009383017.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=585

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/552 (70%), Positives = 452/552 (82%), Gaps = 7/552 (1%)
 Frame = -2

Query  2049  TAVSRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlv  1870
             T ++R     FST L+SLSQTP +L+KR   TW+PDQE+N+VR RSGADMKRKL WYDLV
Sbjct  4     TPLARPHHLSFSTILHSLSQTPHRLRKRMFVTWSPDQEMNQVRQRSGADMKRKLEWYDLV  63

Query  1869  algvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAF  1690
             ALGV GMLG GVFVTTG VA K +GP+VFISYIVAG+SALLSS+CYTEFSVE+PVAGGAF
Sbjct  64    ALGVAGMLGAGVFVTTGRVAHKVSGPAVFISYIVAGVSALLSSMCYTEFSVEMPVAGGAF  123

Query  1689  SYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEG  1510
             SYLR+TFGEFVGYF GANILM+YVLSNAAV+R+FTEYLS+A G  +P  WRV+VDGL +G
Sbjct  124   SYLRVTFGEFVGYFGGANILMEYVLSNAAVARTFTEYLSHAFGVDDPKSWRVQVDGLAQG  183

Query  1509  YNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKS  1330
             YN LDFPAVALIIL+T+ LCHSTKESS++N+VMT+FHV+FFG +I+A F  G+  NL++ 
Sbjct  184   YNALDFPAVALIILITLCLCHSTKESSIVNVVMTVFHVIFFGVVIVACFANGNPKNLIEP  243

Query  1329  GGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalycl  1150
               GLAPFG RGVLDGAAIVY SYIGYDSVSTMAEEI NPSKSLP+GI GSVLIVSALYCL
Sbjct  244   -KGLAPFGARGVLDGAAIVYVSYIGYDSVSTMAEEIRNPSKSLPIGIAGSVLIVSALYCL  302

Query  1149  malslcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYL  973
             MAL+LC ++PY+ I ++ SFS+AFK M+GW+W  NVVGVGASLGIVASLLVAMLGQARYL
Sbjct  303   MALALCSMIPYDEILDDASFSSAFKNMVGWRWMGNVVGVGASLGIVASLLVAMLGQARYL  362

Query  972   CVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFyl  793
             CVVGRARLVP WLAKVHPSTGTP+NATIFLGIC AS+ALFT+L+IVIE+ISIGTL+VFYL
Sbjct  363   CVVGRARLVPFWLAKVHPSTGTPINATIFLGICTASIALFTDLEIVIEMISIGTLLVFYL  422

Query  792   vaaaliyrryaiINGNPPFQvllflflvsssslgf----slSWKLN-LQWWNLPLFGFLT  628
             VA ALIYRRY  + G+      L   L            SLSWKLN   WW L +FG   
Sbjct  423   VAGALIYRRYVKLGGSGGVSSPLPTLLFLLLLTSTSIGFSLSWKLNGGYWWGLAMFGTAA  482

Query  627   LSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSL  448
             ++ T +FHR VPC R    WSVPLMPWPAA SIFL+VFLM +L  +++ RF +W+  ++L
Sbjct  483   IAITGIFHRKVPCNRSTAEWSVPLMPWPAAASIFLSVFLMASLKKRSFLRFVLWSCFITL  542

Query  447   FYVVYGVHSTYK  412
             FY +YGVHST+ 
Sbjct  543   FYALYGVHSTFH  554



>ref|XP_010919915.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Elaeis guineensis]
Length=576

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/569 (71%), Positives = 466/569 (82%), Gaps = 3/569 (1%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FST L+SLSQTP +L++RAL TWTPDQELN+VR RSGADMKRKL WYDLVALGVGGMLG 
Sbjct  8     FSTILHSLSQTPHRLRRRALVTWTPDQELNQVRERSGADMKRKLEWYDLVALGVGGMLGA  67

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA +  GP+VF+SYI+AG+SALLSSLCYTEFSVE PVAGGAFSYLRITFGEF
Sbjct  68    GVFVTTGRVAHEVTGPAVFVSYIIAGISALLSSLCYTEFSVETPVAGGAFSYLRITFGEF  127

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYF GANILM+YVLSNAAV+R+FTEYLS A G  N   WRV+V GL + YN LDFPAV 
Sbjct  128   VGYFGGANILMEYVLSNAAVARNFTEYLSSAFGSHNASSWRVEVSGLAKDYNQLDFPAVV  187

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             L++LLT+ LCH TKESS+LNLVMT+FHV+FFGFII+AGF  GS  NLVK   GL PFG R
Sbjct  188   LLLLLTLCLCHGTKESSMLNLVMTVFHVIFFGFIIVAGFCNGSPRNLVKP-KGLLPFGAR  246

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+LDGAAIVYFSYIGYDSVSTMAEEI NPSKSLP+GI GSVLIVS LYCL+AL+LC ++P
Sbjct  247   GILDGAAIVYFSYIGYDSVSTMAEEIRNPSKSLPIGIAGSVLIVSTLYCLLALALCFMIP  306

Query  1119  YNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVP  943
             YN I    SFS+AF K +GWKWAS  +G GASLGIVASLLVAMLGQARYLCV+ RARLVP
Sbjct  307   YNEISVNASFSSAFQKKVGWKWASKTIGAGASLGIVASLLVAMLGQARYLCVIARARLVP  366

Query  942   SWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrry  763
              W AKVHPSTGTP+NATIFLG+  AS+ALFTEL+IV+E+ISIGTL+VFYLVA AL+YRRY
Sbjct  367   LWFAKVHPSTGTPMNATIFLGLFTASIALFTELEIVLEMISIGTLLVFYLVANALVYRRY  426

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNL-QWWNLPLFGFLTLSFTALFHRLVPCV  586
               +  N P   LLFL L++SSS+GFSLSWKLN   WW + LFG  ++  TA FH  VPC 
Sbjct  427   VKVGRNRPLPTLLFLLLLTSSSIGFSLSWKLNEGYWWEMALFGGASILVTAFFHHRVPCN  486

Query  585   RRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKve  406
              RP  WSVP MPWPAA SIFLNVFLMTTL  KA+ RF +W+ +++LFY +YGVHSTY  E
Sbjct  487   HRPSEWSVPFMPWPAAASIFLNVFLMTTLKAKAFVRFAVWSFVITLFYALYGVHSTYHAE  546

Query  405   emevmvdnnnnhvnnnNSTTQPIKLEIQV  319
             EME+    +  + N ++   Q  KL++QV
Sbjct  547   EMEMERGIDQGNANPSSHDHQAAKLDVQV  575



>ref|XP_010274503.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Nelumbo nucifera]
Length=587

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/570 (71%), Positives = 472/570 (83%), Gaps = 8/570 (1%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
              STYL  L QTP KLK+R  ATWTPDQELN+VRLRSGADMKRKL WYDLV LGVGGMLGV
Sbjct  24    LSTYLQDLHQTPHKLKRRMFATWTPDQELNQVRLRSGADMKRKLQWYDLVGLGVGGMLGV  83

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA + +GP+VFISYI+AG+SALLSSLCYTEFS+++PVAGGAFSYLRITFGEF
Sbjct  84    GVFVTTGQVAARISGPAVFISYIIAGVSALLSSLCYTEFSIQIPVAGGAFSYLRITFGEF  143

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYFAGANILM+YVLSNAAV+RSFT YLS  +G  +PD WR+KV GL EGYN LDF AV 
Sbjct  144   VGYFAGANILMEYVLSNAAVARSFTAYLSCTVGAVHPDSWRLKVGGLAEGYNRLDFTAVV  203

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             +I+LLT  LC+STKESS+ NLVMT+FHV+FFGFIII+GFY GS+ NL+    GL PFGVR
Sbjct  204   VILLLTFCLCYSTKESSMFNLVMTVFHVIFFGFIIISGFYIGSAKNLIHP-DGLTPFGVR  262

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAAIVYFSYIGYD+VST+AEEI NP K+LPVGIVGSV+IV ALYCLMALSLC+++P
Sbjct  263   GVLDGAAIVYFSYIGYDTVSTLAEEIKNPQKNLPVGIVGSVVIVLALYCLMALSLCVMIP  322

Query  1119  YNLIPE-EGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             YN I + E SF  AF KM GW+WASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLV
Sbjct  323   YNEISDTEASFVLAFRKMAGWEWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLV  382

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P WLAKVHPSTGTPLNAT+ LG+C AS+ALFTEL+IV+E+ISIGTL+VFYLV  ALIYRR
Sbjct  383   PIWLAKVHPSTGTPLNATLSLGMCTASIALFTELEIVLEMISIGTLLVFYLVGNALIYRR  442

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCV  586
             Y +I  N P   L++L L+SSSS+GFS+SWK   QWW L LF    ++ TA+FH ++   
Sbjct  443   YVVIGNNHPLPTLVYLLLLSSSSIGFSMSWKFKEQWWGLALFSGTLIAITAVFHYMISRS  502

Query  585   RRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKve  406
              +P  WSVPLMPWPA+ SIFLNVFLMTTLN++A++RFGIW  L++LFYV+YGVHSTY+  
Sbjct  503   GQPSEWSVPLMPWPASASIFLNVFLMTTLNIRAFQRFGIWACLVTLFYVLYGVHSTYR--  560

Query  405   emevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
                       +   N  S+ Q  KLEIQ++
Sbjct  561   ---AEEMGTEDDGINTISSVQQTKLEIQLV  587



>emb|CAN83060.1| hypothetical protein VITISV_010305 [Vitis vinifera]
Length=591

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/599 (68%), Positives = 471/599 (79%), Gaps = 32/599 (5%)
 Frame = -2

Query  2046  AVSRSMPEIF-STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlv  1870
             A+  ++  IF S YL+SLSQTP +L+KR LATWT DQELN+VRLRSGADMKRKL WYDLV
Sbjct  3     AIQTALSSIFFSKYLHSLSQTPHRLRKRMLATWTSDQELNQVRLRSGADMKRKLGWYDLV  62

Query  1869  algvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAF  1690
             ALGVGGMLGVGVFVTTGPVA   +GPSVFISYI+AG+SALLSS+CYTEFSVE+PVAGGAF
Sbjct  63    ALGVGGMLGVGVFVTTGPVALHHSGPSVFISYIIAGISALLSSMCYTEFSVEIPVAGGAF  122

Query  1689  SYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEG  1510
             SYLR+TFGEFVGYFAGANILM+YVLSNAAVSRSFTEYLS A G GN + WRV+V G  +G
Sbjct  123   SYLRVTFGEFVGYFAGANILMEYVLSNAAVSRSFTEYLSCAFG-GNLNSWRVEVHGFTKG  181

Query  1509  YNMLDFPavaliilltivLCHS---------------------TKESSLLNLVMTifhvv  1393
               M+      +I   +++ C +                     TKESS+LN VMTIFHVV
Sbjct  182   --MISLYLNTIIFFKSLLCCFAVFIDLRAEGFSASNVFALTCVTKESSILNFVMTIFHVV  239

Query  1392  ffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNP  1213
             FFGFIIIAGF KGS+ NLV   G LAPFGV+GVLDGAA VYFSYIGYDSVSTMAEEI+NP
Sbjct  240   FFGFIIIAGFLKGSAKNLVNPDG-LAPFGVKGVLDGAAQVYFSYIGYDSVSTMAEEISNP  298

Query  1212  SKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVG  1033
             SKSLPVGI+GSV IVS LYCLM+ +LC++LPYN IPE+ SF+ AF+ MGWKWASN+VG G
Sbjct  299   SKSLPVGIMGSVFIVSGLYCLMSFALCMMLPYNQIPEKASFAIAFQRMGWKWASNIVGAG  358

Query  1032  ASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALF  853
             ASLGIVASLLVAMLGQARYLCV+GRARLVP WLAKVHPSTGTPLNAT+FLG   AS+ALF
Sbjct  359   ASLGIVASLLVAMLGQARYLCVIGRARLVPLWLAKVHPSTGTPLNATLFLGAFTASIALF  418

Query  852   TELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWK  673
             TEL+IV++++++ TL+VFYLVA ALIYRRY I   NPPF  LLFL L+S SS+ FSLSWK
Sbjct  419   TELEIVVDMVNLCTLLVFYLVANALIYRRYVITVNNPPFHTLLFLSLLSCSSIAFSLSWK  478

Query  672   LNLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNV  493
             L  QWW LPLFG + +  TA FH   P   +P  WSVP MPWPAA+SIFLNVFLMTTL  
Sbjct  479   LK-QWWGLPLFGGIMIIITACFHYFXPYPXQPSKWSVPFMPWPAAMSIFLNVFLMTTLKK  537

Query  492   KAYKRFGIWTGLMSLFYVVYGVHSTYKveemevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
              + +RFG+W+ L+ LFYV+YGVHSTY+           +    N NS+ Q  KL+IQ+L
Sbjct  538   LSLQRFGVWSCLIILFYVLYGVHSTYR-----AEEMGMDAGGVNPNSSAQQTKLDIQLL  591



>emb|CDP08331.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/533 (74%), Positives = 451/533 (85%), Gaps = 9/533 (2%)
 Frame = -2

Query  1902  MKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEF  1723
             MKRKLTWYDLVALGVGGMLGVGVFVTTGPVA   +GPSVFISYI+AG+SALLSSLCYTEF
Sbjct  1     MKRKLTWYDLVALGVGGMLGVGVFVTTGPVALDISGPSVFISYIIAGISALLSSLCYTEF  60

Query  1722  SVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDC  1543
             S+E+PVAGGAFSYLR+TFGEFVGYFAGANILM+YVLSNAAV+RSFTEYL  A G  +P+ 
Sbjct  61    SIEIPVAGGAFSYLRVTFGEFVGYFAGANILMEYVLSNAAVARSFTEYLCTAFGRNDPNS  120

Query  1542  WRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagF  1363
             WRV+VDGL++GYNMLDFPAVAL  +LT+ LCHSTKESS+LNL MT+FHV FFGFIIIAGF
Sbjct  121   WRVEVDGLVKGYNMLDFPAVALTAVLTLCLCHSTKESSILNLAMTVFHVAFFGFIIIAGF  180

Query  1362  YKGSSDNLVKSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVG  1183
               GS  NL+K GG LAPFG +GVLDGAA VYFSYIGYDSVSTMAEEI NPS++LP+GIVG
Sbjct  181   QNGSPKNLIKPGG-LAPFGAKGVLDGAAKVYFSYIGYDSVSTMAEEIRNPSRNLPIGIVG  239

Query  1182  SVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLL  1003
             SVLIVSALYCLMALSLCLL+PYN IPE  SFS  F+ +GWKWASN+VGVGASLGIVASLL
Sbjct  240   SVLIVSALYCLMALSLCLLVPYNKIPERASFSVVFRNIGWKWASNLVGVGASLGIVASLL  299

Query  1002  VAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEII  823
             VAMLGQARYLCV+GRARLVPSWLAKVH  TGTPLNATIFLG CQAS+ALFTEL IVIE+I
Sbjct  300   VAMLGQARYLCVIGRARLVPSWLAKVHSKTGTPLNATIFLGFCQASIALFTELDIVIEMI  359

Query  822   SIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPL  643
             SIGTL+VFYLVA AL+YRRY I + +PPF  LLFL L++ +S+GFS+SWKL   WW LPL
Sbjct  360   SIGTLLVFYLVANALLYRRYVITSSHPPFPTLLFLILLTCTSIGFSISWKLKRHWWGLPL  419

Query  642   FGFLTLSFTALFHRLV--PCVRR--PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRF  475
             FG L ++ TALF  L+  P  +R  P  WSVP MPWPAA+SIFLNVFLMTTL   +Y+RF
Sbjct  420   FGGLMIAITALFQYLMAPPASQRQEPAKWSVPFMPWPAAISIFLNVFLMTTLQKLSYQRF  479

Query  474   GIWTGLMSLFYVVYGVHSTYKveemevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
             GIW   ++LFYVVYGVHSTY+       ++   ++    NS+ QP K +IQVL
Sbjct  480   GIWACFITLFYVVYGVHSTYQ----AEEMEVCVDNGVTTNSSVQPTKFDIQVL  528



>gb|KEH31609.1| cationic amino acid transporter [Medicago truncatula]
Length=554

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/523 (73%), Positives = 443/523 (85%), Gaps = 7/523 (1%)
 Frame = -2

Query  1962  LATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVF  1783
             LATWTPDQE N+VR RSGADMKRKL WYDL+ALGVGGMLGVGVFVTTGPVA   +GPSVF
Sbjct  2     LATWTPDQEFNQVRQRSGADMKRKLNWYDLIALGVGGMLGVGVFVTTGPVALHQSGPSVF  61

Query  1782  ISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAA  1603
             ISYI+AG+SALLSSLCYTEF+V+VPVAGGAFSYLR+TFGEF+GYF GANILM+YV SNAA
Sbjct  62    ISYIIAGISALLSSLCYTEFAVQVPVAGGAFSYLRLTFGEFLGYFGGANILMEYVFSNAA  121

Query  1602  VSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLL  1423
             V+RSFTEYLS+A GE NP+ WRV+V GL + YNMLDFPAVALI+LLT+ LCHSTKESS+L
Sbjct  122   VARSFTEYLSFAFGENNPNVWRVEVHGLPKDYNMLDFPAVALILLLTLCLCHSTKESSIL  181

Query  1422  NLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLDGAAIVYFSYIGYDSV  1243
             NL+MT+FHV+FFGFII+AG+Y GS+ NLV   G +AP+GVRGVLDGAAIVYFSYIGYDS 
Sbjct  182   NLIMTVFHVIFFGFIIVAGYYNGSTKNLVNPKG-IAPYGVRGVLDGAAIVYFSYIGYDSA  240

Query  1242  STMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKMMGW  1063
             STMAEE+ +P KSLP+GIVGSVLI + LYCLMALSLC+++PYN I ++ S+S AF  +GW
Sbjct  241   STMAEEVKDPYKSLPIGIVGSVLITTLLYCLMALSLCIMVPYNKISDKASYSMAFLKIGW  300

Query  1062  KWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFL  883
              WASN+VG GASLGIVASLLVAMLGQARYLCV+GRARLVPSWLAKVHPSTGTPLNATIFL
Sbjct  301   SWASNIVGAGASLGIVASLLVAMLGQARYLCVMGRARLVPSWLAKVHPSTGTPLNATIFL  360

Query  882   GICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvss  703
             G C AS+ALFTEL I+IE+ISIGTL+VFY+VA ALIYRRY II   PP   LLFLFL+S 
Sbjct  361   GFCTASIALFTELDIIIELISIGTLMVFYMVANALIYRRYVIIGHTPPLHTLLFLFLLSL  420

Query  702   sslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPC------VRRPESWSVPLMPWPA  541
             +SL FS+ WK   QWW L LFG   ++ T+LF  +VPC            W VP MPWP 
Sbjct  421   TSLCFSIVWKFKQQWWGLLLFGGFMITITSLFQHMVPCNNNLVQQEYAHCWYVPFMPWPP  480

Query  540   ALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             ++SIFLNVFLMTTL   +++RF IW+  +++FYV+YGVHSTY+
Sbjct  481   SMSIFLNVFLMTTLKTLSFQRFAIWSCFITMFYVLYGVHSTYQ  523



>ref|XP_007156591.1| hypothetical protein PHAVU_002G001800g [Phaseolus vulgaris]
 gb|ESW28585.1| hypothetical protein PHAVU_002G001800g [Phaseolus vulgaris]
Length=577

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/570 (69%), Positives = 468/570 (82%), Gaps = 8/570 (1%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y +SLSQTP++LKKR LAT TPDQELN+VR RSGADMKR L WYDLVALG+GGMLGVG
Sbjct  13    SGYFHSLSQTPQRLKKRMLATGTPDQELNQVRQRSGADMKRSLKWYDLVALGLGGMLGVG  72

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTG VA   +GPSVFISYI+AGLSALLSSLCYTEF+V+VPVAGGAFSYLR+TFGEFV
Sbjct  73    VFVTTGSVAHHQSGPSVFISYIIAGLSALLSSLCYTEFAVQVPVAGGAFSYLRLTFGEFV  132

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYFAGANILM+YV SNAAVSRSFTEYLS+  GE +P+ WRVK+ GL + YNMLD PAV+L
Sbjct  133   GYFAGANILMEYVFSNAAVSRSFTEYLSFTFGENDPNVWRVKLHGLPKNYNMLDLPAVSL  192

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I++LT+ LC+STKESS+LNL MT+FHV+FFGFII++G+  GS  NLV S  GLAPFG+RG
Sbjct  193   ILILTLCLCYSTKESSILNLTMTVFHVIFFGFIIVSGYSTGSVKNLV-SPKGLAPFGMRG  251

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V++GAA VYFSYIGYDS ST+AEEI +PSKSLP+GIVGSVLI + LYCLM+LSLC++ PY
Sbjct  252   VVNGAAKVYFSYIGYDSASTLAEEIKDPSKSLPIGIVGSVLITTVLYCLMSLSLCMMAPY  311

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I ++ SF+ AF  +G  W SN+VG GASLGIVASLLVAMLGQARYLCV+GRARLVPSW
Sbjct  312   NKISDKSSFAFAFAKIGGMWESNLVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSW  371

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LAKVHPST TPLNAT+FLG+C A VALFT+L I+IE+I++GTLVVFYLVA ALIYRRY I
Sbjct  372   LAKVHPSTATPLNATLFLGVCTACVALFTDLDIIIELINMGTLVVFYLVANALIYRRYVI  431

Query  756   INGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR-  580
              +  PPF  LLFL L S S+LGFSLSWK NL  W LPLFG L ++ TA +H  VP     
Sbjct  432   TSHTPPFYTLLFLLLFSLSALGFSLSWKFNLLRWGLPLFGGLMITITAFYHHQVPHTHSQ  491

Query  579   -PES-WSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKve  406
              P + W VP MPWP  LSIFLN+FL+TTLN+ A++RF +W   ++LFY++YGVHSTY+  
Sbjct  492   LPHTHWCVPFMPWPPVLSIFLNLFLITTLNLLAFQRFAMWACFITLFYLLYGVHSTYQ--  549

Query  405   emevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
                  ++   N VN+ ++  Q  K+E+QVL
Sbjct  550   --AEEIEIGANQVNSTSTNAQTNKVELQVL  577



>emb|CDY09649.1| BnaC07g34120D [Brassica napus]
Length=579

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/548 (68%), Positives = 446/548 (81%), Gaps = 15/548 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y +SLSQTP +LK R LATWTPDQE+N+VRLRSGADMKRKL W+DLV+LGVGGMLGVG
Sbjct  2     SKYFHSLSQTPHRLKSRMLATWTPDQEVNQVRLRSGADMKRKLRWFDLVSLGVGGMLGVG  61

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVAR  +GP+VFISY++AG SA+LSSLCYTEFSV VPVAGGAFSYLR+TFGEF+
Sbjct  62    VFVTTGPVARDISGPAVFISYMIAGFSAVLSSLCYTEFSVNVPVAGGAFSYLRVTFGEFI  121

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYF G NIL++YVLSNAAV+RSFTEY+  A+G  +P+ WRVKV GL +GYN LDFPAV L
Sbjct  122   GYFGGVNILLEYVLSNAAVARSFTEYMCTAIGVSDPNAWRVKVIGLAKGYNELDFPAVVL  181

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++LLT+ LCHSTKESS+LNLVMT+FHV+FFGF+IIAGF  G     +    GL P+G RG
Sbjct  182   VLLLTLCLCHSTKESSMLNLVMTVFHVIFFGFVIIAGFCHGDGVKALVEPRGLTPYGARG  241

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V++GAA+VYFSYIGYD+VST+AEEI NPS SLPVGI+GSV +VS LYCLM+L LC+++PY
Sbjct  242   VVNGAAVVYFSYIGYDTVSTLAEEIQNPSFSLPVGIIGSVSVVSVLYCLMSLVLCVMVPY  301

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I +  S++ AF+ +GW WA NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSW
Sbjct  302   NEISKSASYAVAFRRIGWGWAGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSW  361

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LAKVHPSTGTPLNAT+FLGIC A++ALFT+L+IV+E+IS+GTL VFYLVA ALIYR+Y +
Sbjct  362   LAKVHPSTGTPLNATLFLGICTATIALFTDLEIVMELISLGTLCVFYLVANALIYRKYTL  421

Query  756   INGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHR--------  601
                N PF+ L FL L+S  SL FSL WKLN  WW L LF  +T++ TALF          
Sbjct  422   TGQNAPFRTLSFLALLSFFSLAFSLWWKLNKPWWGLTLFIVITIAVTALFQYHTWSISST  481

Query  600   -----LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
                  L P    P  WSVP MPWPAA S+FLNVFL TTL   +++RF IWT L+++FYV+
Sbjct  482   TNKNLLTPSC--PSKWSVPFMPWPAAASVFLNVFLTTTLKTLSFQRFAIWTCLVTMFYVL  539

Query  435   YGVHSTYK  412
             YGVH TY+
Sbjct  540   YGVHRTYE  547



>ref|XP_010269827.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Nelumbo nucifera]
Length=593

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/538 (73%), Positives = 455/538 (85%), Gaps = 4/538 (1%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  YL SL +TP +LKKR  ATWTPDQELN+VRLRSGADMKRKL W+DLV LGVGGMLGV
Sbjct  30    FLAYLQSLPETPHRLKKRMFATWTPDQELNQVRLRSGADMKRKLQWFDLVGLGVGGMLGV  89

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA   +GP+V ++YI+AG+SALLSSLCYTEFS+++PVAGGAFSYLR+TFGEF
Sbjct  90    GVFVTTGRVAANISGPAVVLAYIIAGISALLSSLCYTEFSIQIPVAGGAFSYLRVTFGEF  149

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             +GYFAGANILM+YVLSNAAV+RSFTEYLS   GE  P+ WRV+V GL  GYN LDFPAVA
Sbjct  150   MGYFAGANILMEYVLSNAAVARSFTEYLSCTFGE-EPNSWRVEVGGLANGYNRLDFPAVA  208

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             ++ILLT+ LCHSTKESS+LN+VMT+FHV+FFGFIII+GF  GS+ NL+   G L PFG R
Sbjct  209   VVILLTLCLCHSTKESSILNIVMTVFHVIFFGFIIISGFCIGSAKNLIHPSG-LTPFGFR  267

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV+DGAAIVY SYIGYD+VSTMAEEI NP K+LPVGIVGSV+IV+ALYCLM+L+LC+++P
Sbjct  268   GVIDGAAIVYISYIGYDTVSTMAEEIKNPPKALPVGIVGSVVIVTALYCLMSLALCVMIP  327

Query  1119  YNLIPE-EGSFSAAFKMM-GWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             YN I     SF+ AFKM+ GW+WASN VG GA+LGIVASLLVAMLGQARYLCV+GRARLV
Sbjct  328   YNEISNASASFALAFKMIAGWEWASNFVGAGATLGIVASLLVAMLGQARYLCVIGRARLV  387

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P W AKVHPSTGTPLNAT+FLGIC A++ALFT L IV+++ISIGTL+VFYLVA ALIYRR
Sbjct  388   PFWFAKVHPSTGTPLNATVFLGICTATIALFTGLDIVVDMISIGTLLVFYLVANALIYRR  447

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCV  586
             Y +   N P  VLLFL L+SSSS+GFS+SWK + QWW L +FG      TA FH L+PC 
Sbjct  448   YVVNGSNHPAPVLLFLLLLSSSSVGFSMSWKFHEQWWGLAIFGGSLFIITAFFHYLLPCT  507

Query  585   RRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              RP  WSVPLMPWPAA SIFLNVFLMTTL ++A++RFGIW  L++LFYV YGVHSTY 
Sbjct  508   ARPTQWSVPLMPWPAAASIFLNVFLMTTLKIRAFQRFGIWACLVTLFYVFYGVHSTYS  565



>ref|XP_006283404.1| hypothetical protein CARUB_v10004452mg [Capsella rubella]
 gb|EOA16302.1| hypothetical protein CARUB_v10004452mg [Capsella rubella]
Length=580

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/545 (69%), Positives = 446/545 (82%), Gaps = 10/545 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y +SLSQTP +LK R LATWTPDQE+N+VRLRSGADMKRKL W+DLV+LGVGGMLGVG
Sbjct  2     SKYFHSLSQTPHRLKSRMLATWTPDQEVNQVRLRSGADMKRKLRWFDLVSLGVGGMLGVG  61

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVAR  +GP+VFISY+VAG SALLSSLCYTEFSV VPVAGGAFSYLR+TFGEF+
Sbjct  62    VFVTTGPVARDISGPAVFISYMVAGFSALLSSLCYTEFSVNVPVAGGAFSYLRVTFGEFI  121

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYF GANIL++YVLSNAAV+RSFTEY   A G  +P+ WR+KV+GL  GYN LDFPAVAL
Sbjct  122   GYFGGANILLEYVLSNAAVARSFTEYACTAFGVSDPNAWRIKVNGLKTGYNELDFPAVAL  181

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++LLT+ LCHSTKESS+LNLVMT+FH++FFGF+IIAGF  G     +    GL P+GVRG
Sbjct  182   VLLLTLCLCHSTKESSMLNLVMTVFHIIFFGFVIIAGFSHGDGAKALVEPRGLTPYGVRG  241

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V++GAA+VYFSYIGYD+VST+AEEI NPS SLPVGI+GSV +VS LYCLM+L LCL++PY
Sbjct  242   VVNGAAVVYFSYIGYDTVSTLAEEIQNPSFSLPVGIIGSVSVVSVLYCLMSLVLCLMVPY  301

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I +  S++ AF+ +GW WA NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSW
Sbjct  302   NEISKSASYAVAFRRIGWGWAGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSW  361

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LAKVHPSTGTPLNAT+FLG+C AS+ALFT+L+IV+E+IS+GTL VFYLVA ALIYR+Y +
Sbjct  362   LAKVHPSTGTPLNATLFLGLCTASIALFTDLEIVMELISLGTLCVFYLVANALIYRKYTL  421

Query  756   INGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR-  580
                N P   L FL L+SSS+L FSL WKLN  WW L LF  +T+  T +F      +   
Sbjct  422   TGQNSPLHTLSFLALLSSSALAFSLWWKLNKPWWGLMLFISITIGVTVIFQYHTSLLSST  481

Query  579   ---------PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
                      P +WSVP MPWPAA+S+FLNVFL TTL   +++RF IWT L+++FYV+YGV
Sbjct  482   ANKNLLAPIPSTWSVPFMPWPAAISVFLNVFLTTTLKKLSFQRFAIWTCLVTMFYVLYGV  541

Query  426   HSTYK  412
             H TY+
Sbjct  542   HRTYE  546



>ref|XP_009136823.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=579

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/546 (68%), Positives = 444/546 (81%), Gaps = 11/546 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y +SLSQTP +LK R LATWTPDQE+N+VRLRSGADMKRKL W+DLV+LGVGGMLGVG
Sbjct  2     SKYFHSLSQTPHRLKSRMLATWTPDQEVNQVRLRSGADMKRKLRWFDLVSLGVGGMLGVG  61

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVAR  +GP+VFISY++AG SALLSSLCYTEFSV VPVAGGAFSYLR+TFGEF+
Sbjct  62    VFVTTGPVARDISGPAVFISYMIAGFSALLSSLCYTEFSVNVPVAGGAFSYLRVTFGEFI  121

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYF G NIL++YVLSNAAV+RSFTEY+  A+G  +P+ WRVKV GL +GYN LDFPAV L
Sbjct  122   GYFGGVNILLEYVLSNAAVARSFTEYMCTAIGVSDPNAWRVKVIGLAKGYNELDFPAVVL  181

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++LLT+ LCHSTKESS+LNLVMT+FH++FFGF+IIAGF  G     +    GL P+G RG
Sbjct  182   VLLLTLCLCHSTKESSMLNLVMTVFHIIFFGFVIIAGFCHGDGVKALVEPRGLTPYGARG  241

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V++GAA+VYFSYIGYD+VST+AEEI NPS SLPVGI+GSV +VS LYCLM+L LC+++PY
Sbjct  242   VVNGAAVVYFSYIGYDTVSTLAEEIQNPSFSLPVGIIGSVSVVSVLYCLMSLVLCVMVPY  301

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I +  S++ AF+ +GW WA NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSW
Sbjct  302   NEISKSASYAVAFRRIGWGWAGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSW  361

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LAKVHPSTGTPLNAT+FLGIC A++ALFT+L+IV+E+IS+GTL VFYLVA AL+YR+Y +
Sbjct  362   LAKVHPSTGTPLNATLFLGICTATIALFTDLEIVMELISLGTLCVFYLVANALLYRKYTL  421

Query  756   INGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFH----RLVPC  589
                N P   L FL L+SS SL FSL WKLN  WW L LF  + ++ TA F      +   
Sbjct  422   TGQNAPVHTLSFLALLSSFSLAFSLWWKLNKPWWGLTLFIAIAIAVTAFFQYHTWSISST  481

Query  588   VRR-------PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
             V +       P  WSVP MPWPAA S+FLNVFL TTL   +++RF IWT L+++FYV+YG
Sbjct  482   VSKNLLRPSCPSKWSVPFMPWPAAASVFLNVFLTTTLKTLSFQRFAIWTCLVTMFYVLYG  541

Query  429   VHSTYK  412
             VH TY+
Sbjct  542   VHRTYE  547



>ref|XP_010110562.1| Cationic amino acid transporter 6 [Morus notabilis]
 gb|EXC26780.1| Cationic amino acid transporter 6 [Morus notabilis]
Length=566

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/529 (72%), Positives = 439/529 (83%), Gaps = 14/529 (3%)
 Frame = -2

Query  1962  LATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVF  1783
             LATWTP+QELN+VR RSGADMKRKL W+DL+ALG+GGMLGVGVFV TG VA  + GPSVF
Sbjct  2     LATWTPEQELNQVRQRSGADMKRKLKWHDLLALGLGGMLGVGVFVATGEVAVHS-GPSVF  60

Query  1782  ISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAA  1603
             ISY +AG++ALLSSLCY EFSV++PVAGGAFSYLR+TFGEFVGYFAGANILM+YVLSNA 
Sbjct  61    ISYFIAGIAALLSSLCYAEFSVQIPVAGGAFSYLRLTFGEFVGYFAGANILMEYVLSNAG  120

Query  1602  VSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLL  1423
              +RSFTEY+S+  GE NP  WRV V+GLM  Y+ LDFPAVALI+LLT  LCHSTKESS+L
Sbjct  121   AARSFTEYMSFTFGENNPKAWRVHVEGLMTNYDELDFPAVALILLLTFCLCHSTKESSML  180

Query  1422  NLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLDGAAIVYFSYIGYDSV  1243
             NLVMT+FH+VFFGFIIIAG YKGS+DNL+K   GLAPFGV+ ++DGAAIVYF YIGYDS 
Sbjct  181   NLVMTVFHLVFFGFIIIAGLYKGSTDNLIKP-NGLAPFGVKSIIDGAAIVYFGYIGYDSA  239

Query  1242  STMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKMMGW  1063
             STMAEEI NPSK LP+GIVGSVLI S +YCLMALSLCL++PY  I ++ SFS AF+ +GW
Sbjct  240   STMAEEIQNPSKILPIGIVGSVLISSVIYCLMALSLCLMVPYYKIQKKASFSVAFQSIGW  299

Query  1062  KWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFL  883
              WA NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSWLAKVHPSTGTPLNAT+FL
Sbjct  300   NWAGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSWLAKVHPSTGTPLNATLFL  359

Query  882   GICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvss  703
             G+C AS+ALF +L I++++ISIGTLVVF+LVA ALIYRRY +I  NPP ++LLFLFL+SS
Sbjct  360   GLCTASIALFVDLDIILQMISIGTLVVFFLVANALIYRRYVVIGNNPPSKILLFLFLLSS  419

Query  702   sslgfslSWKLNLQWWNLP---------LFGFLTLSFTALFHRLVPCVRR---PESWSVP  559
             ++LGFSL W     WW L          LF   TLS   LFH LVP  R      +WSVP
Sbjct  420   AALGFSLWWHSKPHWWGLHSKLHYWGLLLFCGATLSIIVLFHYLVPNCRANYPSGTWSVP  479

Query  558   LMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              MPWP ALSIFLN+FLMTTL   +++RF IWT L+SLFY++YGVH TY+
Sbjct  480   YMPWPPALSIFLNIFLMTTLTSLSFQRFAIWTVLISLFYMLYGVHQTYQ  528



>ref|XP_009136822.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=602

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/569 (65%), Positives = 444/569 (78%), Gaps = 34/569 (6%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y +SLSQTP +LK R LATWTPDQE+N+VRLRSGADMKRKL W+DLV+LGVGGMLGVG
Sbjct  2     SKYFHSLSQTPHRLKSRMLATWTPDQEVNQVRLRSGADMKRKLRWFDLVSLGVGGMLGVG  61

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVAR  +GP+VFISY++AG SALLSSLCYTEFSV VPVAGGAFSYLR+TFGEF+
Sbjct  62    VFVTTGPVARDISGPAVFISYMIAGFSALLSSLCYTEFSVNVPVAGGAFSYLRVTFGEFI  121

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYF G NIL++YVLSNAAV+RSFTEY+  A+G  +P+ WRVKV GL +GYN LDFPAV L
Sbjct  122   GYFGGVNILLEYVLSNAAVARSFTEYMCTAIGVSDPNAWRVKVIGLAKGYNELDFPAVVL  181

Query  1476  iilltivLCH-----------------------STKESSLLNLVMTifhvvffgfiiiag  1366
             ++LLT+ LCH                       +TKESS+LNLVMT+FH++FFGF+IIAG
Sbjct  182   VLLLTLCLCHRYEYNFCARRRYYINQGKVIKSSTTKESSMLNLVMTVFHIIFFGFVIIAG  241

Query  1365  FYKGSSDNLVKSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIV  1186
             F  G     +    GL P+G RGV++GAA+VYFSYIGYD+VST+AEEI NPS SLPVGI+
Sbjct  242   FCHGDGVKALVEPRGLTPYGARGVVNGAAVVYFSYIGYDTVSTLAEEIQNPSFSLPVGII  301

Query  1185  GSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASL  1006
             GSV +VS LYCLM+L LC+++PYN I +  S++ AF+ +GW WA NVVG GASLGIVASL
Sbjct  302   GSVSVVSVLYCLMSLVLCVMVPYNEISKSASYAVAFRRIGWGWAGNVVGAGASLGIVASL  361

Query  1005  LVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEI  826
             LVAMLGQARYLCV+GRARLVPSWLAKVHPSTGTPLNAT+FLGIC A++ALFT+L+IV+E+
Sbjct  362   LVAMLGQARYLCVIGRARLVPSWLAKVHPSTGTPLNATLFLGICTATIALFTDLEIVMEL  421

Query  825   ISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLP  646
             IS+GTL VFYLVA AL+YR+Y +   N P   L FL L+SS SL FSL WKLN  WW L 
Sbjct  422   ISLGTLCVFYLVANALLYRKYTLTGQNAPVHTLSFLALLSSFSLAFSLWWKLNKPWWGLT  481

Query  645   LFGFLTLSFTALFH----RLVPCVRR-------PESWSVPLMPWPAALSIFLNVFLMTTL  499
             LF  + ++ TA F      +   V +       P  WSVP MPWPAA S+FLNVFL TTL
Sbjct  482   LFIAIAIAVTAFFQYHTWSISSTVSKNLLRPSCPSKWSVPFMPWPAAASVFLNVFLTTTL  541

Query  498   NVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
                +++RF IWT L+++FYV+YGVH TY+
Sbjct  542   KTLSFQRFAIWTCLVTMFYVLYGVHRTYE  570



>emb|CAE04272.2| OSJNBb0103I08.20 [Oryza sativa Japonica Group]
 emb|CAE04339.2| OSJNBb0038F03.3 [Oryza sativa Japonica Group]
Length=561

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/539 (68%), Positives = 444/539 (82%), Gaps = 11/539 (2%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QE ++VR RSGA MKR+L WYDLV LGVGGMLG GVFV
Sbjct  8     LLSIAQTPHRLRRRALVTWTPAQETSEVRDRSGARMKRRLEWYDLVGLGVGGMLGAGVFV  67

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYF  1648
             TTG VAR TAGP+VF SY++AG+SALLSS CY EFSV VP AGGAFSYLR+TFGE VG+F
Sbjct  68    TTGRVARDTAGPAVFASYVIAGVSALLSSFCYAEFSVRVPAAGGAFSYLRVTFGELVGFF  127

Query  1647  AGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliil  1468
              GANILM+YVLSNAAV+RSFT+YL+   G   PD WR++VDG+ +GYN LDFPAVALI++
Sbjct  128   GGANILMEYVLSNAAVARSFTDYLASTCGITEPDAWRIQVDGIAKGYNALDFPAVALILV  187

Query  1467  ltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLD  1288
             LT+ LC+STKES++LN+V+T+FH++FF FII+AG + GS+ NLV S  GLAP+GVRGVLD
Sbjct  188   LTLCLCYSTKESAMLNMVITVFHLLFFVFIILAGLWNGSARNLV-SPHGLAPYGVRGVLD  246

Query  1287  GAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLI  1108
             GAAIVYFSYIGYDS STMAEEI +P+++LPVGI GSVL+VSALYCLM+L+LC +LPY  I
Sbjct  247   GAAIVYFSYIGYDSASTMAEEIRDPARALPVGIAGSVLVVSALYCLMSLALCAMLPYTEI  306

Query  1107  PEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
              E   FSA F+   GW+WA +VVG GASLGIVASLLVAMLGQARYLCV+ RARLVP+WLA
Sbjct  307   AESAPFSAVFREKAGWEWAGSVVGAGASLGIVASLLVAMLGQARYLCVIARARLVPAWLA  366

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KVHPSTGTP+NATIFLG+C AS+ALFTEL++V E+ISIGTL+VFYLVA ALIY RYA + 
Sbjct  367   KVHPSTGTPMNATIFLGLCTASIALFTELQVVFEMISIGTLLVFYLVANALIYHRYAKLG  426

Query  750   GNPPFQvllflflvsssslgfslSWKLNLQW-WNLPLFGFLTLSFTALFHRLVPCVRR--  580
              N    VLLFL +++ SSLGFSLS +++ Q  W + LFG  +++ TA+FH     VRR  
Sbjct  427   ANRSLHVLLFLLILTLSSLGFSLSRRIHGQCRWGMALFGATSVTITAMFH---CAVRRDM  483

Query  579   ---PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
                P  W VPLMPWPAA S+FLNVFLMTTL V +++RFG+W+ ++ +FYV YGVHSTY 
Sbjct  484   PEPPSEWMVPLMPWPAAASVFLNVFLMTTLKVMSFQRFGLWSFVIIVFYVCYGVHSTYS  542



>ref|XP_010434728.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Camelina sativa]
Length=581

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/545 (69%), Positives = 444/545 (81%), Gaps = 10/545 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y +SLSQTP +LK R LATWTPDQE+N+VRLRSGADMKRKL W+DLV+LGVGGMLGVG
Sbjct  2     SKYFHSLSQTPHRLKSRMLATWTPDQEVNQVRLRSGADMKRKLRWFDLVSLGVGGMLGVG  61

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVAR  +GP+VFISY+VAG SALLSSLCYTEFSV VPVAGGAFSYLR+TFGEF+
Sbjct  62    VFVTTGPVARDISGPAVFISYMVAGFSALLSSLCYTEFSVNVPVAGGAFSYLRVTFGEFI  121

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYF GANIL++YVLSNAAV+RSFTEY   A G  +P+ WR+KV+GL  GYN LDFPAVAL
Sbjct  122   GYFGGANILLEYVLSNAAVARSFTEYTCTAFGVSDPNAWRIKVNGLENGYNELDFPAVAL  181

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++LLT+ LCHSTKESS+LNLVMT+FHV+FFGFIIIAGF  G     +    GL P+GVRG
Sbjct  182   VLLLTLCLCHSTKESSMLNLVMTVFHVIFFGFIIIAGFSNGDGAKALVEPRGLTPYGVRG  241

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V++GAA+VYFSYIGYD+VST+AEEI NPS SLPVGI+GSV +VS LYCLM+L LCL++PY
Sbjct  242   VVNGAAVVYFSYIGYDTVSTLAEEIQNPSFSLPVGIIGSVSVVSVLYCLMSLVLCLMVPY  301

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I +  S++ AF+ +GW W  NVVG GASLGIVASLLVAMLGQ+RYLCV+GRARLVPSW
Sbjct  302   NEISKSASYAVAFRKIGWGWGGNVVGAGASLGIVASLLVAMLGQSRYLCVIGRARLVPSW  361

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LAKVHPSTGTPLNAT+FLGIC AS+ALFT+L+IV+E+IS+GTL VFYLVA ALIYR+Y +
Sbjct  362   LAKVHPSTGTPLNATLFLGICTASIALFTDLEIVMELISLGTLCVFYLVANALIYRKYTL  421

Query  756   INGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR-  580
                N P   L FL L+SSS+L FSL WKLN  WW L L   +T++ T  F      +   
Sbjct  422   TGQNSPLHTLSFLALLSSSALAFSLWWKLNKPWWGLLLSLAITIAVTVFFQYHTSLLSST  481

Query  579   ---------PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
                      P +WSVP MPWPAA+S+FLNVFL TTL   +++RF IWT L++LFYV+YGV
Sbjct  482   ANKNLLAPIPSTWSVPFMPWPAAISVFLNVFLTTTLKKLSFQRFAIWTCLVTLFYVLYGV  541

Query  426   HSTYK  412
             H TY+
Sbjct  542   HRTYE  546



>ref|XP_010440066.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Camelina sativa]
Length=580

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/545 (69%), Positives = 443/545 (81%), Gaps = 10/545 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y +SLSQTP +LK R LATWTPDQE+N+VRLRSGADMKRKL W+DLV+LGVGGMLGVG
Sbjct  2     SKYFHSLSQTPHRLKSRMLATWTPDQEVNQVRLRSGADMKRKLRWFDLVSLGVGGMLGVG  61

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVAR  +GP+VFISY+VAG SALLSSLCYTEFSV VPVAGGAFSYLR+TFGEF+
Sbjct  62    VFVTTGPVARDISGPAVFISYMVAGFSALLSSLCYTEFSVNVPVAGGAFSYLRVTFGEFI  121

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYF GANIL++YVLSNAAV+RSFTEY   A G  +P+ WR+KV+GL  GYN LDFPAVAL
Sbjct  122   GYFGGANILLEYVLSNAAVARSFTEYTCTAFGVSDPNAWRIKVNGLENGYNELDFPAVAL  181

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++LLT+ LCHSTKESS+LNLVMT+FHV+FFGF+IIAGF  G     +    GL P+GVRG
Sbjct  182   VLLLTLCLCHSTKESSMLNLVMTVFHVIFFGFVIIAGFSNGDGAKALVEPRGLTPYGVRG  241

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V++GAA+VYFSYIGYD+VST+AEEI NPS SLPVGI+GSV +VS LYCLM+L LCL++PY
Sbjct  242   VVNGAAVVYFSYIGYDTVSTLAEEIQNPSFSLPVGIIGSVSVVSVLYCLMSLVLCLMVPY  301

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I +  S++ AF+ +GW W  NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSW
Sbjct  302   NEISKSASYAVAFRKIGWGWGGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSW  361

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LAKVHPSTGTPLNAT+FLGIC AS+ALFT+L+IV+E+IS+GTL VFYLVA ALIYR+Y +
Sbjct  362   LAKVHPSTGTPLNATLFLGICTASIALFTDLEIVMELISLGTLCVFYLVANALIYRKYTL  421

Query  756   INGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR-  580
                N P   L FL L+SSS+L FSL WKLN  WW L L   +T++ T  F      +   
Sbjct  422   TGQNSPLHTLSFLALLSSSALAFSLWWKLNKPWWGLLLSLAITIAVTVFFQYHTSLLSST  481

Query  579   ---------PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
                      P +WSVP MPWP A+S+FLNVFL TTL   +++RF IWT L++LFYV+YGV
Sbjct  482   ANKNLLAPIPSTWSVPFMPWPTAISVFLNVFLTTTLKKLSFQRFAIWTCLVTLFYVLYGV  541

Query  426   HSTYK  412
             H TY+
Sbjct  542   HRTYE  546



>ref|XP_010449682.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Camelina sativa]
Length=581

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/545 (69%), Positives = 441/545 (81%), Gaps = 10/545 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y +SLSQTP +LK R LATWTPDQE+N+VRLRSGADMKRKL W+DLV+LGVGGMLGVG
Sbjct  2     SKYFHSLSQTPHRLKSRMLATWTPDQEVNQVRLRSGADMKRKLRWFDLVSLGVGGMLGVG  61

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVAR  +GP+VFISY+VAG SALLSSLCYTEFSV VPVAGGAFSYLR+TFGEF+
Sbjct  62    VFVTTGPVARDISGPAVFISYMVAGFSALLSSLCYTEFSVNVPVAGGAFSYLRVTFGEFI  121

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYF GANIL++YVLSNAAV+RSFTEY   A    +P+ WR+KV+ L  GYN LDFPAVAL
Sbjct  122   GYFGGANILLEYVLSNAAVARSFTEYTCTAFDVSDPNAWRIKVNALENGYNELDFPAVAL  181

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++LLT+ LCHSTKESS+LNLVMT+FHV+FFGFIIIAGF  G     +    GL P+GVRG
Sbjct  182   VLLLTLCLCHSTKESSMLNLVMTVFHVIFFGFIIIAGFSNGDGAKALVEPRGLTPYGVRG  241

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V++GAA+VYFSYIGYD+VST+AEEI NPS SLPVGI+GSV +VS LYCLM+L LCL++PY
Sbjct  242   VVNGAAVVYFSYIGYDTVSTLAEEIQNPSFSLPVGIIGSVSVVSVLYCLMSLVLCLMVPY  301

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I +  S++ AF+  GW W  NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSW
Sbjct  302   NEISKSASYAVAFRKTGWGWGGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSW  361

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              AKVHPSTGTPLNAT+FLGIC AS+ALFT+L+IV+E+IS+GTL VFYLVA ALIYR+Y +
Sbjct  362   FAKVHPSTGTPLNATLFLGICTASIALFTDLEIVMELISLGTLCVFYLVANALIYRKYTL  421

Query  756   INGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR-  580
                N P   L FL L+SSS++ FSL WKLN  WW L LF  +T++ T  F      +   
Sbjct  422   TGQNSPLHTLSFLALLSSSAIAFSLWWKLNKPWWGLMLFLAITIAVTVFFQYHNSLLSST  481

Query  579   ---------PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
                      P +WSVP MPWPAA+S+FLNVFL TTL   +++RF IWT L++LFYV+YGV
Sbjct  482   ANKNLLEPIPSTWSVPFMPWPAAISVFLNVFLTTTLKKLSFQRFAIWTCLVTLFYVLYGV  541

Query  426   HSTYK  412
             H TY+
Sbjct  542   HRTYE  546



>ref|XP_008663434.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
isoform X1 [Zea mays]
 gb|AFW59040.1| hypothetical protein ZEAMMB73_148244 [Zea mays]
Length=566

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/547 (67%), Positives = 443/547 (81%), Gaps = 21/547 (4%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QELN+VR RSGA MKR+L WYDLV LGVGGMLG GVFV
Sbjct  7     LLSIAQTPHRLRRRALVTWTPTQELNEVRDRSGARMKRRLEWYDLVGLGVGGMLGAGVFV  66

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITF------G  1666
             TTG VAR TAGP+VF SY+VAG+SALLSSLCY EFSV VPVAGGAFSYLR+TF      G
Sbjct  67    TTGRVARDTAGPAVFASYVVAGVSALLSSLCYAEFSVRVPVAGGAFSYLRVTFASYILSG  126

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             EFVG+F GANILM+YVLSNAAV+RSFT+YL+   G    + WR+ VDG+ +GYN LD PA
Sbjct  127   EFVGFFGGANILMEYVLSNAAVARSFTDYLASTFGVTERNAWRIVVDGIADGYNELDVPA  186

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             VALI+L+T+ LC+STKESS+LN+V+T+FH++FF FI+ AG + GS+ NLV+  G LAP+G
Sbjct  187   VALILLITVCLCYSTKESSMLNMVLTVFHLLFFAFIVAAGLWNGSARNLVRPHG-LAPYG  245

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             VRGVLDGAA+VYFSYIGYDS  TMAEEI +PS++LPVGI GSVL+VS LYCLM+++LC++
Sbjct  246   VRGVLDGAAVVYFSYIGYDSACTMAEEIRDPSRALPVGIAGSVLVVSGLYCLMSVALCVM  305

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY  I E   FS+AF+  +GW+WAS+VVG GAS+GIVASL+VAMLGQARYLCV+ RARL
Sbjct  306   LPYTEISEAAPFSSAFREKVGWRWASSVVGAGASIGIVASLMVAMLGQARYLCVIARARL  365

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP W AKVHPSTGTP+NATIFLG C AS+ALFTEL+IV E+ISIGTL+VFYLVA ALIY 
Sbjct  366   VPLWFAKVHPSTGTPMNATIFLGFCTASLALFTELQIVFEMISIGTLLVFYLVANALIYH  425

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQW--WNLPLFGFLTLSFTALFHRLV  595
             RY  +  N P  VLLFL L++ SSLGFSLS K++  W  W + LFG ++++ T +FH   
Sbjct  426   RYVKVGTNRPLHVLLFLLLLTLSSLGFSLSRKID-GWCQWGMTLFGAVSIAITTIFH---  481

Query  594   PCVRRPE------SWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVY  433
              C  R +       WSVPLMPWPAA S+FLNVFL+TTL V++Y+RFGIW+ +  +FYV Y
Sbjct  482   -CTARQDIAGPSLEWSVPLMPWPAAASVFLNVFLITTLKVRSYQRFGIWSLVTIVFYVCY  540

Query  432   GVHSTYK  412
             GVHSTY 
Sbjct  541   GVHSTYS  547



>ref|XP_006653631.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
7, chloroplastic-like [Oryza brachyantha]
Length=562

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/541 (67%), Positives = 445/541 (82%), Gaps = 15/541 (3%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QE ++VR RSGA MKR+L WYDLV LGVGGMLG GVFV
Sbjct  7     LLSIAQTPHRLRRRALVTWTPAQETSEVRDRSGARMKRRLEWYDLVGLGVGGMLGAGVFV  66

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYF  1648
             TTG  A    GP+VF+SY+VAG++ALLSSLCY EFSV VP AGGAFSYLR+TFGE VG+F
Sbjct  67    TTGRAAPDAPGPAVFVSYVVAGVTALLSSLCYAEFSVRVPAAGGAFSYLRVTFGELVGFF  126

Query  1647  AGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliil  1468
              GANILM+YVLSNAAV+RSFT+YL+   G   PD WR++VD + +GYN LDFPAVALI++
Sbjct  127   GGANILMEYVLSNAAVARSFTDYLASTCGITEPDAWRIQVDAIAKGYNELDFPAVALILV  186

Query  1467  ltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLD  1288
             LT+ LC+STKESS+LN+V+T+FH++FF FII+AG + GS+ NLV+   GLAP+GVRGVLD
Sbjct  187   LTLCLCYSTKESSMLNMVITVFHLLFFVFIILAGLWNGSARNLVRP-HGLAPYGVRGVLD  245

Query  1287  GAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLI  1108
             GAAIVYFSYIGYDS STMAEEI +P+++LPVGI GSVL+VSALYCLM+++LC +LPY  I
Sbjct  246   GAAIVYFSYIGYDSASTMAEEIRDPARALPVGIAGSVLVVSALYCLMSVALCAMLPYTEI  305

Query  1107  PEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
              E   FS+AF+   GW+WA +VVG GASLGIVASLLVAMLGQARYLCV+ RARLVP+WLA
Sbjct  306   SESAPFSSAFREKAGWEWAGSVVGAGASLGIVASLLVAMLGQARYLCVIARARLVPAWLA  365

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KVHPSTGTP+NAT+FLG+C AS+ALFTEL++V E+ISIGTL+VFYLVA ALIY RYA + 
Sbjct  366   KVHPSTGTPMNATLFLGLCTASIALFTELQVVFEMISIGTLLVFYLVANALIYHRYAKLG  425

Query  750   GNPPFQvllflflvsssslgfslSWKLNLQW-WNLPLFGFLTLSFTALFHRLVPC---VR  583
              N    VLLFL L++ SSLGFSLS +++ Q  W + LFG ++++ TA+FH    C   VR
Sbjct  426   ANRSLHVLLFLLLLTLSSLGFSLSRRIDGQCRWGMALFGTISVAITAIFH----CQYGVR  481

Query  582   R-----PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             R     P  W+VPLMPWPAA S+FLN+FLMTTL + +++RFG+W+ ++ +FYV YGVHST
Sbjct  482   RDMAEPPSEWTVPLMPWPAAASVFLNMFLMTTLKMMSFQRFGLWSLVIIIFYVCYGVHST  541

Query  417   Y  415
             Y
Sbjct  542   Y  542



>ref|XP_006838495.1| hypothetical protein AMTR_s00002p00166780 [Amborella trichopoda]
 gb|ERN01064.1| hypothetical protein AMTR_s00002p00166780 [Amborella trichopoda]
Length=575

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/537 (66%), Positives = 427/537 (80%), Gaps = 2/537 (0%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS +L +LSQTP++L++RA AT + D+EL ++R RSGADMKRKL WYDLVALG+GGMLG 
Sbjct  11    FSIFLYNLSQTPRRLRERAGATCSSDEELTEIRQRSGADMKRKLEWYDLVALGIGGMLGS  70

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG VA   +GPS+FISY+VAG++ALLSSLCYTEFSVE+PVAGGAFSYLRITFGEF
Sbjct  71    GVFVTTGTVALNVSGPSIFISYMVAGIAALLSSLCYTEFSVEMPVAGGAFSYLRITFGEF  130

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             VGYF GAN+LM+YVLSNA V+RSFTEYL   +G  +P+ WR++V  L  GYNMLDF AV 
Sbjct  131   VGYFGGANLLMEYVLSNAVVARSFTEYLCSTIGVTDPNAWRIEVAFLPNGYNMLDFTAVG  190

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             LI+LLTI LC+STKESSLLNLVMT+FHV F GF+ I GF  GS  NLVK   GLAP+G++
Sbjct  191   LIVLLTICLCYSTKESSLLNLVMTVFHVAFVGFVTIVGFSNGSVKNLVKP-KGLAPYGIK  249

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV DGAAIVY SYIGYDSVSTMAEEI NPSKSLPVGI GSV IVS LYCLM L+L  ++P
Sbjct  250   GVFDGAAIVYISYIGYDSVSTMAEEIRNPSKSLPVGIAGSVAIVSILYCLMTLALSTMVP  309

Query  1119  YNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVP  943
             YN I     FS+AFK ++GW+WA NVVG GASLGI+ SLLVAMLGQARY+CVVGRA LVP
Sbjct  310   YNEIIATAPFSSAFKRIVGWQWAGNVVGAGASLGIITSLLVAMLGQARYMCVVGRAHLVP  369

Query  942   SWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrry  763
              W A+V+ STGTP+N+T+ LG+C A +ALF  L  ++E+ISIG L+VFY+VA ALIYRRY
Sbjct  370   LWFARVNQSTGTPVNSTLSLGMCTAFIALFAGLDQILEMISIGALLVFYMVANALIYRRY  429

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVR  583
                  + P   LLFL ++S+ S GF++ WKL   WW L +FG   +S  A+F  LV  V 
Sbjct  430   VRPGFSRPLPTLLFLVILSAISCGFAIQWKLERGWWELGMFGLAYISMIAIFQGLVTPVY  489

Query  582   RPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             RP  W VPLMPWPA+ SIFLNVFL+ TL  ++Y+RFGIW+ ++ LFY++Y VHSTY 
Sbjct  490   RPAKWRVPLMPWPASASIFLNVFLLGTLRRRSYQRFGIWSLVVCLFYLLYSVHSTYN  546



>ref|XP_004978161.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Setaria italica]
Length=560

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/541 (68%), Positives = 447/541 (83%), Gaps = 15/541 (3%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QE+N+VR RSGA MKR+L WYDLVALGVGGMLG GVFV
Sbjct  7     LLSIAQTPHRLRRRALVTWTPAQEMNEVRDRSGARMKRRLEWYDLVALGVGGMLGAGVFV  66

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYF  1648
             TTG VAR TAG +VF SY++AG+SALLSS CY EFSV  PVAGGAFSYLR+TFGEFVG+F
Sbjct  67    TTGRVARDTAGAAVFASYVIAGVSALLSSFCYAEFSVRFPVAGGAFSYLRVTFGEFVGFF  126

Query  1647  AGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliil  1468
              GANILM+YVLSNAAV+RSFT+YL+   G   P+ WR+ VDGL EGYN LD PAVALI++
Sbjct  127   GGANILMEYVLSNAAVARSFTDYLASTFGVTEPNAWRIVVDGLAEGYNALDVPAVALILI  186

Query  1467  ltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLD  1288
             +TI LC+STKESS+LN+V+T+FH++FF FII+AG + GS+ NLV+   GLAP+GVRGVLD
Sbjct  187   ITICLCYSTKESSMLNMVLTVFHLLFFAFIIVAGLWNGSAGNLVRP-HGLAPYGVRGVLD  245

Query  1287  GAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLI  1108
             GAAIVYFSYIGYDS STMAEEI +P+++LPVGI GSVL+VSALYCLM+L+LC +LPYN I
Sbjct  246   GAAIVYFSYIGYDSASTMAEEIRDPARALPVGIAGSVLVVSALYCLMSLTLCAMLPYNEI  305

Query  1107  PEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
              E   FS+AF+  +GW+WAS+VVG GASLGIVASLLVAMLGQARYLCV+ RARLVPSWLA
Sbjct  306   SETAPFSSAFREKVGWRWASSVVGAGASLGIVASLLVAMLGQARYLCVIARARLVPSWLA  365

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KVHPSTGTP+NATIFLG C AS+ALFTEL+ V E+ISIGTL+VFYLVA ALIY RY  + 
Sbjct  366   KVHPSTGTPMNATIFLGFCTASLALFTELQTVFEMISIGTLLVFYLVANALIYHRYVKVG  425

Query  750   GNPPFQvllflflvsssslgfslSWKLNLQW--WNLPLFGFLTLSFTALFHRLVPCVRR-  580
              N P  VLLF+ L++ SSLGFS+S K++  W  W + LFG ++++ T +FH    C  R 
Sbjct  426   VNRPLHVLLFMLLLTLSSLGFSISRKID-GWCRWGMTLFGAISIAITTIFH----CTARQ  480

Query  579   -----PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
                  P  WSVPLMPWPAA S+FLNVFL+TTL +++Y+RFGIW+ ++ +FYV YGVHSTY
Sbjct  481   DVAGPPSEWSVPLMPWPAAASVFLNVFLITTLKMRSYQRFGIWSLVIIVFYVCYGVHSTY  540

Query  414   K  412
              
Sbjct  541   S  541



>gb|EAY95030.1| hypothetical protein OsI_16839 [Oryza sativa Indica Group]
Length=591

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/569 (64%), Positives = 444/569 (78%), Gaps = 41/569 (7%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QE ++VR RSGA MKR+L WYDLV LGVGGMLG GVFV
Sbjct  8     LLSIAQTPHRLRRRALVTWTPAQETSEVRDRSGARMKRRLEWYDLVGLGVGGMLGAGVFV  67

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYF  1648
             TTG VAR TAGP+VF SY++AG+SALLSS CY EFSV VP AGGAFSYLR+TFGE VG+F
Sbjct  68    TTGRVARDTAGPAVFASYVIAGVSALLSSFCYAEFSVRVPAAGGAFSYLRVTFGELVGFF  127

Query  1647  AGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliil  1468
              GANILM+YVLSNAAV+RSFT+YL+   G   PD WR++VDG+ +GYN LDFPAVALI++
Sbjct  128   GGANILMEYVLSNAAVARSFTDYLASTCGITEPDAWRIQVDGIAKGYNALDFPAVALILV  187

Query  1467  ltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLD  1288
             LT+ LC+STKES++LN+V+T+FH++FF FII+AG + GS+ NLV S  GLAP+GVRGVLD
Sbjct  188   LTLCLCYSTKESAMLNMVITVFHLLFFVFIILAGLWNGSARNLV-SPHGLAPYGVRGVLD  246

Query  1287  GAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLI  1108
             GAAIVYFSYIGYDS STMAEEI +P+++LPVGI GSVL+VSALYCLM+L+LC +LPY  I
Sbjct  247   GAAIVYFSYIGYDSASTMAEEIRDPARALPVGIAGSVLVVSALYCLMSLALCAMLPYTEI  306

Query  1107  PEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
              E   FSA F+   GW+WA +VVG GASLGIVASLLVAMLGQARYLCV+ RARLVP+WLA
Sbjct  307   AESAPFSAVFREKAGWEWAGSVVGAGASLGIVASLLVAMLGQARYLCVIARARLVPAWLA  366

Query  930   KVHPSTGTPLNATIFL------------------------------GICQASVALFTELK  841
             KVHPSTGTP+NATIFL                              G+C AS+ALFTEL+
Sbjct  367   KVHPSTGTPMNATIFLDRANGSIKYTNNFTEVKVLTTVSDHENCNAGLCTASIALFTELQ  426

Query  840   IVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQ  661
             +V E+ISIGTL+VFYLVA ALIY RYA +  N    VLLFL L++ SSLGFSLS +++ Q
Sbjct  427   VVFEMISIGTLLVFYLVANALIYHRYAKLGANRSLHVLLFLLLLTLSSLGFSLSRRIHGQ  486

Query  660   W-WNLPLFGFLTLSFTALFHRLVPCVRR-----PESWSVPLMPWPAALSIFLNVFLMTTL  499
               W + LFG  +++ TA+FH     VRR     P  W VPLMPWPAA S+FLNVFLMTTL
Sbjct  487   CRWGMALFGATSVTITAMFH---CAVRRDMPEPPSEWMVPLMPWPAAASVFLNVFLMTTL  543

Query  498   NVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              V +++RFG+W+ ++ +FYV YGVHSTY 
Sbjct  544   KVMSFQRFGLWSFVIIVFYVCYGVHSTYS  572



>ref|XP_008663435.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
isoform X2 [Zea mays]
Length=560

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/541 (67%), Positives = 443/541 (82%), Gaps = 15/541 (3%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QELN+VR RSGA MKR+L WYDLV LGVGGMLG GVFV
Sbjct  7     LLSIAQTPHRLRRRALVTWTPTQELNEVRDRSGARMKRRLEWYDLVGLGVGGMLGAGVFV  66

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYF  1648
             TTG VAR TAGP+VF SY+VAG+SALLSSLCY EFSV VPVAGGAFSYLR+TFGEFVG+F
Sbjct  67    TTGRVARDTAGPAVFASYVVAGVSALLSSLCYAEFSVRVPVAGGAFSYLRVTFGEFVGFF  126

Query  1647  AGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliil  1468
              GANILM+YVLSNAAV+RSFT+YL+   G    + WR+ VDG+ +GYN LD PAVALI+L
Sbjct  127   GGANILMEYVLSNAAVARSFTDYLASTFGVTERNAWRIVVDGIADGYNELDVPAVALILL  186

Query  1467  ltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLD  1288
             +T+ LC+STKESS+LN+V+T+FH++FF FI+ AG + GS+ NLV+   GLAP+GVRGVLD
Sbjct  187   ITVCLCYSTKESSMLNMVLTVFHLLFFAFIVAAGLWNGSARNLVRP-HGLAPYGVRGVLD  245

Query  1287  GAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLI  1108
             GAA+VYFSYIGYDS  TMAEEI +PS++LPVGI GSVL+VS LYCLM+++LC++LPY  I
Sbjct  246   GAAVVYFSYIGYDSACTMAEEIRDPSRALPVGIAGSVLVVSGLYCLMSVALCVMLPYTEI  305

Query  1107  PEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
              E   FS+AF+  +GW+WAS+VVG GAS+GIVASL+VAMLGQARYLCV+ RARLVP W A
Sbjct  306   SEAAPFSSAFREKVGWRWASSVVGAGASIGIVASLMVAMLGQARYLCVIARARLVPLWFA  365

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KVHPSTGTP+NATIFLG C AS+ALFTEL+IV E+ISIGTL+VFYLVA ALIY RY  + 
Sbjct  366   KVHPSTGTPMNATIFLGFCTASLALFTELQIVFEMISIGTLLVFYLVANALIYHRYVKVG  425

Query  750   GNPPFQvllflflvsssslgfslSWKLNLQW--WNLPLFGFLTLSFTALFHRLVPCVRRP  577
              N P  VLLFL L++ SSLGFSLS K++  W  W + LFG ++++ T +FH    C  R 
Sbjct  426   TNRPLHVLLFLLLLTLSSLGFSLSRKID-GWCQWGMTLFGAVSIAITTIFH----CTARQ  480

Query  576   E------SWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             +       WSVPLMPWPAA S+FLNVFL+TTL V++Y+RFGIW+ +  +FYV YGVHSTY
Sbjct  481   DIAGPSLEWSVPLMPWPAAASVFLNVFLITTLKVRSYQRFGIWSLVTIVFYVCYGVHSTY  540

Query  414   K  412
              
Sbjct  541   S  541



>ref|XP_010540809.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Tarenaya hassleriana]
Length=577

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/537 (68%), Positives = 440/537 (82%), Gaps = 2/537 (0%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + YL+SLSQTP +LK R LATWTPDQELN+VRLRSG DMKR+L W DL+ALGVGGMLGVG
Sbjct  9     AKYLHSLSQTPHRLKARMLATWTPDQELNQVRLRSGPDMKRRLRWLDLMALGVGGMLGVG  68

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVAR+ +GP+VFISYI AG SALLSSLCY EFSV VPVAGGAFSYLR+TFGEFV
Sbjct  69    VFVTTGPVAREISGPAVFISYIFAGFSALLSSLCYAEFSVSVPVAGGAFSYLRVTFGEFV  128

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GY  GANIL++YVLSNAAV+RSFTEY+  A G  +P+ WRV+V+GL  GYN LDFPA+AL
Sbjct  129   GYLGGANILLEYVLSNAAVARSFTEYMCTAFGGSDPNKWRVRVEGLESGYNELDFPALAL  188

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++LLT+ LC+STKESS+LNLVMT+FHV FFGF+II GF +G     +    GLAP+GVRG
Sbjct  189   VLLLTLCLCYSTKESSMLNLVMTVFHVAFFGFVIIGGFREGGGAKALVEPDGLAPYGVRG  248

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +++GAA+VYFSYIGYD+VST+AEEI +PS SLP+GIVGSV+ VSALY LMALSLCL++PY
Sbjct  249   IVNGAAVVYFSYIGYDTVSTLAEEIHDPSFSLPIGIVGSVISVSALYSLMALSLCLMVPY  308

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I ++ S++ AF+ +GW W  NVVGVGAS+GIVASLLVAM+GQARYLCV  RARLVPS 
Sbjct  309   NEISKKASYAVAFRKIGWGWGGNVVGVGASVGIVASLLVAMMGQARYLCVXXRARLVPSC  368

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             L+ VHPSTGTPLNAT+FLG+C AS+ALFT+L+IV+E+IS+GTL VFYLVA ALIYR+Y I
Sbjct  369   LSTVHPSTGTPLNATLFLGLCTASIALFTDLEIVMELISLGTLCVFYLVANALIYRKYTI  428

Query  756   INGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLF--GFLTLSFTALFHRLVPCVR  583
                N PF  L FL L+S S++ FS+ WKLN QWW L LF    +  +    +H       
Sbjct  429   TAQNAPFHTLSFLALLSLSAIAFSVWWKLNKQWWGLTLFPAIAIAATAFFQYHASRSPTP  488

Query  582   RPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              P +WSVPLMPWPAA+S FLNVFLMTTL   +++RF IWT L++LFY +YGVH TY+
Sbjct  489   NPGAWSVPLMPWPAAISAFLNVFLMTTLKPLSFQRFAIWTSLITLFYALYGVHRTYE  545



>ref|XP_008663436.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
isoform X3 [Zea mays]
Length=525

 Score =   536 bits (1382),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 349/525 (66%), Positives = 424/525 (81%), Gaps = 22/525 (4%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QELN+VR RSGA MKR+L WYDLV LGVGGMLG GVFV
Sbjct  7     LLSIAQTPHRLRRRALVTWTPTQELNEVRDRSGARMKRRLEWYDLVGLGVGGMLGAGVFV  66

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITF------G  1666
             TTG VAR TAGP+VF SY+VAG+SALLSSLCY EFSV VPVAGGAFSYLR+TF      G
Sbjct  67    TTGRVARDTAGPAVFASYVVAGVSALLSSLCYAEFSVRVPVAGGAFSYLRVTFASYILSG  126

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             EFVG+F GANILM+YVLSNAAV+RSFT+YL+   G    + WR+ VDG+ +GYN LD PA
Sbjct  127   EFVGFFGGANILMEYVLSNAAVARSFTDYLASTFGVTERNAWRIVVDGIADGYNELDVPA  186

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             VALI+L+T+ LC+STKESS+LN+V+T+FH++FF FI+ AG + GS+ NLV+  G LAP+G
Sbjct  187   VALILLITVCLCYSTKESSMLNMVLTVFHLLFFAFIVAAGLWNGSARNLVRPHG-LAPYG  245

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             VRGVLDGAA+VYFSYIGYDS  TMAEEI +PS++LPVGI GSVL+VS LYCLM+++LC++
Sbjct  246   VRGVLDGAAVVYFSYIGYDSACTMAEEIRDPSRALPVGIAGSVLVVSGLYCLMSVALCVM  305

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY  I E   FS+AF+  +GW+WAS+VVG GAS+GIVASL+VAMLGQARYLCV+ RARL
Sbjct  306   LPYTEISEAAPFSSAFREKVGWRWASSVVGAGASIGIVASLMVAMLGQARYLCVIARARL  365

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP W AKVHPSTGTP+NATIFLG C AS+ALFTEL+IV E+ISIGTL+VFYLVA ALIY 
Sbjct  366   VPLWFAKVHPSTGTPMNATIFLGFCTASLALFTELQIVFEMISIGTLLVFYLVANALIYH  425

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQW--WNLPLFGFLTLSFTALFHRLV  595
             RY  +  N P  VLLFL L++ SSLGFSLS K++  W  W + LFG ++++ T +FH   
Sbjct  426   RYVKVGTNRPLHVLLFLLLLTLSSLGFSLSRKID-GWCQWGMTLFGAVSIAITTIFH---  481

Query  594   PCVRRPE------SWSVPLMPWPAALSIFLNVFLMTTL-NVKAYK  481
              C  R +       WSVPLMPWPAA S+FLNVFL+TTL  +K ++
Sbjct  482   -CTARQDIAGPSLEWSVPLMPWPAAASVFLNVFLITTLKEIKLFR  525



>ref|XP_003581477.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Brachypodium distachyon]
Length=561

 Score =   535 bits (1377),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 362/536 (68%), Positives = 440/536 (82%), Gaps = 6/536 (1%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S +QTP +L++RAL T TP QELN+VR RSG  M R+L WYDLV +GVGGMLG GVFV
Sbjct  7     LLSAAQTPHRLRRRALVTPTPAQELNEVRDRSGPRMARRLEWYDLVGIGVGGMLGAGVFV  66

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYF  1648
             TTG VAR TAGP+VF SY VAG+SALLSS CY EF+  VPVAGGAFSYLR+TFGEFVG+F
Sbjct  67    TTGRVARDTAGPAVFASYAVAGVSALLSSFCYAEFAARVPVAGGAFSYLRVTFGEFVGFF  126

Query  1647  AGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliil  1468
              GANILM+YVLSNAAV+RSFT+YL+   G   P+ WR++V G+ EGYN LDFPAVALI+L
Sbjct  127   GGANILMEYVLSNAAVARSFTDYLASTCGVTEPNAWRIQVAGIAEGYNALDFPAVALILL  186

Query  1467  ltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLD  1288
             LTI LC+STKESS+LN+V+T FH++FFGFI++AGF+ G + NLV+   GLAP+GV GVLD
Sbjct  187   LTICLCYSTKESSMLNMVLTGFHLLFFGFIVVAGFWNGKARNLVRP-HGLAPYGVGGVLD  245

Query  1287  GAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLI  1108
             GAA+VYFSYIGYDS STMAEEI +P+ +LPVGI GSVL+VSALYCLM+L+LC +LPY  I
Sbjct  246   GAAVVYFSYIGYDSASTMAEEIRDPACALPVGIAGSVLLVSALYCLMSLALCTMLPYTEI  305

Query  1107  PEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
              E   FS+AF+  +GWKWAS VVG GAS+GIVASLLVAMLGQARYLCV+ RARLVP+ LA
Sbjct  306   AESAPFSSAFREKVGWKWASGVVGAGASIGIVASLLVAMLGQARYLCVIARARLVPACLA  365

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KVHPSTGTP+NAT+FLG C AS+ALFTEL+IV E+ISIGTL+ FYLVA ALIY RY  + 
Sbjct  366   KVHPSTGTPMNATVFLGFCTASIALFTELQIVFEMISIGTLLAFYLVANALIYHRYVKLG  425

Query  750   GNPPFQvllflflvsssslgfslSWKLNLQW-WNLPLFGFLTLSFTALFHRLVPC-VRRP  577
              N P  VL+FL L++ SSLGFSLS +++ +W W + LFG + ++ T +FH      V  P
Sbjct  426   TNRPLYVLIFLLLLTLSSLGFSLSRRIDGRWRWGMALFGAICVAVTVIFHYTTQQDVAGP  485

Query  576   --ESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
               ESW+VPLMPWPAA S+FLNVFLMTTL +++++RFGIW+ ++++FYV YGVHSTY
Sbjct  486   SSESWTVPLMPWPAAASVFLNVFLMTTLKLRSFQRFGIWSLVITIFYVCYGVHSTY  541



>ref|XP_002448255.1| hypothetical protein SORBIDRAFT_06g024120 [Sorghum bicolor]
 gb|EES12583.1| hypothetical protein SORBIDRAFT_06g024120 [Sorghum bicolor]
Length=576

 Score =   531 bits (1369),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 361/562 (64%), Positives = 438/562 (78%), Gaps = 41/562 (7%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QELN+VR RSG  MKR+L WYDLV LGVGGMLG GVFV
Sbjct  7     LLSIAQTPHRLRRRALVTWTPAQELNEVRDRSGPRMKRRLEWYDLVGLGVGGMLGAGVFV  66

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYF  1648
             TTG VAR TAGP+VF+SY++AG+SALLSS CY EFSV VPVAGGAFSYLR+TFGEFVG+F
Sbjct  67    TTGRVARDTAGPAVFVSYVIAGVSALLSSFCYAEFSVRVPVAGGAFSYLRVTFGEFVGFF  126

Query  1647  AGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliil  1468
              GANILM+YVLSNAAV+RSFT+YL+   G    + WR+ VDG+ +GYN LD PAV LI+L
Sbjct  127   GGANILMEYVLSNAAVARSFTDYLASTFGVTEHNAWRIVVDGIADGYNALDVPAVGLILL  186

Query  1467  ltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLD  1288
             +T+ LC+STKESS+LN+V+T+FH++FF FII AG + GS+ NLV+   GLAP+GV GVLD
Sbjct  187   ITVCLCYSTKESSMLNMVLTVFHLLFFAFIIAAGLWNGSARNLVRP-HGLAPYGVAGVLD  245

Query  1287  GAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL-  1111
             GAAIVYFSYIGYDS  TMAEEI  PS++LPVGI GSVL+VSALYCLM+++LC++LPY   
Sbjct  246   GAAIVYFSYIGYDSACTMAEEIREPSRALPVGIAGSVLVVSALYCLMSVALCVMLPYTEV  305

Query  1110  --------------------IPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAM  994
                                 I E   FS+AF+  +GW+WAS+VVG GAS+GIVASLLVAM
Sbjct  306   TMHAYAGGVARSRSRPVARSISEAAPFSSAFREKVGWRWASSVVGAGASIGIVASLLVAM  365

Query  993   LGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIG  814
             LGQARYLCV+ RARLVP W AKVHPSTGTP+NATIFL +     ALFTEL+IV E+ISIG
Sbjct  366   LGQARYLCVIARARLVPLWFAKVHPSTGTPMNATIFLAL-----ALFTELQIVFEMISIG  420

Query  813   TLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQW--WNLPLF  640
             TL+VFYLVA ALIY RY  I  N P  VLLFL L++ SSLGFSLS K++ +W  W + LF
Sbjct  421   TLLVFYLVANALIYHRYVKIGTNRPLHVLLFLLLLTLSSLGFSLSRKID-EWCRWGMALF  479

Query  639   GFLTLSFTALFHRLVPCVRR------PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKR  478
             G ++++ T +FH    C  R      P  WSVPLMPWPAA S+FLNVFL+TTL V++++R
Sbjct  480   GAISIAITTIFH----CTARQDITGPPLEWSVPLMPWPAAASVFLNVFLITTLKVRSFQR  535

Query  477   FGIWTGLMSLFYVVYGVHSTYK  412
             FGIW+ ++ +FYV YGVHSTY 
Sbjct  536   FGIWSLVIIVFYVCYGVHSTYS  557



>gb|KFK26763.1| hypothetical protein AALP_AA8G290600 [Arabis alpina]
Length=441

 Score =   518 bits (1335),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 301/404 (75%), Positives = 356/404 (88%), Gaps = 0/404 (0%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  SLSQTP +LK R LATWTPDQELN+VRLRSGADMKRKL W+DLV+LGVGGMLGVGVF
Sbjct  4     YFRSLSQTPHRLKSRMLATWTPDQELNQVRLRSGADMKRKLRWFDLVSLGVGGMLGVGVF  63

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTGPVAR  +GP+VFISY+VAG SALLSSLCYTEFSV VPVAGGAFSYLR+TFGEF+GY
Sbjct  64    VTTGPVARDVSGPAVFISYMVAGFSALLSSLCYTEFSVNVPVAGGAFSYLRVTFGEFIGY  123

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GANIL++YVLSNAAV+RSFTEY+  A+G  +P+ WR+KV+GL +GYN LDFPAVAL++
Sbjct  124   FGGANILLEYVLSNAAVARSFTEYMCTAIGVSDPNAWRIKVNGLEKGYNELDFPAVALVL  183

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             LLT+ LC STKESS+LNLVMT+ H++FFGF+IIAGFY G     +    GL P+GVRGV+
Sbjct  184   LLTLCLCRSTKESSMLNLVMTVSHIIFFGFVIIAGFYHGDGPKALVEPRGLTPYGVRGVV  243

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
             +GAA+VYFSYIGYD+VST+AEEI NPS SLPVGI+GSV +V+ LYCLM+L LC+++PYN 
Sbjct  244   NGAAVVYFSYIGYDTVSTLAEEIQNPSFSLPVGIIGSVSVVTVLYCLMSLVLCVMVPYNE  303

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I +  S++ AF+ +GW WA NVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSWLA
Sbjct  304   ISKSASYAVAFRRVGWGWAGNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSWLA  363

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVF  799
             KVHPSTGTPLNAT+FLG+C AS+ALFT+L+IV+E+IS+GTL VF
Sbjct  364   KVHPSTGTPLNATLFLGLCTASIALFTDLEIVMELISLGTLCVF  407



>gb|KEH31610.1| cationic amino acid transporter [Medicago truncatula]
Length=398

 Score =   503 bits (1296),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 300/386 (78%), Positives = 342/386 (89%), Gaps = 4/386 (1%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
              S Y  SLSQTP +L+KR LATWTPDQE N+VR RSGADMKRKL WYDL+ALGVGGMLGV
Sbjct  4     LSNYFYSLSQTPHRLRKRMLATWTPDQEFNQVRQRSGADMKRKLNWYDLIALGVGGMLGV  63

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTGPVA   +GPSVFISYI+AG+SALLSSLCYTEF+V+VPVAGGAFSYLR+TFGEF
Sbjct  64    GVFVTTGPVALHQSGPSVFISYIIAGISALLSSLCYTEFAVQVPVAGGAFSYLRLTFGEF  123

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             +GYF GANILM+YV SNAAV+RSFTEYLS+A GE NP+ WRV+V GL + YNMLDFPAVA
Sbjct  124   LGYFGGANILMEYVFSNAAVARSFTEYLSFAFGENNPNVWRVEVHGLPKDYNMLDFPAVA  183

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             LI+LLT+ LCHSTKESS+LNL+MT+FHV+FFGFII+AG+Y GS+ NLV   G +AP+GVR
Sbjct  184   LILLLTLCLCHSTKESSILNLIMTVFHVIFFGFIIVAGYYNGSTKNLVNPKG-IAPYGVR  242

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GVLDGAAIVYFSYIGYDS STMAEE+ +P KSLP+GIVGSVLI + LYCLMALSLC+++P
Sbjct  243   GVLDGAAIVYFSYIGYDSASTMAEEVKDPYKSLPIGIVGSVLITTLLYCLMALSLCIMVP  302

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             YN I ++ S+S AF  +GW WASN+VG GASLGIVASLLVAMLGQARYLCV+GRARLVPS
Sbjct  303   YNKISDKASYSMAFLKIGWSWASNIVGAGASLGIVASLLVAMLGQARYLCVMGRARLVPS  362

Query  939   WLAKVHPSTGTPLNATIFLG---ICQ  871
             WLAKVHPSTGTPLNATIFLG   +C 
Sbjct  363   WLAKVHPSTGTPLNATIFLGKQIVCH  388



>ref|XP_002975704.1| hypothetical protein SELMODRAFT_103397 [Selaginella moellendorffii]
 gb|EFJ23333.1| hypothetical protein SELMODRAFT_103397 [Selaginella moellendorffii]
Length=604

 Score =   498 bits (1283),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 313/543 (58%), Positives = 418/543 (77%), Gaps = 11/543 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + YL+++S+T  +LK+R  A+WTP +E+N+VR RSGA+M+RKL WYDL+A+G+GGMLG G
Sbjct  12    TAYLSAMSKTHSRLKQRMAASWTPSEEMNEVRSRSGAEMRRKLKWYDLIAMGMGGMLGAG  71

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FVTTG  A+  AGPS+ ++YIVAG+SALLS+ CYTEF+VE+PVAGGAFSYLRITFGEF 
Sbjct  72    IFVTTGTAAKSFAGPSIVLAYIVAGISALLSAFCYTEFAVEMPVAGGAFSYLRITFGEFA  131

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +F GAN+LM+YVLSNAAV+RSFT Y S   G      WR++V  +   YNMLDFPAVAL
Sbjct  132   AFFTGANLLMEYVLSNAAVARSFTAYFSAIFGVA---AWRIEVTAIHSKYNMLDFPAVAL  188

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAP  1312
             +I++TI LC+STK+SS+ N+VMTI HV+F  FII+AGF KG   N    G     GG  P
Sbjct  189   LIIITIFLCYSTKDSSIFNMVMTIAHVLFILFIIVAGFVKGDVKNFTTPGHPSSEGGFFP  248

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNP-SKSLPVGIVGSVLIVsalyclmalsl  1135
             +GVRGVL+GAAIVYFSYIGYD+VST+AEE+  P  K++P+G+ GSV IVS LYCLMA S+
Sbjct  249   YGVRGVLNGAAIVYFSYIGYDAVSTLAEEVEEPVKKNIPIGVSGSVAIVSVLYCLMAASM  308

Query  1134  cllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
              +L+PY++I  + S+  AFK +GW WA+ +V VGASLGI  SLLVAMLGQARYLCV+GR+
Sbjct  309   SMLVPYDMIDADASYPMAFKKVGWDWAAKIVSVGASLGIFTSLLVAMLGQARYLCVIGRS  368

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              ++P W AKV+PSTGTP+NAT+FLG+  ++++LFT+L+I++ +ISIGTL VFY+VA ALI
Sbjct  369   NVIPYWFAKVNPSTGTPINATVFLGVVTSAISLFTDLEILLNMISIGTLFVFYMVANALI  428

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKLNLQ--WWNLPLFGFLTLSFTALFHR  601
             +RR+ +   + P+  L+FL L S S++GF   W LN    WW L  FG L +  T +F  
Sbjct  429   FRRHVVRKISSPWPTLVFLVLFSGSAIGFVTFWNLNRNDLWWGLVFFGVLCVLLTMIFWW  488

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP   +P  W  PLMPW AA+SIFLNVFL+ +++ ++Y+RFG+W+ ++ +FYVVY VH+
Sbjct  489   KVPQAHKPADWGAPLMPWLAAVSIFLNVFLLGSVDWQSYRRFGLWSIVVVIFYVVYSVHA  548

Query  420   TYK  412
             ++ 
Sbjct  549   SFD  551



>ref|XP_002973649.1| hypothetical protein SELMODRAFT_173423 [Selaginella moellendorffii]
 gb|EFJ25309.1| hypothetical protein SELMODRAFT_173423 [Selaginella moellendorffii]
Length=604

 Score =   498 bits (1281),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 311/543 (57%), Positives = 418/543 (77%), Gaps = 11/543 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + YL+++S+T  +LK+R  A+WTP +E+N+VR RSGA+M+RKL WYDL+A+G+GGMLG G
Sbjct  12    TAYLSAISKTHSRLKQRMAASWTPSEEMNEVRSRSGAEMRRKLKWYDLIAMGMGGMLGAG  71

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FVTTG  A+  AGPS+ ++YIVAG+SALLS+ CYTEF+VE+PVAGGAFSYLRITFGEF 
Sbjct  72    IFVTTGTAAKSFAGPSIVLAYIVAGISALLSAFCYTEFAVEMPVAGGAFSYLRITFGEFA  131

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +F GAN+LM+YVLSNAAV+RSFT Y S   G      WR++V  +   YNMLDFPAVAL
Sbjct  132   AFFTGANLLMEYVLSNAAVARSFTAYFSAIFGVA---AWRIEVTAIHSKYNMLDFPAVAL  188

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAP  1312
             +I++TI LC+STK+SS+ N+VMT+ HV+F  FII+AGF KG   N    G     GG  P
Sbjct  189   LIIITIFLCYSTKDSSIFNMVMTVAHVLFILFIIVAGFVKGDVKNFTTPGHPSSEGGFFP  248

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNP-SKSLPVGIVGSVLIVsalyclmalsl  1135
             +GVRGVL+GAAIVYFSYIGYD+VST+AEE+  P  K++P+G+ GSV IVS LYCLMA S+
Sbjct  249   YGVRGVLNGAAIVYFSYIGYDAVSTLAEEVEEPVKKNIPIGVSGSVAIVSVLYCLMAASM  308

Query  1134  cllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
              +L+PY++I  + S+  AF+ +GW WA+ +V VGASLGI  SLLVAMLGQARYLCV+GR+
Sbjct  309   SMLVPYDMIDADASYPMAFRKVGWDWAAKIVSVGASLGIFTSLLVAMLGQARYLCVIGRS  368

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              ++P W AKV+PSTGTP+NAT+FLG+  ++++LFT+L+I++ +ISIGTL VFY+VA ALI
Sbjct  369   NVIPYWFAKVNPSTGTPINATVFLGVVTSAISLFTDLEILLNMISIGTLFVFYMVANALI  428

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKLNLQ--WWNLPLFGFLTLSFTALFHR  601
             +RR+ +   + P+  L+FL L S S++GF   W LN    WW L  FG L +  T +F  
Sbjct  429   FRRHVVRKISSPWPTLVFLALFSGSAIGFVTFWNLNRNDLWWGLVFFGVLCVLLTMIFWW  488

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP   +P  W  PLMPW AA+SIFLNVFL+ +++ ++Y+RFG+W+ ++ +FYVVY VH+
Sbjct  489   KVPQAHKPADWGAPLMPWLAAVSIFLNVFLLGSVDWQSYRRFGLWSIVVVIFYVVYSVHA  548

Query  420   TYK  412
             ++ 
Sbjct  549   SFD  551



>ref|XP_008663437.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
isoform X4 [Zea mays]
Length=453

 Score =   491 bits (1265),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 290/410 (71%), Positives = 348/410 (85%), Gaps = 8/410 (2%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QELN+VR RSGA MKR+L WYDLV LGVGGMLG GVFV
Sbjct  7     LLSIAQTPHRLRRRALVTWTPTQELNEVRDRSGARMKRRLEWYDLVGLGVGGMLGAGVFV  66

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITF------G  1666
             TTG VAR TAGP+VF SY+VAG+SALLSSLCY EFSV VPVAGGAFSYLR+TF      G
Sbjct  67    TTGRVARDTAGPAVFASYVVAGVSALLSSLCYAEFSVRVPVAGGAFSYLRVTFASYILSG  126

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             EFVG+F GANILM+YVLSNAAV+RSFT+YL+   G    + WR+ VDG+ +GYN LD PA
Sbjct  127   EFVGFFGGANILMEYVLSNAAVARSFTDYLASTFGVTERNAWRIVVDGIADGYNELDVPA  186

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             VALI+L+T+ LC+STKESS+LN+V+T+FH++FF FI+ AG + GS+ NLV+  G LAP+G
Sbjct  187   VALILLITVCLCYSTKESSMLNMVLTVFHLLFFAFIVAAGLWNGSARNLVRPHG-LAPYG  245

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             VRGVLDGAA+VYFSYIGYDS  TMAEEI +PS++LPVGI GSVL+VS LYCLM+++LC++
Sbjct  246   VRGVLDGAAVVYFSYIGYDSACTMAEEIRDPSRALPVGIAGSVLVVSGLYCLMSVALCVM  305

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY  I E   FS+AF+  +GW+WAS+VVG GAS+GIVASL+VAMLGQARYLCV+ RARL
Sbjct  306   LPYTEISEAAPFSSAFREKVGWRWASSVVGAGASIGIVASLMVAMLGQARYLCVIARARL  365

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVF  799
             VP W AKVHPSTGTP+NATIFLG C AS+ALFTEL+IV E+ISIGTL+VF
Sbjct  366   VPLWFAKVHPSTGTPMNATIFLGFCTASLALFTELQIVFEMISIGTLLVF  415



>gb|EAZ31508.1| hypothetical protein OsJ_15645 [Oryza sativa Japonica Group]
Length=571

 Score =   494 bits (1271),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 342/569 (60%), Positives = 418/569 (73%), Gaps = 61/569 (11%)
 Frame = -2

Query  2007  LNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfV  1828
             L S++QTP +L++RAL TWTP QE ++VR RSGA MKR+L WYDLV LGVGGMLG GVFV
Sbjct  8     LLSIAQTPHRLRRRALVTWTPAQETSEVRDRSGARMKRRLEWYDLVGLGVGGMLGAGVFV  67

Query  1827  TTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYF  1648
             TTG VAR TAGP+VF SY++A                    A    S    T  E VG+F
Sbjct  68    TTGRVARDTAGPAVFASYVIA--------------------ASPRSSPPSATPSELVGFF  107

Query  1647  AGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliil  1468
              GANILM+YVLSNAAV+RSFT+YL+   G   PD WR++VDG+ +GYN LDFPAVALI++
Sbjct  108   GGANILMEYVLSNAAVARSFTDYLASTCGITEPDAWRIQVDGIAKGYNALDFPAVALILV  167

Query  1467  ltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLD  1288
             LT+ LC+STKES++LN+V+T+FH++FF FII+AG + GS+ NLV S  GLAP+GVRGVLD
Sbjct  168   LTLCLCYSTKESAMLNMVITVFHLLFFVFIILAGLWNGSARNLV-SPHGLAPYGVRGVLD  226

Query  1287  GAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLI  1108
             GAAIVYFSYIGYDS STMAEEI +P+++LPVGI GSVL+VSALYCLM+L+LC +LPY  I
Sbjct  227   GAAIVYFSYIGYDSASTMAEEIRDPARALPVGIAGSVLVVSALYCLMSLALCAMLPYTEI  286

Query  1107  PEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
              E   FSA F+   GW+WA +VVG GASLGIVASLLVAMLGQARYLCV+ RARLVP+WLA
Sbjct  287   AESAPFSAVFREKAGWEWAGSVVGAGASLGIVASLLVAMLGQARYLCVIARARLVPAWLA  346

Query  930   KVHPSTGTPLNATIFL------------------------------GICQASVALFTELK  841
             KVHPSTGTP+NATIFL                              G+C AS+ALFTEL+
Sbjct  347   KVHPSTGTPMNATIFLDRANGSIKYTNNFTEVKVLTTVSDHENCNAGLCTASIALFTELQ  406

Query  840   IVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQ  661
             +V E+ISIGTL+VFYLVA ALIY RYA +  N    VLLFL +++ SSLGFSLS +++ Q
Sbjct  407   VVFEMISIGTLLVFYLVANALIYHRYAKLGANRSLHVLLFLLILTLSSLGFSLSRRIHGQ  466

Query  660   W-WNLPLFGFLTLSFTALFHRLVPCVRR-----PESWSVPLMPWPAALSIFLNVFLMTTL  499
               W + LFG  +++ TA+FH     VRR     P  W VPLMPWPAA S+FLNVFLMTTL
Sbjct  467   CRWGMALFGATSVTITAMFH---CAVRRDMPEPPSEWMVPLMPWPAAASVFLNVFLMTTL  523

Query  498   NVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              V +++RFG+W+ ++ +FYV YGVHSTY 
Sbjct  524   KVMSFQRFGLWSFVIIVFYVCYGVHSTYS  552



>ref|XP_010646375.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Vitis vinifera]
Length=470

 Score =   487 bits (1253),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 319/456 (70%), Positives = 373/456 (82%), Gaps = 8/456 (2%)
 Frame = -2

Query  1683  LRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYN  1504
             ++  +GEFVGYFAGANILM+YVLSNAAVSRSFTEYLS A G GN + WRV+V G  +G+N
Sbjct  23    IQKNYGEFVGYFAGANILMEYVLSNAAVSRSFTEYLSCAFG-GNLNSWRVEVHGFTKGFN  81

Query  1503  MLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG  1324
             MLDFPAVA+I+LLT+ LC+STKESS+LN VMTIFHVVFFGFIIIAGF KGS+ NLV   G
Sbjct  82    MLDFPAVAIILLLTLCLCYSTKESSILNFVMTIFHVVFFGFIIIAGFLKGSAKNLVNPDG  141

Query  1323  GLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclma  1144
              LAPFGV+GVLDGAA VYFSYIGYDSVSTMAEEI+NPSKSLPVGI+GSV IVS LYCLM+
Sbjct  142   -LAPFGVKGVLDGAAQVYFSYIGYDSVSTMAEEISNPSKSLPVGIMGSVFIVSGLYCLMS  200

Query  1143  lslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVV  964
              +LC++LPYN IPE+ SF+ AF+ MGWKWASN+VG GASLGIVASLLVAMLGQARYLCV+
Sbjct  201   FALCMMLPYNQIPEKASFAIAFQRMGWKWASNIVGAGASLGIVASLLVAMLGQARYLCVI  260

Query  963   GRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaa  784
             GRARLVP WLAKVHPSTGTPLNAT+FLG   AS++LFTEL+IV++++++ TL+VFYLVA 
Sbjct  261   GRARLVPLWLAKVHPSTGTPLNATLFLGAFTASISLFTELEIVVDMVNLCTLLVFYLVAN  320

Query  783   aliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFH  604
             ALIYRRY I   NPPF  LLFL L+S SS+ FSLSWKL  QWW LPLFG + +  TA FH
Sbjct  321   ALIYRRYVITVNNPPFHTLLFLSLLSCSSIAFSLSWKLK-QWWGLPLFGGIMIIITACFH  379

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               VP   +P  WSVP MPWPAA+SIFLNVFLMTTL   + +RFG+W+ L+ LFYV+YGVH
Sbjct  380   YFVPYPNQPSKWSVPFMPWPAAMSIFLNVFLMTTLKKLSLQRFGVWSCLIILFYVLYGVH  439

Query  423   STYKveemevmvdnnnnhvnnnNSTTQPIKLEIQVL  316
             STY+           +    N NS+ Q  KL+IQ+L
Sbjct  440   STYR-----AEEMGMDAGGVNPNSSAQQTKLDIQLL  470



>ref|XP_001756602.1| predicted protein [Physcomitrella patens]
 gb|EDQ78556.1| predicted protein [Physcomitrella patens]
Length=594

 Score =   480 bits (1236),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 291/543 (54%), Positives = 399/543 (73%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  ++  TP++L K A    TP  E+++VR RSGA+M R L W+D++ALGVGGM+G G+F
Sbjct  21    YGRAILDTPRRLYKHAWDISTPTDEMSEVRARSGAEMSRSLHWWDVIALGVGGMVGAGIF  80

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V+TG  AR ++GPSV I+Y+VAG+SALLS+LCYTEF+VE+PVAGGAFSYLRITFGEF  +
Sbjct  81    VSTGTAAR-SSGPSVVIAYLVAGISALLSALCYTEFAVEMPVAGGAFSYLRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              AGAN++M+YVLSNAAV+RSFT Y + A G  + D WRV+VDGL +GYN +D  AV +++
Sbjct  140   IAGANLIMEYVLSNAAVARSFTSYAASAYGVLHADAWRVQVDGLADGYNQIDVVAVLVVM  199

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG------GGLAPF  1309
              LT  LC STK+S  LNLVMT+ H+ F  FII+ GF KG   NL  +G       G AP 
Sbjct  200   FLTAFLCCSTKKSCTLNLVMTVLHIAFILFIIVMGFVKGDVKNLTTAGDPVANPSGFAPM  259

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G+RG+L GAAIVYFSYIG+DSVST AEE+ NP++S+P+G+ GSV+IV+ LY L+A++LC+
Sbjct  260   GIRGILGGAAIVYFSYIGFDSVSTTAEEVKNPARSMPIGVSGSVIIVTVLYSLIAIALCM  319

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             L PY++I     FS+AF+ ++GW+W +  +G GASLGI+ SLLVA+LGQARY+CV+GRA 
Sbjct  320   LQPYDMIDTGAPFSSAFQHVVGWEWVTKFIGAGASLGIMTSLLVALLGQARYMCVLGRAH  379

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP W A V+PSTGTP+NATIFLG C A+++LFT+L +++ ++SIGTL VFY+VA ALI+
Sbjct  380   IVPQWFAAVNPSTGTPINATIFLGACTAAISLFTDLTVLLNLVSIGTLFVFYMVANALIF  439

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKLNLQW---WNLPLFGFLTLSFTALFHR  601
             RR+ +           +L ++S  ++ F   W+    +   W L L G L ++ TA+F  
Sbjct  440   RRHYVRGKTSSLPTAAYLVVLSVLAITFVTVWQCGQHYRHNWALYLVGGLAIALTAVFWF  499

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              +P  ++ + WSVP MPW AA SIFLNVFL+ +++  +Y RF IW  +  +FY++Y VHS
Sbjct  500   KIPTAQKGKDWSVPCMPWVAAASIFLNVFLLGSVDKASYMRFVIWIIIAIVFYILYSVHS  559

Query  420   TYK  412
             T+ 
Sbjct  560   THD  562



>ref|XP_004250472.1| PREDICTED: cationic amino acid transporter 7, chloroplastic [Solanum 
lycopersicum]
Length=584

 Score =   468 bits (1203),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 288/544 (53%), Positives = 399/544 (73%), Gaps = 10/544 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             TYL +LS TP +L +RA +  T  +E ++VR RSG DMKR L WYDLV  GVGGM+G GV
Sbjct  13    TYLRALSDTPHRLARRACSVSTTFEETSRVRARSGGDMKRSLRWYDLVGFGVGGMVGAGV  72

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVT+G  +   AGP+V +SY +AG  ALLS+ CYTEF+V++PVAGG+FSY+RITFGEF+ 
Sbjct  73    FVTSGRASSMCAGPAVVLSYAIAGFCALLSAFCYTEFAVDMPVAGGSFSYIRITFGEFLA  132

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +  GAN+++DYVLSNAAV+RSFT YL  ALG       R+ V+GL +G+N +D  AV ++
Sbjct  133   FLTGANLIIDYVLSNAAVARSFTGYLCTALGISTESRLRIIVNGLPKGFNEIDIVAVLVV  192

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPF  1309
             + LT+++C+ST+ESSLLN+V+T+ H+VF  F+I+ GF +G + N  ++G      G  PF
Sbjct  193   LALTVIICYSTRESSLLNMVLTVLHLVFIVFVIVIGFTRGETKNFREAGDENHASGFFPF  252

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P G+ GSV++V+ LYCLMA S+ +
Sbjct  253   GASGVFNGAAMVYLSYIGYDAVSTMAEEVRNPVKDIPAGVSGSVILVTVLYCLMAASMSM  312

Query  1128  lLPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY++I  +  FS AF +  GW+W SNV+GVGAS GI+ SLLVAMLGQARY+CV+GR+ 
Sbjct  313   LLPYDMIDPDAPFSGAFMESDGWRWVSNVIGVGASFGILTSLLVAMLGQARYMCVIGRSS  372

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP+W AKVHP T TP+NA++FLGIC A++ALFT+L+I++ ++SIGTL VFY+VA A+IY
Sbjct  373   VVPAWFAKVHPKTSTPVNASVFLGICTAAIALFTDLQILLNLVSIGTLFVFYMVANAVIY  432

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFH  604
             +RY  I    P+  L FLF  S +S+ F+L W+       + + L     + ++   LFH
Sbjct  433   KRYVSIGVTNPWPTLSFLFCFSLTSILFTLLWQFAPPGKPKAFMLGACTAIAIAVLQLFH  492

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP  ++PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG ++ L  L YV+Y VH
Sbjct  493   YMVPQAQKPEFWGVPLMPWIPSMSIFLNIFLLGSLDRPSYIRFGFFSALAVLVYVLYSVH  552

Query  423   STYK  412
             +++ 
Sbjct  553   ASFD  556



>ref|XP_006367241.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Solanum tuberosum]
Length=584

 Score =   466 bits (1200),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 286/544 (53%), Positives = 398/544 (73%), Gaps = 10/544 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +YL +LS TP +L +RA +  T  +E +++R RSG DMKR L WYDLV  GVGGM+G GV
Sbjct  13    SYLRALSDTPHRLARRACSVSTSFEETSRLRARSGGDMKRSLRWYDLVGFGVGGMVGAGV  72

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVT+G  +R  AGP+V +SY +AG  ALLS+ CYTEF+V++PVAGGAFSY+RITFGEF+ 
Sbjct  73    FVTSGRASRMCAGPAVVLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYIRITFGEFLA  132

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +  GAN+++DYVLSNAAV+RSFT YL  ALG       R+ V+GL +G+N +D  AV ++
Sbjct  133   FLTGANLIIDYVLSNAAVARSFTGYLCTALGISTESRLRITVNGLPKGFNEIDIVAVLVV  192

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPF  1309
             + LT+++C+ST+ESS+LN+V+T+ H+VF  F+I+ GF +G + N  ++G      G  PF
Sbjct  193   LALTVIICYSTRESSMLNMVLTVLHLVFIVFVIVIGFTRGDTKNFREAGDENHASGFFPF  252

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P G+ GSV++V+ LYCLMA S+ +
Sbjct  253   GASGVFNGAAMVYLSYIGYDAVSTMAEEVRNPVKDIPAGVSGSVILVTVLYCLMAASMSM  312

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY++I  +  FS AF    GW+W SNV+GVGAS GI+ SLLVAMLGQARY+CV+GR+ 
Sbjct  313   LLPYDMIDTDAPFSGAFMGSDGWRWVSNVIGVGASFGILTSLLVAMLGQARYMCVIGRSS  372

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP+W A+VHP T TP+NA++FLGIC A++ALFT+L+I++ ++SIGTL VFY+VA A+IY
Sbjct  373   VVPAWFARVHPKTSTPVNASVFLGICTAAIALFTDLQILLNLVSIGTLFVFYMVANAVIY  432

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFH  604
             +RY  I    P+  L FLF  S +S+ F+L W+       +   L     + ++   LFH
Sbjct  433   KRYVSIGVTNPWPTLSFLFCFSLTSILFTLLWQFAPPGKPKALMLGACTAIAIAVLQLFH  492

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP  ++PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG ++ L  L YV+Y VH
Sbjct  493   YMVPQAQKPEFWGVPLMPWIPSMSIFLNIFLLGSLDRPSYIRFGFFSALAVLVYVLYSVH  552

Query  423   STYK  412
             +++ 
Sbjct  553   ASFD  556



>ref|XP_009799957.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=582

 Score =   463 bits (1192),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 286/544 (53%), Positives = 400/544 (74%), Gaps = 12/544 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +YL +LS TP +L +RA +  T  ++ ++VR RSG DMKR L WYDLV  GVGGM+G GV
Sbjct  13    SYLRALSDTPNRLARRAGSVSTSFEQTSRVRARSGGDMKRSLRWYDLVGFGVGGMVGAGV  72

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVT+G  +R  AGP+V +SY +AG  ALLS+ CYTEF+V++PVAGGAFSY+RITFGEF+ 
Sbjct  73    FVTSGRASRLCAGPAVVLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYIRITFGEFLA  132

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +  GAN+++DYVLSNAAV+RSFT YL  ALG  +    ++ V GL +G+N +D  AV ++
Sbjct  133   FLTGANLIIDYVLSNAAVARSFTGYLCTALGIESK--LKITVSGLPKGFNEIDVVAVLVV  190

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPF  1309
             + LT+++C+ST+ESS+LN+V+T  H+VF  F+I+ GF +G + N  K+G      G  PF
Sbjct  191   LALTVIICYSTRESSMLNMVLTALHLVFIVFVIVIGFTRGETKNFTKAGDQNHASGFFPF  250

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P G+ GSV++V+ LYCLMA S+ +
Sbjct  251   GASGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPAGVSGSVILVTVLYCLMAASMSM  310

Query  1128  lLPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY++I  +  FS AF +  GW+W SNV+GVGA+ GI+ SLLVAMLGQARY+CV+GR+ 
Sbjct  311   LLPYDMIDPDAPFSGAFMESDGWRWVSNVIGVGAAFGILTSLLVAMLGQARYMCVIGRSS  370

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP+W AKVHP T TP+NA++FLGIC A++ALFT+L+I++ ++SIGTL VFY+VA A+IY
Sbjct  371   VVPAWFAKVHPKTSTPVNASVFLGICTAAIALFTDLQILLNLVSIGTLFVFYMVANAVIY  430

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFH  604
             +RY  +    P+  L FLF  S +S+ F+L W+       + + L     +T++   ++H
Sbjct  431   KRYVSVGVTNPWPTLSFLFCFSLTSILFTLLWQFAPPGKPKAFMLGACTAITIAVVQIYH  490

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP  R+PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG ++GL  L YV Y VH
Sbjct  491   YMVPQARKPEFWGVPLMPWIPSISIFLNIFLLGSLDRPSYVRFGFFSGLAVLVYVFYSVH  550

Query  423   STYK  412
             +++ 
Sbjct  551   ASFD  554



>gb|EYU19824.1| hypothetical protein MIMGU_mgv1a003376mg [Erythranthe guttata]
Length=589

 Score =   463 bits (1192),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 293/546 (54%), Positives = 392/546 (72%), Gaps = 14/546 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +LS TP +L +RA +  T  +E  ++R+RSG++MKR L WYDLV  GVGGM+G GVF
Sbjct  15    YLRALSDTPNRLSRRACSVSTSSEETTRLRIRSGSEMKRTLRWYDLVGFGVGGMVGAGVF  74

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGP+V +SY +AGL ALLS+ CYTEF+V++PVAGGAFSY+R+TFGEF  +
Sbjct  75    VTTGRASRLYAGPAVVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYVRVTFGEFPAF  134

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN+++DYVLSNAAV+RSFT YL  ALG       R     L EGYN LD  AVA+++
Sbjct  135   LTGANLVIDYVLSNAAVARSFTSYLGTALGLSTRTQLRFTAHALPEGYNELDLIAVAVVL  194

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
             +LT+V+C+STKESS LN+V+T+ H++F  F+I+ GF+KG  +N  K G     GG  PFG
Sbjct  195   ILTLVICYSTKESSWLNMVLTVLHILFIVFVIVVGFWKGDWNNFTKPGNPENPGGFFPFG  254

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             V GV +GAA+VY SYIGYD+VSTMAEE+ +P K++P+G+ GSV++V+ LYC MA S+  L
Sbjct  255   VSGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKNIPIGVSGSVVLVTVLYCFMAASMSAL  314

Query  1125  LPYNLIPEEGSFSAAFKM--MGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LPY++I  +  FS AF+    GWKW SNV+GVGAS GI+ SLLV+MLGQARY+CV+GRA 
Sbjct  315   LPYDMIDADAPFSGAFREGSEGWKWVSNVIGVGASFGILTSLLVSMLGQARYMCVIGRAC  374

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP+W A+VH ST TP+NA+ FLGI  A +ALFT+L I++ ++SIGTL VFY+V+ A+IY
Sbjct  375   VVPTWFARVHNSTSTPVNASSFLGIFTAGIALFTDLNILLNLVSIGTLFVFYMVSNAVIY  434

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLT------LSFTAL  610
             RRY       P+    FLF  S + + F+L W+      N P    L       ++   L
Sbjct  435   RRYVTNGATNPWPTTSFLFCFSLTCIIFTLIWQFGPS-SNKPKALMLVACLGVAIALVQL  493

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
             FH  VP  R+PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG ++GL+ L YV+Y 
Sbjct  494   FHFTVPQARKPEFWGVPLMPWIPSISIFLNIFLLGSLDKPSYVRFGFFSGLIVLVYVLYS  553

Query  429   VHSTYK  412
             VHS++ 
Sbjct  554   VHSSFD  559



>ref|XP_006398930.1| hypothetical protein EUTSA_v10013075mg [Eutrema salsugineum]
 gb|ESQ40383.1| hypothetical protein EUTSA_v10013075mg [Eutrema salsugineum]
Length=582

 Score =   462 bits (1188),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 294/541 (54%), Positives = 393/541 (73%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +L +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  20    YLNSLSVTPSRLARRAISVSTSSDEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMVGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN++MDYV+SNAAVSRSFT YL  A G      WR  V GL  G+N +D  AV +++
Sbjct  140   FTGANLIMDYVMSNAAVSRSFTAYLGTAFGISTSK-WRFVVSGLPNGFNEIDPVAVLVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLAPFG  1306
              +T+++C ST+ESS +N++MT FH+ F  F+I+ GF KG+  NL      +   G  PFG
Sbjct  199   AITVIICCSTRESSKVNMIMTAFHIAFIFFVIVMGFLKGNPKNLSLPAKPEHPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ NP K +PVG+ GSV IV+ LYCLMA+S+ +L
Sbjct  259   AAGVFNGAAMVYLSYIGYDAVSTMAEEVQNPVKDIPVGVSGSVAIVTVLYCLMAVSMSML  318

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  FSAAF+   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDPEAPFSAAFRGSDGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP W A++HP+T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA ALI+R
Sbjct  379   VPVWFAQIHPNTSTPVNASTFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANALIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  I    P+  L FL L S +SL F+L WKL    NL+ + L     + ++   +FH 
Sbjct  439   RYVPIGPTKPWPTLSFLTLFSITSLVFTLIWKLAPQGNLKAFMLGSCAVVAIAIVLIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP   +PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG ++GL+ L Y+ YGVH+
Sbjct  499   VVPQANKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYVRFGFFSGLIVLVYLFYGVHA  558

Query  420   T  418
             +
Sbjct  559   S  559



>gb|KEH31611.1| cationic amino acid transporter [Medicago truncatula]
Length=442

 Score =   455 bits (1171),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 286/412 (69%), Positives = 339/412 (82%), Gaps = 7/412 (2%)
 Frame = -2

Query  1629  MDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliilltivLC  1450
             M+YV SNAAV+RSFTEYLS+A GE NP+ WRV+V GL + YNMLDFPAVALI+LLT+ LC
Sbjct  1     MEYVFSNAAVARSFTEYLSFAFGENNPNVWRVEVHGLPKDYNMLDFPAVALILLLTLCLC  60

Query  1449  HSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLDGAAIVY  1270
             HSTKESS+LNL+MT+FHV+FFGFII+AG+Y GS+ NLV   G +AP+GVRGVLDGAAIVY
Sbjct  61    HSTKESSILNLIMTVFHVIFFGFIIVAGYYNGSTKNLVNPKG-IAPYGVRGVLDGAAIVY  119

Query  1269  FSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSF  1090
             FSYIGYDS STMAEE+ +P KSLP+GIVGSVLI + LYCLMALSLC+++PYN I ++ S+
Sbjct  120   FSYIGYDSASTMAEEVKDPYKSLPIGIVGSVLITTLLYCLMALSLCIMVPYNKISDKASY  179

Query  1089  SAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTG  910
             S AF  +GW WASN+VG GASLGIVASLLVAMLGQARYLCV+GRARLVPSWLAKVHPSTG
Sbjct  180   SMAFLKIGWSWASNIVGAGASLGIVASLLVAMLGQARYLCVMGRARLVPSWLAKVHPSTG  239

Query  909   TPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQv  730
             TPLNATIFLG C AS+ALFTEL I+IE+ISIGTL+VFY+VA ALIYRRY II   PP   
Sbjct  240   TPLNATIFLGFCTASIALFTELDIIIELISIGTLMVFYMVANALIYRRYVIIGHTPPLHT  299

Query  729   llflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPC------VRRPESW  568
             LLFLFL+S +SL FS+ WK   QWW L LFG   ++ T+LF  +VPC            W
Sbjct  300   LLFLFLLSLTSLCFSIVWKFKQQWWGLLLFGGFMITITSLFQHMVPCNNNLVQQEYAHCW  359

Query  567   SVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              VP MPWP ++SIFLNVFLMTTL   +++RF IW+  +++FYV+YGVHSTY+
Sbjct  360   YVPFMPWPPSMSIFLNVFLMTTLKTLSFQRFAIWSCFITMFYVLYGVHSTYQ  411



>ref|XP_006407531.1| hypothetical protein EUTSA_v10020371mg [Eutrema salsugineum]
 gb|ESQ48984.1| hypothetical protein EUTSA_v10020371mg [Eutrema salsugineum]
Length=582

 Score =   459 bits (1182),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 291/543 (54%), Positives = 389/543 (72%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +  +RA++  T   E+++VR  SG  M+R L WYDLV LG+GGM+G GVF
Sbjct  20    YLNSLSDTPSRFSRRAVSVSTSYDEMSRVRAVSGEQMRRTLRWYDLVGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLFAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT Y   A G    + WR  V GL +G+N +D  AV +++
Sbjct  140   ITGANLIMDYVMSNAAVSRGFTAYFGSAFGLSTSE-WRFVVSGLPDGFNEIDPIAVLVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T ++C+ST+ESS +NLV+T  H+ F  F+I+ GF+KG + NL +        G  PFG
Sbjct  199   AVTFIICYSTRESSKVNLVLTALHIAFIVFVIVMGFWKGDAKNLTRPDNPENPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GSV IV+ LYCLMA+S+ +L
Sbjct  259   ASGVFNGAAMVYLSYIGYDAVSTMAEEVRDPVKDIPMGISGSVAIVTVLYCLMAVSMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E ++SAAF K  GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDAEAAYSAAFSKSEGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP+W AKVHP+T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   VPAWFAKVHPNTSTPVNASAFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLN----LQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +S+ F+L WKL      +W  L       ++   +FH 
Sbjct  439   RYVAVGYTKPWPTLSFLCLFSITSIVFTLVWKLAPSGPSKWSMLGASAVAAIAIVQIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP  R PE W VPLMPW   +SIFLN+FL  +L+  +Y RFG ++GL  L YV Y VH+
Sbjct  499   VVPQARTPEFWGVPLMPWTPCVSIFLNIFLFGSLDAPSYLRFGFFSGLAVLVYVFYSVHA  558

Query  420   TYK  412
             +Y 
Sbjct  559   SYD  561



>ref|XP_009591737.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=582

 Score =   459 bits (1182),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 288/544 (53%), Positives = 397/544 (73%), Gaps = 12/544 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +YL +LS TP +L +RA +  T  +E ++VR RSG DMKR L WYDLV  GVGGM+G GV
Sbjct  13    SYLRALSDTPNRLARRAGSVSTSFEETSRVRARSGGDMKRSLQWYDLVGFGVGGMVGAGV  72

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVT+G  +R  AGP+V +SY +AG  ALLS+ CYTEF+V++PVAGGAFSY+RITFGEF+ 
Sbjct  73    FVTSGRASRLCAGPAVVLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYIRITFGEFLA  132

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +  GAN+++DYVLSNAAV+RSFT YLS ALG  +    ++ V GL +G+N +D  AV ++
Sbjct  133   FLTGANLIIDYVLSNAAVARSFTGYLSTALGIESK--LKITVSGLPKGFNEIDVVAVLVV  190

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPF  1309
             + LT+++C+ST+ESS+LN+V+T  H+VF  F+I+ GF +G + N  K+G      G  PF
Sbjct  191   LALTVIICYSTRESSMLNMVLTALHLVFIVFVIVIGFTRGETKNFTKAGDQNHASGFFPF  250

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P G+ GSV++V+ LYCLMA S+ +
Sbjct  251   GASGVFNGAAMVYLSYIGYDAVSTMAEEVRNPVKDIPAGVSGSVILVTVLYCLMAASMSM  310

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY++I  +  FS AF    GW+W SNV+GVGA+ GI+ SLLVAMLGQARY+CV+GR+ 
Sbjct  311   LLPYDMIDPDAPFSGAFMGSDGWRWVSNVIGVGAAFGILTSLLVAMLGQARYMCVIGRSS  370

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP+W AKVHP T TP+NA+ FLGIC A++ALFT+L+I++ ++SIGTL VFY+VA A+IY
Sbjct  371   VVPAWFAKVHPKTSTPVNASAFLGICTAAIALFTDLQILLNLVSIGTLFVFYMVANAVIY  430

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFH  604
             +RY  +    P+  L FLF  S +S+ F+L W+       +   L     + ++   LF+
Sbjct  431   KRYVSVGVTNPWPTLSFLFCFSLTSILFTLLWQFAPPGKPKALMLGACTAIAIAVLQLFN  490

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP  R+PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG ++GL  L YV Y VH
Sbjct  491   YVVPQARKPEFWGVPLMPWIPSISIFLNIFLLGSLDRPSYVRFGFFSGLAVLVYVFYSVH  550

Query  423   STYK  412
             +++ 
Sbjct  551   ASFD  554



>ref|XP_002882687.1| hypothetical protein ARALYDRAFT_317861 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58946.1| hypothetical protein ARALYDRAFT_317861 [Arabidopsis lyrata subsp. 
lyrata]
Length=584

 Score =   459 bits (1182),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 290/543 (53%), Positives = 387/543 (71%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +  +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  20    YLNSLSDTPSRFSRRAVSVSTSYDEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGLSALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLYAGPSIVVSYAIAGLSALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT YL  A G    + WR  V GL  G+N++D  AV +++
Sbjct  140   ITGANLIMDYVMSNAAVSRGFTAYLGSAFGISASE-WRFIVSGLPNGFNVIDPIAVIVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T ++C+ST+ESS +N+V+T  H+ F  F+I+ GF+KG   NL +        G  PFG
Sbjct  199   TVTFIICYSTRESSKVNMVLTALHIAFLVFVIVMGFWKGDIKNLTRPDNPENPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             V GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GSV IV  LYCLMA+S+ +L
Sbjct  259   VSGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGSVAIVIVLYCLMAISMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  +SAAF K  GW+W +  VG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDPEAPYSAAFSKSEGWEWVTKAVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP W AKVHP T TP+NA+ FLGI  A +ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   VPIWFAKVHPKTSTPVNASAFLGIFTAFLALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLN----LQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +S+ F+L W+L      +W+ L       ++   +FH 
Sbjct  439   RYVAVGYTKPWPTLSFLCLFSITSIFFTLVWQLAPRGPPKWFILGASAVTAIAIVQIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP  R PE W VPLMPW   +SIFLN+FL+ +L+  +Y RFG ++GL  L YV Y VH+
Sbjct  499   VVPQARIPEFWGVPLMPWTPCVSIFLNIFLLGSLDAPSYIRFGFFSGLAVLIYVFYSVHA  558

Query  420   TYK  412
             +Y 
Sbjct  559   SYD  561



>ref|NP_187671.1| cationic amino acid transporter 7 [Arabidopsis thaliana]
 sp|Q9SQZ0.1|CAAT7_ARATH RecName: Full=Cationic amino acid transporter 7, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51376.1|AC011560_8 putative amino acid transporter; 33388-30195 [Arabidopsis thaliana]
 gb|AAF76365.1| amino acid transporter, putative [Arabidopsis thaliana]
 gb|AEE74933.1| cationic amino acid transporter 7 [Arabidopsis thaliana]
Length=584

 Score =   459 bits (1180),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 291/543 (54%), Positives = 386/543 (71%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +  +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  20    YLNSLSDTPSRFSRRAVSVSTSYDEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYVLSNAAVSR FT YL  A G    + WR  V GL  G+N +D  AV +++
Sbjct  140   ITGANLIMDYVLSNAAVSRGFTAYLGSAFGISTSE-WRFIVSGLPNGFNEIDPIAVIVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T V+C+ST+ESS +N+V+T  H+ F  F+I+ GF KG   NL +        G  PFG
Sbjct  199   AVTFVICYSTRESSKVNMVLTALHIAFIVFVIVMGFSKGDVKNLTRPDNPENPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             V GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GSV IV  LYCLMA+S+ +L
Sbjct  259   VSGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGSVAIVIVLYCLMAISMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  +SAAF K  GW+W + VVG+GAS GI+ SL+VAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDAEAPYSAAFSKSEGWEWVTRVVGIGASFGILTSLIVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP W AKVHP T TP+NA+ FLGI  A +ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   VPIWFAKVHPKTSTPVNASAFLGIFTAVLALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLN----LQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +S+ F+L W+L      +W+ L       ++   +FH 
Sbjct  439   RYVTVGYTEPWPTLSFLCLFSITSILFTLVWQLAPSGPPKWFILGASTVTAIAIVQIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP  R PE W VPLMPW   +SIFLN+FL+ +L+  +Y RFG ++GL+ L YV Y VH+
Sbjct  499   VVPQARIPEFWGVPLMPWTPCVSIFLNIFLLGSLDAPSYIRFGFFSGLVVLVYVFYSVHA  558

Query  420   TYK  412
             +Y 
Sbjct  559   SYD  561



>ref|XP_002871112.1| ATCAT6/CAT6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47371.1| ATCAT6/CAT6 [Arabidopsis lyrata subsp. lyrata]
Length=580

 Score =   458 bits (1178),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 292/541 (54%), Positives = 391/541 (72%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +L +RA++  T   E++ VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  21    YLNSLSATPSRLSRRAISVSTSSDEMSHVRAVSGEQMRRTLRWYDLIGLGIGGMVGAGVF  80

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  81    VTTGRASRLDAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  140

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN++MDYV+SNAAVSRSFT YL  A G      WR  V GL +G+N +D  AV +++
Sbjct  141   FTGANLIMDYVMSNAAVSRSFTAYLGTAFGISTSK-WRFVVSGLPKGFNEIDPVAVLVVL  199

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
             ++T+++C ST+ESS +N++MT FH+ F  F+I+ GF KG S NL          G  PFG
Sbjct  200   VITVIICCSTRESSKVNMIMTAFHIAFIFFVIVMGFIKGDSKNLSSPANPEHPSGFFPFG  259

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ NP K +PVG+ GSV IV+ LYCLMA+S+ +L
Sbjct  260   AAGVFNGAAMVYLSYIGYDAVSTMAEEVENPVKDIPVGVSGSVAIVTVLYCLMAVSMSML  319

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY++I  E  FSAAF+   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  320   LPYDMIDPEAPFSAAFRGSNGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  379

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP W AK+HP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA ALI+R
Sbjct  380   VPFWFAKIHPKTSTPVNASTFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANALIFR  439

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +SL F+L WKL      + + L     + ++   +F  
Sbjct  440   RYVPVGPTKPWPTLCFLTLFSITSLVFTLIWKLVPEGKPKAFMLGASAVVAIAIVLIFQC  499

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP  R+PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG ++GL+ L Y++YGVH+
Sbjct  500   VVPQARKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYVRFGFFSGLIVLVYLLYGVHA  559

Query  420   T  418
             +
Sbjct  560   S  560



>ref|XP_006445758.1| hypothetical protein CICLE_v10014713mg [Citrus clementina]
 ref|XP_006485459.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Citrus sinensis]
 gb|ESR58998.1| hypothetical protein CICLE_v10014713mg [Citrus clementina]
Length=586

 Score =   458 bits (1178),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 280/546 (51%), Positives = 399/546 (73%), Gaps = 12/546 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S YL +L+ TP ++ +RAL+  T  +E+++VR +SG+DM++ L WYDLV  G+GGM+G G
Sbjct  14    SAYLRALAHTPARVSRRALSVSTSYEEMSRVRAKSGSDMRKTLRWYDLVCFGIGGMVGAG  73

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTG  +R  AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF 
Sbjct  74    VFVTTGHASRLNAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFA  133

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +  G+N++M+YV+SNAAV+R F  Y   A+G      WR+KVDGL +G+N +D  AVA+
Sbjct  134   AFLTGSNLIMEYVMSNAAVARGFASYFGTAIGVPTAK-WRLKVDGLPDGFNEIDVLAVAV  192

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAP  1312
             ++++T V+C+ST+ESS++N+++T+ H++F  F+I+ GF+KG   N  + G      G  P
Sbjct  193   VLVITFVICYSTRESSVVNMILTVLHILFIAFVILMGFWKGDPKNFTEPGDPKNPSGFFP  252

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
             +G +GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P+G+ GSV+IV+ LYCLMA S+ 
Sbjct  253   YGAKGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVIIVTVLYCLMAASMS  312

Query  1131  llLPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGR  958
             +L+PY++I  E  FS AF  K  GWKW SNV+GVGAS GI+ SLLVAMLGQARY+CV+GR
Sbjct  313   MLMPYDMIDAEAPFSGAFSGKSDGWKWVSNVIGVGASFGILTSLLVAMLGQARYMCVIGR  372

Query  957   ARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal  778
             + +VP+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+
Sbjct  373   SSVVPAWFARVHPKTSTPVNASAFLGIFTAAIALFTDLTVLLNLVSIGTLFVFYMVANAV  432

Query  777   iyrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTAL  610
             IYRRY  +    P   L FLFL S +S+ F+L W        + + L     + ++   +
Sbjct  433   IYRRYVNLGTTNPQPTLSFLFLFSVTSIIFTLIWHFVPPCKSKAFMLGASAIVAIAVLQI  492

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
             FH +VP  ++PE W VPLMPW   +SIFLN+FL+ +L+  +Y RFG ++ L  L Y++Y 
Sbjct  493   FHCVVPQAKKPEFWGVPLMPWIPCISIFLNIFLLGSLDGPSYVRFGFFSALAVLVYLLYS  552

Query  429   VHSTYK  412
             VH+++ 
Sbjct  553   VHASFD  558



>ref|XP_004497134.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Cicer arietinum]
Length=577

 Score =   457 bits (1176),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 284/545 (52%), Positives = 387/545 (71%), Gaps = 10/545 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F TYL +++QTP +  +R  +  T  +E+++VR RSG  M++ L W+DLV  G+GGM+G 
Sbjct  11    FRTYLRAVAQTPSRFARRGFSVSTSYEEMSRVRARSGTSMRKTLRWFDLVGFGIGGMVGA  70

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG  +R  AGP+V +SY +AG  ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF
Sbjct  71    GVFVTTGHASRVFAGPAVVLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEF  130

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN++MDYV+SNAAV+R FT Y    +G  +   WR+ V    EG+N +D  AVA
Sbjct  131   AAFLTGANLIMDYVMSNAAVARGFTAYFGATIGVSSAK-WRITVPSFPEGFNQIDMVAVA  189

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLA  1315
             +++L+T+V+C+ST+ESS++N+++T  H++F  F+I+ GF+KGS  N  +        G  
Sbjct  190   VVLLITLVICYSTRESSVVNMILTALHILFIAFVIVIGFWKGSWKNFTQPANPEHPSGFF  249

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             P G  GV +GAA VY SYIGYD+VSTMAEE+  P K +P+G+ GSV+IV+ LYCLMA S+
Sbjct  250   PHGAAGVFNGAAAVYLSYIGYDAVSTMAEEVKEPVKDIPIGVSGSVIIVTVLYCLMAASM  309

Query  1134  cllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
             C+LLPY++I  E  FSAAF   GW WAS V+GVGAS GI+ SL+VAMLGQARY+CV+GR 
Sbjct  310   CMLLPYDMIDPEAPFSAAFTSDGWGWASRVIGVGASFGILTSLIVAMLGQARYMCVIGRC  369

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              +VPSW AKVHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A++
Sbjct  370   NVVPSWFAKVHPKTSTPVNASAFLGIFTAAIALFTDLDVLLNLVSIGTLFVFYMVANAVV  429

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWN----LPLFGFLTLSFTALF  607
             YRRY       P+  L FLF  S +S+ F+L WK           L   G L ++   LF
Sbjct  430   YRRYVAAGTTNPWPTLCFLFSFSFTSIMFTLIWKFVATGVTKAGLLSACGVLAIAILQLF  489

Query  606   HRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
             H  VP  R+PE W VPLMPW  A+SIFLN+FL+ +L+  +Y RFG ++G+  LFYV Y V
Sbjct  490   HFTVPQARKPEFWGVPLMPWVPAISIFLNLFLLGSLDGPSYIRFGFFSGVAVLFYVFYSV  549

Query  426   HSTYK  412
             H+++ 
Sbjct  550   HASFD  554



>ref|XP_002269556.1| PREDICTED: cationic amino acid transporter 6, chloroplastic [Vitis 
vinifera]
Length=586

 Score =   457 bits (1176),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 281/548 (51%), Positives = 397/548 (72%), Gaps = 13/548 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F+ Y  +L+QTP +L +RA +  T  +E+++VR RSG+DM+R L W+DLV  G+GGM+G 
Sbjct  12    FTAYARALAQTPSRLARRACSVSTSFEEMSRVRARSGSDMQRNLRWFDLVGFGLGGMVGA  71

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG  +R  AGP+V +SY +AG+ ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF
Sbjct  72    GVFVTTGRASRLYAGPAVVLSYAIAGICALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEF  131

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN++MDYVLSNAAV+RSFT YL  A+G      WR  V GL +G+N +D  AVA
Sbjct  132   AAFLTGANLVMDYVLSNAAVARSFTAYLGTAIGFPTTK-WRFTVSGLPKGFNEIDLVAVA  190

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV------KSGGGL  1318
             +++++T+++C+ST+ESS++N+V+T  H++F  F+I+ GF++G   N        +  GG 
Sbjct  191   VVLIITLIICYSTRESSVVNMVLTAMHILFIAFVIVVGFWRGDWKNFTEPADPRRHQGGF  250

Query  1317  APFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmals  1138
              PFG  GV +GAA+VY SYIGYD+VST+AEE+ NP K +P+G+ GSV++V+ LYCLMA S
Sbjct  251   FPFGASGVFNGAAMVYLSYIGYDAVSTLAEEVRNPVKDIPIGVSGSVMLVTILYCLMAAS  310

Query  1137  lcllLPYNLIPEEGSFSAAFKMM--GWKWASNVVGVGASLGIVASLLVAMLGQARYLCVV  964
             +  LLPY+ I  E  FSAAF+    GWKW SNV+G GAS GI+ SL+VAMLGQARY+CV+
Sbjct  311   MSKLLPYDAIDPEAPFSAAFRGQSNGWKWVSNVIGAGASFGILTSLMVAMLGQARYMCVI  370

Query  963   GRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaa  784
             GR+++VPSW A+VH  T TP+NA+ FLGI  A++A+FT+L +++ ++SIGTL VFY+VA 
Sbjct  371   GRSKVVPSWFARVHHKTCTPVNASAFLGIFTAAIAVFTDLNVLLNLVSIGTLFVFYMVAN  430

Query  783   aliyrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFT  616
             A+IYRRY  +    P+  L FL   S +S+ F+L W      + +   L     + ++  
Sbjct  431   AVIYRRYVSVGATNPWPTLSFLVSFSLTSIIFTLIWHFAAPGHPKEVMLGACTVVAVAIL  490

Query  615   ALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
              +FH +VP VR+PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG ++ L  L YV+
Sbjct  491   QMFHCMVPQVRKPEHWGVPLMPWIPSISIFLNIFLLGSLDRPSYVRFGYFSALAVLVYVL  550

Query  435   YGVHSTYK  412
             Y VH+++ 
Sbjct  551   YSVHASFD  558



>ref|NP_196097.1| cationic amino acid transporter 6 [Arabidopsis thaliana]
 sp|Q9LZ20.1|CAAT6_ARATH RecName: Full=Cationic amino acid transporter 6, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25896.1|AF360186_1 putative amino acid transport protein [Arabidopsis thaliana]
 emb|CAB86019.1| amino acid transport-like protein [Arabidopsis thaliana]
 dbj|BAB08981.1| amino acid transporter-like protein [Arabidopsis thaliana]
 gb|AAK64078.1| putative amino acid transport protein [Arabidopsis thaliana]
 gb|AAM62800.1| amino acid transport-like protein [Arabidopsis thaliana]
 gb|AED90782.1| cationic amino acid transporter 6 [Arabidopsis thaliana]
Length=583

 Score =   457 bits (1176),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 293/541 (54%), Positives = 390/541 (72%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +L +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  21    YLNSLSATPSRLSRRAISVSTSSDEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMVGAGVF  80

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  81    VTTGRASRLDAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  140

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN++MDYV+SNAAVSRSFT YL  A G      WR  V GL +G+N +D  AV +++
Sbjct  141   FTGANLVMDYVMSNAAVSRSFTAYLGTAFGISTSK-WRFVVSGLPKGFNEIDPVAVLVVL  199

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
             ++T+++C ST+ESS +N++MT FH+ F  F+I+ GF KG S NL          G  PFG
Sbjct  200   VITVIICCSTRESSKVNMIMTAFHIAFIFFVIVMGFIKGDSKNLSSPANPEHPSGFFPFG  259

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ NP K +PVG+ GSV IV+ LYCLMA+S+ +L
Sbjct  260   AAGVFNGAAMVYLSYIGYDAVSTMAEEVENPVKDIPVGVSGSVAIVTVLYCLMAVSMSML  319

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  FSAAF+   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  320   LPYDLIDPEAPFSAAFRGSNGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  379

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP W AK+HP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA ALI+R
Sbjct  380   VPFWFAKIHPKTSTPVNASTFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANALIFR  439

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +SL F+L WKL      + + L     + ++    F  
Sbjct  440   RYVPVGPTKPWPTLCFLTLFSITSLVFTLIWKLVPEGKPKAFMLGASAVVAIAIVLSFQC  499

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP  R+PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG ++GL+ L Y+ YGVH+
Sbjct  500   VVPQARKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYVRFGFFSGLIVLVYLFYGVHA  559

Query  420   T  418
             +
Sbjct  560   S  560



>ref|XP_009122720.1| PREDICTED: cationic amino acid transporter 7, chloroplastic [Brassica 
rapa]
Length=584

 Score =   457 bits (1176),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 289/543 (53%), Positives = 385/543 (71%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +  +RA++      E+++VR  SG  M+R L WYDLV LG+GGM+G GVF
Sbjct  20    YLNSLSHTPSRFSRRAISVSPSYDEMSRVRAVSGEQMRRTLRWYDLVGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  +R  AGPS+  SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VPTGRASRLLAGPSIVFSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT YL  A G    + WR  V GL  G+N +D  AV +++
Sbjct  140   ITGANLIMDYVMSNAAVSRGFTAYLGSAFGLSTSE-WRFVVSGLPNGFNEIDPVAVLVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T ++C+ST+ESS +N+V+T  H+ F  F+I+ GF+KG   NL +        G  PFG
Sbjct  199   AVTFIICYSTRESSKVNMVLTALHIAFIVFVIVMGFWKGDKKNLTRPANPENPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GSV IV  LYCLMA+S+ +L
Sbjct  259   ASGVFNGAAMVYLSYIGYDAVSTMAEEVRDPVKDIPMGISGSVAIVIVLYCLMAISMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  ++AAF K  GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDPEAPYAAAFSKSEGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP+W AKVHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   VPTWFAKVHPKTSTPVNASAFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +S  F+L WKL    + +W+ L   G   ++   +FH 
Sbjct  439   RYVAVGYTRPWPTLSFLCLFSITSTVFTLVWKLAPSGSPKWFMLGASGVAAIAIVQIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP  R PE W VPLMPW   +SIFLN+FL+ +L+  +Y RFG ++GL  L YV Y VH+
Sbjct  499   VVPQARTPEFWGVPLMPWTPCVSIFLNIFLLGSLDAPSYIRFGFFSGLAVLVYVFYSVHA  558

Query  420   TYK  412
             +Y 
Sbjct  559   SYD  561



>ref|XP_006836089.1| hypothetical protein AMTR_s00114p00137590 [Amborella trichopoda]
 gb|ERM98942.1| hypothetical protein AMTR_s00114p00137590 [Amborella trichopoda]
Length=590

 Score =   456 bits (1174),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 286/552 (52%), Positives = 394/552 (71%), Gaps = 16/552 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
              ++Y+ +LS+TP++L KR  +  +  +EL+ V++RSG+ M ++L W+DLV LG+GGM+G 
Sbjct  10    LNSYIKALSETPQRLNKRMWSVSSASEELSLVKVRSGSLMAKRLRWFDLVGLGLGGMVGA  69

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG   +  AGP + +SY +AGL ALLS+LCYTEF+V++PVAGGAFSYLRITFGEF
Sbjct  70    GVFVTTGSAMKLYAGPGIVVSYAIAGLCALLSALCYTEFAVDMPVAGGAFSYLRITFGEF  129

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               Y  G N++M+YV SNAAV+RS T YL  A G    + WR+K+D   E YN LDF AVA
Sbjct  130   AAYMTGTNLVMEYVFSNAAVARSLTSYLGSAFGIVATEKWRIKIDSFPENYNSLDFVAVA  189

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLA  1315
             +I+ LT  +C+STKESS+LN+ +T  H+VF  FIII GF KG S+N   +      GG  
Sbjct  190   IILALTFCICYSTKESSILNMAITGVHIVFIVFIIILGFCKGESENFTHTQNPSKEGGFF  249

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             P+G  GV +GAAI+YFSYIGYD+VSTMAEE+ +P+K +P+G+ GSV++V+ LY LMA ++
Sbjct  250   PYGATGVFNGAAIIYFSYIGYDAVSTMAEEVKDPAKDIPIGVSGSVVLVTVLYTLMAAAM  309

Query  1134  cllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGR  958
               L+PY+ I  +  FS+AFK ++GW W SNV+G GASLGI+ SL+VAMLGQARY+CV+GR
Sbjct  310   AKLVPYDAIDLDSPFSSAFKRVVGWGWVSNVIGGGASLGILTSLMVAMLGQARYMCVIGR  369

Query  957   ARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal  778
             + +VP+  AKVHP T TP+NA+IFLG+C A++A+FT+L +++ +ISIGTL VFY+VA A+
Sbjct  370   SAVVPTCFAKVHPRTSTPVNASIFLGLCTAAIAMFTDLSVLVNLISIGTLFVFYMVANAV  429

Query  777   iyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTA-----  613
             +YRRY           L FL  +S  SL F+L W  +    N        L+ TA     
Sbjct  430   LYRRYNAHEKGSVVPTLSFLAALSILSLLFALLWHQSPPLSNPIAVICRLLALTACPVTI  489

Query  612   -----LFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSL  448
                  LFH LVP   RP  W+VPLMP+  A+S+FLN+FL+ +L+  +Y RFG+++G+  +
Sbjct  490   VALLILFHNLVPQAPRPVLWAVPLMPYIPAVSVFLNIFLLASLDGASYLRFGVFSGVALM  549

Query  447   FYVVYGVHSTYK  412
             FYV+Y VH++Y 
Sbjct  550   FYVLYSVHASYD  561



>ref|XP_009407333.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=604

 Score =   457 bits (1175),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 287/547 (52%), Positives = 393/547 (72%), Gaps = 11/547 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
              + Y  +L+ T ++L +RA +  T  +E+++VR RSGADM R L W DLV LG+GGM+G 
Sbjct  27    LAAYGRALADTHRRLGRRAGSVTTSYEEMSRVRARSGADMARSLRWPDLVGLGLGGMVGA  86

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFV TG  AR  AGP++ +SY +AGL ALLS+LCYTEF+V++PVAGGAFSYLR+TFGEF
Sbjct  87    GVFVATGRAARICAGPAIVLSYAIAGLCALLSALCYTEFAVDMPVAGGAFSYLRVTFGEF  146

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN++M+YV SNAAV+RSFT YL  A+       WR+ V GL EG+N +D  A+A
Sbjct  147   AAFLTGANLIMEYVFSNAAVARSFTAYLGTAISVDTTAKWRITVVGLPEGFNQIDLLALA  206

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNL------VKSGGGL  1318
             +++L++I +C+STKESS+LN+V+T  H+ F  FII+ GF++G + NL       KS GG 
Sbjct  207   VVLLVSICICYSTKESSVLNMVLTATHIAFILFIIVVGFWRGETRNLRHPANPAKSNGGF  266

Query  1317  APFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmals  1138
              P+G+ GV +GAA+VY SYIGYD+VSTMAEE+ NP++ +P+G+ GSV +V+ LYCLMA S
Sbjct  267   LPYGIAGVFNGAAMVYLSYIGYDAVSTMAEEVRNPARDIPIGVSGSVALVTLLYCLMAAS  326

Query  1137  lcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVG  961
             + +L+PY+ I EE  FSAAF+   GW W SNV+GVGAS GI+ SLLV+MLGQARYLCV+G
Sbjct  327   MSMLVPYDAIDEESPFSAAFRGSDGWGWVSNVIGVGASFGILTSLLVSMLGQARYLCVIG  386

Query  960   RARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaa  781
             R+ +VP+WLA+VHP T TP+NA+ FLG+  A++ALFT+L +++ ++SIGTL VFY+V  A
Sbjct  387   RSSVVPAWLARVHPKTATPVNASAFLGVFTAAIALFTDLNVLLNLVSIGTLFVFYMVGNA  446

Query  780   liyrryaiINGNPPFQvllflflvsssslgfslSWKLN-LQWWNLPLFGFLTLSFTA---  613
             ++YRRY  +    P+  + FL   SS S+ F+L W+          L G  T+   A   
Sbjct  447   VVYRRYVAVGSTNPWPTISFLLSFSSVSITFTLIWQFAPAGLAKAVLLGGCTVVAVAVLQ  506

Query  612   LFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVY  433
             +F+ LVP  R+PE W VPLMPW  A+SIFLNVFL+ +L+  +Y RF  ++    L YV Y
Sbjct  507   VFNYLVPQARKPEHWGVPLMPWIPAVSIFLNVFLLGSLDGPSYLRFAFFSAFTVLVYVFY  566

Query  432   GVHSTYK  412
              VH++Y 
Sbjct  567   SVHASYD  573



>ref|XP_010486672.1| PREDICTED: cationic amino acid transporter 7, chloroplastic [Camelina 
sativa]
Length=585

 Score =   455 bits (1170),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 286/543 (53%), Positives = 387/543 (71%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +  +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  20    YLNSLSDTPSRFSRRAVSVSTSYDEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT YL  A G    + WR  V GL  G+N +D  AV +++
Sbjct  140   ITGANLIMDYVMSNAAVSRGFTAYLGSAFGISTSE-WRFVVSGLPNGFNEIDPIAVTVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T ++C+ST+ESS +N+V+T  H+ F  F+I+ GF+KG   NL +        G  PFG
Sbjct  199   AVTFIICYSTRESSKVNMVLTALHIAFIVFVIVMGFWKGDVKNLTRPDNPDNPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GS+ IV  LYCLMALS+ +L
Sbjct  259   ASGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGSLAIVIVLYCLMALSMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  +SAAF K  GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDAEAPYSAAFSKSEGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             +P+W AKVHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   IPTWFAKVHPKTSTPVNASAFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLN----LQWWNLPLFGFLTLSFTALFHR  601
             RY ++    P+  L FL L S +S+ F+L W+L     L+W+ L       ++   +FH 
Sbjct  439   RYVVVGYTKPWPTLSFLCLFSITSVFFTLVWQLAPPGPLRWFTLGASAVTAIAIVQIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP    PE W VPLMPW   +SI LN+FL+ +L+  +Y RFG ++GL  L YV Y VH+
Sbjct  499   VVPQAMIPEFWGVPLMPWTPCVSISLNIFLLGSLDAPSYIRFGFFSGLAVLVYVFYSVHA  558

Query  420   TYK  412
             ++ 
Sbjct  559   SFD  561



>ref|XP_010464736.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Camelina sativa]
Length=585

 Score =   455 bits (1170),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 285/543 (52%), Positives = 387/543 (71%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +  +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  20    YLNSLSDTPSRFSRRAVSVSTSYDEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT YL  A G    + WR  V GL  G+N +D  AV +++
Sbjct  140   ITGANLIMDYVMSNAAVSRGFTAYLGSAFGISTSE-WRFVVSGLPNGFNEIDPIAVTVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T ++C+ST+ESS +N+++T  H+ F  F+I+ GF+KG   NL +        G  PFG
Sbjct  199   AVTFIICYSTRESSKVNMILTALHIAFIVFVIVMGFWKGDVKNLTRPDNPDNPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GSV IV  LYCLMALS+ +L
Sbjct  259   ASGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGSVAIVIVLYCLMALSMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  +SAAF K  GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDAEAPYSAAFSKSEGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             +P+W AKVHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   IPTWFAKVHPKTSTPVNASAFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLN----LQWWNLPLFGFLTLSFTALFHR  601
             RY ++    P+  L FL L + +S+ F+L W+L     L+W+ L       ++   +FH 
Sbjct  439   RYVVVGYTKPWPTLSFLCLFTITSVFFTLVWQLAPPGPLRWFMLGASAVTAIAIVQIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP    PE W VPLMPW   +SI LN+FL+ +L+  +Y RFG ++GL  L YV Y VH+
Sbjct  499   VVPQAMIPEFWGVPLMPWTPCVSISLNIFLLGSLDAPSYIRFGFFSGLAVLVYVFYSVHA  558

Query  420   TYK  412
             ++ 
Sbjct  559   SFD  561



>gb|KFK24917.1| hypothetical protein AALP_AA8G041700 [Arabis alpina]
Length=588

 Score =   455 bits (1170),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 290/542 (54%), Positives = 390/542 (72%), Gaps = 12/542 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+NSLS TP +L +RA++  T   E++++R  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  25    YINSLSATPSRLARRAISVSTSSDEMSRIRTISGEQMRRTLRWYDLIGLGIGGMVGAGVF  84

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  85    VTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  144

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN++MDYV+SNAAVSRSFT YL  A G      WR  V GL EG+N +D  AV +++
Sbjct  145   FTGANLIMDYVMSNAAVSRSFTAYLGTAFGISTSK-WRFVVSGLPEGFNEIDPVAVLVVL  203

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV------KSGGGLAPF  1309
              +T+++C ST+ESS +N++MT FH+ F  F+I+ GF KG+  NL       K+  G  PF
Sbjct  204   AITVIICSSTRESSKVNMIMTAFHITFIIFVIVMGFLKGNLKNLSSPANPEKNPSGFFPF  263

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+ NP K +PVG+ GSV IV+ LYCLMA+S+ +
Sbjct  264   GAAGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPVGVSGSVAIVTVLYCLMAVSMSM  323

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY+ I  E  FSAAF+   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R
Sbjct  324   LLPYDQIDTEAPFSAAFRGSNGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSR  383

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP W AK+H  T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA ALI+
Sbjct  384   VVPVWFAKIHHKTSTPVNASTFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANALIF  443

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFH  604
             RRY  I    P+  L FL L S +SL F+L W+L     L+ + L     + ++   +F 
Sbjct  444   RRYVPIGPTKPWPTLSFLTLFSVTSLIFTLVWQLTPQGKLKAFLLGATAVVAIAIVLIFQ  503

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP   +PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG ++GL+ L Y+ YGVH
Sbjct  504   CVVPQANKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYVRFGFFSGLIVLVYLFYGVH  563

Query  423   ST  418
             ++
Sbjct  564   AS  565



>ref|XP_001765563.1| predicted protein [Physcomitrella patens]
 gb|EDQ69613.1| predicted protein [Physcomitrella patens]
Length=575

 Score =   454 bits (1167),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 302/557 (54%), Positives = 406/557 (73%), Gaps = 14/557 (3%)
 Frame = -2

Query  2043  VSRSMPEIFST---YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDl  1873
             V+   P  FS+   Y  ++  TP +L  RALA  T  +E+ +V+  SGA+M R L W+D+
Sbjct  7     VAYQAPSSFSSVSEYGYAILDTPGRLCDRALAVSTLTEEMTEVKAMSGAEMTRNLRWWDV  66

Query  1872  valgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGA  1693
             +ALGVGGM+G G+FV+TG  AR + GP+V ++Y+VAG+SALLS+LCYTEF+VE+PVAGGA
Sbjct  67    IALGVGGMVGAGIFVSTGSAARLS-GPAVVLAYLVAGISALLSALCYTEFAVEMPVAGGA  125

Query  1692  FSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLME  1513
             FSYLRITFGEF  +  GAN+LM+YVLSNAAV+RSFT Y + A G    D WR+ V GL  
Sbjct  126   FSYLRITFGEFPAFIVGANLLMEYVLSNAAVARSFTSYAASAYGVLQVDAWRLHVGGLAA  185

Query  1512  GYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVK  1333
             GYN +D  AV++++ LT+ LC STK+SS+ NLVMT+ H+ F  FIIIAGF KG + NL  
Sbjct  186   GYNQIDLVAVSVVMFLTVFLCCSTKKSSVFNLVMTVLHMAFILFIIIAGFVKGDTKNLTH  245

Query  1332  SG------GGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLI  1171
             +G       G  P G+RG+L GAAIVYFSYIG+DSVST AEE+ NP+K++P+G+ GSV++
Sbjct  246   AGDPAANPSGFVPMGIRGILGGAAIVYFSYIGFDSVSTTAEEVKNPAKNMPIGVSGSVVV  305

Query  1170  VsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAM  994
             V+ LY L+A++LC+L PY++I     FS AF+ ++GW+WA+N +GVGASLGI+ SLLVAM
Sbjct  306   VTVLYSLIAVALCMLQPYDMIDIGAPFSTAFQHVVGWEWATNFIGVGASLGIITSLLVAM  365

Query  993   LGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIG  814
             LGQARY+CV+GRA +VP W A V+ STGTP+NAT+FLG C A+++LFT+L +++ +ISIG
Sbjct  366   LGQARYMCVLGRAHIVPQWFAVVNSSTGTPINATVFLGGCTAAISLFTDLTVLLNLISIG  425

Query  813   TLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKL---NLQWWNLPL  643
             TL VFY+VA ALIYRR+ +     PF+ + FL + S  ++ F   W+    N   W L L
Sbjct  426   TLFVFYMVANALIYRRHHVPEKTNPFRTIAFLTIFSVDAVTFVTIWQFDHHNRHTWALYL  485

Query  642   FGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWT  463
              G L L+ T LF   VP  ++ + WSVP MPW AA SIFLNVFL+ +++  +Y RF  WT
Sbjct  486   LGGLALAMTTLFWFKVPTAQKNKDWSVPCMPWVAAASIFLNVFLLGSVDRASYVRFVTWT  545

Query  462   GLMSLFYVVYGVHSTYK  412
              +  +FY++YGVHSTY 
Sbjct  546   IVAVVFYLLYGVHSTYD  562



>ref|XP_006299116.1| hypothetical protein CARUB_v10015257mg [Capsella rubella]
 gb|EOA32014.1| hypothetical protein CARUB_v10015257mg [Capsella rubella]
Length=584

 Score =   452 bits (1162),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 285/543 (52%), Positives = 385/543 (71%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +  +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  20    YLNSLSDTPSRFSRRAVSVSTSYDEMSRVREVSGEQMRRTLRWYDLIGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT YL  A G    + WR  V GL  G+N +D  AV +++
Sbjct  140   ITGANLIMDYVMSNAAVSRGFTAYLGSAFGISTSE-WRFAVAGLPNGFNEIDPIAVIVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T ++C+ T+ESS +N+V+T  H+ F  F+I+ GF+KG   NL +        G  PFG
Sbjct  199   AVTFIICYGTRESSKVNMVLTALHIAFIVFVIVMGFWKGDVKNLTRPDNPENPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GSV IV  LYCLMALS+ +L
Sbjct  259   ASGVFEGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGSVAIVIVLYCLMALSMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  +S AF +  GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDAEAPYSGAFSRSEGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             +P+W AKVHP+T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   IPTWFAKVHPNTSTPVNASAFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +S+ F+L W+L     L+W+ L       ++   +F  
Sbjct  439   RYVALGYTMPWPTLSFLCLFSITSIFFTLVWQLVPPGPLKWFMLDASAVTAIAIVQIFQC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP    PE W VPLMPW   +SIFLN+FL+ +L+  +Y RFG ++GL  L YV Y VH+
Sbjct  499   VVPQAIIPEFWGVPLMPWTPCVSIFLNIFLLGSLDAPSYIRFGFFSGLAVLVYVFYSVHA  558

Query  420   TYK  412
             +Y 
Sbjct  559   SYD  561



>ref|XP_009130837.1| PREDICTED: cationic amino acid transporter 6, chloroplastic [Brassica 
rapa]
Length=583

 Score =   452 bits (1162),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 289/541 (53%), Positives = 386/541 (71%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +L +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  20    YLNSLSSTPSRLARRAVSVSTSSDEMSRVRAVSGEHMRRTLRWYDLIGLGIGGMVGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN+++DYV+SNAAVSRSFT YL  A G      WR  V  L  G+N +D  AV +++
Sbjct  140   FTGANLVLDYVMSNAAVSRSFTAYLGTAFGISTHK-WRFVVSALPGGFNEIDPVAVVVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
              +T+++C ST+ESS +N++MT FH+ F  F+I+ GF +G S NL          G  PFG
Sbjct  199   AITVIICCSTRESSKVNMIMTAFHIAFIVFVIVMGFLRGDSKNLTSPAKPEHPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV  GAA+VY SYIGYD+VSTMAEE+ NP K +PVG+ GSV IV+ LYCLMA+S+ +L
Sbjct  259   AAGVFSGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPVGVSGSVAIVTVLYCLMAVSMSML  318

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  FSAAF+   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDPEAPFSAAFRGSNGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP W AK+H  T TP+NA+ FLGI  A +ALFT+L I++ ++SIGTL VFY+VA ALI++
Sbjct  379   VPVWFAKIHHRTSTPVNASSFLGIFTAVLALFTDLNILLNLVSIGTLFVFYMVANALIFK  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S+ SL F+L W+L     ++ + L     + ++   +FH 
Sbjct  439   RYVPVGPTKPWPTLTFLTLFSTISLVFTLIWQLAPQGKVKAFMLGASAVVAIAIVLIFHY  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             LVP   +PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG ++GL+ L Y+ YGVH+
Sbjct  499   LVPQANKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYVRFGFFSGLIVLVYLFYGVHA  558

Query  420   T  418
             +
Sbjct  559   S  559



>ref|XP_006378822.1| hypothetical protein POPTR_0010s24730g [Populus trichocarpa]
 gb|ERP56619.1| hypothetical protein POPTR_0010s24730g [Populus trichocarpa]
Length=586

 Score =   452 bits (1162),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 284/546 (52%), Positives = 394/546 (72%), Gaps = 12/546 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             ++Y+ +L+QTP +  +RA +  T  +E+++V+ RSG+DM+R L WYDLV  G+GGM+G G
Sbjct  13    NSYIQALAQTPARFARRAGSVSTSYEEMSRVKARSGSDMQRTLRWYDLVGFGIGGMVGAG  72

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTG  +R   GPSV ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF 
Sbjct  73    VFVTTGRASRVCTGPSVIISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFA  132

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +  GAN++MDYV+SNAAV+RSFT YL  A+G      WRV V  L +G+N +D  AV +
Sbjct  133   AFLTGANLIMDYVMSNAAVARSFTAYLGSAIGISTSK-WRVVVHVLPDGFNEIDIFAVLV  191

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLAP  1312
             ++ +T+++C+ST+ESS++N+V+T  H++F GF+I+ GF+KG   N       K+  G  P
Sbjct  192   VLAITLIICYSTRESSVVNMVLTALHILFIGFVILMGFWKGDWKNFTEPADPKNPSGFFP  251

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
             FG  GV +GAA+VY SYIGYD+VST+AEE+ NP K +P+G+ GSV+IV+ LYCLM+ S+ 
Sbjct  252   FGAPGVFNGAAMVYLSYIGYDAVSTLAEEVHNPVKDIPIGVSGSVIIVTVLYCLMSASMS  311

Query  1131  llLPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGR  958
             +LLPY++I  +  FSAAF  K  GWKW SNV+G+GAS GI+ SLLVAMLGQARY+CV+GR
Sbjct  312   MLLPYDMIDADAPFSAAFRGKSDGWKWVSNVIGIGASFGILTSLLVAMLGQARYMCVIGR  371

Query  957   ARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal  778
             + +VP+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+
Sbjct  372   SNVVPAWFARVHPKTSTPVNASAFLGIFTAAIALFTDLNVLLNLVSIGTLFVFYMVANAV  431

Query  777   iyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQW----WNLPLFGFLTLSFTAL  610
             +YRRY  I    P+  L FL   S +S+ F+L W    Q     + L     + ++   L
Sbjct  432   VYRRYVAIGTTNPWPTLAFLCSFSLTSILFTLIWHFMPQGKGKAFMLGACAVIAIAIIQL  491

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
             FH LVP  R+PE W VPLMPW   +SIFLN+FL+ +L   +Y RF  ++ L  L YV+Y 
Sbjct  492   FHCLVPQARKPEFWGVPLMPWIPCVSIFLNIFLLGSLGGPSYVRFVFFSALAVLVYVLYS  551

Query  429   VHSTYK  412
             VH+++ 
Sbjct  552   VHASFD  557



>ref|XP_010494590.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Camelina sativa]
Length=585

 Score =   451 bits (1160),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 286/543 (53%), Positives = 385/543 (71%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS T  +  +RA++  T   E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  20    YLNSLSDTSSRFSRRAVSVSTSYDEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT YL  A G    + WR  V GL  G+N +D  AV +++
Sbjct  140   ITGANLIMDYVMSNAAVSRGFTAYLGSAFGISTSE-WRFVVSGLPNGFNEIDPIAVTVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T ++C+ST+ESS +N+V+T  H+ F  F+I+ GF+KG   NL +        G  PFG
Sbjct  199   AVTFIICYSTRESSKVNMVLTALHIAFIVFVIVMGFWKGDVKNLTRPDNPDNPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GSV IV  LYCLMALS+ +L
Sbjct  259   ASGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGSVAIVIVLYCLMALSMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  +SAAF K  GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDAEAPYSAAFSKSEGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             +P+W AKVHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   IPTWFAKVHPKTSTPVNASAFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLN----LQWWNLPLFGFLTLSFTALFHR  601
             RY ++    P+  L FL L S +S+ F+L W+L     L+W+ L       ++   +FH 
Sbjct  439   RYVVVGYTKPWPTLSFLCLFSITSVFFTLVWQLAPPGPLRWFMLGASAVTAIAIVQIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP    PE W VPLMPW   +SI LN+FL+ +L   +Y RFG ++GL  L YV Y VH+
Sbjct  499   VVPQAMIPEFWGVPLMPWTPCVSISLNIFLLGSLEAPSYIRFGCFSGLAVLVYVFYSVHA  558

Query  420   TYK  412
             ++ 
Sbjct  559   SFD  561



>ref|XP_008784057.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Phoenix dactylifera]
Length=577

 Score =   451 bits (1159),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 281/544 (52%), Positives = 390/544 (72%), Gaps = 11/544 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L++TP +L++RA +  T  +E+++VR RSG DM R L W DLV LG+GGM+G GVF
Sbjct  24    YRRALAETPWRLRRRAWSVTTTHEEMSRVRARSGPDMARALRWPDLVGLGLGGMVGAGVF  83

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  AGP+V +SY +AGL ALLS+ CYTEF+V++P+AGGAFSYLR+TFGEF  Y
Sbjct  84    VATGRAARLYAGPAVVVSYAIAGLCALLSAFCYTEFAVDMPIAGGAFSYLRVTFGEFAAY  143

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++M+YV SNAAV+RSFT YL  A+GE     WR+ V GL +G+N +D  AV +++
Sbjct  144   LTGANLIMEYVFSNAAVARSFTTYLGTAIGEDATAQWRITVSGLPQGFNQIDLLAVTIVL  203

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNL------VKSGGGLAPF  1309
             ++++ +C+STKESS+LNLV+T  H+ F  FII+ GF++G   N        K+ GG  P+
Sbjct  204   IISVCICYSTKESSVLNLVLTSIHIAFILFIILMGFWRGDWKNFTHPANPAKNPGGFFPY  263

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             GV GV +GAA+VY SYIGYD+VSTMAEE+ NP++ +P+G+ GSV++V+ LYCLMA SL +
Sbjct  264   GVSGVFNGAAMVYLSYIGYDAVSTMAEEVKNPTRDIPIGVSGSVVLVTLLYCLMAASLAM  323

Query  1128  lLPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             L+PY+ I  E  FS AF K  GW+W SN +G GA  GI+ SLLV+MLGQARYLCV+GR+ 
Sbjct  324   LVPYDAIDTESPFSGAFRKSDGWRWVSNAIGAGAGFGILTSLLVSMLGQARYLCVIGRSN  383

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP+WLA+VHPST TP+NA+ FLG+  A++AL TEL +++ ++SIGTL VFY+V+ A+IY
Sbjct  384   VVPAWLARVHPSTATPVNASAFLGVFTAAIALITELDVLLNLVSIGTLFVFYMVSNAVIY  443

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKLNLQ-WWNLPLFGFLTLSFTALFHR--  601
             RRY ++    P+  + FL   + +SL F+L W+          L G   ++  A+ H   
Sbjct  444   RRYVVVGSTNPWPTVSFLLCFAFASLAFTLVWRCAPPGRTKFLLLGGCAVAAIAVLHAFQ  503

Query  600   -LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              LVP  R PE W VPLMPW  ++S FLN+FL+ +L   +Y RFG ++ +  L YV+YGVH
Sbjct  504   VLVPQAREPEFWGVPLMPWIPSISAFLNLFLLGSLEGPSYIRFGFFSVIAVLVYVLYGVH  563

Query  423   STYK  412
             +++ 
Sbjct  564   ASFD  567



>ref|XP_008345866.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
isoform X1 [Malus domestica]
Length=587

 Score =   451 bits (1160),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 279/542 (51%), Positives = 388/542 (72%), Gaps = 13/542 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +L+ TP +L +RA +  T   E++ VR RSG  M++ L W+DLV LG+GGM+G GVF
Sbjct  21    YLRALADTPTRLARRASSVSTSYDEMSAVRARSGPHMQKTLRWFDLVGLGLGGMVGAGVF  80

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGP++ ISY +AG  ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  81    VTTGRASRLYAGPAIVISYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  140

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAV+R FT Y+  A+G      WR  V GL  G++ +DF AV +++
Sbjct  141   LTGANLVMDYVMSNAAVARGFTAYMGSAIGVPAAK-WRFTVSGLPNGFDQIDFVAVVVVL  199

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
              +T+++C+STKESS+LN+V+T  H++F  F+I+AGF KG  +N           G  P+G
Sbjct  200   TITLIICYSTKESSVLNMVLTAVHIIFIAFVIVAGFCKGDWNNFTHPADPAQPSGFFPYG  259

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             V GV +GA++VY SYIGYD+VSTMAEE+ NP K +P+G+ GSVL+V+ LYCLMA S+  L
Sbjct  260   VSGVFNGASMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVLLVTVLYCLMAASMSKL  319

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             LPY+ I  E  FSAAF+    KW SNV+GVGAS GI+ SLLV+MLGQARY+CV+GR+R+V
Sbjct  320   LPYDAIDPEAPFSAAFR---GKWESNVIGVGASFGILTSLLVSMLGQARYMCVIGRSRVV  376

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+RR
Sbjct  377   PAWFARVHPKTSTPVNASAFLGILTAAIALFTDLNVLLNLVSIGTLFVFYMVANAVIFRR  436

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRL  598
             Y ++    P   L FL   S +S+ F   W       L+ + L +   + +S   +FH  
Sbjct  437   YVVVGTTNPRPTLSFLCSXSLTSIIFVFIWHFAPPGKLKAFMLVVTAAIAVSMLQIFHYQ  496

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP VR+PE W VPLMPW  ++SIFLN+FL+ +++  +Y RFG+++G+  L YV Y VH++
Sbjct  497   VPQVRKPEYWGVPLMPWMPSISIFLNIFLLGSMDKPSYVRFGVFSGVTVLVYVFYSVHAS  556

Query  417   YK  412
             + 
Sbjct  557   FD  558



>ref|XP_010452377.1| PREDICTED: cationic amino acid transporter 6, chloroplastic [Camelina 
sativa]
Length=587

 Score =   451 bits (1160),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 289/541 (53%), Positives = 391/541 (72%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS+TP +L +R ++  T  +E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  23    YLNSLSKTPSRLSRRVISVSTSSEEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMVGAGVF  82

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+R+TFGEF  +
Sbjct  83    VTTGRASRIYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYVRVTFGEFPAF  142

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN+++DYV SNAAVSRSFT YL  A G      WR  V GL +G+N +D  AV ++I
Sbjct  143   FTGANLILDYVFSNAAVSRSFTAYLGSAFGISTSK-WRFFVTGLPKGFNEIDPVAVVVVI  201

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLAPFG  1306
              +T+++C  T+ESS +N++MT FH+ F  F+I+ GF KG S NL      +   G  PFG
Sbjct  202   AITVIICCGTRESSKVNMIMTAFHIAFVLFVIVMGFLKGDSKNLSVPANPEHPSGFFPFG  261

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ NP K +PVG+ GSV IV+ LYCLMA+S+ +L
Sbjct  262   AAGVFNGAAMVYLSYIGYDAVSTMAEEVENPVKDIPVGVSGSVAIVTVLYCLMAVSMSML  321

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  FSAAFK   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  322   LPYDLIDPEAPFSAAFKGSNGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  381

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP   +K+HP T TP+NA+IFLGI  A++ALFT+L +++ ++SIGTL VFY+VA ALI+R
Sbjct  382   VPFCFSKIHPKTSTPVNASIFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANALIFR  441

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +SL F+L WKL      + + L     + ++   +FH 
Sbjct  442   RYVPLQPTKPWTTLSFLALFSITSLVFTLIWKLLPEGKPKAFMLGAIAVVAIAMVLIFHC  501

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP   +PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG+++ L+ L Y++YGVH+
Sbjct  502   MVPQAWKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYARFGVFSCLIVLVYLLYGVHA  561

Query  420   T  418
             +
Sbjct  562   S  562



>ref|XP_010490998.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Camelina sativa]
Length=587

 Score =   450 bits (1157),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 289/541 (53%), Positives = 390/541 (72%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS+TP +L +RA++  T  +E+++VR  SG  M+R L WYDL+ LG+GGM+G GVF
Sbjct  23    YLNSLSETPSRLSRRAVSVSTSSEEMSRVRAVSGEQMRRTLRWYDLIGLGIGGMVGAGVF  82

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+R+TFGEF  +
Sbjct  83    VTTGRASRIYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYVRVTFGEFPAF  142

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN+++DYV SNAAVSRSFT YL  A G      WR  V GL +G+N +D  AV ++I
Sbjct  143   FTGANLILDYVFSNAAVSRSFTAYLGSAFGISTSK-WRFFVTGLPKGFNEIDPVAVVVVI  201

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLAPFG  1306
              +T+++C  T+ESS +N++MT FH+ F  F+I+ GF KG S NL      +   G  PFG
Sbjct  202   AITVIICCGTRESSKVNMIMTAFHIAFVLFVIVMGFLKGDSKNLSVPANPEHPSGFFPFG  261

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ NP K +PVG+ GSV IV+ LYCLMA+S+ +L
Sbjct  262   AAGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPVGVSGSVAIVTVLYCLMAVSMSML  321

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  FSAAFK   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  322   LPYDLIDPEAPFSAAFKGSNGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  381

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP   +K+HP T TP+NA+IFLGI  A +ALFT+L +++ ++SIGTL VFY+VA ALI+R
Sbjct  382   VPFCFSKIHPKTSTPVNASIFLGIFTAILALFTDLNVLLNLVSIGTLFVFYMVANALIFR  441

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +SL F+L+WK       + + L     + ++   +FH 
Sbjct  442   RYVHLQPTKPWTTLSFLALFSITSLVFTLTWKFVPEGKPKAFMLGAIAVVAIAMVLIFHC  501

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP   +PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG+ + L+ L Y++YGVH+
Sbjct  502   MVPQAWKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYARFGVCSCLIVLVYLLYGVHA  561

Query  420   T  418
             +
Sbjct  562   S  562



>ref|XP_009341581.1| PREDICTED: cationic amino acid transporter 7, chloroplastic [Pyrus 
x bretschneideri]
Length=587

 Score =   449 bits (1156),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 282/542 (52%), Positives = 387/542 (71%), Gaps = 13/542 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +L+ TP +L +RA +  T   E++ VR RSG  M++ L W+DLV LG+GGM+G GVF
Sbjct  21    YLRALADTPTRLARRASSVSTSYDEMSAVRARSGPHMQKTLRWFDLVGLGLGGMVGAGVF  80

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGP++ ISY +AG SALLS+ CYTEF+V++PVAGGAFSYLR+TFGEFV +
Sbjct  81    VTTGRASRLYAGPAIVISYAIAGFSALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFVAF  140

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAV+R FT YL  A+G      WR  V  L +G+N  D  AV +++
Sbjct  141   LTGANLVMDYVMSNAAVARGFTAYLGSAIGVPAAK-WRFTVSVLPDGFNQTDVVAVVVVL  199

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
              +T+++C+STKESS+LN+V+T  H++F  F+I+AGF KG  +N           G  P+G
Sbjct  200   TITLIICYSTKESSVLNMVLTAVHIIFIMFVIVAGFCKGDWNNFTHPADPARPSGFFPYG  259

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             V GV +GA++VY SYIGYD+VSTMAEE+ NP K +P+G+ GSVL+V+ LYCLMA S+  L
Sbjct  260   VSGVFNGASMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVLLVTVLYCLMAASMSKL  319

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             LPY+ I  E  FSAAF+    KW SNV+GVGAS GI+ SLLVAMLGQARY+CV+GR+R+V
Sbjct  320   LPYDAIDPEAPFSAAFR---GKWESNVIGVGASFGILTSLLVAMLGQARYMCVIGRSRVV  376

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+RR
Sbjct  377   PGWFARVHPKTSTPVNASAFLGILTAAIALFTDLNVLLNLVSIGTLFVFYMVANAVIFRR  436

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRL  598
             Y ++    P   L FL   S +S+ F   W       L+ + L +   + +S   +FH  
Sbjct  437   YVVVGTTNPRPTLSFLCSFSLTSIIFVFIWHFAPRGKLKAFMLVVTAAIAVSMLQIFHFQ  496

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP VR+PE W VPLMPW  ++SIFLN+FL+ +++  +Y RFG+++G+  L YV Y VH++
Sbjct  497   VPQVRKPEYWGVPLMPWMPSISIFLNIFLLGSMDKPSYVRFGVFSGVTVLVYVFYSVHAS  556

Query  417   YK  412
             + 
Sbjct  557   FD  558



>ref|XP_010931100.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=596

 Score =   449 bits (1155),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 283/543 (52%), Positives = 389/543 (72%), Gaps = 10/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L++TP++L++R  +  T  +E++++R RSG+DM R L W DLV LG+GGM+G GVF
Sbjct  27    YGRALAETPRRLRRRVGSATTTYEEMSRLRARSGSDMARALRWPDLVGLGLGGMVGAGVF  86

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  A + AGP++ +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  87    VTTGRAASQNAGPAIVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  146

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++M+YV SNAAVSRSFT YL   +G      WR+ V GL +G+N +D  AVA+++
Sbjct  147   LTGANLIMEYVFSNAAVSRSFTAYLGTVIGVDTAARWRITVSGLPKGFNQIDLLAVAVVL  206

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLAPFG  1306
             ++T+ +C S KESS+LNLV+T  H+ F  FII+ GF++G S N       ++ GG  P+G
Sbjct  207   IITVCICCSAKESSVLNLVLTSVHLTFILFIIVMGFWRGDSKNFTHPANPENPGGFLPYG  266

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             + GV +GAA+VY SYIGYD+VSTMAEE+ NP++ +P+G+ GSV++V+ LYCLMA S+ +L
Sbjct  267   ISGVFNGAAVVYLSYIGYDAVSTMAEEVKNPTRDIPIGVSGSVVLVTVLYCLMAASMAML  326

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+ I  E  FSAAF +  GW W SNV+G GA  GI+ SLLVAMLGQARYLCV+GR+ +
Sbjct  327   LPYDAIDIEAPFSAAFGRSDGWGWVSNVIGAGAVFGILTSLLVAMLGQARYLCVIGRSSV  386

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP+WLA+VHPST TP+NA++FLG+  A++ALFTEL +++ ++SI TL VFY+VA A+IYR
Sbjct  387   VPAWLARVHPSTSTPVNASVFLGVFTAAIALFTELDVLLNLVSIATLFVFYMVANAVIYR  446

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLP-LFGFLTLSFTAL---FHR  601
             RY       P+  + FL   S +SL F+L W           L G   LS  A+   F  
Sbjct  447   RYVTAGSTNPWPTISFLLCFSFASLSFTLVWNFAPPGRTKALLLGACALSAIAILQAFQL  506

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             LVP  R+PE W VP+MPW  ++SIFLN+FL+ +L   +Y RFG ++ L  L YV Y VH+
Sbjct  507   LVPQARKPEFWGVPMMPWIPSISIFLNLFLLGSLGRPSYVRFGCFSVLAILVYVFYSVHA  566

Query  420   TYK  412
             ++ 
Sbjct  567   SFD  569



>ref|XP_007214662.1| hypothetical protein PRUPE_ppa003270mg [Prunus persica]
 gb|EMJ15861.1| hypothetical protein PRUPE_ppa003270mg [Prunus persica]
Length=588

 Score =   448 bits (1153),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 390/545 (72%), Gaps = 13/545 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  YL +L+QTP +L +RA +  T   E++ VR RSG+DM++ L W+DLV LGVGGM+G 
Sbjct  18    FRAYLRALAQTPARLARRARSVSTSYDEMSGVRARSGSDMQKTLRWFDLVGLGVGGMVGA  77

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG  +R  AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF
Sbjct  78    GVFVTTGHASRLYAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEF  137

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN++MDYV+SNAAVSR FT YL  A+G      WR  +  L +G+N +D  AV 
Sbjct  138   SAFLTGANLVMDYVMSNAAVSRGFTAYLGTAIGVPAAK-WRFTLSALPDGFNQIDVVAVV  196

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLA  1315
             +++ +T+++C+ST+ESS+LN+V+T  H++F  F++I GF  G   N  +        G  
Sbjct  197   VVLTITLIICYSTRESSVLNMVLTAVHIIFIMFMVILGFCTGDWKNFTEPADPAHRAGFF  256

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             P GV GV +GA++VY SYIGYD+VSTMAEE+ NP K +P+G+ GSVL+V+ LYCLMA S+
Sbjct  257   PNGVSGVFNGASMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVLLVTVLYCLMAASM  316

Query  1134  cllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
              +LLPY+LI  E  FSAAF+    KW SN++G GAS GI+ SLLVAMLGQARY+CV+GR+
Sbjct  317   SMLLPYDLIDPEAPFSAAFR---GKWESNLIGAGASFGILTSLLVAMLGQARYMCVLGRS  373

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              +VP W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I
Sbjct  374   SVVPVWFARVHPKTSTPVNASAFLGILTAAIALFTDLNVLLNLVSIGTLFVFYMVANAVI  433

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALF  607
             +RRY ++    P   L FL   S +S+ FS  W+      L+ + L +   + +S   +F
Sbjct  434   FRRYVVVGTTNPRPTLSFLCSFSLTSIIFSFIWQFMPPGKLKAFMLCVTAAIAISMLQIF  493

Query  606   HRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
             H +VP VR+PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG+++ +  L YV Y V
Sbjct  494   HCMVPQVRKPEFWGVPLMPWLPSISIFLNIFLLGSLDRPSYIRFGVFSAVAVLVYVFYSV  553

Query  426   HSTYK  412
             H+++ 
Sbjct  554   HASFD  558



>ref|XP_011076844.1| PREDICTED: cationic amino acid transporter 7, chloroplastic [Sesamum 
indicum]
Length=585

 Score =   448 bits (1152),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 297/550 (54%), Positives = 403/550 (73%), Gaps = 17/550 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F +YL +LS TP +L +RA +  T  +E ++VR RSG+DMKR L WYDLV LGVGGM+G 
Sbjct  11    FKSYLRALSDTPNRLSRRACSISTSLEETSRVRARSGSDMKRTLRWYDLVGLGVGGMVGA  70

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG  +R  AGP+V +SY +AGL ALLS+ CYTEF+V++PVAGGAFSY+R+TFGEF
Sbjct  71    GVFVTTGHASRLCAGPAVVLSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYIRVTFGEF  130

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             + +  G+N+++DYVLSNAAV+R FT+YL  ALG       R  + GL +GYN +D  AVA
Sbjct  131   LAFLTGSNLIIDYVLSNAAVARGFTDYLGTALGLSTHTQLRFTIHGLPKGYNEIDLIAVA  190

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLA  1315
             +++LLT+V+C+ST+ESS LN+V+T+ H++F  F+I+ GF++G  +N       K+ GG  
Sbjct  191   VVLLLTLVICYSTRESSWLNMVLTVLHILFIVFVIVVGFWRGDWNNFTEPGNPKNAGGFF  250

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             PFG  GV +GAA+VY SYIGYD+VSTMAEE+ +P K++P+G+ GSV++V+ LYCLMA S+
Sbjct  251   PFGASGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKNIPIGVSGSVILVTILYCLMAASM  310

Query  1134  cllLPYNLIPEEGSFSAAFK--MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVG  961
               LLPY++I  E  FS AF+    GW+W SNV+GVGAS GI+ SLLVAMLGQARY+CV+G
Sbjct  311   SALLPYDMIDPEAPFSGAFREGSSGWRWVSNVIGVGASFGILTSLLVAMLGQARYMCVIG  370

Query  960   RARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaa  781
             R+ +VPSW A+VH ST TP+NA+ FLGI  A++ALFT+L I+++ +SIGTL +FY+VA A
Sbjct  371   RSCVVPSWFARVHHSTSTPVNASAFLGIFTAAIALFTDLNILLKFVSIGTLFIFYMVANA  430

Query  780   liyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTA----  613
             +IYRRY  +    P+  L FLF  S +S+ F+L W+        P  GF+  S TA    
Sbjct  431   VIYRRYVTVGTTNPWPTLSFLFCFSLTSVIFTLLWQFAPS--GKPK-GFMLGSCTAVAIG  487

Query  612   ---LFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFY  442
                LFH +VP  R+PE W VPLMPW  ++SIFLN+FL+  L+  +Y RFG ++ L+ L Y
Sbjct  488   IVQLFHFMVPQARKPEFWGVPLMPWIPSISIFLNIFLLGALDRPSYVRFGFFSALVVLVY  547

Query  441   VVYGVHSTYK  412
             V+Y VHS++ 
Sbjct  548   VLYSVHSSFD  557



>ref|XP_010423539.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Camelina sativa]
Length=588

 Score =   447 bits (1150),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 288/541 (53%), Positives = 388/541 (72%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS+TP +L +R ++  T   E+++VR  S   M+R L WYDL+ LG+GGM+G GVF
Sbjct  24    YLNSLSETPSRLSRRVISVSTSSDEMSRVRAASDEQMRRTLRWYDLIGLGIGGMVGAGVF  83

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+R+TFGEF  +
Sbjct  84    VTTGRASRIYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYVRVTFGEFPAF  143

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN+++DYV SNAAVSRSFT YL  A G      WR  V GL +G+N +D  AV ++I
Sbjct  144   FTGANLILDYVFSNAAVSRSFTAYLGSAFGISTSK-WRFFVTGLPKGFNEIDPVAVVVVI  202

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLAPFG  1306
              +T+++C  T+ESS +N++MT FH+ F  F+I+ GF KG S NL      +   G  PFG
Sbjct  203   AITVIICCGTRESSKVNMIMTAFHIAFVLFVIVMGFLKGDSKNLSVPANPEHPSGFFPFG  262

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ NP K +PVG+ GSV IV+ LYCLMA+S+ +L
Sbjct  263   AAGVFNGAAMVYLSYIGYDAVSTMAEEVENPVKDIPVGVSGSVAIVTVLYCLMAVSMSML  322

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  FSAAFK   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  323   LPYDLIDPEAPFSAAFKGSNGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  382

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP   +K+HP T TP+NA+IFLGI  A +ALFT+L +++ ++SIGTL VFY+VA ALI+R
Sbjct  383   VPFCFSKIHPKTSTPVNASIFLGIFTAILALFTDLNVLLNLVSIGTLFVFYMVANALIFR  442

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S +SL F+L WKL      + + L     + ++   +FH 
Sbjct  443   RYVPLQPTKPWTTLSFLALFSITSLVFTLIWKLVPEGKPKAFMLGAIAVVAIAMVLIFHC  502

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP   +PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG+++ L+ L Y++YGVH+
Sbjct  503   MVPQAWKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYARFGVFSCLIVLVYLLYGVHA  562

Query  420   T  418
             +
Sbjct  563   S  563



>gb|KFK38452.1| hypothetical protein AALP_AA3G115100 [Arabis alpina]
Length=584

 Score =   446 bits (1148),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 286/543 (53%), Positives = 384/543 (71%), Gaps = 11/543 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL+SLS TP +  +RAL+  T   E++++R  SG  M+R L WYDLV LG+GGM+G GVF
Sbjct  20    YLHSLSDTPSRFSRRALSVSTSYDEMSRIRSVSGEQMRRTLRWYDLVGLGIGGMIGAGVF  79

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+RITFGEF  +
Sbjct  80    VTTGRASRLFAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRITFGEFPAF  139

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT YL  A G      WR  V  L  G+N +D  AV +++
Sbjct  140   LTGANLIMDYVMSNAAVSRGFTAYLGSAFGISTSK-WRFVVSSLPIGFNEIDPIAVIVVL  198

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
              +T ++C+STKESS LN+V+T  H+ F  F+I+ GF+KG   NL +        G  PFG
Sbjct  199   AVTFIICYSTKESSKLNMVLTALHIAFIVFVIVMGFWKGEVKNLTRPDNPENPSGFFPFG  258

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+GI GSV+IV  LYCLMA+S+ +L
Sbjct  259   ASGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGSVVIVIVLYCLMAVSMSML  318

Query  1125  LPYNLIPEEGSFSAAF-KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  +S AF K  GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  319   LPYDLIDPEAPYSTAFSKSEGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  378

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP+W A VHP T TP+NA++FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+R
Sbjct  379   VPAWFAMVHPKTSTPVNASVFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANAVIFR  438

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLN----LQWWNLPLFGFLTLSFTALFHR  601
             RY ++    P+  L FL L S +S+ F+L  KL      +W+ L       ++   +FH 
Sbjct  439   RYVVVGYTKPWPTLSFLCLFSITSIVFTLVCKLAPPGPPKWFMLGACTVAAIAIVQIFHC  498

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP    PE W VPLMPW   +SIFLN+FL+ +L+  +Y RFG ++GL  + YV Y VH+
Sbjct  499   VVPQAMIPEFWGVPLMPWTPCVSIFLNIFLLGSLDAPSYIRFGFFSGLAVIVYVFYSVHA  558

Query  420   TYK  412
             +Y 
Sbjct  559   SYD  561



>ref|XP_008799668.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Phoenix dactylifera]
Length=594

 Score =   447 bits (1149),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 281/539 (52%), Positives = 388/539 (72%), Gaps = 11/539 (2%)
 Frame = -2

Query  2001  SLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfVTT  1822
             +L++TP++L++R  +  T  +E+++VR RSG+DM R L W DLV LG+GGM+G GVFVTT
Sbjct  27    ALAETPRRLRRRVGSVTTTYEEMSRVRARSGSDMARALRWPDLVGLGLGGMVGAGVFVTT  86

Query  1821  GPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYFAG  1642
             G  AR+ AGP++ +SY +AG  ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +  G
Sbjct  87    GRAARQNAGPAIVVSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAFLTG  146

Query  1641  ANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliillt  1462
             AN++M+YVLSNAA +RSFT YL   +G      WR+ V GL +G+N +D  AVA+++++T
Sbjct  147   ANLIMEYVLSNAAAARSFTAYLGTVIGVDTAARWRITVSGLPKGFNQIDLLAVAVVLIIT  206

Query  1461  ivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV------KSGGGLAPFGVR  1300
             + +C+STKESS+LNLV+T  H+ F  FII+ GF++G S N        ++ GG  P+G+ 
Sbjct  207   VCICYSTKESSVLNLVLTSVHLAFIMFIIVMGFWRGDSKNFTHPANPEENPGGFFPYGIS  266

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV +GAA+VY SYIGYD+VSTMAEE+ NP++ +P+G+ GSV++V+ LYCLMA S+ +LLP
Sbjct  267   GVFNGAALVYLSYIGYDAVSTMAEEVKNPTRDIPIGVSGSVVLVTVLYCLMAASMVMLLP  326

Query  1119  YNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVP  943
             Y+ I  E  FSAAF    GW W SNV+G GA  GI+ SLLVAMLGQARYLCV+GR+ +VP
Sbjct  327   YDAIDIEAPFSAAFTGSDGWGWVSNVIGAGAVFGILTSLLVAMLGQARYLCVIGRSSVVP  386

Query  942   SWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrry  763
             +W A+VHPST TP+NA+ FLG+  A++ALFTEL +++ ++SIGTL VFY+VA A+IYRRY
Sbjct  387   AWFARVHPSTSTPVNASAFLGVFTAAIALFTELDVLLSLVSIGTLFVFYMVANAVIYRRY  446

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLP-LFGFLTLSFTAL---FHRLV  595
                    P+  + FL   S +SL F+L W           L G   +S  A+   F  LV
Sbjct  447   VTAGSTNPWPTISFLLCFSFASLAFTLVWNFAPPGRTKALLLGACAVSAIAILQAFQLLV  506

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             P  R+PE W VPLMPW  ++S+FLN+FL+ +L+  ++ RFG ++ L  L YV Y VH++
Sbjct  507   PQARKPEFWGVPLMPWIPSISVFLNLFLLGSLDRPSFVRFGFFSVLAVLVYVFYSVHAS  565



>gb|EYU37209.1| hypothetical protein MIMGU_mgv1a024374mg, partial [Erythranthe 
guttata]
Length=570

 Score =   446 bits (1147),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 291/550 (53%), Positives = 395/550 (72%), Gaps = 14/550 (3%)
 Frame = -2

Query  2028  PEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggm  1849
             P+I   YL +LS TP +  + A + +T  +E ++ R RSG  MKR L W+DLV  G+GGM
Sbjct  1     PQI---YLRALSDTPNRPPRSAGSMYTSSEETSRARARSGPTMKRSLRWHDLVGFGIGGM  57

Query  1848  lgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITF  1669
             +G GVFVT+G  +R  AGP+V +SY +AGL ALLS+ CYTEF+VE+PVAGGAFSY+R+TF
Sbjct  58    VGAGVFVTSGRASRLYAGPAVVLSYAIAGLCALLSAFCYTEFAVEMPVAGGAFSYIRVTF  117

Query  1668  GEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFP  1489
             GEF+ +  GAN+++DYVLSNAAV+R FT YL  ALG       R  +  L +GYN +D  
Sbjct  118   GEFLAFLTGANLIIDYVLSNAAVARGFTAYLGTALGLSTRTHLRFTIRTLPDGYNEMDLI  177

Query  1488  avaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGG  1324
             AVA+I+LLT+V+C+ST+ESS LN+V+T+ H++F  F+I+ GF++G   N       K+ G
Sbjct  178   AVAVILLLTLVICYSTRESSWLNMVLTVVHILFIVFVIVVGFWRGEWKNFTEPANPKNPG  237

Query  1323  GLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclma  1144
             G  PFGV GV +GAA+VY SYIGYD+VSTMAEE+ +P K++P+GI GSV++V+ LYCLMA
Sbjct  238   GFFPFGVSGVFNGAAMVYLSYIGYDAVSTMAEEVKDPEKNIPIGISGSVVLVTVLYCLMA  297

Query  1143  lslcllLPYNLIPEEGSFSAAFK--MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLC  970
              S+  LLPY++I  E  FS AFK    GW+W SN++GVGAS GI+ SLLVAMLGQARY+C
Sbjct  298   ASMSALLPYDMIDPEAPFSGAFKNGSAGWRWVSNIIGVGASFGILTSLLVAMLGQARYMC  357

Query  969   VVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylv  790
             V+GR+ +VP+W AKV+ ST TP+NA+ FLGI  A++ALFT+L I++ ++SIGTL VFY+V
Sbjct  358   VIGRSCVVPTWFAKVNASTSTPVNASAFLGIFTAAIALFTDLNILLNLVSIGTLFVFYMV  417

Query  789   aaaliyrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLS  622
             A A+IYRRY       P+  L FLF  S +SL F+L W+       + + L     + + 
Sbjct  418   ANAVIYRRYVNHGATNPWPTLSFLFCFSLTSLIFTLLWQFTPSGKTKAFMLGSCIIVAIF  477

Query  621   FTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFY  442
                LFH +VP  R+PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG ++GL  L Y
Sbjct  478   VVQLFHFMVPQARKPEFWGVPLMPWIPSVSIFLNIFLLGSLDRPSYVRFGFFSGLTVLVY  537

Query  441   VVYGVHSTYK  412
             V+Y VHS++ 
Sbjct  538   VMYSVHSSFD  547



>ref|XP_010912336.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Elaeis guineensis]
Length=594

 Score =   446 bits (1148),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 281/557 (50%), Positives = 394/557 (71%), Gaps = 14/557 (3%)
 Frame = -2

Query  2049  TAVSRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlv  1870
             TA S + P     Y  +L++TP++L++RA +  T  +E+++VR RSG  M R+L W DLV
Sbjct  14    TASSFASPR---AYGRALAETPRRLRRRAGSVTTTYEEMSRVRARSGPGMARELRWPDLV  70

Query  1869  algvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAF  1690
              LG+GGM+G GVFV TG   R  AGP+V +SY +AGL ALLS+ CYTEF+V++P+AGGAF
Sbjct  71    GLGLGGMVGAGVFVATGRATRLKAGPAVVVSYAIAGLCALLSAFCYTEFAVDMPIAGGAF  130

Query  1689  SYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEG  1510
             SYLR+TFGEF  +  GAN++M+YV SNAAV+RSFT YL  A+G      WR+ V GL +G
Sbjct  131   SYLRVTFGEFAAFLTGANLIMEYVFSNAAVARSFTTYLGTAIGVDAAARWRITVSGLPKG  190

Query  1509  YNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV--  1336
             +N +D  AV +++++++ +C+STKESS+LNLV+T  H+ F  FII+ GF++G   N    
Sbjct  191   FNQIDLLAVTIVLIVSVCICYSTKESSVLNLVLTSIHIAFILFIILMGFWRGDWKNFTHP  250

Query  1335  ----KSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIV  1168
                 K+ GG  P+G  GV +GAA+VY SYIGYD+VSTMAEE+ NP++ +P+G+ GSV++V
Sbjct  251   ANPAKNAGGFFPYGASGVFNGAAMVYLSYIGYDAVSTMAEEVKNPTRDIPIGVSGSVVLV  310

Query  1167  salyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAML  991
             + LYCLMA SL +LLPY+ I  E  FS AF    GW+W SNV+G GA  GI+ SLLV+ML
Sbjct  311   TVLYCLMAASLAMLLPYDAIDTESPFSGAFSGSDGWRWVSNVIGAGAGFGILTSLLVSML  370

Query  990   GQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGT  811
             GQARYLCV+GR+ +VP+WLA+VHPST TP+NA+ FLG+  A++AL TEL +++ ++SIGT
Sbjct  371   GQARYLCVIGRSNVVPAWLARVHPSTATPVNASAFLGVFTAAIALITELDVLLNLVSIGT  430

Query  810   LVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPL  643
             L VFY+VA A+IYRRY ++    P+  + FL   +S+ L  +L+W+       +   L  
Sbjct  431   LFVFYMVANAVIYRRYVVVGSTNPWPTISFLLCFTSACLALTLAWRFAPPGRTKALLLVG  490

Query  642   FGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWT  463
             F    ++    F  LVP  R PE W VPLMPW  ++SIFLN+FL+ +L+ ++Y RFG ++
Sbjct  491   FAVAAIALVQAFLVLVPQAREPEFWGVPLMPWIPSISIFLNLFLLGSLDGRSYIRFGFFS  550

Query  462   GLMSLFYVVYGVHSTYK  412
              L  L YV+Y VH+++ 
Sbjct  551   VLAVLVYVLYSVHASFD  567



>ref|XP_008231821.1| PREDICTED: cationic amino acid transporter 6, chloroplastic [Prunus 
mume]
Length=587

 Score =   446 bits (1146),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 390/545 (72%), Gaps = 13/545 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  YL +L+QTP +L +RA +  T   E++ VR RSG+DM++ L W+DLV LGVGGM+G 
Sbjct  17    FRAYLRALAQTPARLARRAGSVSTSYDEMSGVRARSGSDMQKTLRWFDLVGLGVGGMVGA  76

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG  +R  AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF
Sbjct  77    GVFVTTGHASRLYAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEF  136

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN++MDYV+SNAAVSR FT YL  A+G      WR  +  L +G+N +D  AV 
Sbjct  137   AAFLTGANLVMDYVMSNAAVSRGFTAYLGTAIGVPAAK-WRFTLSALPDGFNQIDVVAVV  195

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLA  1315
             +++ +T+++C+ST+ESS+LN+V+T  H++F  F+II GF  G   N  +        G  
Sbjct  196   VVLTITLIICYSTRESSVLNMVLTAVHIIFIMFMIILGFCTGDWKNFTEPADPAHPAGFF  255

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             P GV GV +GA++VY SYIGYD+VSTMAEE+ NP K +P+G+ GSVL+V+ LYCLMA S+
Sbjct  256   PNGVSGVFNGASMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVLLVTVLYCLMAASM  315

Query  1134  cllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
              +LLPY+LI  E  F AAF+    KW SN++G GAS GI+ SLLVAMLGQARY+CV+GR+
Sbjct  316   SMLLPYDLIDPEAPFPAAFR---GKWESNLIGAGASFGILTSLLVAMLGQARYMCVLGRS  372

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              +VP+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I
Sbjct  373   SVVPAWFARVHPKTTTPVNASAFLGILTAAIALFTDLNVLLNLVSIGTLFVFYMVANAVI  432

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALF  607
             +RRY ++    P   L FL   S +S+ FS  W+      L+ + L +   + +S   +F
Sbjct  433   FRRYVVVGTTNPRPTLSFLCSFSLTSIIFSFIWQFMPPGKLRAFMLCVTAAIAISMLQIF  492

Query  606   HRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
             H +VP VR+PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG+++ +  L YV Y V
Sbjct  493   HCMVPQVRKPEFWGVPLMPWLPSISIFLNIFLLGSLDRPSYVRFGVFSAVAVLVYVFYSV  552

Query  426   HSTYK  412
             H+++ 
Sbjct  553   HASFD  557



>gb|KEH44284.1| cationic amino acid transporter [Medicago truncatula]
Length=582

 Score =   445 bits (1145),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 278/542 (51%), Positives = 389/542 (72%), Gaps = 10/542 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL ++++TP +  +R  +  T  +E+++VR RSG  M++ L W+DLV+ G+GGM+G GVF
Sbjct  14    YLQAVAKTPSRFARRGFSVSTSYEEMSRVRARSGNSMRKSLRWFDLVSFGIGGMVGAGVF  73

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG   R  AGPSV +SY +AG  ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  74    VTTGHATRVHAGPSVVLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  133

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAV+R FT+Y+   +G  +   WR+ V    EG+N +D  AV +++
Sbjct  134   ITGANLIMDYVMSNAAVARGFTKYVGTTVGVSSAK-WRITVPSFPEGFNQIDLVAVVVVL  192

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
             L+T+V+C+STKESS++N+++T  H++F  F+I+ GF+KGS  NL +        G  P G
Sbjct  193   LITVVICYSTKESSVVNMILTGLHILFIAFVIVIGFWKGSWKNLTQPANPENPSGFFPHG  252

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV  GA+ VY SYIGYD+VSTMAEE+  P K +P+G+ GSV+IV+ LYCLMA S+C+L
Sbjct  253   AAGVFKGASAVYLSYIGYDAVSTMAEEVKEPVKDIPIGVSGSVIIVTILYCLMAASMCML  312

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             LPY++I  E  FSAAFK  GW WAS V+GVGAS GI+ SL+VAMLGQARY+CV+GR+ +V
Sbjct  313   LPYDMIDPEAPFSAAFKSDGWGWASRVIGVGASFGILTSLIVAMLGQARYMCVIGRSNVV  372

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P+W AKVHP T TP+NA+ FLGI  A++ALFT+L ++++++SIGTL VFY+VA A++YRR
Sbjct  373   PAWFAKVHPKTSTPVNASAFLGIFTAAIALFTDLDVLLDLVSIGTLFVFYMVANAVVYRR  432

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRL  598
             Y +     P+  + FL   S +S+ F+L WK       +   L   G L +    LFH  
Sbjct  433   YVVAGTTNPWPTVSFLLSFSFTSIMFTLIWKCVPTGVAKAGMLSACGVLAVVILQLFHFT  492

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R+PE W VPLMPW  A+SIFLN+FL+ +L+  +Y RFG+++ +  LFY+ Y VH++
Sbjct  493   VPQARKPEFWGVPLMPWIPAISIFLNLFLLGSLDGPSYVRFGVFSAVAVLFYIFYSVHAS  552

Query  417   YK  412
             + 
Sbjct  553   FD  554



>ref|NP_001053455.1| Os04g0543600 [Oryza sativa Japonica Group]
 dbj|BAF15369.1| Os04g0543600, partial [Oryza sativa Japonica Group]
Length=444

 Score =   439 bits (1130),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 283/426 (66%), Positives = 348/426 (82%), Gaps = 11/426 (3%)
 Frame = -2

Query  1668  GEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFP  1489
             GE VG+F GANILM+YVLSNAAV+RSFT+YL+   G   PD WR++VDG+ +GYN LDFP
Sbjct  4     GELVGFFGGANILMEYVLSNAAVARSFTDYLASTCGITEPDAWRIQVDGIAKGYNALDFP  63

Query  1488  avaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPF  1309
             AVALI++LT+ LC+STKES++LN+V+T+FH++FF FII+AG + GS+ NLV S  GLAP+
Sbjct  64    AVALILVLTLCLCYSTKESAMLNMVITVFHLLFFVFIILAGLWNGSARNLV-SPHGLAPY  122

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             GVRGVLDGAAIVYFSYIGYDS STMAEEI +P+++LPVGI GSVL+VSALYCLM+L+LC 
Sbjct  123   GVRGVLDGAAIVYFSYIGYDSASTMAEEIRDPARALPVGIAGSVLVVSALYCLMSLALCA  182

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             +LPY  I E   FSA F+   GW+WA +VVG GASLGIVASLLVAMLGQARYLCV+ RAR
Sbjct  183   MLPYTEIAESAPFSAVFREKAGWEWAGSVVGAGASLGIVASLLVAMLGQARYLCVIARAR  242

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             LVP+WLAKVHPSTGTP+NATIFLG+C AS+ALFTEL++V E+ISIGTL+VFYLVA ALIY
Sbjct  243   LVPAWLAKVHPSTGTPMNATIFLGLCTASIALFTELQVVFEMISIGTLLVFYLVANALIY  302

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKLNLQW-WNLPLFGFLTLSFTALFHRLV  595
              RYA +  N    VLLFL +++ SSLGFSLS +++ Q  W + LFG  +++ TA+FH   
Sbjct  303   HRYAKLGANRSLHVLLFLLILTLSSLGFSLSRRIHGQCRWGMALFGATSVTITAMFH---  359

Query  594   PCVRR-----PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
               VRR     P  W VPLMPWPAA S+FLNVFLMTTL V +++RFG+W+ ++ +FYV YG
Sbjct  360   CAVRRDMPEPPSEWMVPLMPWPAAASVFLNVFLMTTLKVMSFQRFGLWSFVIIVFYVCYG  419

Query  429   VHSTYK  412
             VHSTY 
Sbjct  420   VHSTYS  425



>ref|XP_011024173.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Populus euphratica]
Length=586

 Score =   444 bits (1142),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 280/546 (51%), Positives = 390/546 (71%), Gaps = 12/546 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             ++Y+ +L+QTP +  +RA +  T  +E ++V+ RSG+DM+R L WYDLV  G+GGM+G G
Sbjct  13    NSYIQALAQTPARFARRAGSVSTSYEETSRVKARSGSDMQRTLRWYDLVGFGIGGMVGAG  72

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTG  +R  AGPSV ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF 
Sbjct  73    VFVTTGRASRVCAGPSVIISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFA  132

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +  GAN++MDYV+SNAAV+RSFT YL  A+G      WRV V  L +G+N +D  AV +
Sbjct  133   AFLTGANLIMDYVMSNAAVARSFTAYLGSAIGISTSK-WRVVVHVLPDGFNEIDIFAVLV  191

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLAP  1312
             ++ +T+++C+ST+ESS++N+V+T  H++F GF+I+ GF+KG   N       K+  G  P
Sbjct  192   VLAITLIICYSTRESSVVNMVLTALHILFIGFVILIGFWKGDRKNFTEPADPKNPSGFFP  251

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
             FG  GV +GAA+VY SYIGYD+VST+AEE+ NP K +P+G+ GSV+IV+ LYCLM+ S+ 
Sbjct  252   FGASGVFNGAAMVYLSYIGYDAVSTLAEEVHNPVKDIPIGVSGSVIIVTVLYCLMSASMS  311

Query  1131  llLPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGR  958
             +LLPY++I  +  FSAAF  K  GWKW SN++G+GAS GI+ SLLVAMLGQARY+CV+GR
Sbjct  312   MLLPYDMIDADAPFSAAFRGKSDGWKWVSNLIGMGASFGILTSLLVAMLGQARYMCVIGR  371

Query  957   ARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal  778
             + +VP+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+
Sbjct  372   SNVVPAWFARVHPKTSTPVNASAFLGIFTAAIALFTDLNVLLNLVSIGTLFVFYMVANAV  431

Query  777   iyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWN----LPLFGFLTLSFTAL  610
             ++RRY  I    P+  L FL   S +S+ F+L W    Q       L     + ++   L
Sbjct  432   VHRRYVAIGTTNPWPTLAFLCSFSLTSILFTLIWHFMPQGKGKAVMLGACAVIAIAIIQL  491

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
             F   VP   +PE W VPLMPW   +SIFLN+FL+ +L   +Y RF  ++ L  L YV+Y 
Sbjct  492   FRCSVPLASKPEFWGVPLMPWIPCVSIFLNIFLLGSLGGPSYVRFVFFSALAVLVYVLYS  551

Query  429   VHSTYK  412
             VH+++ 
Sbjct  552   VHASFD  557



>gb|KDP43675.1| hypothetical protein JCGZ_24133 [Jatropha curcas]
Length=601

 Score =   444 bits (1143),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 280/545 (51%), Positives = 385/545 (71%), Gaps = 12/545 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F +YL + SQTP +  +RA +  T  +E+++V+ RSG +M++ L WYDLV  G+GGM+G 
Sbjct  23    FMSYLRAFSQTPTRFARRAGSVSTSYEEMSRVKARSGPEMQKTLRWYDLVGFGIGGMVGA  82

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG  +R  AGP+V +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF
Sbjct  83    GVFVTTGRASRLYAGPAVVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEF  142

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN++MDYV+SNAAV+R FT YL  A+G      WR+ V  L  G+N +D  AV 
Sbjct  143   AAFLTGANLIMDYVMSNAAVARGFTAYLGTAIGLSTSK-WRLVVHALPNGFNEIDMVAVL  201

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLA  1315
             +++ +T ++C+ST+ESS++N+V+T  H++F  F+I+ GF+KG   N  +        G  
Sbjct  202   VVLAITFIICYSTRESSVVNMVLTALHILFIAFVILVGFWKGDWKNFTEPANPQNPSGFF  261

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             PFG  GV +GAA+VY SYIGYD+VST+AEE+ NP K +P+G+ GSV +V+ LYCLMA S+
Sbjct  262   PFGAPGVFNGAAMVYLSYIGYDAVSTLAEEVHNPVKDIPIGVSGSVALVTILYCLMAASM  321

Query  1134  cllLPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVG  961
               LLPY+LI  E  FSAAF  K  GW+W SNV+GVGAS GI+ SLLV+MLGQARY+CV+G
Sbjct  322   SKLLPYDLIDAEAPFSAAFRGKSDGWEWVSNVIGVGASFGILTSLLVSMLGQARYMCVIG  381

Query  960   RARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaa  781
             R+ +VP W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A
Sbjct  382   RSSVVPEWFARVHPRTSTPVNASAFLGIFTAAIALFTDLNVLLNLVSIGTLFVFYMVANA  441

Query  780   liyrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTA  613
             +IYRRY +I    P+  L FL   S +SL F+L W      N + + L       ++   
Sbjct  442   VIYRRYIVIGTTNPWPTLSFLCSFSFTSLLFTLIWHFMPQGNSKAFMLGACAATAIAMVQ  501

Query  612   LFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVY  433
             +FH +VP  R+PE W VPLMPW   +SIFLN+FL+ +L+  +Y RF  ++ L  L YV Y
Sbjct  502   VFHCIVPQARKPEFWGVPLMPWIPCVSIFLNIFLLGSLDGPSYLRFAFFSALAVLVYVFY  561

Query  432   GVHST  418
              VH++
Sbjct  562   SVHAS  566



>ref|XP_009416875.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=600

 Score =   443 bits (1139),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 279/544 (51%), Positives = 387/544 (71%), Gaps = 11/544 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L++T ++L +RA +  T  +E+++VR RSGADM R L W DLV  G+GGM+G GVF
Sbjct  29    YGRALAETHRRLGRRAASVTTTYEEMSRVRARSGADMARSLRWPDLVGFGLGGMVGAGVF  88

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  AGP++ +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  89    VATGRAARLYAGPAIVLSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  148

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++M+YV SNAAV+RSFT YL  A+G      WR+ + GL +G+N +D  AVA+I+
Sbjct  149   LTGANLIMEYVFSNAAVARSFTAYLGTAIGVDTAAKWRIIIIGLPKGFNQIDLLAVAVIV  208

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNL------VKSGGGLAPF  1309
             L+++ +C+STKESS+LN+V+T  H+ F  FII+ GF++G   NL       +S GG  P+
Sbjct  209   LISMCICYSTKESSVLNMVLTAIHIAFILFIIVMGFWRGDVRNLTHPANPAESRGGFLPY  268

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             GV GV +GAA+VY SYIGYD+VSTMAEE+  P++ +P+G+ GSV +V+ LYCLMA+S+ +
Sbjct  269   GVAGVFNGAAMVYLSYIGYDAVSTMAEEVRKPARDIPIGVSGSVALVALLYCLMAVSMSM  328

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             L+PY+ I +E  FSAAF+   GW W SNV+G GAS GI+ SLLV+MLGQARYLCV+GR+ 
Sbjct  329   LVPYDAIDKESPFSAAFRGSDGWGWVSNVIGAGASFGILTSLLVSMLGQARYLCVIGRSS  388

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP+WLA+VHP T TP+NA+ FLG   A +AL T+L +++ ++SIGTL VFY+V+ A++Y
Sbjct  389   VVPAWLAQVHPKTSTPVNASAFLGAFTAVIALLTDLDVLLNLVSIGTLFVFYMVSNAVVY  448

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKLN-LQWWNLPLFGFLTLSFTA---LFH  604
             RRY  +    P+  + FL   S  SL  +L W+          L G  T+   A   +F+
Sbjct  449   RRYVTVGSTNPWPTISFLLAFSFVSLTITLIWRFAPAGLAKAVLLGGCTVVAVAVLQVFN  508

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              LVP  R+PE W VPLMPW  A+S+FLNVFL+ +L+  +Y RFG ++    L YV Y VH
Sbjct  509   SLVPQARKPEHWGVPLMPWVPAVSVFLNVFLLGSLDGPSYVRFGFFSVFAVLVYVFYSVH  568

Query  423   STYK  412
             +++ 
Sbjct  569   ASFD  572



>ref|XP_002316491.1| cationic amino acid transporter 6 family protein [Populus trichocarpa]
 gb|EEF02662.1| cationic amino acid transporter 6 family protein [Populus trichocarpa]
Length=600

 Score =   442 bits (1138),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 284/560 (51%), Positives = 394/560 (70%), Gaps = 26/560 (5%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             ++Y+ +L+QTP +  +RA +  T  +E+++V+ RSG+DM+R L WYDLV  G+GGM+G G
Sbjct  13    NSYIQALAQTPARFARRAGSVSTSYEEMSRVKARSGSDMQRTLRWYDLVGFGIGGMVGAG  72

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTG  +R   GPSV ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF 
Sbjct  73    VFVTTGRASRVCTGPSVIISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFA  132

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +  GAN++MDYV+SNAAV+RSFT YL  A+G      WRV V  L +G+N +D  AV +
Sbjct  133   AFLTGANLIMDYVMSNAAVARSFTAYLGSAIGISTSK-WRVVVHVLPDGFNEIDIFAVLV  191

Query  1476  iilltivLCHS--------------TKESSLLNLVMTifhvvffgfiiiagFYKGSSDNL  1339
             ++ +T+++C+S              T+ESS++N+V+T  H++F GF+I+ GF+KG   N 
Sbjct  192   VLAITLIICYSFRLLNMTSLFLVDSTRESSVVNMVLTALHILFIGFVILMGFWKGDWKNF  251

Query  1338  V-----KSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVL  1174
                   K+  G  PFG  GV +GAA+VY SYIGYD+VST+AEE+ NP K +P+G+ GSV+
Sbjct  252   TEPADPKNPSGFFPFGAPGVFNGAAMVYLSYIGYDAVSTLAEEVHNPVKDIPIGVSGSVI  311

Query  1173  IVsalyclmalslcllLPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLV  1000
             IV+ LYCLM+ S+ +LLPY++I  +  FSAAF  K  GWKW SNV+G+GAS GI+ SLLV
Sbjct  312   IVTVLYCLMSASMSMLLPYDMIDADAPFSAAFRGKSDGWKWVSNVIGIGASFGILTSLLV  371

Query  999   AMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIIS  820
             AMLGQARY+CV+GR+ +VP+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++S
Sbjct  372   AMLGQARYMCVIGRSNVVPAWFARVHPKTSTPVNASAFLGIFTAAIALFTDLNVLLNLVS  431

Query  819   IGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQW----WN  652
             IGTL VFY+VA A++YRRY  I    P+  L FL   S +S+ F+L W    Q     + 
Sbjct  432   IGTLFVFYMVANAVVYRRYVAIGTTNPWPTLAFLCSFSLTSILFTLIWHFMPQGKGKAFM  491

Query  651   LPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFG  472
             L     + ++   LFH LVP  R+PE W VPLMPW   +SIFLN+FL+ +L   +Y RF 
Sbjct  492   LGACAVIAIAIIQLFHCLVPQARKPEFWGVPLMPWIPCVSIFLNIFLLGSLGGPSYVRFV  551

Query  471   IWTGLMSLFYVVYGVHSTYK  412
              ++ L  L YV+Y VH+++ 
Sbjct  552   FFSALAVLVYVLYSVHASFD  571



>ref|XP_011032916.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Populus euphratica]
Length=585

 Score =   441 bits (1135),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 282/546 (52%), Positives = 392/546 (72%), Gaps = 12/546 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
              +Y  +L+QTP +L +RA +  T  +E+++V+ RSG+ M+R L WYDLV  G+GGM+G G
Sbjct  12    DSYFRALAQTPSRLARRACSVSTSHEEMSQVKARSGSVMQRTLRWYDLVGFGIGGMVGAG  71

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFV TG  +R  AGPSV ISY +AGL ALLSS CYTEF+V++PVAGGAFSYLR+TFGEF 
Sbjct  72    VFVITGHASRLRAGPSVVISYAIAGLCALLSSFCYTEFAVDMPVAGGAFSYLRVTFGEFA  131

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +  GAN++MDYVLSNAAV+R FT YL  A+G      WR+ + GL +G+N +D  AV +
Sbjct  132   AFLTGANLIMDYVLSNAAVARGFTAYLGSAIGISTSK-WRLVIHGLPDGFNEIDTFAVLV  190

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAP  1312
             ++ +T+++C+ST+ESSL+N+++TI H++F GF+I+ GF+KG   N  +        G  P
Sbjct  191   VLAITLIICYSTRESSLVNMLLTILHILFIGFVILMGFWKGDWKNFTQPANPNNPSGFFP  250

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
             FG  GV +GAA+VY SYIGYD+VST+AEE+ NP K +P+G+ GSV+IV+ LYCLMA S+ 
Sbjct  251   FGAPGVFNGAAMVYLSYIGYDAVSTLAEEVHNPVKDIPIGVSGSVIIVTILYCLMAASMS  310

Query  1131  llLPYNLIPEEGSFSAAFK--MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGR  958
             +LLPY++I  +  FSAAF+    GW+W SNV+G GAS GI+ SLLVAMLGQARYLCV+GR
Sbjct  311   MLLPYDMIDVDAPFSAAFRGESDGWQWVSNVIGTGASFGILTSLLVAMLGQARYLCVIGR  370

Query  957   ARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal  778
             + +VP+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA+AL
Sbjct  371   SSVVPAWFARVHPKTSTPVNASAFLGIFTAAIALFTDLNVLLNLVSIGTLFVFYMVASAL  430

Query  777   iyrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTAL  610
             +YRRY  I    P+  L FL  +S +S+ F+L W        +   L     + ++   +
Sbjct  431   VYRRYVAIGTTNPWPTLSFLCSISFTSILFTLIWHFMPNGKGKALMLGACAVIAIAIIQI  490

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
             FH +VP  R+PE W VPLMPW    SIFLN+FL+ +L+  +Y RF  ++ L  L YV+Y 
Sbjct  491   FHCIVPQARKPEFWGVPLMPWIPCASIFLNIFLLGSLDGPSYVRFVFFSALAVLVYVLYS  550

Query  429   VHSTYK  412
             VH+++ 
Sbjct  551   VHASFD  556



>ref|XP_006287349.1| hypothetical protein CARUB_v10000547mg [Capsella rubella]
 gb|EOA20247.1| hypothetical protein CARUB_v10000547mg [Capsella rubella]
Length=586

 Score =   441 bits (1133),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 282/541 (52%), Positives = 388/541 (72%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YLNSLS TP +L +RA++  T   E+++VR   G +M+R L WYDL+ LG+GGM+G GVF
Sbjct  23    YLNSLSATPSRLSRRAVSVSTSADEMSRVRAVPGEEMRRTLRWYDLIGLGIGGMVGAGVF  82

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AG+ ALLS+ CYTEF+V +PVAGGAFSY+R+TFGEF  +
Sbjct  83    VTTGRASRLFAGPSIVVSYAIAGICALLSAFCYTEFAVHLPVAGGAFSYIRVTFGEFPAF  142

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
             F GAN++M+YV+SNAAVSRSFT YL  A G      WR  V GL +G+N +D  A  +++
Sbjct  143   FTGANLIMEYVMSNAAVSRSFTAYLGTAFGISTAK-WRFVVSGLPKGFNEIDPVAAVVVV  201

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLV-----KSGGGLAPFG  1306
              +T+++C  T+ESS +N++MT FH+ F  F+++ GF KG S NL      +   G  PFG
Sbjct  202   AITVIICCGTRESSKVNMIMTAFHIAFILFVVVMGFVKGDSKNLSVPSNPEHPSGFFPFG  261

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+  P K +PVG+ GSV IV+ LYCLMA+S+ +L
Sbjct  262   AAGVFNGAAMVYLSYIGYDAVSTMAEEVKYPEKDIPVGVSGSVAIVTVLYCLMAVSMSML  321

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY+LI  E  FSAAF+   GW+W + VVG+GAS GI+ SLLVAMLGQARY+CV+GR+R+
Sbjct  322   LPYDLIDAEAPFSAAFRGSNGWEWVTKVVGIGASFGILTSLLVAMLGQARYMCVIGRSRV  381

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
             VP   +K+HP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA ALI+R
Sbjct  382   VPFCFSKIHPKTCTPVNASTFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANALIFR  441

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY  +    P+  L FL L S++SL F+L WKL      + + L     + ++   +F  
Sbjct  442   RYVPLQPTKPWTTLSFLALFSTTSLVFTLIWKLMPEGKPKAFMLGASAVVAIAMVLIFQC  501

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             +VP   +PE W VP MPW   +SIFLN+FL+ +L+  +Y RFG ++GL+ L Y++YGVH+
Sbjct  502   VVPQASKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYGRFGGFSGLIVLVYLLYGVHA  561

Query  420   T  418
             +
Sbjct  562   S  562



>ref|XP_004308176.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=586

 Score =   439 bits (1130),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 278/560 (50%), Positives = 388/560 (69%), Gaps = 17/560 (3%)
 Frame = -2

Query  2052  ETAVSRSMPEIFST---YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTW  1882
             E + S+     FS+   YL +L+ TP +L +RA++  T   E++ VR RSG+DM + L W
Sbjct  2     EESQSQCHASSFSSPRAYLRALADTPARLARRAVSVSTSYDEMSAVRARSGSDMHKTLGW  61

Query  1881  YDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVA  1702
              DL+  G GGM+G GVFVTTG  +R  AGPSV ISY +AGL ALLS+ CYTEF+V++PVA
Sbjct  62    LDLLGFGFGGMVGAGVFVTTGRASRLYAGPSVVISYAIAGLCALLSAFCYTEFAVDMPVA  121

Query  1701  GGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDG  1522
             GGAFSYLR+TFGEF  +  GAN++MDYV+SNAAV+R FT YL  A+G      WR  V  
Sbjct  122   GGAFSYLRVTFGEFAAFLTGANLMMDYVMSNAAVARGFTAYLGTAIGVPAAK-WRFTVAA  180

Query  1521  LMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDN  1342
             L  G+N +D  AV +++ +T+++C+ST+ESS++N+V+T  H+ F  F+I+ GF KG  +N
Sbjct  181   LPNGFNEIDVVAVVVVLAVTLIICYSTRESSVVNMVLTALHITFILFVIVIGFCKGDWNN  240

Query  1341  LVKSG------GGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGS  1180
                         G  P+G+ GV +GA++VY SYIGYD+VSTMAEE+ NP K +P+G+ GS
Sbjct  241   FTAPADPTTHPSGFFPYGIAGVFNGASMVYLSYIGYDAVSTMAEEVRNPVKDIPIGVSGS  300

Query  1179  VLIVsalyclmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLV  1000
             VLIV+ LYCLMA S+  LLPY++I  E  FSAAF+    KW + V+GVGASLGI+ SLLV
Sbjct  301   VLIVTLLYCLMAASMSKLLPYDMIDPEAPFSAAFR---GKWEARVIGVGASLGILTSLLV  357

Query  999   AMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIIS  820
             AMLGQARY+CV+GR+ +VP+W A+VHP T TP+N++ FLGI  A+++LFT+L +++ ++S
Sbjct  358   AMLGQARYMCVIGRSSVVPAWFARVHPKTSTPVNSSAFLGILTAAISLFTDLNVLLNLVS  417

Query  819   IGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLF  640
             IGTL VFY+VA A+I+RRY  +    P+  + FL   S +++ FS+ W++  Q     L 
Sbjct  418   IGTLFVFYMVANAVIFRRYVALGRTKPWPTISFLCSFSLTAIFFSVIWQIAPQGRAKALM  477

Query  639   ----GFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFG  472
                   +  S   +FH +V   R+PE W VPLMPW  ++SIFLNVFL+ +L+  +Y RFG
Sbjct  478   LCVTAIIAASIVQIFHCMVKQARKPEFWGVPLMPWMPSVSIFLNVFLLGSLDRPSYVRFG  537

Query  471   IWTGLMSLFYVVYGVHSTYK  412
              ++G   L YV Y VH+++ 
Sbjct  538   YFSGFAVLVYVFYSVHASFD  557



>ref|XP_007142869.1| hypothetical protein PHAVU_007G023700g [Phaseolus vulgaris]
 gb|ESW14863.1| hypothetical protein PHAVU_007G023700g [Phaseolus vulgaris]
Length=583

 Score =   439 bits (1129),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 288/547 (53%), Positives = 393/547 (72%), Gaps = 12/547 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  YL +LS TP +L +RAL+  T   E+ +VR RSG  M++ L WYDLV+LG+GGM+G 
Sbjct  9     FRNYLRALSHTPTRLAQRALSVSTSYDEITQVRARSGTTMRKTLRWYDLVSLGIGGMVGA  68

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG   R  AGP+V +SY +AG  ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF
Sbjct  69    GVFVTTGHATRLYAGPAVLLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEF  128

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN+++DYVLSNAAV+R FT YL  A+G  +   WR+ V  L +G+N +D  AVA
Sbjct  129   AAFMTGANLVVDYVLSNAAVARGFTAYLGTAIGISSSK-WRLTVPSLPDGFNEIDVVAVA  187

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLA  1315
             +++LLT+V+C+ST+ESS++N+++T  H++F  F+I+ GF++GS  N  +       GG  
Sbjct  188   VVLLLTLVICYSTRESSVVNMILTALHILFIAFVIMIGFWRGSRKNFTEPANPENPGGFF  247

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             P G  GV  GAA VY SYIGYD+VSTMAEE+ +P + +PVG+ GSV+IV+ LYCLMA S+
Sbjct  248   PHGAAGVFKGAAAVYLSYIGYDAVSTMAEEVKDPVRDIPVGVSGSVVIVTVLYCLMAASM  307

Query  1134  cllLPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVG  961
               LLPY++I  E  FSAAF  K  GW W S V+GVGAS GI+ SLLVAMLGQARY+CV+G
Sbjct  308   TKLLPYDMIDAEAPFSAAFSGKSDGWGWPSRVIGVGASFGILTSLLVAMLGQARYMCVIG  367

Query  960   RARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaa  781
             R+ +VPSW A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A
Sbjct  368   RSNVVPSWFARVHPRTSTPVNASAFLGIFTAAIALFTDLNVLLNLVSIGTLFVFYMVANA  427

Query  780   liyrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTA  613
             +IYRRY  +  + P+  L FL   S +++ F+L WK       +   L + G + ++   
Sbjct  428   VIYRRYVALGTSNPWPTLSFLCSFSFTAIMFTLIWKFVPTGGAKAGMLSVSGVIAIAILQ  487

Query  612   LFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVY  433
             LFH +VP VR+PE W VP MPW  ++SIFLNVFL+ +L+  +Y RFG ++ +  LFYV Y
Sbjct  488   LFHCMVPQVRKPEFWGVPFMPWIPSISIFLNVFLLGSLDGPSYVRFGFFSAVAVLFYVFY  547

Query  432   GVHSTYK  412
              VH+++ 
Sbjct  548   SVHASFD  554



>ref|XP_010558926.1| PREDICTED: cationic amino acid transporter 6, chloroplastic [Tarenaya 
hassleriana]
Length=584

 Score =   436 bits (1122),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 281/542 (52%), Positives = 385/542 (71%), Gaps = 12/542 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL++LS+TP +  +RA +  T   E+++    SG  M+R L WYDLV LG+GGM+G GVF
Sbjct  13    YLHALSKTPSRFARRAASVSTSFDEMSRAASVSGDQMRRTLRWYDLVGLGIGGMVGAGVF  72

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF+V +PVAGGAFSY+R+TFGEF  +
Sbjct  73    VTTGHASRLLAGPSIVVSYAIAGLCALLSAFCYTEFAVHLPVAGGAFSYIRVTFGEFAAF  132

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAVSR FT YL  A+G  +   WR  V GL  G+N +D  AVA+++
Sbjct  133   ITGANLIMDYVMSNAAVSRGFTAYLGTAIGVSSSK-WRFVVSGLPNGFNEIDLVAVAVVL  191

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG------GGLAPF  1309
              +T ++C+ T+ESS +N+V+T  H+ F  F+I+ GF++G   NL + G       G  PF
Sbjct  192   AVTFIICYGTRESSKVNMVLTALHIAFIVFVIVMGFWRGDPKNLTRPGKPEEHPSGFFPF  251

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+G+ GSV IV+ LYCLMA+S+ +
Sbjct  252   GAAGVFNGAAMVYLSYIGYDAVSTMAEEVRDPVKDIPIGVSGSVAIVTVLYCLMAVSMSM  311

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY+LI  +  FS AFK   GW+WASNVVG+GAS GI+ SLLVAMLGQARY+CV+GR+ 
Sbjct  312   LLPYDLIDPDAPFSGAFKGSDGWEWASNVVGIGASFGILTSLLVAMLGQARYMCVIGRSG  371

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VPSW + +HP T TP+N++ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA ALI+
Sbjct  372   VVPSWFSHIHPLTSTPVNSSAFLGIFTAALALFTDLNVLLNLVSIGTLFVFYMVANALIF  431

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFH  604
              RY  +    P+  L FL L S +SL F+L WKL      + + L       ++   +F+
Sbjct  432   SRYVQLGTTKPWPTLSFLCLFSITSLVFTLVWKLVPPGQPKAFMLVATAVAAIAVIQIFY  491

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP VR PE W VP MPW   +SIFLNVFL+ +L+  +Y RFG ++G+  L YV+Y VH
Sbjct  492   CVVPQVREPELWGVPFMPWTPCVSIFLNVFLLGSLDGPSYVRFGFFSGVAVLVYVLYSVH  551

Query  423   ST  418
             ++
Sbjct  552   AS  553



>ref|XP_008345869.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
isoform X2 [Malus domestica]
Length=579

 Score =   436 bits (1120),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 276/542 (51%), Positives = 384/542 (71%), Gaps = 21/542 (4%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +L+ TP +L +RA +  T   E++ VR RSG  M++ L W+DLV LG+GGM+G GVF
Sbjct  21    YLRALADTPTRLARRASSVSTSYDEMSAVRARSGPHMQKTLRWFDLVGLGLGGMVGAGVF  80

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGP++ ISY +AG  ALLS+ CYTEF+V++PVAGGAFSYLR+TFG     
Sbjct  81    VTTGRASRLYAGPAIVISYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYLRVTFG-----  135

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
                AN++MDYV+SNAAV+R FT Y+  A+G      WR  V GL  G++ +DF AV +++
Sbjct  136   ---ANLVMDYVMSNAAVARGFTAYMGSAIGVPAAK-WRFTVSGLPNGFDQIDFVAVVVVL  191

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
              +T+++C+STKESS+LN+V+T  H++F  F+I+AGF KG  +N           G  P+G
Sbjct  192   TITLIICYSTKESSVLNMVLTAVHIIFIAFVIVAGFCKGDWNNFTHPADPAQPSGFFPYG  251

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             V GV +GA++VY SYIGYD+VSTMAEE+ NP K +P+G+ GSVL+V+ LYCLMA S+  L
Sbjct  252   VSGVFNGASMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVLLVTVLYCLMAASMSKL  311

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             LPY+ I  E  FSAAF+    KW SNV+GVGAS GI+ SLLV+MLGQARY+CV+GR+R+V
Sbjct  312   LPYDAIDPEAPFSAAFR---GKWESNVIGVGASFGILTSLLVSMLGQARYMCVIGRSRVV  368

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+I+RR
Sbjct  369   PAWFARVHPKTSTPVNASAFLGILTAAIALFTDLNVLLNLVSIGTLFVFYMVANAVIFRR  428

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRL  598
             Y ++    P   L FL   S +S+ F   W       L+ + L +   + +S   +FH  
Sbjct  429   YVVVGTTNPRPTLSFLCSXSLTSIIFVFIWHFAPPGKLKAFMLVVTAAIAVSMLQIFHYQ  488

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP VR+PE W VPLMPW  ++SIFLN+FL+ +++  +Y RFG+++G+  L YV Y VH++
Sbjct  489   VPQVRKPEYWGVPLMPWMPSISIFLNIFLLGSMDKPSYVRFGVFSGVTVLVYVFYSVHAS  548

Query  417   YK  412
             + 
Sbjct  549   FD  550



>ref|XP_010695076.1| PREDICTED: cationic amino acid transporter 6, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=588

 Score =   435 bits (1118),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 281/549 (51%), Positives = 392/549 (71%), Gaps = 14/549 (3%)
 Frame = -2

Query  2019  FST---YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggm  1849
             FST   Y  +L+QTPK+L +RA++  TP +EL++ + RSG DM+R L WYDLV LG+GGM
Sbjct  13    FSTIPAYFRALTQTPKRLARRAISVSTPFEELSQFKSRSGPDMRRSLRWYDLVGLGIGGM  72

Query  1848  lgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITF  1669
             +G GVFVT G  +   AGP+V +SY +AG  ALLS+ CYTEF+V++P+AGGAF+YLR+TF
Sbjct  73    VGAGVFVTAGKASHSYAGPAVVLSYAIAGFCALLSAFCYTEFAVDIPLAGGAFTYLRVTF  132

Query  1668  GEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFP  1489
             GEF  +  GAN+++DYVLSNAAV+RSFT YL  A+G      WR  +  L +G+N +D  
Sbjct  133   GEFAAFLTGANLVLDYVLSNAAVARSFTAYLGTAIGVSTSK-WRFTLSFLPKGFNEIDVI  191

Query  1488  avaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVK-----SGG  1324
             AV +I+++T+++C+ST+ESS +N+V+T  H++F  FI++ GF KG   N          G
Sbjct  192   AVLVILIITLIICYSTRESSAVNMVLTALHLLFIAFIVVMGFIKGDVKNFTNPENPNHPG  251

Query  1323  GLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclma  1144
             G  P G+ GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P+G+ GSV++V+ LYCLM+
Sbjct  252   GFFPHGLTGVFNGAALVYLSYIGYDAVSTMAEEVHNPVKDIPIGVSGSVILVTFLYCLMS  311

Query  1143  lslcllLPYNLIPEEGSFSAAFKM-MGWKWASNVVGVGASLGIVASLLVAMLGQARYLCV  967
              S+ +LLPY+ I  E +F+ AFK   GW+W SNV+G GAS GI+ SL+VAMLGQARY+CV
Sbjct  312   TSMSMLLPYDAIDPEAAFTGAFKAEKGWEWVSNVIGGGASFGILTSLMVAMLGQARYMCV  371

Query  966   VGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylva  787
             +GR+ +VP+W A+VHP T TP+NA+ FLGI  A++ALFT+L I++ ++SIGTL VFY+VA
Sbjct  372   IGRSNVVPAWFARVHPKTSTPVNASAFLGILTAAIALFTDLDILLNLVSIGTLFVFYMVA  431

Query  786   aaliyrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSF  619
              A++YRRY  I    P+  L FL   S +S+ F+L W       LQ   L +   + + F
Sbjct  432   NAVVYRRYVAIGTTSPWPTLSFLCSFSVTSVLFTLIWHFVPSGKLQGVMLGVCAIIAIIF  491

Query  618   TALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYV  439
               LF  LVP  R+PE W VPLMPW  ++SIFLN+FL+ +L+  +Y RFG ++ L  + YV
Sbjct  492   LRLFQCLVPQARKPEFWGVPLMPWLPSMSIFLNIFLLGSLDGASYIRFGFFSVLSVVVYV  551

Query  438   VYGVHSTYK  412
             +Y VH+++ 
Sbjct  552   LYSVHASFD  560



>ref|XP_007010450.1| Cationic amino acid transporter 7 [Theobroma cacao]
 gb|EOY19260.1| Cationic amino acid transporter 7 [Theobroma cacao]
Length=623

 Score =   436 bits (1120),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 277/544 (51%), Positives = 388/544 (71%), Gaps = 12/544 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +L  TP +L +RA +  TP +EL++VR RSG+DM+R L W+DLV LG+GGMLG GVF
Sbjct  53    YLRALVHTPGRLARRAGSVSTPYEELSRVRARSGSDMQRSLRWFDLVGLGIGGMLGAGVF  112

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGP++ ISY +AG  ALLS+ CYTEF+V +P+AGGAFSYLR+TFGEF  +
Sbjct  113   VTTGKASRLHAGPAIVISYAIAGFCALLSAFCYTEFAVHMPLAGGAFSYLRVTFGEFAAF  172

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++M+YV+SNAAV+RSFT YL  A+G      WR  V GL +G++ +D  A  +++
Sbjct  173   LTGANLIMEYVMSNAAVARSFTSYLGAAIGISTAK-WRFTVPGLPKGFDEIDVVACTVVL  231

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
             ++T+++C+STK+SS++N+++T  H++F GF+I  GF++G  +N           G  P G
Sbjct  232   IITLIICYSTKQSSVVNMILTALHILFIGFVIFMGFWRGDWNNFTHPANPDNPSGFFPHG  291

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA VY SYIGYD+VSTMAEE+ +P K +PVG+ GSV+IV+ LYCLMA S+  L
Sbjct  292   PSGVFNGAAAVYLSYIGYDAVSTMAEEVRDPVKDIPVGVSGSVIIVTILYCLMAASMSKL  351

Query  1125  LPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LPY++I  E  FSAAF  +  GW+W S V+GVGAS GI+ SLLVAMLGQARY+CV+GR+ 
Sbjct  352   LPYDMIDVEAPFSAAFSGRSDGWEWVSRVIGVGASFGILTSLLVAMLGQARYMCVIGRSS  411

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VP+W A+VH  T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A+IY
Sbjct  412   VVPAWFARVHHKTSTPVNASAFLGIFTAAIALFTDLSVLLNLVSIGTLFVFYMVANAVIY  471

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFH  604
             RRY ++    P+  L FL L+S +S+ F+L W        + + L     + +S   +F 
Sbjct  472   RRYVVVGTTKPWSTLSFLCLLSLTSIIFTLLWHFAPPGKPKAFVLGTCVVIAISILQIFR  531

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP  R+P+ W VP MPW  ++SIFLN+FLM +L   +Y RFG ++ L  L YV+Y VH
Sbjct  532   CMVPQARKPDFWGVPFMPWLPSISIFLNIFLMGSLGGPSYVRFGFFSALAVLVYVLYSVH  591

Query  423   STYK  412
             +++ 
Sbjct  592   ASFD  595



>gb|KGN46047.1| hypothetical protein Csa_6G046250 [Cucumis sativus]
Length=574

 Score =   433 bits (1113),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 274/542 (51%), Positives = 381/542 (70%), Gaps = 13/542 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y ++LSQTP +L +RA +  T   E+   R  SG  M+R L W+DLV  G+GGM+G GVF
Sbjct  14    YFHALSQTPSRLSRRAFSVSTSFDEMTTTRSTSGVHMQRTLRWFDLVGFGLGGMIGAGVF  73

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTGP A   AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  74    VTTGP-ATLQAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  132

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAV+RSF++YL  A+G      WR+ + GL +G++ +D  AVA+++
Sbjct  133   LTGANLIMDYVMSNAAVARSFSQYLGAAIGVSTAK-WRLHIPGLPKGFDQIDLIAVAVVL  191

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
             ++TI++C+STK+SS++N+ +T  H++F  F+I+ GF+KG   N  + G      G  P G
Sbjct  192   IITIIICYSTKQSSVVNMTLTAIHILFIAFVIVFGFWKGDWKNFTEPGDPKNESGFFPHG  251

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV  GA++VY SYIGYD+VSTMAEE+ +P+K +P+G+ GSV++V+ LYCLMA S+  L
Sbjct  252   AAGVFKGASLVYLSYIGYDAVSTMAEEVRSPAKDIPIGVSGSVVLVTVLYCLMAASMAKL  311

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             LPY++I +E  F+AAF    WKW SNV+G GAS GI+ SLLVAM+GQARY+CV+GR+R+V
Sbjct  312   LPYDMIKKEAPFAAAFGR--WKWVSNVIGGGASFGILTSLLVAMMGQARYMCVIGRSRVV  369

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P+W A VHP T TPLNA+ FLG+  A++ALF +L I++  + IGTL VFY+VA A+IYRR
Sbjct  370   PAWFADVHPKTSTPLNASAFLGVFTAAIALFADLDILLNFVCIGTLFVFYMVANAVIYRR  429

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRL  598
             Y  I    P+  L FL   S +++ F+L W        +   L +   + +  + +FH +
Sbjct  430   YVEIGSTNPWPTLSFLCSFSLTAIIFTLIWHFVTPGMAKTTLLSVTAIVAIVISLIFHGV  489

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R+PE W VPLMPW    SIFLN+FL+  L+  +Y RF  ++ L  L YV+Y VHS+
Sbjct  490   VPQARKPEFWGVPLMPWIPCASIFLNIFLLGALDGTSYIRFVFFSILAVLIYVLYSVHSS  549

Query  417   YK  412
             Y 
Sbjct  550   YD  551



>ref|XP_004140991.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Cucumis sativus]
Length=617

 Score =   433 bits (1113),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 274/542 (51%), Positives = 381/542 (70%), Gaps = 13/542 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y ++LSQTP +L +RA +  T   E+   R  SG  M+R L W+DLV  G+GGM+G GVF
Sbjct  57    YFHALSQTPSRLSRRAFSVSTSFDEMTTTRSTSGVHMQRTLRWFDLVGFGLGGMIGAGVF  116

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTGP A   AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  117   VTTGP-ATLQAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  175

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAV+RSF++YL  A+G      WR+ + GL +G++ +D  AVA+++
Sbjct  176   LTGANLIMDYVMSNAAVARSFSQYLGAAIGVSTAK-WRLHIPGLPKGFDQIDLIAVAVVL  234

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
             ++TI++C+STK+SS++N+ +T  H++F  F+I+ GF+KG   N  + G      G  P G
Sbjct  235   IITIIICYSTKQSSVVNMTLTAIHILFIAFVIVFGFWKGDWKNFTEPGDPKNESGFFPHG  294

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV  GA++VY SYIGYD+VSTMAEE+ +P+K +P+G+ GSV++V+ LYCLMA S+  L
Sbjct  295   AAGVFKGASLVYLSYIGYDAVSTMAEEVRSPAKDIPIGVSGSVVLVTVLYCLMAASMAKL  354

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             LPY++I +E  F+AAF    WKW SNV+G GAS GI+ SLLVAM+GQARY+CV+GR+R+V
Sbjct  355   LPYDMIKKEAPFAAAFGR--WKWVSNVIGGGASFGILTSLLVAMMGQARYMCVIGRSRVV  412

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P+W A VHP T TPLNA+ FLG+  A++ALF +L I++  + IGTL VFY+VA A+IYRR
Sbjct  413   PAWFADVHPKTSTPLNASAFLGVFTAAIALFADLDILLNFVCIGTLFVFYMVANAVIYRR  472

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRL  598
             Y  I    P+  L FL   S +++ F+L W        +   L +   + +  + +FH +
Sbjct  473   YVEIGSTNPWPTLSFLCSFSLTAIIFTLIWHFVTPGMAKTTLLSVTAIVAIVISLIFHGV  532

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R+PE W VPLMPW    SIFLN+FL+  L+  +Y RF  ++ L  L YV+Y VHS+
Sbjct  533   VPQARKPEFWGVPLMPWIPCASIFLNIFLLGALDGTSYIRFVFFSILAVLIYVLYSVHSS  592

Query  417   YK  412
             Y 
Sbjct  593   YD  594



>gb|KHG16483.1| Cationic amino acid transporter 7, chloroplastic -like protein 
[Gossypium arboreum]
Length=582

 Score =   431 bits (1108),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 280/545 (51%), Positives = 394/545 (72%), Gaps = 11/545 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F +YL +L+QTP +   RA +  +  +EL+ V+ RSG++M   L WYDL+ LG+GGM+G 
Sbjct  11    FRSYLRALAQTPSRFAHRAPSVSSSYEELSWVKSRSGSNMHNSLRWYDLIGLGIGGMVGA  70

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG  +R  AGP++ ISY +AGL ALLS+ CYTEF+V +PVAGGAFSYLRITFGEF
Sbjct  71    GVFVTTGRASRLYAGPAILISYAIAGLCALLSAFCYTEFAVHMPVAGGAFSYLRITFGEF  130

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN++M+YV+SNAAV+R FT YLS A+G      WR     L +G+N +D  AVA
Sbjct  131   AAFLTGANLIMEYVMSNAAVARGFTSYLSAAIGIPTAK-WRFTAAALPKGFNEIDLLAVA  189

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVK-----SGGGLA  1315
             +++ +T+++C+ST+ESS+LN+++T  H++F  F+++ GF+KG  +N  +     S  G  
Sbjct  190   VVLTVTLIICYSTRESSILNMILTTLHILFIIFVVLMGFWKGDWNNFTRPMNPNSPSGFF  249

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             P+G  GV +GAA+VYFSYIGYD+VSTMAEE+  P K +P+G+ GSV+IV+ LYCLMA S+
Sbjct  250   PYGPSGVFNGAAMVYFSYIGYDAVSTMAEEVRYPIKDIPIGVTGSVVIVTILYCLMAASM  309

Query  1134  cllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
              +LLPY+ I  E  F+AAF     +W S V+GVGAS GI+ SLLVAMLGQARY+CV+GR+
Sbjct  310   SMLLPYDRIDVEAPFAAAFSGR-LEWVSKVIGVGASFGILTSLLVAMLGQARYMCVIGRS  368

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              +VP+W A+VH  T TPLNA+ FLGI  A++ALFT+L I++ ++SIGTL V+Y+VA A+I
Sbjct  369   SVVPTWFARVHSKTSTPLNASAFLGIFTAAIALFTDLNILLNLMSIGTLFVYYMVANAVI  428

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALF  607
             YRRY +I    P+ +L FL L++ +SL F+LSW      + + + L L   L  + T +F
Sbjct  429   YRRYVVIGTTKPWSILSFLCLLTLTSLLFTLSWHFAPSGSSKSFLLGLCIGLATAITLIF  488

Query  606   HRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
                VP VR+PE W VP MPW  ++SIF+N+FL+ +L+ ++Y RFG ++GL  L YV+Y V
Sbjct  489   RHTVPQVRKPEFWGVPFMPWLPSISIFMNIFLLGSLDGQSYVRFGFFSGLAVLVYVLYSV  548

Query  426   HSTYK  412
             H+++ 
Sbjct  549   HASFD  553



>gb|EPS66398.1| cationic amino acid transporter, partial [Genlisea aurea]
Length=564

 Score =   429 bits (1103),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 268/545 (49%), Positives = 384/545 (70%), Gaps = 11/545 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +YL +LS TP +L++RA +  T  +E +++R RSG +MKR L WYDLV  GVGGM+G GV
Sbjct  13    SYLGALSDTPARLRRRAFSVSTSYEETSRLRARSGPEMKRTLRWYDLVCFGVGGMVGAGV  72

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVTTG  +R  AGP+V +SY +AG+ ALLS+ CYTEF+V++PVAGGAFSY+R+TFGEF  
Sbjct  73    FVTTGRASRMYAGPAVVLSYAIAGVCALLSAFCYTEFAVDMPVAGGAFSYIRVTFGEFSA  132

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +   +N+++DYVLSNAAV+R FT YL  ALG       R  V GL  GYN +D  AVA+I
Sbjct  133   FMTASNLIVDYVLSNAAVARGFTAYLGTALGVPVDGNLRFAVRGLPRGYNEIDPIAVAVI  192

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPF  1309
             ++LT+++C+S +ESS +N+ +T  H+ F  F+I  GF+KG   N V+ G     GG  PF
Sbjct  193   LILTLLICYSIRESSWVNMTLTALHISFVAFVIAMGFWKGELKNFVEPGNPNHAGGFFPF  252

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G+ GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P+G+ GSV++V+ LYCLMA S+  
Sbjct  253   GISGVFNGAAMVYLSYIGYDAVSTMAEEVRNPVKDIPIGVSGSVILVAVLYCLMAASMSA  312

Query  1128  lLPYNLIPEEGSFSAAFK--MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
             LLPY++I  E  FS AF+     W+W SN +G+GAS GI+ SLLV+M+GQ+RY+CV+GR+
Sbjct  313   LLPYDMIDAEAPFSGAFQEGSSSWRWVSNTIGIGASFGILTSLLVSMVGQSRYMCVIGRS  372

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              +VP W A+VH ST TP+NA++FLGIC A++ALFT+L+I++ ++SIGTL VFY+VA A++
Sbjct  373   CVVPPWFARVHTSTSTPVNASLFLGICTAAIALFTDLEILLNLVSIGTLFVFYMVANAVV  432

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALF  607
             +RRY  +    P   + FL   S +S+ F+ +W+      ++ W L     + ++   +F
Sbjct  433   FRRYVAVGTTNPLPTVSFLVSFSLASIAFAAAWQAAPAGRMKLWMLSTAVAMAVAAVVVF  492

Query  606   HRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
                V   R+PE W VP+MPW    S+FL++FL+ +++  +Y RFG+     +  Y++YGV
Sbjct  493   RSRVAVARKPEFWGVPMMPWIPCASVFLDIFLLGSMDRPSYVRFGVMCAAAAAVYLLYGV  552

Query  426   HSTYK  412
             HS++ 
Sbjct  553   HSSFD  557



>ref|XP_010031295.1| PREDICTED: cationic amino acid transporter 6, chloroplastic [Eucalyptus 
grandis]
 gb|KCW50558.1| hypothetical protein EUGRSUZ_J00272 [Eucalyptus grandis]
Length=585

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 271/541 (50%), Positives = 383/541 (71%), Gaps = 11/541 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +L+QTP +L +RA +  T  +E+++VR RSG  M + L W+DLV LGVGGM+G GVF
Sbjct  16    YLRALAQTPARLARRAGSVSTSYEEMSRVRSRSGPSMAKTLRWFDLVGLGVGGMVGAGVF  75

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG      AGP+V +SY +AG+ ALLS+LCYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  76    VTTGRATHCDAGPAVVLSYFIAGVCALLSALCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  135

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++ +YVLSNAAV+RSFT Y   A+G      WR+ V G   G+N +D  AVAL++
Sbjct  136   LTGANLIAEYVLSNAAVARSFTCYFGTAIGVSCAK-WRLTVPGFPGGFNEIDLLAVALVL  194

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
             +LT+++C+ T+ESS++N+++T  H++F  F+I+ GF KG+  N  + G     GG  P+G
Sbjct  195   ILTLIICYGTRESSIVNMMLTALHILFIAFVIVMGFSKGNWKNFTEPGDPSHPGGFFPYG  254

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA VYFSYIGYD+VSTMAEE+  P K +P+G+ GSV++V+ LYCLMA S+ +L
Sbjct  255   ATGVFNGAATVYFSYIGYDAVSTMAEEVKKPVKDIPIGVSGSVILVTVLYCLMAASMSML  314

Query  1125  LPYNLIPEEGSFSAAFKMMG-WKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY++I ++  F+  F+  G  +W    +G GAS GI+ SL+VAMLGQARY+CV+GR+ +
Sbjct  315   LPYDMIDKDVPFAGVFRGSGSLEWVPKAIGAGASFGILTSLIVAMLGQARYMCVIGRSGV  374

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr  769
              P+W A+VHP T TP+NA+ FLGI  A++ALFT+L ++++++SIGTL VFY+VA A+IYR
Sbjct  375   APTWFARVHPRTSTPVNASAFLGILTAAIALFTDLNVLLDLVSIGTLFVFYMVANAVIYR  434

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHR  601
             RY       P   + FL   S +++ F+L W+L      +++ L     + L    +FH 
Sbjct  435   RYVAAGTTNPRPTVSFLSAFSLTAVIFALLWQLAPTGKPKYFMLAACALVALGVLQVFHF  494

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  R+PE W VPLMPW   +SIFLN+FL+ T +  A+ RFGI++G + L YV YGVH+
Sbjct  495   TVPQARKPEFWGVPLMPWIPCVSIFLNIFLLGTRSGPAFARFGIFSGAVVLIYVFYGVHA  554

Query  420   T  418
             +
Sbjct  555   S  555



>ref|XP_008456609.1| PREDICTED: cationic amino acid transporter 6, chloroplastic [Cucumis 
melo]
Length=628

 Score =   427 bits (1097),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 269/540 (50%), Positives = 381/540 (71%), Gaps = 13/540 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y ++LSQTP +L +RA +  T   E+   R  SG  M+R L W+DLV  G+GGM+G GVF
Sbjct  68    YFHALSQTPSRLSRRAFSVSTSFDEMTTTRSTSGVHMQRTLRWFDLVGFGLGGMIGAGVF  127

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTGP A + AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  128   VTTGPAALQ-AGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  186

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAV+RSF++YL  A+G      WR+ + GL +G++ +D  AVA+++
Sbjct  187   LTGANLIMDYVMSNAAVARSFSQYLGAAIGISTAK-WRLHIPGLPKGFDQIDLIAVAVVL  245

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
             ++T+++C+STK+SS++N+ +T  H++F  F+I+ GF+KG   N  + G      G  P G
Sbjct  246   IITVIICYSTKQSSVVNMTLTAIHILFIAFVIVFGFWKGDWKNFTEPGDPKNESGFFPHG  305

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV  GA++VY SYIGYD+VSTMAEE+ +P+K +P+G+ GSV++V+ LYCLMA S+  L
Sbjct  306   AAGVFKGASLVYLSYIGYDAVSTMAEEVRSPAKDIPIGVSGSVVLVTVLYCLMAASMAKL  365

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             LPY++I +E  F+AAF    WKW SNV+G GAS GI+ SLLVAM+GQARY+CV+GR+R+V
Sbjct  366   LPYDMIKKEAPFAAAFGR--WKWVSNVIGGGASFGILTSLLVAMMGQARYMCVIGRSRVV  423

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrr  766
             P+W A+VHP T TPLNA+ FLG+  A++ALF +L +++  + IGTL VFY+VA A+IYRR
Sbjct  424   PAWFAEVHPKTSTPLNASAFLGVFTAAIALFADLDVLLNFVCIGTLFVFYMVANAVIYRR  483

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRL  598
             Y  I    P   L FL   S +++ F+L W        +   L +   + +  + +FH +
Sbjct  484   YVEIGSTNPRPTLSFLCSFSLTAIIFTLMWHFVTPGKAKTTLLSVTAIVAIVISLIFHCV  543

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP   +PE W VPLMPW    SIFLN+FL+ +L+  +Y RF  ++ L  L Y++Y VHS+
Sbjct  544   VPQAWKPEFWGVPLMPWIPCASIFLNIFLLGSLDGTSYIRFVFFSILAVLIYMLYSVHSS  603



>gb|KHG26942.1| Cationic amino acid transporter 7, chloroplastic -like protein 
[Gossypium arboreum]
Length=586

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 277/556 (50%), Positives = 389/556 (70%), Gaps = 11/556 (2%)
 Frame = -2

Query  2052  ETAVSRSMPEIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDl  1873
             ET  S S      +YL +L+QTP++L +RA +  +  +EL++V+ RSG+DM+R L W+DL
Sbjct  2     ETHSSSSSFSTLQSYLKALAQTPRRLARRAPSVSSSYEELSRVKARSGSDMQRTLRWFDL  61

Query  1872  valgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGA  1693
             V LG+GGM+G GVFVTTG  +R  AGP++ +SY +AGL ALLS+ CYTEF+V +PVAGGA
Sbjct  62    VGLGIGGMVGAGVFVTTGRASRLYAGPAIVVSYAIAGLCALLSAFCYTEFAVHMPVAGGA  121

Query  1692  FSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLME  1513
             FSYLRITFGEF  +  GAN++ +YV+SNAAVSR  T Y+  A+G      WR  +     
Sbjct  122   FSYLRITFGEFAAFLTGANLITEYVMSNAAVSRGLTSYMGAAMGISTTK-WRFILPLFPN  180

Query  1512  GYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVK  1333
             G+N +D  A A++++LT+V+C+ST+ESS++N+++T  H++F  F+I+ G +KG  +N   
Sbjct  181   GFNEIDLVAPAIVLILTLVICYSTRESSVVNMILTTLHILFIAFLILMGLWKGDWNNFTH  240

Query  1332  SGG-----GLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIV  1168
              G      G  P+G  GV +GAA+VY SYIGYD+VSTMAEE+ +P K +P+G+ GSV+IV
Sbjct  241   PGNPQHPSGFFPYGASGVFNGAAMVYLSYIGYDAVSTMAEEVRDPVKDIPIGVSGSVIIV  300

Query  1167  salyclmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLG  988
             + LYCLMA S+ +LLPY++I  E  FSAAF     +  + V+GVGAS GI+ SLLVAMLG
Sbjct  301   TILYCLMAASMSMLLPYDMIDVEAPFSAAFSGRS-ELVARVIGVGASFGILTSLLVAMLG  359

Query  987   QARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTL  808
             QARY+CV+GR+ +VP+W A VHP T TP+NA+ FLGI  A++ALFT+L I++ ++SIGTL
Sbjct  360   QARYMCVIGRSNVVPAWFAGVHPKTSTPVNASAFLGIFTAAIALFTDLNILLNLVSIGTL  419

Query  807   VVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLP-LFG--  637
              VFY+V+ A+IYRRY ++    P+  L FL L S +S  F+L W         P L G  
Sbjct  420   FVFYMVSNAVIYRRYVMVGTTKPWPTLSFLCLFSLTSTIFTLVWHFTPPGKPKPFLLGAC  479

Query  636   -FLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTG  460
               + +S   +FH +VP  R+P  W VP MPW  ++SIFLNVFL+ +L+  +Y RFG ++ 
Sbjct  480   VVIAISILQVFHCMVPQARKPAFWGVPFMPWLPSISIFLNVFLLGSLDGPSYVRFGFFSA  539

Query  459   LMSLFYVVYGVHSTYK  412
             L  L YV+Y VH+++ 
Sbjct  540   LAVLVYVLYSVHASFD  555



>ref|XP_003637200.1| High affinity cationic amino acid transporter [Medicago truncatula]
Length=623

 Score =   426 bits (1094),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 278/584 (48%), Positives = 389/584 (67%), Gaps = 51/584 (9%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              YL ++++TP +  +R  +  T  +E+++VR RSG  M++ L W+DLV+ G+GGM+G GV
Sbjct  13    NYLQAVAKTPSRFARRGFSVSTSYEEMSRVRARSGNSMRKSLRWFDLVSFGIGGMVGAGV  72

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVTTG   R  AGPSV +SY +AG  ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  
Sbjct  73    FVTTGHATRVHAGPSVVLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAA  132

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +  GAN++MDYV+SNAAV+R FT+Y+   +G  +   WR+ V    EG+N +D  AV ++
Sbjct  133   FITGANLIMDYVMSNAAVARGFTKYVGTTVGVSSAK-WRITVPSFPEGFNQIDLVAVVVV  191

Query  1473  illtivLCH-----------------------------------------STKESSLLNL  1417
             +L+T+V+C+                                         STKESS++N+
Sbjct  192   LLITVVICYRHRTHFDQRCRCYEFIIYNGAQFSFSKFINILFIFYFVQFFSTKESSVVNM  251

Query  1416  VMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFGVRGVLDGAAIVYFSYIGY  1252
             ++T  H++F  F+I+ GF+KGS  NL +        G  P G  GV  GA+ VY SYIGY
Sbjct  252   ILTGLHILFIAFVIVIGFWKGSWKNLTQPANPENPSGFFPHGAAGVFKGASAVYLSYIGY  311

Query  1251  DSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKM  1072
             D+VSTMAEE+  P K +P+G+ GSV+IV+ LYCLMA S+C+LLPY++I  E  FSAAFK 
Sbjct  312   DAVSTMAEEVKEPVKDIPIGVSGSVIIVTILYCLMAASMCMLLPYDMIDPEAPFSAAFKS  371

Query  1071  MGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNAT  892
              GW WAS V+GVGAS GI+ SL+VAMLGQARY+CV+GR+ +VP+W AKVHP T TP+NA+
Sbjct  372   DGWGWASRVIGVGASFGILTSLIVAMLGQARYMCVIGRSNVVPAWFAKVHPKTSTPVNAS  431

Query  891   IFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflfl  712
              FLGI  A++ALFT+L ++++++SIGTL VFY+VA A++YRRY +     P+  + FL  
Sbjct  432   AFLGIFTAAIALFTDLDVLLDLVSIGTLFVFYMVANAVVYRRYVVAGTTNPWPTVSFLLS  491

Query  711   vsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWP  544
              S +S+ F+L WK       +   L   G L +    LFH  VP  R+PE W VPLMPW 
Sbjct  492   FSFTSIMFTLIWKCVPTGVAKAGMLSACGVLAVVILQLFHFTVPQARKPEFWGVPLMPWI  551

Query  543   AALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              A+SIFLN+FL+ +L+  +Y RFG+++ +  LFY+ Y VH+++ 
Sbjct  552   PAISIFLNLFLLGSLDGPSYVRFGVFSAVAVLFYIFYSVHASFD  595



>emb|CDO99923.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   422 bits (1084),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 274/508 (54%), Positives = 374/508 (74%), Gaps = 13/508 (3%)
 Frame = -2

Query  1902  MKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEF  1723
             MKR L WYDLV  GVGGM+G GVFVTTG  +R+ AGPSV +SY +AGL ALLS+ CYTEF
Sbjct  1     MKRTLRWYDLVGFGVGGMVGAGVFVTTGTASRRYAGPSVVLSYAIAGLCALLSAFCYTEF  60

Query  1722  SVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDC  1543
             +V++PVAGGAFSY+R+TFGEF+ +  GAN+++DYVLSNAAV+RSFT Y + A+G      
Sbjct  61    AVDMPVAGGAFSYIRVTFGEFLAFLTGANLIIDYVLSNAAVARSFTTYFATAIGVSTK--  118

Query  1542  WRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagF  1363
              R+ V  L +G+N +D  AVAL+++LT+V+C+ST+ESSLLN+V+T+ H++F  F+I+ GF
Sbjct  119   LRITVHFLPKGFNEIDILAVALVLILTLVICYSTRESSLLNMVLTVLHIMFIVFVILMGF  178

Query  1362  YKGSSDNLVKSG-----GGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLP  1198
             ++G   N  + G     GG  PFG  GV +GAA+VY SYIGYD+VSTMAEE+ NP + +P
Sbjct  179   WRGEWKNFSEPGNPKHPGGFFPFGASGVFNGAAMVYLSYIGYDAVSTMAEEVRNPVRDIP  238

Query  1197  VGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK--MMGWKWASNVVGVGASL  1024
             VG+ GSV++V+ LYCLMA S+ LLLPY++I  E  FS AF+    GW+WASNV+GVGAS 
Sbjct  239   VGVSGSVILVTVLYCLMAASMSLLLPYDMIDPEAPFSGAFRGGSDGWEWASNVIGVGASF  298

Query  1023  GIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTEL  844
             GI+ SLLVAMLGQARY+CV+GR+R+VP+W A VHP T TP+NA+ FLGI  A++ALFT+L
Sbjct  299   GILTSLLVAMLGQARYMCVIGRSRVVPAWFANVHPRTCTPVNASAFLGIFTAAIALFTDL  358

Query  843   KIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKL--  670
              I++ ++SIGTL VFY+VA A+IYRRY  +    P+  L FLF  S +S+ F++ W+   
Sbjct  359   NILLNLVSIGTLFVFYMVANAVIYRRYVSVGTTNPWPTLSFLFCFSLTSIIFTVVWQFAP  418

Query  669   --NLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLN  496
                 + + L     + +    +FH  VP  R+PE W VPLMPW  ++SIFLN+FL+ +L+
Sbjct  419   PGKPKAFILGACTAIAIGVLQVFHHTVPEARKPEFWGVPLMPWIPSISIFLNIFLLGSLD  478

Query  495   VKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
               +Y RFG ++ L  L Y++Y VH+++ 
Sbjct  479   RPSYVRFGFFSALAVLVYLLYSVHASFD  506



>ref|XP_003555221.1| PREDICTED: cationic amino acid transporter 7, chloroplastic-like 
[Glycine max]
Length=587

 Score =   422 bits (1086),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 280/544 (51%), Positives = 388/544 (71%), Gaps = 13/544 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL++LS TP +L  RAL+  T   E+++VR RSG  M++ L W+DLV+LG+GGM+G GVF
Sbjct  17    YLSALSHTPTRLALRALSVSTSYDEMSQVRARSGTSMRKTLRWFDLVSLGIGGMVGAGVF  76

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  A   AGP+V +SY +AG  ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  77    VTTGH-ATLYAGPAVLLSYAIAGFCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  135

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++ DYVLSNAAV+R  T YL   +G  +   WR+ V  L +G+N +DF AVA+++
Sbjct  136   LTGANLVADYVLSNAAVARGLTAYLGTTIGISSAK-WRLTVPSLPKGFNEIDFVAVAVVL  194

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAPFG  1306
             L+T+V+C+ST+ESS++N+++T  H++F  F+I+ GF++G+  N  +        G  P G
Sbjct  195   LITLVICYSTRESSVVNMILTALHILFIAFVIMMGFWRGNWKNFTEPANPHNPSGFFPHG  254

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV  GAA+VY SYIGYD+VSTMAEE+ +P K +PVG+ GSV++V+ LYCLMA S+  L
Sbjct  255   AAGVFKGAALVYLSYIGYDAVSTMAEEVRDPVKDIPVGVSGSVVVVTVLYCLMAASMTKL  314

Query  1125  LPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LPY++I  E  FSAAF  +  GW W S V+GVGAS GI+ SLLVAMLGQARY+CV+GR+ 
Sbjct  315   LPYDVINAEAPFSAAFSGRSDGWGWVSRVIGVGASFGILTSLLVAMLGQARYMCVIGRSN  374

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy  772
             +VPSW A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++ IGTL VFY+VA A+IY
Sbjct  375   VVPSWFARVHPKTSTPVNASAFLGIFTAAIALFTDLDVLLNLVCIGTLFVFYMVANAVIY  434

Query  771   rryaiINGNPPFQvllflflvsssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFH  604
             RRY       P+  L FL   S +++ F+L WK       +   L + G + ++   LFH
Sbjct  435   RRYVATGTTNPWPTLSFLCSFSITAIMFTLIWKFVPTGGAKAGMLSVSGVIAIAILQLFH  494

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP VR+PE W VP MPW  ++SIFLNVFL+ +L+  +Y RFG ++ +  LFYV Y VH
Sbjct  495   CMVPQVRKPEFWGVPFMPWIPSISIFLNVFLLGSLDGPSYVRFGFFSAVAVLFYVFYSVH  554

Query  423   STYK  412
             +++ 
Sbjct  555   ASFD  558



>gb|EEC68890.1| hypothetical protein OsI_37534 [Oryza sativa Indica Group]
Length=600

 Score =   422 bits (1084),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 275/547 (50%), Positives = 372/547 (68%), Gaps = 18/547 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L+QTP++L  RA A  +P +E+++VR RSGADM R L W DLV LG+GGM+G GVF
Sbjct  30    YGRALAQTPRRLAARACAAASPGEEMSRVRARSGADMARALRWPDLVGLGLGGMVGAGVF  89

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG   R  AGP+V +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGE   +
Sbjct  90    VTTGRATRLYAGPAVVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGELAAF  149

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++M+YV SNAAV+RSFT YL  A+G   P  WR+ V GL +G+N +D  AV +I+
Sbjct  150   LTGANLIMEYVFSNAAVARSFTAYLGTAVGVDAPSKWRIAVPGLPKGFNEVDLVAVGVIL  209

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG------GGLAPF  1309
             L+T+ +C+STKESS +N+V+T  HV+F  F+I+ GF++G + NL +        GG  P 
Sbjct  210   LITVCICYSTKESSSVNMVLTAVHVLFIMFVIVMGFWRGDTRNLTRPADPEHNPGGFFPH  269

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+  PS+ +P+G+ GSV++V+ LYCLMA S+ +
Sbjct  270   GAAGVFNGAAMVYLSYIGYDAVSTMAEEVERPSRDIPIGVSGSVVLVTLLYCLMAASMSM  329

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY+ I  E  FS AFK   GW W SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+ 
Sbjct  330   LLPYDAIDTEAPFSGAFKGSSGWGWVSNVIGAGASLGILTSLMVAMLGQARYLCVIGRSG  389

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVV-Fylvaaali  775
             ++P+WLA+V+P T TP+NA+ FLG+  A++ALFTEL I++ ++ IGTL V + +  A + 
Sbjct  390   VMPAWLARVNPRTATPVNASAFLGVFTAALALFTELDILLNLVCIGTLFVFYMVANAVVY  449

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLT----------L  625
              R  A    +   +    +  ++       ++    L W   P  G  T           
Sbjct  450   RRYVAAAEDDEEGRRRGAVPTLAFLLAFSLVALCFTLVWKLAPRGGARTGLLVACGAAAA  509

Query  624   SFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLF  445
             +  A F  LVP  RRPE W VP MPW  A S+FLNVFL+ +L+  +Y RFG +T   +L 
Sbjct  510   AAVAAFRALVPQARRPELWGVPAMPWVPAASVFLNVFLLGSLDRPSYVRFGFFTAAAALV  569

Query  444   YVVYGVH  424
             YV+Y VH
Sbjct  570   YVLYSVH  576



>emb|CBI25025.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   417 bits (1072),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 264/509 (52%), Positives = 369/509 (72%), Gaps = 13/509 (3%)
 Frame = -2

Query  1902  MKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEF  1723
             M+R L W+DLV  G+GGM+G GVFVTTG  +R  AGP+V +SY +AG+ ALLS+ CYTEF
Sbjct  1     MQRNLRWFDLVGFGLGGMVGAGVFVTTGRASRLYAGPAVVLSYAIAGICALLSAFCYTEF  60

Query  1722  SVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDC  1543
             +V++PVAGGAFSYLR+TFGEF  +  GAN++MDYVLSNAAV+RSFT YL  A+G      
Sbjct  61    AVDMPVAGGAFSYLRVTFGEFAAFLTGANLVMDYVLSNAAVARSFTAYLGTAIGFPTTK-  119

Query  1542  WRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagF  1363
             WR  V GL +G+N +D  AVA+++++T+++C+ST+ESS++N+V+T  H++F  F+I+ GF
Sbjct  120   WRFTVSGLPKGFNEIDLVAVAVVLIITLIICYSTRESSVVNMVLTAMHILFIAFVIVVGF  179

Query  1362  YKGSSDNLV------KSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSL  1201
             ++G   N        +  GG  PFG  GV +GAA+VY SYIGYD+VST+AEE+ NP K +
Sbjct  180   WRGDWKNFTEPADPRRHQGGFFPFGASGVFNGAAMVYLSYIGYDAVSTLAEEVRNPVKDI  239

Query  1200  PVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKMM--GWKWASNVVGVGAS  1027
             P+G+ GSV++V+ LYCLMA S+  LLPY+ I  E  FSAAF+    GWKW SNV+G GAS
Sbjct  240   PIGVSGSVMLVTILYCLMAASMSKLLPYDAIDPEAPFSAAFRGQSNGWKWVSNVIGAGAS  299

Query  1026  LGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTE  847
              GI+ SL+VAMLGQARY+CV+GR+++VPSW A+VH  T TP+NA+ FLGI  A++A+FT+
Sbjct  300   FGILTSLMVAMLGQARYMCVIGRSKVVPSWFARVHHKTCTPVNASAFLGIFTAAIAVFTD  359

Query  846   LKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKL-  670
             L +++ ++SIGTL VFY+VA A+IYRRY  +    P+  L FL   S +S+ F+L W   
Sbjct  360   LNVLLNLVSIGTLFVFYMVANAVIYRRYVSVGATNPWPTLSFLVSFSLTSIIFTLIWHFA  419

Query  669   ---NLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTL  499
                + +   L     + ++   +FH +VP VR+PE W VPLMPW  ++SIFLN+FL+ +L
Sbjct  420   APGHPKEVMLGACTVVAVAILQMFHCMVPQVRKPEHWGVPLMPWIPSISIFLNIFLLGSL  479

Query  498   NVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             +  +Y RFG ++ L  L YV+Y VH+++ 
Sbjct  480   DRPSYVRFGYFSALAVLVYVLYSVHASFD  508



>emb|CDY11308.1| BnaA03g01440D [Brassica napus]
Length=528

 Score =   417 bits (1071),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 272/505 (54%), Positives = 363/505 (72%), Gaps = 11/505 (2%)
 Frame = -2

Query  1902  MKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEF  1723
             M+R L WYDL+ LG+GGM+G GVFVTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF
Sbjct  1     MRRTLRWYDLIGLGIGGMVGAGVFVTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEF  60

Query  1722  SVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDC  1543
             +V +PVAGGAFSY+RITFGEF  +F GAN+++DYV+SNAAVSRSFT YL  A G      
Sbjct  61    AVHLPVAGGAFSYIRITFGEFPAFFTGANLVLDYVMSNAAVSRSFTAYLGTAFGISTHK-  119

Query  1542  WRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagF  1363
             WR  V  L  G+N +D  AV +++ +T+++C ST+ESS +N++MT FH+ F  F+I+ GF
Sbjct  120   WRFVVSALPGGFNEIDPVAVVVVLAITVIICCSTRESSKVNMIMTAFHIAFIVFVIVMGF  179

Query  1362  YKGSSDNLVKSG-----GGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLP  1198
              +G S NL          G  PFG  GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P
Sbjct  180   LRGDSKNLTSPAKPEHPSGFFPFGAAGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIP  239

Query  1197  VGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLG  1021
             VG+ GSV IV+ LYCLMA+S+ +LLPY+LI  E  FSAAF+   GW+W + VVG+GAS G
Sbjct  240   VGVSGSVAIVTVLYCLMAVSMSMLLPYDLIDPEAPFSAAFRGSNGWEWVTKVVGIGASFG  299

Query  1020  IVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELK  841
             I+ SLLVAMLGQARY+CV+GR+R+VP W AK+H  T TP+NA+ FLGI  A +ALFT+L 
Sbjct  300   ILTSLLVAMLGQARYMCVIGRSRVVPVWFAKIHHRTSTPVNASSFLGIFTAVLALFTDLN  359

Query  840   IVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKL---  670
             I++ ++SIGTL VFY+VA ALI++RY  +    P+  L FL L S+ SL F+L W+L   
Sbjct  360   ILLNLVSIGTLFVFYMVANALIFKRYVPVGPTKPWPTLTFLTLFSTISLVFTLIWQLAPQ  419

Query  669   -NLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNV  493
               ++ + L     + ++   +FH LVP   +PE W VP MPW   +SIFLN+FL+ +L+ 
Sbjct  420   GKVKAFMLGASAVVAIAIVLIFHYLVPQANKPELWGVPFMPWTPCVSIFLNIFLLGSLDA  479

Query  492   KAYKRFGIWTGLMSLFYVVYGVHST  418
              +Y RFG ++GL+ L Y+ YGVH++
Sbjct  480   PSYVRFGFFSGLIVLVYLFYGVHAS  504



>emb|CDX80920.1| BnaC03g01740D [Brassica napus]
Length=528

 Score =   415 bits (1067),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 271/505 (54%), Positives = 363/505 (72%), Gaps = 11/505 (2%)
 Frame = -2

Query  1902  MKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEF  1723
             M+R L WYDL+ LG+GGM+G GVFVTTG  +R  AGPS+ +SY +AGL ALLS+ CYTEF
Sbjct  1     MRRTLRWYDLIGLGIGGMVGAGVFVTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEF  60

Query  1722  SVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDC  1543
             +V +PVAGGAFSY+RITFGEF  +F GAN+++DYV+SNAAVSRSFT YL  A G      
Sbjct  61    AVHLPVAGGAFSYIRITFGEFPAFFTGANLVLDYVMSNAAVSRSFTAYLGTAFGISTHK-  119

Query  1542  WRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagF  1363
             WR  V  L  G+N +D  AV +++ +T+++C ST+ESS +N++MT FH+ F  F+I+ GF
Sbjct  120   WRFVVSALPGGFNEIDPVAVVVVLAITVIICCSTRESSKVNMIMTAFHIAFIAFVIVMGF  179

Query  1362  YKGSSDNLVKSG-----GGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLP  1198
              +G S NL          G  PFG  GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P
Sbjct  180   LRGDSKNLTSPAKPEHPSGFFPFGAAGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIP  239

Query  1197  VGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLG  1021
             VG+ GSV IV+ LYCLMA+S+ +LLPY+LI  E  FSAAF+   GW+W + VVG+GAS G
Sbjct  240   VGVSGSVAIVTVLYCLMAVSMSMLLPYDLIDPEAPFSAAFRGSNGWEWVTKVVGIGASFG  299

Query  1020  IVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELK  841
             I+ SLLVAMLGQARY+CV+GR+R+VP W AK+H  T TP+NA+ FLGI  A +ALFT+L 
Sbjct  300   ILTSLLVAMLGQARYMCVIGRSRVVPVWFAKIHHRTSTPVNASSFLGIFTAVLALFTDLN  359

Query  840   IVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKL---  670
             I++ ++SIGTL VFY+VA ALI++RY  +    P+  L FL L S+ SL F+L W+L   
Sbjct  360   ILLNLVSIGTLFVFYMVANALIFKRYVPVGPTKPWPTLTFLTLFSTISLVFTLIWQLAPQ  419

Query  669   -NLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNV  493
               ++ + L     + ++   +FH +VP   +PE W VP MPW   +SIFLN+FL+ +L+ 
Sbjct  420   GKVKAFMLGASAVVAIAIVLIFHFVVPQANKPELWGVPFMPWTPCVSIFLNIFLLGSLDA  479

Query  492   KAYKRFGIWTGLMSLFYVVYGVHST  418
              +Y RFG ++GL+ L Y+ YGVH++
Sbjct  480   PSYVRFGFFSGLIVLVYLFYGVHAS  504



>ref|XP_003577030.2| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Brachypodium distachyon]
Length=553

 Score =   412 bits (1059),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 263/532 (49%), Positives = 355/532 (67%), Gaps = 24/532 (5%)
 Frame = -2

Query  1935  LNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLS  1756
             +++VR RSGA M R L W DLV LG+GGM+G GVFVTTG   R  AGP V +SY +AGL 
Sbjct  1     MSRVRARSGAPMARALRWPDLVGLGLGGMVGAGVFVTTGRATRLYAGPGVVVSYAIAGLC  60

Query  1755  ALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYL  1576
             ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +  GAN++M+YV SNAAV+RSFT YL
Sbjct  61    ALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAFLTGANLIMEYVFSNAAVARSFTAYL  120

Query  1575  SYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhv  1396
               A+G   P  WR+ V GL EG+N +D  AV +I+L+++ +C+STK+SS++N+V+T  HV
Sbjct  121   GTAVGVDAPSKWRIAVPGLPEGFNQVDLVAVGVILLISVCICYSTKDSSMVNMVLTAVHV  180

Query  1395  vffgfiiiagFYKGSSDNLVKSG-----GGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMA  1231
             VF  FII+ GF++G + NL +       GG  P GV GV  GAA+VY SYIGYD+VSTMA
Sbjct  181   VFILFIIVMGFWRGDARNLTRPSDPAHPGGFFPNGVGGVFSGAAMVYLSYIGYDAVSTMA  240

Query  1230  EEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKWA  1054
             EE+  P++ +P+G+ GSV+IV+ LYCLMA S+ +LLPY+ I  E  FS AF+   GW W 
Sbjct  241   EEVEKPARDIPIGVSGSVVIVTVLYCLMAASMSMLLPYDAIDTEAPFSGAFRGSEGWGWV  300

Query  1053  SNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGIC  874
             SNV+G GASLGI+ SL+VAMLGQARY+CV+GR+ ++P+WLAKVHP+T TP+NA+ FLG+ 
Sbjct  301   SNVIGAGASLGILTSLMVAMLGQARYMCVIGRSGVMPAWLAKVHPNTATPVNASAFLGLF  360

Query  873   QASVALFTELKIVIEIISIGTLVVFylvaaa--------liyrryaiINGNPPFQvllfl  718
              A++ALFTEL I++ ++ IGTL VFY+V+ A              +I NG    +     
Sbjct  361   TAALALFTELDILLNLVCIGTLFVFYMVSNAVVYRRYVLAASSSSSIPNGGSDRRGASAW  420

Query  717   flvsssslgfslSWKLNLQWWNLP----------LFGFLTLSFTALFHRLVPCVRRPESW  568
               ++       L+    L W   P            G   ++    F  LVP    P+ W
Sbjct  421   PTLAFLLAFSLLAIAFTLSWKLAPEGRARIALLACIGIAAVATVGAFQLLVPQAHTPQLW  480

Query  567   SVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              VP MPW  A S+FLNVFL+ +L+  +Y RF  ++    L Y +Y VH+++ 
Sbjct  481   GVPGMPWVPAASVFLNVFLLGSLDRPSYVRFAFFSAATVLVYALYSVHASFD  532



>ref|XP_002515785.1| cationic amino acid transporter, putative [Ricinus communis]
 gb|EEF46624.1| cationic amino acid transporter, putative [Ricinus communis]
Length=576

 Score =   413 bits (1061),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 271/549 (49%), Positives = 381/549 (69%), Gaps = 26/549 (5%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F +YL +L QTP +L  RA +  T  +E+++V+ RSG++M++ L W+DLV  G+GGM+G 
Sbjct  12    FRSYLQALGQTPTRLACRAGSVSTSYEEMSRVKARSGSEMQKSLRWHDLVCFGIGGMVGA  71

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             GVFVTTG  +R  AGP+V +SY +AGL ALLS+ CYTEF+V++PVAGG          EF
Sbjct  72    GVFVTTGRASRLYAGPAVVVSYAIAGLCALLSAFCYTEFAVDMPVAGG----------EF  121

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +  GAN++MDYV+SNAAV+R FT Y   A+G      WR+ V  L  G+N +D  AV 
Sbjct  122   AAFLTGANLIMDYVMSNAAVARGFTAYFCAAIGMSTSK-WRLVVHALPNGFNEIDMVAVL  180

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLA  1315
             +++ +T+++C+ST++SS++N+V+T+ H++F  F+I+ GF+KG   N           G  
Sbjct  181   VVLAITLIICYSTRQSSVVNMVLTVLHIMFILFVIVMGFWKGQWKNFTAPAYSNHPSGFF  240

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             PFG  GV +GAA+VY SYIGYD+VST+AEE+ NP   +P+G+ GSV +V+ LYCLMA S+
Sbjct  241   PFGAPGVFNGAALVYLSYIGYDAVSTLAEEVHNPVNDIPIGVSGSVALVTVLYCLMAASM  300

Query  1134  cllLPYNLIPEEGSFSAAFKMM--GWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVG  961
              +LLPY+LI  E  FSAAFK    GW+W SNV+GVGAS GI+ SLLV+MLGQARY+CV+G
Sbjct  301   SMLLPYDLIDAEAPFSAAFKGKSDGWEWVSNVIGVGASFGILTSLLVSMLGQARYMCVIG  360

Query  960   RARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaa  781
             R+ +VP+W A+VHP T TP+NA+ FLGI  A++ALFT+L +++ ++SIGTL VFY+VA A
Sbjct  361   RSSVVPAWFARVHPRTSTPVNASAFLGIFTAAIALFTDLNVLLNLVSIGTLFVFYMVANA  420

Query  780   liyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLP---LFGFLTLSFTAL  610
             +IYRRY  I    P+  L FL   S +SL F+L W    Q    P   + G  T++  A+
Sbjct  421   VIYRRYVAIGTTKPWPTLSFLCSFSFTSLLFTLIWHFMPQ--GKPKAFMLGACTMTAIAI  478

Query  609   ---FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYV  439
                F+ +VP  R+PE W VPLMPW   +SIFLN+FL+ +L+  +Y RF  ++GL  L YV
Sbjct  479   IQVFNCMVPQARKPEFWGVPLMPWIPCVSIFLNIFLLGSLDGPSYLRFAFFSGLAVLVYV  538

Query  438   VYGVHSTYK  412
             +Y VH+++ 
Sbjct  539   LYSVHASFD  547



>ref|XP_008679437.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Zea mays]
 gb|AFW64861.1| hypothetical protein ZEAMMB73_477510 [Zea mays]
Length=599

 Score =   401 bits (1030),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 283/551 (51%), Positives = 375/551 (68%), Gaps = 17/551 (3%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y  +L+QTP++L +RA A   P +E+++VR RSG  M R L W+DLV LG+GGM+G GV
Sbjct  26    AYGRALAQTPRRLARRACAATAPREEMSRVRARSGPRMARALRWWDLVGLGLGGMVGAGV  85

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVTTG  AR  AGP + +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  
Sbjct  86    FVTTGRAARIYAGPGLVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAA  145

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +  GAN++M+YV SNAAV+RSFT YL  A+G   P  WR+ V GL +G+N +D  AV +I
Sbjct  146   FLTGANLIMEYVFSNAAVARSFTAYLGTAVGVDAPSKWRIPVPGLPQGFNQVDLVAVGVI  205

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVK------SGGGLAP  1312
             +LL++ +C+STKESS++NLV+T  HVVF  FII+ GF  G + NL +      S GG  P
Sbjct  206   LLLSVCICYSTKESSVVNLVLTGVHVVFILFIIVMGFAHGDARNLSRPADPAHSPGGFFP  265

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
              G  GV +GAA VY SYIGYD+VSTMAEE+  P + +P G+ GSV++V+ LYCLMA S+ 
Sbjct  266   HGAAGVFNGAAAVYLSYIGYDAVSTMAEEVERPDRDIPAGVSGSVVLVTVLYCLMATSMS  325

Query  1131  llLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
             +LLPY+ I  E  FS AFK   G  W SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+
Sbjct  326   MLLPYDAIDPEAPFSGAFKGRDGMAWVSNVIGAGASLGILTSLMVAMLGQARYLCVIGRS  385

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              +VP+WLA+V P T TP+NA+ FLG+  A++ALFTEL +++ ++SIGTL VFY+VA A++
Sbjct  386   GVVPAWLARVDPRTATPINASAFLGLLTAALALFTELDVLLNLVSIGTLFVFYMVANAVV  445

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLP----LFGFLT------L  625
             YRRY         Q       ++  +    ++    L W   P      G L+      +
Sbjct  446   YRRYVGDPCPGSGQKRRAWPALAFIAAFSLIAISFTLLWQFAPGGAAKVGLLSGTAAVAV  505

Query  624   SFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLF  445
             +    F  LVP  R PE W VP MPW  A S+FLNVFL+ +L+  +Y RFG ++    LF
Sbjct  506   AAVVAFQALVPQAREPELWGVPGMPWVPAASVFLNVFLLGSLDRPSYVRFGFFSAFAVLF  565

Query  444   YVVYGVHSTYK  412
             YV Y VH++Y 
Sbjct  566   YVFYSVHASYD  576



>ref|XP_002441854.1| hypothetical protein SORBIDRAFT_08g003530 [Sorghum bicolor]
 gb|EES15692.1| hypothetical protein SORBIDRAFT_08g003530 [Sorghum bicolor]
Length=545

 Score =   397 bits (1021),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 274/521 (53%), Positives = 364/521 (70%), Gaps = 14/521 (3%)
 Frame = -2

Query  1935  LNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLS  1756
             +++VR RSGADM R L W+DLV LG+GGM+G GVFVTTG  AR  AGP V +SY +AGL 
Sbjct  1     MSRVRARSGADMARALRWWDLVGLGLGGMVGAGVFVTTGRAARLHAGPGVVVSYAIAGLC  60

Query  1755  ALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYL  1576
             ALLS+ CYTEF+V++PVAGGAFSYLR+TFGE   +  GAN++M+YV SNAAV+RSFT YL
Sbjct  61    ALLSAFCYTEFAVDLPVAGGAFSYLRVTFGELAAFLTGANLIMEYVFSNAAVARSFTAYL  120

Query  1575  SYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhv  1396
               A+G   P  WR+ V GL +G+N +D  AVA+I+L+T+ +C+STKESS++N+V+T  HV
Sbjct  121   GTAVGVDAPSQWRITVHGLPDGFNQVDLLAVAVILLITVCICYSTKESSVVNMVLTAVHV  180

Query  1395  vffgfiiiagFYKGSSDNLV------KSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTM  1234
              F  FII  GF  G + NL       +S GG  P G  GV +GAA+VY SYIGYD+VSTM
Sbjct  181   AFILFIIGMGFRHGDARNLTRPADPSRSPGGFFPHGAVGVFNGAAMVYLSYIGYDAVSTM  240

Query  1233  AEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKW  1057
             AEE+  P++ +PVG+ GSV++V+ LYCLMA S+ +LLPY+ I  E  FS AFK      W
Sbjct  241   AEEVQRPARDIPVGVSGSVVVVTVLYCLMAASMSMLLPYDAIDPEAPFSGAFKGRERCAW  300

Query  1056  ASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGI  877
              SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+ ++P+WLA+V+P T TP+NA+ FLG+
Sbjct  301   VSNVIGAGASLGILTSLMVAMLGQARYLCVIGRSGVMPAWLARVNPRTATPVNASAFLGV  360

Query  876   CQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvssss  697
               A++ALFTEL I++ ++ IGTL VF  + A  +  R  +  G   +  L FL + S S+
Sbjct  361   FTAALALFTELDILLNLVCIGTLFVF-YMVANAVVYRRYVGGGGARWPTLAFLLVFSLSA  419

Query  696   lgfslSWKL------NLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAAL  535
             L F+L+WKL       ++   L     L ++  A F  LVP  R PE W VP MPW  A 
Sbjct  420   LAFTLAWKLAPPERRGVRAGLLAACAALAVTAVAAFQALVPQARVPELWGVPGMPWVPAA  479

Query  534   SIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             S+FLNVFL+ +L+  +Y RF I++    L YV+Y VH++Y 
Sbjct  480   SVFLNVFLLGSLDRPSYVRFAIFSAAALLVYVLYSVHASYD  520



>ref|XP_002442832.1| hypothetical protein SORBIDRAFT_08g003570 [Sorghum bicolor]
 gb|EES16670.1| hypothetical protein SORBIDRAFT_08g003570 [Sorghum bicolor]
Length=545

 Score =   395 bits (1016),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 279/521 (54%), Positives = 369/521 (71%), Gaps = 13/521 (2%)
 Frame = -2

Query  1935  LNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLS  1756
             +++VR RSGADM R L W+DLV LG+GGM+G GVFVTTG  AR  AGP V +SY +AGL 
Sbjct  1     MSRVRARSGADMARALRWWDLVGLGLGGMVGAGVFVTTGRAARLHAGPGVVVSYAIAGLC  60

Query  1755  ALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYL  1576
             ALLS+ CYTEF+V++PVAGGAFSYLR+TFGE   +  GAN++M+YV SNAAV+RSFT YL
Sbjct  61    ALLSAFCYTEFAVDLPVAGGAFSYLRVTFGELAAFLTGANLIMEYVFSNAAVARSFTAYL  120

Query  1575  SYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhv  1396
               A+G   P  WR+ V  L +G+N +D  AVA+I+L+T+ +C+STKESS++N+V+T  HV
Sbjct  121   GTAVGVDAPSQWRITVHALPDGFNQVDLVAVAVILLITVCICYSTKESSVVNMVLTAVHV  180

Query  1395  vffgfiiiagFYKGSSDNLV------KSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTM  1234
              F  FII  GF  G + NL       +S GG  P G  GV +GAA+VY SYIGYD+VSTM
Sbjct  181   AFILFIIGMGFRHGDARNLTRPADPSRSPGGFFPHGAVGVFNGAAMVYLSYIGYDAVSTM  240

Query  1233  AEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKW  1057
             AEE+  P++ +PVG+ GSV++V+ LYCLMA S+ +LLPY+ I  E  FS AFK      W
Sbjct  241   AEEVQRPARDIPVGVSGSVVVVTVLYCLMAASMSMLLPYDAIDPEAPFSGAFKGRERCAW  300

Query  1056  ASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGI  877
              SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+ ++P+WLA+V+P T TP+NA+ FLG+
Sbjct  301   VSNVIGAGASLGILTSLMVAMLGQARYLCVIGRSGVMPAWLARVNPRTATPVNASAFLGV  360

Query  876   CQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvssss  697
               A++ALFTEL I++ ++ IGTL VFY+VA A++YRRY    G   +  L FL + S S+
Sbjct  361   FTAALALFTELDILLNLVCIGTLFVFYMVANAVVYRRYVGGGGGARWPTLAFLLVFSLSA  420

Query  696   lgfslSWKL------NLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAAL  535
             L F+L+WKL       ++   L     L ++  A F  LVP  R PE W VP MPW  A 
Sbjct  421   LAFTLAWKLAPPEPRGVRAGLLAACAALAVTAVAAFQALVPQARVPELWGVPGMPWVPAA  480

Query  534   SIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             S+FLNVFL+ +L+  +Y RF I++    L YV+Y VH++Y 
Sbjct  481   SVFLNVFLLGSLDRPSYVRFAIFSAAALLVYVLYSVHASYD  521



>gb|ABA96501.1| Amino acid permease family protein, expressed [Oryza sativa Japonica 
Group]
Length=535

 Score =   392 bits (1007),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 257/511 (50%), Positives = 345/511 (68%), Gaps = 18/511 (4%)
 Frame = -2

Query  1902  MKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEF  1723
             M R L W DLV LG+GGM+G GVFVTTG   R  AGP+V +SY +AGL ALLS+ CYTEF
Sbjct  1     MARALRWPDLVGLGLGGMVGAGVFVTTGRATRLYAGPAVVVSYAIAGLCALLSAFCYTEF  60

Query  1722  SVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDC  1543
             +V++PVAGGAFSYLR+TFGE   +  GAN++M+YV SNAAV+RSFT YL  A+G   P  
Sbjct  61    AVDMPVAGGAFSYLRVTFGELAAFLTGANLIMEYVFSNAAVARSFTAYLGTAVGVDAPSK  120

Query  1542  WRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagF  1363
             WR+ V GL +G+N +D  AV +I+L+T+ +C+STKESS +N+V+T  HV+F  F+I+ GF
Sbjct  121   WRIAVPGLPKGFNEVDLVAVGVILLITVCICYSTKESSSVNMVLTAVHVLFIMFVIVMGF  180

Query  1362  YKGSSDNLVKSG------GGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSL  1201
             ++G + NL +        GG  P G  GV +GAA+VY SYIGYD+VSTMAEE+  PS+ +
Sbjct  181   WRGDTRNLTRPADPEHNPGGFFPHGAAGVFNGAAMVYLSYIGYDAVSTMAEEVERPSRDI  240

Query  1200  PVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASL  1024
             P+G+ GSV++V+ LYCLMA S+ +LLPY+ I  E  FS AFK   GW W SNV+G GASL
Sbjct  241   PIGVSGSVVLVTLLYCLMAASMSMLLPYDAIDTEAPFSGAFKGSSGWGWVSNVIGAGASL  300

Query  1023  GIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTEL  844
             GI+ SL+VAMLGQARYLCV+GR+ ++P+WLA+V+P T TP+NA+ FLG+  A++ALFTEL
Sbjct  301   GILTSLMVAMLGQARYLCVIGRSGVMPAWLARVNPRTATPVNASAFLGVFTAALALFTEL  360

Query  843   KIVIEIISIGTLVV-FylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKLN  667
              I++ ++ IGTL V + +  A +  R  A    +   +    +  ++       ++    
Sbjct  361   DILLNLVCIGTLFVFYMVANAVVYRRYVAAAEDDEEGRRRGAVPTLAFLLAFSLVALCFT  420

Query  666   LQWWNLPLFGFLT----------LSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNV  517
             L W   P  G  T           +  A F  LVP  RRPE W VP MPW  A S+FLNV
Sbjct  421   LVWKLAPRGGARTGLLVACGAAAAAAVAAFRALVPQARRPELWGVPAMPWVPAASVFLNV  480

Query  516   FLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
             FL+ +L+  +Y RFG +T   +L YV+Y VH
Sbjct  481   FLLGSLDRPSYVRFGFFTAAAALVYVLYSVH  511



>emb|CBI40921.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   386 bits (991),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 258/372 (69%), Positives = 300/372 (81%), Gaps = 7/372 (2%)
 Frame = -2

Query  1431  SLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLDGAAIVYFSYIGY  1252
             S+LN VMTIFHVVFFGFIIIAGF KGS+ NLV   G LAPFGV+GVLDGAA VYFSYIGY
Sbjct  33    SILNFVMTIFHVVFFGFIIIAGFLKGSAKNLVNPDG-LAPFGVKGVLDGAAQVYFSYIGY  91

Query  1251  DSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKM  1072
             DSVSTMAEEI+NPSKSLPVGI+GSV IVS LYCLM+ +LC++LPYN IPE+ SF+ AF+ 
Sbjct  92    DSVSTMAEEISNPSKSLPVGIMGSVFIVSGLYCLMSFALCMMLPYNQIPEKASFAIAFQR  151

Query  1071  MGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNAT  892
             MGWKWASN+VG GASLGIVASLLVAMLGQARYLCV+GRARLVP WLAKVHPSTGTPLNAT
Sbjct  152   MGWKWASNIVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPLWLAKVHPSTGTPLNAT  211

Query  891   IFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflfl  712
             +FLG   AS++LFTEL+IV++++++ TL+VFYLVA ALIYRRY I   NPPF  LLFL L
Sbjct  212   LFLGAFTASISLFTELEIVVDMVNLCTLLVFYLVANALIYRRYVITVNNPPFHTLLFLSL  271

Query  711   vsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALS  532
             +S SS+ FSLSWKL  QWW LPLFG + +  TA FH  VP   +P  WSVP MPWPAA+S
Sbjct  272   LSCSSIAFSLSWKLK-QWWGLPLFGGIMIIITACFHYFVPYPNQPSKWSVPFMPWPAAMS  330

Query  531   IFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKveemevmvdnnnnhvnnnNS  352
             IFLNVFLMTTL   + +RFG+W+ L+ LFYV+YGVHSTY+           +    N NS
Sbjct  331   IFLNVFLMTTLKKLSLQRFGVWSCLIILFYVLYGVHSTYR-----AEEMGMDAGGVNPNS  385

Query  351   TTQPIKLEIQVL  316
             + Q  KL+IQ+L
Sbjct  386   SAQQTKLDIQLL  397



>gb|EEC67700.1| hypothetical protein OsI_35169 [Oryza sativa Indica Group]
Length=610

 Score =   391 bits (1005),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 235/411 (57%), Positives = 313/411 (76%), Gaps = 7/411 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L+QTP++L +RA A  +P +E+++VR RSGA M R+L W+DLV LG+GGM+G GVF
Sbjct  34    YGRALAQTPRRLARRACAATSPGEEMSRVRARSGARMARRLRWHDLVGLGLGGMVGAGVF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG   R  AGP V +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGE   +
Sbjct  94    VTTGRATRLYAGPGVVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGELAAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++M+YV SNAAV+RSFT YL  A+G   P  WR+ V GL +G+N +D  AV +I+
Sbjct  154   LTGANLIMEYVFSNAAVARSFTAYLGTAVGVDAPSKWRIAVPGLPKGFNEVDLIAVGVIL  213

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG------GGLAPF  1309
             L+++ +C+STKESS++N+V+T  HV F  FII+ GF++G + NL +        GG  P 
Sbjct  214   LISVCICYSTKESSVVNMVLTAVHVAFILFIIVMGFWRGDTRNLTRPADPAHNPGGFFPH  273

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+  PS+ +PVG+ GSV++V+ LYCLMA S+ +
Sbjct  274   GAAGVFNGAAMVYLSYIGYDAVSTMAEEVERPSRDIPVGVSGSVMLVTLLYCLMAASMSM  333

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY+ I  E  FS AFK   GW W SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+ 
Sbjct  334   LLPYDAIDTEAPFSGAFKGSSGWGWVSNVIGAGASLGILTSLMVAMLGQARYLCVIGRSG  393

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVF  799
             ++P+WLAKVHP T TP+NA+ FLG+  A++ALFTEL +++ ++SIGTL VF
Sbjct  394   VMPAWLAKVHPCTATPVNASAFLGVFTAALALFTELDVLLNLVSIGTLFVF  444


 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  609  FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
            F  LV   RRPE W VP MPW  A S+FLNVFL+ +L+  +Y RFG +T    L YV+Y 
Sbjct  517  FRALVAEARRPELWGVPAMPWVPAASVFLNVFLLGSLDRPSYVRFGFFTAAAVLVYVLYS  576

Query  429  VHSTY  415
            VH++Y
Sbjct  577  VHASY  581



>ref|XP_006368940.1| hypothetical protein POPTR_0001s150802g, partial [Populus trichocarpa]
 gb|ERP65509.1| hypothetical protein POPTR_0001s150802g, partial [Populus trichocarpa]
Length=371

 Score =   383 bits (983),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 261/377 (69%), Positives = 312/377 (83%), Gaps = 7/377 (2%)
 Frame = -2

Query  1443  TKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLDGAAIVYFS  1264
             TKESS+LNL+MT+FHV+FFGFIII GF KGS+ NLV+ GG LAPFGV+GVLDGAAIVYFS
Sbjct  1     TKESSILNLIMTVFHVIFFGFIIIVGFSKGSARNLVEPGG-LAPFGVKGVLDGAAIVYFS  59

Query  1263  YIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSA  1084
             YIGYDSVSTMAEEI NP+KSLPVGI+GSVLIV+ LYCLMALSLCLL+P+N+I ++ SFS 
Sbjct  60    YIGYDSVSTMAEEIQNPAKSLPVGILGSVLIVTGLYCLMALSLCLLVPFNMIDKDASFSV  119

Query  1083  AFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTP  904
             AF+ +GWKWASNVVG GASLGIVASLLVAMLGQARYLCV+GRARLVPSW AKV+PSTGTP
Sbjct  120   AFEKIGWKWASNVVGAGASLGIVASLLVAMLGQARYLCVIGRARLVPSWFAKVNPSTGTP  179

Query  903   LNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvll  724
             LNAT+FLG+C AS+ALFTEL I++EIISI TL+VFY+VA ALIYRRY +I+ NPP + LL
Sbjct  180   LNATLFLGLCTASIALFTELSIILEIISISTLLVFYMVANALIYRRYVVISHNPPSRTLL  239

Query  723   flflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRRP-ESWSVPLMPW  547
             FL L+SS+++GFS+SWKL+ QWW LP+ G   ++ TA F   VP V +P E WSVP MPW
Sbjct  240   FLVLLSSTAIGFSMSWKLDEQWWALPVLGGFMIAITAFFQYKVPSVCQPNEEWSVPFMPW  299

Query  546   PAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYKveemevmvdnnnnhv  367
             PA  SIFLNVFLMTTL  ++++RFGIW  L++LFYV+YGVHSTY+               
Sbjct  300   PAVTSIFLNVFLMTTLKARSFQRFGIWAFLITLFYVLYGVHSTYR-----AEEMEVGVGE  354

Query  366   nnnNSTTQPIKLEIQVL  316
               ++ + Q  KL+IQVL
Sbjct  355   IPHHPSIQQTKLDIQVL  371



>ref|XP_004978714.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Setaria italica]
Length=542

 Score =   387 bits (994),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 268/525 (51%), Positives = 358/525 (68%), Gaps = 18/525 (3%)
 Frame = -2

Query  1935  LNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLS  1756
             +++VR RSG  M R L W+DLV LG+GGM+G GVFVTTG   R  AGP V +SY +AGL 
Sbjct  1     MSRVRARSGPRMARALRWWDLVGLGLGGMVGAGVFVTTGRATRLYAGPGVVVSYAIAGLC  60

Query  1755  ALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYL  1576
             ALLS+ CYTEF+V++PVAGGAFSYLR+TFGE   +  GAN++M+YV SNAAV+RS T YL
Sbjct  61    ALLSAFCYTEFAVDMPVAGGAFSYLRVTFGELAAFLTGANLIMEYVFSNAAVARSLTAYL  120

Query  1575  SYALGEGNPDCWRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhv  1396
               A+G   P  WR+ V GL EG+N +D  AV +I+L+++ +C+STKESS++NLV+T  HV
Sbjct  121   GTAVGVDAPSKWRIAVPGLPEGFNQVDLIAVGVILLISVCICYSTKESSVVNLVLTGVHV  180

Query  1395  vffgfiiiagFYKGSSDNLV------KSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTM  1234
              F  F+I+ GF  G   NL       ++ GG  P G  GV +GAA VY SYIGYD+VSTM
Sbjct  181   AFILFVIVMGFKHGDKRNLTHPADPSRNPGGFFPHGAAGVFNGAAAVYLSYIGYDAVSTM  240

Query  1233  AEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKW  1057
             AEE+  P++ +P G+ GSV++V+ALYCLMA S+ +LLPY+ I  E  FS AFK M G  W
Sbjct  241   AEEVERPARDIPAGVSGSVVVVTALYCLMAASMSMLLPYDAIDPEAPFSGAFKGMKGKAW  300

Query  1056  ASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGI  877
              SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+ ++P+WLA+VHP T TP+NA+ FLG+
Sbjct  301   VSNVIGAGASLGILTSLMVAMLGQARYLCVIGRSGVMPAWLARVHPRTATPVNASAFLGL  360

Query  876   CQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvssss  697
               A++ALFTEL +++ ++SIGTL VFY+VA A++YRRY   + N           ++   
Sbjct  361   FTAALALFTELDVLLNLVSIGTLFVFYMVANAVVYRRYVGDSDNSD-SSRRAWPALAFLG  419

Query  696   lgfslSWKLNLQWWNLPLFG----------FLTLSFTALFHRLVPCVRRPESWSVPLMPW  547
                 ++    L W  +P  G             ++  A FH LVP  R PE W VP MPW
Sbjct  420   AFSLIALSFTLLWQFVPAGGARAGLLAACAAAAVAAVAAFHALVPQARAPELWGVPGMPW  479

Query  546   PAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
               A S+FLNVFL+ +L+  +Y RFG ++    L YV+Y VH+++ 
Sbjct  480   VPAASVFLNVFLLGSLDRPSYVRFGFFSAAAVLVYVLYSVHASHD  524



>ref|XP_002449017.1| hypothetical protein SORBIDRAFT_05g003440 [Sorghum bicolor]
 gb|EES08005.1| hypothetical protein SORBIDRAFT_05g003440 [Sorghum bicolor]
Length=608

 Score =   387 bits (995),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 286/570 (50%), Positives = 375/570 (66%), Gaps = 54/570 (9%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y  +L+QTP++L +RA A   P +E+++VR RSG  M R L W+DLV LG+GGM+G GV
Sbjct  30    AYGRALAQTPRRLARRACAATAPHEEMSRVRARSGTRMARALRWWDLVGLGLGGMVGAGV  89

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVTTG  AR  AGP + +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  
Sbjct  90    FVTTGRAARLYAGPGLVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAA  149

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +  GAN++M+YV SNAAV+RSFT YL  A+G   P  WR+ V GL EG+N +D  AV +I
Sbjct  150   FLTGANLIMEYVFSNAAVARSFTAYLGTAVGVDAPSKWRIPVPGLPEGFNQVDLVAVGVI  209

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNL------VKSGGGLAP  1312
             +LL++ +C+STKESS++NLV+T  HV F  FII+ GF  G + NL      V + GG  P
Sbjct  210   LLLSVCICYSTKESSVVNLVLTGVHVAFILFIIVMGFVHGDARNLSRPADPVHNPGGFFP  269

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
              G  GV +GAA VY SYIGYD+VSTMAEE+  P + +P G+ GSV++V+ALYCLMA S+ 
Sbjct  270   HGAAGVFNGAAAVYLSYIGYDAVSTMAEEVERPDRDIPAGVSGSVVLVTALYCLMAASMS  329

Query  1131  llLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
             +LLPY+ I  E  FS AFK   G  W SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+
Sbjct  330   MLLPYDAIDPEAPFSGAFKGRDGMAWVSNVIGAGASLGILTSLMVAMLGQARYLCVIGRS  389

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              +VP+WLA+V   T TP+NA+ FLG+  A++ALFTEL +++ ++SIGTL VFY+VA A++
Sbjct  390   GVVPAWLARVDRRTATPVNASAFLGLLTAALALFTELDVLLNLVSIGTLFVFYMVANAVV  449

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFG---FLTLSFTAL--  610
             YRRY    G+P                  + +      W  L   G    + LSFT L  
Sbjct  450   YRRYV---GDP--------------CPAGTGTAHETRAWPTLAFIGAFSLIALSFTLLWQ  492

Query  609   -------------------------FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMT  505
                                      F  LVP  R PE W VP MPW  A S+FLNVFL+ 
Sbjct  493   FAPGGAAKAVMLSATAAAAVAVVAAFQALVPQAREPEVWGVPGMPWVPAASVFLNVFLLG  552

Query  504   TLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             +L+  +Y RFG ++  + L YV+Y VH++Y
Sbjct  553   SLDRPSYARFGFFSAAVVLVYVLYSVHASY  582



>gb|KEH31612.1| cationic amino acid transporter [Medicago truncatula]
Length=309

 Score =   375 bits (964),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 235/305 (77%), Positives = 271/305 (89%), Gaps = 1/305 (0%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y  SLSQTP +L+KR LATWTPDQE N+VR RSGADMKRKL WYDL+ALGVGGMLGVG
Sbjct  5     SNYFYSLSQTPHRLRKRMLATWTPDQEFNQVRQRSGADMKRKLNWYDLIALGVGGMLGVG  64

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTGPVA   +GPSVFISYI+AG+SALLSSLCYTEF+V+VPVAGGAFSYLR+TFGEF+
Sbjct  65    VFVTTGPVALHQSGPSVFISYIIAGISALLSSLCYTEFAVQVPVAGGAFSYLRLTFGEFL  124

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
             GYF GANILM+YV SNAAV+RSFTEYLS+A GE NP+ WRV+V GL + YNMLDFPAVAL
Sbjct  125   GYFGGANILMEYVFSNAAVARSFTEYLSFAFGENNPNVWRVEVHGLPKDYNMLDFPAVAL  184

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I+LLT+ LCHSTKESS+LNL+MT+FHV+FFGFII+AG+Y GS+ NLV    G+AP+GVRG
Sbjct  185   ILLLTLCLCHSTKESSILNLIMTVFHVIFFGFIIVAGYYNGSTKNLVNP-KGIAPYGVRG  243

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             VLDGAAIVYFSYIGYDS STMAEE+ +P KSLP+GIVGSVLI + LYCLMALSLC+++PY
Sbjct  244   VLDGAAIVYFSYIGYDSASTMAEEVKDPYKSLPIGIVGSVLITTLLYCLMALSLCIMVPY  303

Query  1116  NLIPE  1102
             N +  
Sbjct  304   NKVSH  308



>ref|XP_008465895.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Cucumis melo]
Length=323

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 241/309 (78%), Positives = 270/309 (87%), Gaps = 5/309 (2%)
 Frame = -2

Query  2022  IFST----YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvg  1855
             +FST    YL SLSQTP +L+KR LATWTPDQELN+VR RSGADMKRKL W+DL+ALGVG
Sbjct  5     VFSTFLRHYLYSLSQTPHRLRKRMLATWTPDQELNQVRQRSGADMKRKLKWFDLIALGVG  64

Query  1854  gmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRI  1675
             GMLGVGVFVTTGPVA    GP+VF+SYI+AG+SALLSSLCYTEFSV V  AGGAFSYLR+
Sbjct  65    GMLGVGVFVTTGPVALHVTGPAVFLSYIIAGISALLSSLCYTEFSVHVSAAGGAFSYLRL  124

Query  1674  TFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLD  1495
             TFGEFVGYFAGANI+M+YVLSNAAV+RSFTEYL  A GE  P+ WRV+V GL+ GYNMLD
Sbjct  125   TFGEFVGYFAGANIIMEYVLSNAAVARSFTEYLCVAFGESEPNAWRVEVHGLLNGYNMLD  184

Query  1494  FPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLA  1315
             FPAV LI+LLT+ LCHSTKESS LNL+MTIFHV+FFGFII  G YKGS+ NLVK   GLA
Sbjct  185   FPAVGLILLLTLCLCHSTKESSTLNLIMTIFHVIFFGFIIGCGMYKGSAKNLVKP-DGLA  243

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             PFGV+GVLDGAAIVYFSYIGYDS ST+AEEI NP+KSLP+GIVGSV+I SALYCLMALSL
Sbjct  244   PFGVKGVLDGAAIVYFSYIGYDSASTLAEEIQNPTKSLPIGIVGSVIITSALYCLMALSL  303

Query  1134  cllLPYNLI  1108
              L+LPYN +
Sbjct  304   SLMLPYNQV  312



>ref|XP_006445759.1| hypothetical protein CICLE_v10014713mg [Citrus clementina]
 gb|ESR58999.1| hypothetical protein CICLE_v10014713mg [Citrus clementina]
Length=453

 Score =   375 bits (963),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 214/386 (55%), Positives = 297/386 (77%), Gaps = 8/386 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S YL +L+ TP ++ +RAL+  T  +E+++VR +SG+DM++ L WYDLV  G+GGM+G G
Sbjct  14    SAYLRALAHTPARVSRRALSVSTSYEEMSRVRAKSGSDMRKTLRWYDLVCFGIGGMVGAG  73

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTG  +R  AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF 
Sbjct  74    VFVTTGHASRLNAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFA  133

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +  G+N++M+YV+SNAAV+R F  Y   A+G      WR+KVDGL +G+N +D  AVA+
Sbjct  134   AFLTGSNLIMEYVMSNAAVARGFASYFGTAIGVPTAK-WRLKVDGLPDGFNEIDVLAVAV  192

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAP  1312
             ++++T V+C+ST+ESS++N+++T+ H++F  F+I+ GF+KG   N  + G      G  P
Sbjct  193   VLVITFVICYSTRESSVVNMILTVLHILFIAFVILMGFWKGDPKNFTEPGDPKNPSGFFP  252

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
             +G +GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P+G+ GSV+IV+ LYCLMA S+ 
Sbjct  253   YGAKGVFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVIIVTVLYCLMAASMS  312

Query  1131  llLPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGR  958
             +L+PY++I  E  FS AF  K  GWKW SNV+GVGAS GI+ SLLVAMLGQARY+CV+GR
Sbjct  313   MLMPYDMIDAEAPFSGAFSGKSDGWKWVSNVIGVGASFGILTSLLVAMLGQARYMCVIGR  372

Query  957   ARLVPSWLAKVHPSTGTPLNATIFLG  880
             + +VP+W A+VHP T TP+NA+ FLG
Sbjct  373   SSVVPAWFARVHPKTSTPVNASAFLG  398



>gb|EMT15465.1| High affinity cationic amino acid transporter 1 [Aegilops tauschii]
Length=537

 Score =   376 bits (965),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 261/519 (50%), Positives = 345/519 (66%), Gaps = 23/519 (4%)
 Frame = -2

Query  1902  MKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEF  1723
             M R L W DLV LG+GGM+G GV VTTG   R  AGP V +SY +AGL ALLS+ CYTEF
Sbjct  1     MARALRWPDLVGLGLGGMVGAGVVVTTGRATRLHAGPGVVVSYAIAGLCALLSAFCYTEF  60

Query  1722  SVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDC  1543
             +V++PVAGGAFSYLR+TFGEF  +  GAN++M+YV SNAAV+RSFT Y+  A+G   P  
Sbjct  61    AVDMPVAGGAFSYLRVTFGEFAAFLTGANLIMEYVFSNAAVARSFTAYMGTAVGVDAPSK  120

Query  1542  WRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagF  1363
             WR+ V GL  G+N +D  AV +I+L+++ +C+STKESS +N+V+T  HV F  FII+ GF
Sbjct  121   WRIAVPGLPNGFNQVDLVAVGVILLISVCICYSTKESSKVNMVLTAVHVAFILFIIVMGF  180

Query  1362  YKGSSDNLVKSG-----GGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLP  1198
             ++G + NL         GG  P GV GV  GAA+VY SYIGYD+VSTMAEE+  P++ +P
Sbjct  181   WRGDARNLTHPADPAHPGGFFPNGVGGVFSGAAMVYLSYIGYDAVSTMAEEVERPARDIP  240

Query  1197  VGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLG  1021
             +G+ GSV+IV+ LYCLMA S+ +LLPY+ I  E  FS AF+   GW W SNV+G GASLG
Sbjct  241   IGVSGSVIIVTVLYCLMAASMSMLLPYDAIDTEAPFSGAFRGSDGWGWVSNVIGAGASLG  300

Query  1020  IVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELK  841
             I+ SL+VAMLGQARYLCV+GR+ ++P+WLAKVHP T TP+NA+ FLG+  A++ALFTEL 
Sbjct  301   ILTSLMVAMLGQARYLCVIGRSGVMPAWLAKVHPKTATPVNASAFLGLLTAALALFTELD  360

Query  840   IVIEIISIGTL---------VVFylvaaaliyrryaiINGNP-PFQvllflflvsssslg  691
             I++ ++ IGTL         VV+               +  P  +  L FL   S  +L 
Sbjct  361   ILLNLVCIGTLFVFYMVSNAVVYRRYVVGPTGSSTESGDRQPSAWPTLAFLLAFSLIALS  420

Query  690   fslSWKLNLQWWNLPLFGFLT------LSFTALFHRLVPCVRRPESWSVPLMPWPAALSI  529
             F+L WKL  +     + G L+      ++    F  LVP    PE W VP MPW  A S+
Sbjct  421   FTLVWKLAPEGGRTRV-GLLSACGAAAVATVGAFQALVPQAHTPELWGVPGMPWVPAASV  479

Query  528   FLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             FLNVFL+ +L+  +Y RFG ++    L YV+Y VH++Y 
Sbjct  480   FLNVFLLGSLDRPSYVRFGFFSAAAVLVYVLYSVHASYD  518



>ref|NP_001065789.2| Os11g0155500 [Oryza sativa Japonica Group]
 dbj|BAF27634.2| Os11g0155500 [Oryza sativa Japonica Group]
Length=667

 Score =   375 bits (964),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 235/411 (57%), Positives = 314/411 (76%), Gaps = 7/411 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L+QTP++L +RA A  +P +E+++VR RSGA M R+L W+DLV LG+GGM+G GVF
Sbjct  34    YGRALAQTPRRLARRACAATSPGEEMSRVRARSGARMARRLRWHDLVGLGLGGMVGAGVF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG   R  AGP V +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGE   +
Sbjct  94    VTTGRATRLYAGPGVVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGELAAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++M+YV SNAAV+RSFT YL  A+G   P  WR+ V GL +G+N +D  AV +I+
Sbjct  154   LTGANLIMEYVFSNAAVARSFTAYLGTAVGVDAPSKWRIAVPGLPKGFNEVDLIAVGVIL  213

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVK------SGGGLAPF  1309
             L+++ +C+STKESS++N+V+T  HV F  FII+ GF++G + NL +      + GG  P 
Sbjct  214   LISVCICYSTKESSVVNMVLTAVHVAFILFIIVMGFWRGDTRNLTRPVDLAHNPGGFFPH  273

Query  1308  GVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcl  1129
             G  GV +GAA+VY SYIGYD+VSTMAEE+  PS+ +PVG+ GSV++V+ LYCLMA S+ +
Sbjct  274   GAAGVFNGAAMVYLSYIGYDAVSTMAEEVERPSRDIPVGVSGSVVLVTLLYCLMAASMSM  333

Query  1128  lLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LLPY+ I  E  FS AFK   GW W SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+ 
Sbjct  334   LLPYDAIDTEAPFSGAFKGSSGWGWVSNVIGAGASLGILTSLMVAMLGQARYLCVIGRSG  393

Query  951   LVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVF  799
             ++P+WLAKVHP T TP+NA+ FLG+  A++ALFTEL +++ ++SIGTL VF
Sbjct  394   VMPAWLAKVHPCTATPVNASAFLGVFTAALALFTELDVLLNLVSIGTLFVF  444


 Score = 72.8 bits (177),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  609  FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
            F  LV   RRPE W VP MPW  A S+FLNVFL+ +L+  +Y RFG +T    L YV+Y 
Sbjct  517  FRALVAEARRPELWGVPAMPWVPAASVFLNVFLLGSLDRPSYVRFGFFTAAAVLVYVLYS  576

Query  429  VHSTY  415
            VH++Y
Sbjct  577  VHASY  581



>gb|KDO40957.1| hypothetical protein CISIN_1g0398001mg, partial [Citrus sinensis]
Length=387

 Score =   364 bits (935),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 209/380 (55%), Positives = 294/380 (77%), Gaps = 8/380 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S YL +L+ TP ++ +RAL+  T  +E+++VR +SG+DM++ L WYDLV  G+GGM+G G
Sbjct  14    SAYLRALAHTPARVSRRALSVSTSYEEMSRVRAKSGSDMRKTLRWYDLVCFGIGGMVGAG  73

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFVTTG  +R  AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF 
Sbjct  74    VFVTTGRASRLNAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFA  133

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +  G+N++++YV+SNAAV+R F  Y   A+G      WR+KVDGL +G+N +D  AVA+
Sbjct  134   AFLTGSNLILEYVMSNAAVARGFASYFGTAIGVPTAK-WRLKVDGLPDGFNEIDVLAVAV  192

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++++T V+C+ST++SS++N+++T+ H++F  F+I+ GF+K       K+  G  P+G +G
Sbjct  193   VLVITFVICYSTRDSSVVNMILTVLHILFIAFVILMGFWKDP-----KNPSGFFPYGAKG  247

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V +GAA+VY SYIGYD+VSTMAEE+ NP K +P+G+ GSV+IV+ LYCLMA S+ +L+PY
Sbjct  248   VFNGAAMVYLSYIGYDAVSTMAEEVKNPVKDIPIGVSGSVIIVTVLYCLMAASMSMLMPY  307

Query  1116  NLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVP  943
             ++I  E  FS AF  K  GWKW SNV+GVGAS GI+ SLLVAMLGQARY+CV+GR+ +VP
Sbjct  308   DMIDAEAPFSGAFSGKSDGWKWVSNVIGVGASFGILTSLLVAMLGQARYMCVIGRSSVVP  367

Query  942   SWLAKVHPSTGTPLNATIFL  883
             +W A+VHP T TP+NA+ FL
Sbjct  368   AWFARVHPKTSTPVNASAFL  387



>ref|XP_006379455.1| hypothetical protein POPTR_0008s01700g, partial [Populus trichocarpa]
 gb|ERP57252.1| hypothetical protein POPTR_0008s01700g, partial [Populus trichocarpa]
Length=477

 Score =   367 bits (942),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 223/413 (54%), Positives = 303/413 (73%), Gaps = 20/413 (5%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
              +Y  +L+QTP +L +RA +  T  +E+++V+ RSG+ M+R L WYDLV  G+GGM+G G
Sbjct  12    DSYFRALAQTPARLARRACSVSTSHEEMSQVKARSGSVMQRTLRWYDLVGFGIGGMVGAG  71

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFV TG  +R  AGPSV ISY +AGL ALLSS CYTEF+V++PVAGGAFSYLRITFGEF 
Sbjct  72    VFVITGHASRLRAGPSVVISYAIAGLCALLSSFCYTEFAVDMPVAGGAFSYLRITFGEFA  131

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +  GAN+LMDYV+SNAAV+R FT YL  A+G      WR+ + GL +G+N +D  AV +
Sbjct  132   AFLTGANLLMDYVMSNAAVARGFTAYLGSAIGISKSK-WRLVIHGLPDGFNEIDTFAVLV  190

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGG-----GLAP  1312
             ++ +T+++C+ST+ESSL+N+V+TI H++F GF+I+ GF+KG   N  +        G  P
Sbjct  191   VLAITLIICYSTRESSLVNMVLTILHILFIGFVILMGFWKGDWKNFTQPANPNNPSGFFP  250

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
             FG  GV +GAA+VY SYIGYD+VST+AEE+ NP K +P+G+ GSV+IV+ LYCLMA S+ 
Sbjct  251   FGAPGVFNGAAMVYLSYIGYDAVSTLAEEVHNPVKDIPIGVSGSVIIVTILYCLMAASMS  310

Query  1131  llLPYNLIPEEGSFSAAFK--MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGR  958
             +LLPY++I  +  FSAAF+    GW+W SNV+G+GAS GI+ SLLVAMLGQARYLCV+GR
Sbjct  311   MLLPYDMIDADAPFSAAFRGESDGWQWVSNVIGMGASFGILTSLLVAMLGQARYLCVIGR  370

Query  957   ARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVF  799
             + +VP+W A+V P                AS+ALFT+L +++ ++SIGTL VF
Sbjct  371   SNVVPAWFARVPPKD------------INASIALFTDLNVLLNLVSIGTLFVF  411



>ref|XP_004169173.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Cucumis sativus]
Length=417

 Score =   355 bits (912),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 291/390 (75%), Gaps = 9/390 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y ++LSQTP +L +RA +  T   E+   R  SG  M+R L W+DLV  G+GGM+G GVF
Sbjct  14    YFHALSQTPSRLSRRAFSVSTSFDEMTTTRSTSGVHMQRTLRWFDLVGFGLGGMIGAGVF  73

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTGP A   AGP++ ISY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  74    VTTGP-ATLQAGPAIVISYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  132

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAV+RSF++YL  A+G      WR+ + GL +G++ +D  AVA+++
Sbjct  133   LTGANLIMDYVMSNAAVARSFSQYLGAAIGVSTAK-WRLHIPGLPKGFDQIDLIAVAVVL  191

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
             ++TI++C+STK+SS++N+ +T  H++F  F+I+ GF+KG   N  + G      G  P G
Sbjct  192   IITIIICYSTKQSSVVNMTLTAIHILFIAFVIVFGFWKGDWKNFTEPGDPKNESGFFPHG  251

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV  GA++VY SYIGYD+VSTMAEE+ +P+K +P+G+ GSV++V+ LYCLMA S+  L
Sbjct  252   AAGVFKGASLVYLSYIGYDAVSTMAEEVRSPAKDIPIGVSGSVVLVTVLYCLMAASMAKL  311

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             LPY++I +E  F+AAF    WKW SNV+G GAS GI+ SLLVAM+GQARY+CV+GR+R+V
Sbjct  312   LPYDMIKKEAPFAAAFGR--WKWVSNVIGGGASFGILTSLLVAMMGQARYMCVIGRSRVV  369

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVAL  856
             P+W A+VHP T TPLNA+ FLG    S++L
Sbjct  370   PAWFAEVHPKTSTPLNASAFLGNLFHSISL  399



>gb|EMS63824.1| Low affinity cationic amino acid transporter 2 [Triticum urartu]
Length=457

 Score =   355 bits (912),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 209/290 (72%), Positives = 254/290 (88%), Gaps = 2/290 (1%)
 Frame = -2

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             EFVG+F GANILM+YVLSNAAV+RSFT+YL+   G   P+ WRV+V+ + +GYN LDFPA
Sbjct  107   EFVGFFGGANILMEYVLSNAAVARSFTDYLASTCGVTEPNAWRVEVEAIAKGYNALDFPA  166

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             VALI+LLT+ LC+STKESS LN+V+T FH++FF FII+AGF+ GS+ N+V + GGLAP+G
Sbjct  167   VALILLLTVCLCYSTKESSTLNMVLTAFHLLFFAFIIVAGFWNGSARNMV-TPGGLAPYG  225

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             VRGVLDGAA+VYFSYIGYDS STMAEEI +P+++LPVGI GSVLIVSALYCLM+++LC++
Sbjct  226   VRGVLDGAAVVYFSYIGYDSASTMAEEIRDPARALPVGIAGSVLIVSALYCLMSVALCVM  285

Query  1125  LPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARL  949
             LPY  I E   FS+AF+   GW+WASNVVG GAS+GIVASLLVAMLGQARYLCV+ RARL
Sbjct  286   LPYTEITESAPFSSAFRDKAGWRWASNVVGAGASIGIVASLLVAMLGQARYLCVIARARL  345

Query  948   VPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVF  799
             VP+WLAKVHPSTGTP+NATIFLG+C AS+ALFTEL+IV E+ISIGTL+ F
Sbjct  346   VPAWLAKVHPSTGTPMNATIFLGLCTASIALFTELQIVFEMISIGTLLAF  395



>ref|XP_004977353.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like 
[Setaria italica]
Length=599

 Score =   360 bits (924),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 230/412 (56%), Positives = 306/412 (74%), Gaps = 7/412 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y  +L+QTP++L +RA A   P +E+++VR RSG  M R L W+DLV LG+GGM+G GV
Sbjct  30    AYGRALAQTPRRLARRACAATAPGEEMSRVRARSGPRMARALRWWDLVGLGLGGMVGAGV  89

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FVTTG   R  AGP V +SY +AGL ALLS+ CYTEF+V++PVAGGAFSYLR+TFGEF  
Sbjct  90    FVTTGRATRLYAGPGVVVSYAIAGLCALLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAA  149

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +  GAN++M+YV SNAAV+RSFT YL  A+G   P  WR+ V GL EG+N +D  AV +I
Sbjct  150   FLTGANLIMEYVFSNAAVARSFTAYLGTAVGVDAPSKWRIPVPGLPEGFNQVDLVAVGVI  209

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG------GGLAP  1312
             +L+T+ +C+STKESS++N+V+T  HV F  FII+ GF  G + NL +        GG  P
Sbjct  210   LLITVCICYSTKESSVVNMVLTAVHVAFILFIIVIGFVHGDARNLTRPADPSRNPGGFFP  269

Query  1311  FGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslc  1132
              G  GV +GAA+VY SYIGYD+VSTMAEE+  P++ +P+G+ GSV++V+ LYCLMA S+ 
Sbjct  270   HGAMGVFNGAAMVYLSYIGYDAVSTMAEEVERPARDIPIGVSGSVVVVTVLYCLMAASMS  329

Query  1131  llLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
             +LLPY+ I  E  FS  F+   G  W SNV+G GASLGI+ SL+VAMLGQARYLCV+GR+
Sbjct  330   MLLPYDAIDPEAPFSGPFRGRKGMAWVSNVIGAGASLGILTSLMVAMLGQARYLCVIGRS  389

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVF  799
              ++P+WLA+V+P T TP+NA+ FLG+  A++ALFTEL I++ ++ IGTL VF
Sbjct  390   GVMPAWLARVNPRTATPVNASAFLGLFTAALALFTELDILLNLVCIGTLFVF  441


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -2

Query  609  FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
            F  LVP    PE W VP MPW  A S+FLNVFL+ +L+  +Y RFG ++    L YV+Y 
Sbjct  514  FQALVPQAHAPELWGVPGMPWVPAASVFLNVFLLGSLDRPSYVRFGFFSVAALLVYVLYS  573

Query  429  VHSTYK  412
            VH++Y 
Sbjct  574  VHASYD  579



>ref|XP_010088818.1| Cationic amino acid transporter 6 [Morus notabilis]
 gb|EXB37001.1| Cationic amino acid transporter 6 [Morus notabilis]
Length=670

 Score =   362 bits (929),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 221/396 (56%), Positives = 296/396 (75%), Gaps = 9/396 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +L+QTP +LK+RA +  T   E+++ R RSG +M + L WYDLV  G+GGM+G GVF
Sbjct  15    YLRALAQTPTRLKRRAGSVSTSFDEMSRARARSGPNMLKTLRWYDLVGFGIGGMVGAGVF  74

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             VTTG  +R  AGP+V +SY +AGL A+LS+ CYTEF+V++PVAGGAFSYLR+TFGEF  +
Sbjct  75    VTTGRASRLYAGPAVVVSYAIAGLCAVLSAFCYTEFAVDMPVAGGAFSYLRVTFGEFAAF  134

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
               GAN++MDYV+SNAAV+R FT YL  A+G      WR+ V GL +G+N +D  AV +++
Sbjct  135   LTGANLVMDYVMSNAAVARGFTAYLGTAIGVSTAK-WRITVAGLPKGFNEIDVVAVLVVL  193

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSG-----GGLAPFG  1306
             L+T+++C+ST+ESS++N+V+T  H++F  F+I+ GF+KG   N  +        G  P G
Sbjct  194   LITLIICYSTRESSMVNMVLTALHILFIVFLIVVGFWKGEWRNFSEPADPEKPSGFFPNG  253

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
               GV +GAA+VY SYIGYD+VSTMAEE+ NP K +P+G+ GSV IV+ LYCLMA S+  L
Sbjct  254   ASGVFNGAAMVYLSYIGYDAVSTMAEEVRNPVKDIPIGVSGSVAIVTVLYCLMAASMSKL  313

Query  1125  LPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRAR  952
             LPY++I EE  FSAAF  K  GW+  SNV+GVGAS GI+ SLLVAMLGQARY+CV+GR+R
Sbjct  314   LPYDMIDEEAPFSAAFRGKSDGWRCVSNVIGVGASFGILTSLLVAMLGQARYMCVIGRSR  373

Query  951   LVPSWLAKVHPSTGTPLNATIFLGI-CQASVALFTE  847
             +VP+W A+VHP T TP+NA+ FLG+ C   VA+FT 
Sbjct  374   VVPAWFARVHPMTSTPVNASAFLGVQCCRIVAVFTR  409


 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 102/162 (63%), Gaps = 4/162 (2%)
 Frame = -2

Query  885  LGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvs  706
            L I  A +ALFT+L +++ ++SIGTL VFY+VA A+IYRRY ++    P+  L FL   +
Sbjct  480  LRIFTALIALFTDLNVLLNLVSIGTLFVFYMVANAVIYRRYIVVGTTNPWPTLSFLCSFT  539

Query  705  ssslgfslSWKL----NLQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAA  538
             +S+ F+L W+       +   L     + ++   +F+ +VP  R+PE W VPLMPW  +
Sbjct  540  FTSIMFTLIWQFAPPGKPKAVMLGASALIAVAMLQIFNCMVPQARKPEFWGVPLMPWIPS  599

Query  537  LSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
            +SIFLN+FL+ +L+  +Y RFG ++ L  L YV Y VH+++ 
Sbjct  600  ISIFLNIFLLGSLDGPSYVRFGFFSALAVLVYVFYSVHASFD  641



>ref|XP_010537818.1| PREDICTED: cationic amino acid transporter 1 [Tarenaya hassleriana]
Length=596

 Score =   354 bits (909),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 233/541 (43%), Positives = 345/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+ +L + P +LK R +       E++++R RSG +MKR LTW+DL+  G+G ++G G+F
Sbjct  35    YVKALKEIPARLKDRVMTRSVDAAEIHEIRARSGHEMKRNLTWWDLMWFGIGAVIGAGIF  94

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  95    VLTGLEARDHAGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  154

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+RS+T Y +  L    PD +R+    L E Y  LD  AVA+  
Sbjct  155   IAAGNIILEYVVGGAAVARSWTSYFA-TLCNHKPDDFRLIARCLGEDYGHLDPIAVAVCA  213

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I    STK SS LN V +I H+    FI+IAG  K +  N        AP+G RGV 
Sbjct  214   VICIFAVFSTKGSSRLNYVASIIHIAVIVFIVIAGLTKANPKNYQD----FAPYGTRGVF  269

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               AA+++F+YIG+D+VSTMAEE  NP K++P+G+VGS++I +A YCLMA++LCL+ PY+ 
Sbjct  270   KAAAVLFFAYIGFDAVSTMAEETKNPGKNIPIGLVGSMIITTACYCLMAVALCLMQPYDQ  329

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARYL  + R  ++P WLA
Sbjct  330   IDPDAPFSVAFSAIGWDWAKYIVAAGALKGMTTVLLVGAVGQARYLTHIARTHMMPPWLA  389

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              V   TGTP+NATI +    A +A FT+L I+ +++S+ TL +F LVA  L+ R      
Sbjct  390   NVSAKTGTPINATIVMLAATALIAFFTKLNILADLLSVSTLFIFMLVAVGLLVRRYYVSG  449

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
                     + L+ L L+ +SS+G S+ W L    W      +P++   TL        LV
Sbjct  450   ETTSTNQIKFLVLLALILASSVGTSVYWALTDNEWIGYCITVPIWFLSTLG----MRLLV  505

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P++W VPL+PW  + SI +N+FL+ +++  ++ RFGIWT ++ ++Y+++G+H+TY
Sbjct  506   PQARSPKTWGVPLVPWLPSASIAINIFLLGSIDKDSFIRFGIWTAILLIYYLLFGLHATY  565

Query  414   K  412
              
Sbjct  566   D  566



>ref|XP_010923669.1| PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis]
Length=601

 Score =   352 bits (903),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 226/544 (42%), Positives = 349/544 (64%), Gaps = 19/544 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + Y  +  +T  +L+ R  A      EL++VR RSG +MKR LTW+DL+  G+G ++G G
Sbjct  35    ANYRQAFRETGMRLRDRVTARSLDQTELHEVRARSGHEMKRNLTWWDLIWFGIGAVIGAG  94

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG    +  GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  95    IFVLTGQETHEDVGPAVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  154

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y +  L   NPD +R+ V  L   YN+LD  AVA+
Sbjct  155   AFIAAGNILLEYVIGGAAVARSWTSYFATLLNH-NPDDFRIHVSALANDYNLLDPIAVAV  213

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I ++ I+   STK +S  N + +I HV    FIIIAG  K  + NL        P+GVRG
Sbjct  214   ITIVCIIAVLSTKGTSRFNYIASIIHVAVILFIIIAGLTKADTKNLTP----FTPYGVRG  269

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+Y+G+D+VSTMAEE  NP+K +P+G+VG++ I +  YC +AL+LCL+ PY
Sbjct  270   IFKASAVLFFAYVGFDAVSTMAEETKNPAKDIPIGLVGAMSITTLAYCALALTLCLMQPY  329

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I    +FS AF+ +G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +VP W
Sbjct  330   RSIDVNAAFSVAFQAVGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMVPPW  389

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LA+VH  TGTP+NATI + I  A +A FT L I+  ++SI TL +F ++ A  +  R   
Sbjct  390   LAQVHAKTGTPINATIVMLIATAVIAFFTSLGILSNLLSISTLFIF-MLVAVALLVRRYY  448

Query  756   INGNPPF----QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
             ++G   +    +++  + L+ +SS+  +  W L+ + W      +P++ FL+  F  L  
Sbjct  449   VSGVTSYADRNKLVACIVLILASSIATATYWGLSKKGWIGYVVTVPIW-FLSTLFLGL--  505

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP  R P+ W VP++PW  +LSI +N+FL+ +++ K++ RFGIWT  + ++Y  +G+H
Sbjct  506   -VVPKARAPKLWGVPMVPWLPSLSIAINIFLLGSIDRKSFMRFGIWTAFLLVYYFFFGLH  564

Query  423   STYK  412
             ++Y 
Sbjct  565   ASYD  568



>ref|XP_010241176.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Nelumbo nucifera]
Length=605

 Score =   352 bits (903),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 233/538 (43%), Positives = 343/538 (64%), Gaps = 9/538 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y+ + S+T  +LK R L     + ELN+++ RS  DMK+ L+W+DL+ LG+G ++G G+
Sbjct  31    NYVKAWSETGMRLKDRILTRSLDETELNEMKARSQNDMKKNLSWWDLIWLGIGAVIGTGI  90

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  AR  AGP+V  SY+V+G+SA+LS  CYTEF+VE+P AGG+F+YLR+  G+F+ 
Sbjct  91    FVLTGQEARYDAGPAVVFSYVVSGISAMLSVFCYTEFAVEIPAAGGSFAYLRVELGDFMA  150

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NIL +YV+S AAVSRS+T Y +  L    PD +R+  +GL E Y+ LD  AV +I
Sbjct  151   FIAAGNILFEYVISGAAVSRSWTSYFA-TLCNHKPDEFRIIANGLAEDYSRLDPIAVVII  209

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
              ++ +    STK SS +N V +I HV    F+IIAG     + N        APFG RG+
Sbjct  210   AIVAVFASRSTKASSRVNYVASIIHVCIILFVIIAGMAHADTKNYAV----FAPFGARGI  265

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
               G+A+++F+Y+G+D+VSTMAEE  NP + +P+G++GS+ I++  YCL A +LCL+ PY+
Sbjct  266   FKGSAVLFFAYVGFDAVSTMAEETKNPGRDIPIGLLGSMSIITVAYCLFAATLCLMQPYD  325

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              +  +  FS AFK +G  WA  +V +GA  G+ + LLV+ +GQARYL  +GR  ++P WL
Sbjct  326   QVDPDAPFSMAFKAVGMNWAKYIVALGALKGMSSVLLVSAIGQARYLTHIGRTHMMPPWL  385

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiI  754
             A V+  TGTP+NATI + I  A +A FT+L I+  ++SI TL +F LVA AL+ RRY + 
Sbjct  386   AHVNEKTGTPINATITMLIATAIIAFFTDLDILSNLLSISTLFIFMLVAVALLVRRYYVT  445

Query  753   NGNPPFQvllflflvss---sslgfslSWKL-NLQWWNLPLFGFLTLSFTALFHRLVPCV  586
                 P    L +  + +   SS   +  W L   +W    + G L L  T      VP  
Sbjct  446   GVTTPRDRNLLITFLLTILGSSCAMAALWALGESRWVAYLVVGILWLLSTLGLRLFVPHA  505

Query  585   RRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             R P+ W VPL+PW  + SI +N FL+ +++ K+Y RF +WTGL+ L+Y  +G+H++Y 
Sbjct  506   RDPKLWGVPLVPWLPSASIAINXFLLGSIDGKSYMRFAMWTGLLLLYYFFFGLHASYD  563



>ref|XP_011085217.1| PREDICTED: cationic amino acid transporter 1-like isoform X3 
[Sesamum indicum]
Length=612

 Score =   352 bits (902),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 237/546 (43%), Positives = 355/546 (65%), Gaps = 24/546 (4%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y+N+L +TP +L  R L       EL +V+ RS  DMK+ L W+DL+  G+G ++G G
Sbjct  37    SNYVNALKETPARLVDRVLTRSNEQGEL-EVKARSEHDMKKTLNWWDLMWFGMGAVIGAG  95

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR  AGP+V +SY+V+G SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV
Sbjct  96    IFVLTGLEARDEAGPAVVLSYVVSGTSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFV  155

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y +  L    PD +R++   L +GYN LD  ++ +
Sbjct  156   AFIAAGNILLEYVIGGAAVARSWTSYFA-TLCNHKPDDFRIQAHNLPDGYNQLDPISIGI  214

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             II + I+   STK SS LN + ++ H++   FIII G    S    VK+    APFGVRG
Sbjct  215   IICVCILAVMSTKGSSRLNYIASVIHIIVIAFIIICGLINAS----VKNYTPFAPFGVRG  270

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V   +A+++F+Y+G+D+VSTMAEE  NP + +P+G+VGS++I + +YCL+A++LCL+ PY
Sbjct  271   VFKASAVLFFAYVGFDAVSTMAEETKNPGRDIPIGLVGSMVITTLIYCLLAVTLCLMTPY  330

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I  +  FS AF+ +GW WA  VV  GA  G+ + LLV  +GQARYL  + R  ++P W
Sbjct  331   KSIDPDAPFSRAFETVGWYWAEYVVAAGALKGMTSVLLVGAVGQARYLTHIARTHMIPPW  390

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr----  769
              AKV P TGTP+NAT+ +    A +A FT+L I+ +++SI TL +F LV+ AL+ R    
Sbjct  391   FAKVDPKTGTPINATVAMLAATAIIAFFTKLAILSDLLSISTLFIFMLVSVALLVRRYYV  450

Query  768   --ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTAL  610
                 +  N N   ++++F+FL+ +SS   S  W +N   W      +PL+  L+ +  A 
Sbjct  451   DGETSAANCN---KLVVFIFLILASSGATSGYWAVNEDGWIGYCITVPLW-VLSTAGLAF  506

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
             F   VP  R+P+ W VPL+PW  + SI +NVFL+ +++  +Y RF IWT ++ ++Y ++G
Sbjct  507   F---VPQARKPKLWGVPLVPWLPSSSIAINVFLLGSIDKDSYIRFLIWTAMLLVYYFIFG  563

Query  429   VHSTYK  412
             +H++Y 
Sbjct  564   LHASYD  569



>gb|AAX92723.1| amino acid transporter-like protein [Oryza sativa Japonica Group]
 gb|ABA91533.1| Amino acid permease family protein, expressed [Oryza sativa Japonica 
Group]
Length=541

 Score =   349 bits (895),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 218/375 (58%), Positives = 287/375 (77%), Gaps = 7/375 (2%)
 Frame = -2

Query  1902  MKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEF  1723
             M R+L W+DLV LG+GGM+G GVFVTTG   R  AGP V +SY +AGL ALLS+ CYTEF
Sbjct  1     MARRLRWHDLVGLGLGGMVGAGVFVTTGRATRLYAGPGVVVSYAIAGLCALLSAFCYTEF  60

Query  1722  SVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDC  1543
             +V++PVAGGAFSYLR+TFGE   +  GAN++M+YV SNAAV+RSFT YL  A+G   P  
Sbjct  61    AVDMPVAGGAFSYLRVTFGELAAFLTGANLIMEYVFSNAAVARSFTAYLGTAVGVDAPSK  120

Query  1542  WRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagF  1363
             WR+ V GL +G+N +D  AV +I+L+++ +C+STKESS++N+V+T  HV F  FII+ GF
Sbjct  121   WRIAVPGLPKGFNEVDLIAVGVILLISVCICYSTKESSVVNMVLTAVHVAFILFIIVMGF  180

Query  1362  YKGSSDNLVK------SGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSL  1201
             ++G + NL +      + GG  P G  GV +GAA+VY SYIGYD+VSTMAEE+  PS+ +
Sbjct  181   WRGDTRNLTRPVDLAHNPGGFFPHGAAGVFNGAAMVYLSYIGYDAVSTMAEEVERPSRDI  240

Query  1200  PVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFK-MMGWKWASNVVGVGASL  1024
             PVG+ GSV++V+ LYCLMA S+ +LLPY+ I  E  FS AFK   GW W SNV+G GASL
Sbjct  241   PVGVSGSVVLVTLLYCLMAASMSMLLPYDAIDTEAPFSGAFKGSSGWGWVSNVIGAGASL  300

Query  1023  GIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTEL  844
             GI+ SL+VAMLGQARYLCV+GR+ ++P+WLAKVHP T TP+NA+ FLG+  A++ALFTEL
Sbjct  301   GILTSLMVAMLGQARYLCVIGRSGVMPAWLAKVHPCTATPVNASAFLGVFTAALALFTEL  360

Query  843   KIVIEIISIGTLVVF  799
              +++ ++SIGTL VF
Sbjct  361   DVLLNLVSIGTLFVF  375


 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -2

Query  609  FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
            F  LV   RRPE W VP MPW  A S+FLNVFL+ +L+  +Y RFG +T    L YV+Y 
Sbjct  448  FRALVAEARRPELWGVPAMPWVPAASVFLNVFLLGSLDRPSYVRFGFFTAAAVLVYVLYS  507

Query  429  VHSTY  415
            VH++Y
Sbjct  508  VHASY  512



>ref|NP_193844.2| amino acid transporter 1 [Arabidopsis thaliana]
 sp|Q84MA5.1|CAAT1_ARATH RecName: Full=Cationic amino acid transporter 1; AltName: Full=Amino 
acid transporter 1 [Arabidopsis thaliana]
 gb|AAP21253.1| At4g21120 [Arabidopsis thaliana]
 dbj|BAE99519.1| amino acid transport protein AAT1 [Arabidopsis thaliana]
 gb|AEE84405.1| amino acid transporter 1 [Arabidopsis thaliana]
Length=594

 Score =   350 bits (899),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 227/541 (42%), Positives = 351/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +L +TP +   R +       E+N+++ RSG +MK+ LTW+DL+  G+G ++G G+F
Sbjct  34    YLKALKETPSRFMDRIMTRSLDSDEINEMKARSGHEMKKTLTWWDLMWFGIGAVIGSGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  +GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  94    VLTGLEARNHSGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+RS+T Y +  L    P+ +R+ V  L E Y+ LD  AV +  
Sbjct  154   IAAGNIILEYVVGGAAVARSWTSYFATLLNH-KPEDFRIIVHKLGEDYSHLDPIAVGVCA  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS  N + +I H+V   F+IIAGF K      VK+     P+GVRGV 
Sbjct  213   IICVLAVVGTKGSSRFNYIASIIHMVVILFVIIAGFTKAD----VKNYSDFTPYGVRGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               AA+++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY  
Sbjct  269   KSAAVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVTLCLMQPYQQ  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WLA
Sbjct  329   IDPDAPFSVAFSAVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARAHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             +V+  TGTP+NAT+ +    A +A FT+LKI+ +++S+ TL +F  VA AL+ R      
Sbjct  389   QVNAKTGTPINATVVMLAATALIAFFTKLKILADLLSVSTLFIFMFVAVALLVRRYYVTG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               +     + L+FL L+ +SS   ++ W L  + W      +P++ FL+   T     LV
Sbjct  449   ETSTRDRNKFLVFLGLILASSTATAVYWALEEEGWIGYCITVPIW-FLS---TVAMKFLV  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++ K++ RF IWTG++ ++YV++G+H+TY
Sbjct  505   PQARAPKIWGVPLVPWLPSASIAINIFLLGSIDTKSFVRFAIWTGILLIYYVLFGLHATY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_008794464.1| PREDICTED: cationic amino acid transporter 1-like [Phoenix dactylifera]
 ref|XP_008794465.1| PREDICTED: cationic amino acid transporter 1-like [Phoenix dactylifera]
Length=601

 Score =   350 bits (898),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 229/541 (42%), Positives = 350/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +T  +L+ R  A      EL++VR RSG +MKR L+W+DL+  G+G ++G G+F
Sbjct  39    YRQALRETGMRLRDRVTARSHDLTELHEVRARSGHEMKRNLSWWDLIWFGIGAVIGAGIF  98

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A +  GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  99    VLTGQEANRDVGPAVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  158

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L   +P+ +R+ V GL   YN LD  AVA+I 
Sbjct  159   IAAGNILLEYVIGGAAVARSWTSYFATLLNH-DPEDFRIHVSGLAADYNRLDPIAVAIIT  217

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ IV   STK +S  N + +I HV    FII+AG  K  + N        AP+G RGV 
Sbjct  218   IVCIVAVLSTKGTSRFNYIASIIHVAVIIFIIVAGLTKADAKNYTP----FAPYGARGVF  273

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NPSK +P+G+VG++ I +  YC +A++LCL+ PY  
Sbjct  274   KASAVLFFAYVGFDAVSTMAEETKNPSKDIPIGLVGAMSITTLAYCSLAVTLCLMQPYKQ  333

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I    +FS AF+ +G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +VP WLA
Sbjct  334   IDVNAAFSVAFEAVGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMVPPWLA  393

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             +VH  TGTP+NAT+ +    A+VA FT+L I+  ++SI TL +F LVA AL+ RRY +  
Sbjct  394   QVHSKTGTPINATVVMLCATATVAFFTDLGILSNLLSISTLFIFMLVAVALLVRRYYVSG  453

Query  750   GNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
                 F   + +  + L+ +SS+  +  W L+ + W      +P++ FL+   T+     V
Sbjct  454   ETSDFNRYKFVACIVLILASSIATATYWALSKKGWIGYVVTVPIW-FLS---TSCLWLAV  509

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VP++PW  ++SI +N+FL+ +++ K++ RFGIWT  + ++Y  +G+H++Y
Sbjct  510   PQARAPKLWGVPMVPWLPSVSIAINIFLLGSIDSKSFMRFGIWTAFLLIYYFFFGLHASY  569

Query  414   K  412
              
Sbjct  570   D  570



>ref|XP_010923711.1| PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis]
Length=613

 Score =   350 bits (899),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 231/544 (42%), Positives = 350/544 (64%), Gaps = 19/544 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + Y  +  +T  +L+ R  A      EL++VR RSG +MKR L+W+DL+  G+G ++G G
Sbjct  37    ANYRQAFRETGMRLRDRVTARSLDQTELHEVRARSGHEMKRNLSWWDLIWFGIGAVIGAG  96

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG    +  GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  97    IFVLTGQETNEDVGPAVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  156

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y +  L   +P+ +R+ V  L + YN+LD  AVA+
Sbjct  157   AFIAAGNILLEYVIGGAAVARSWTSYFATLLNH-DPNDFRIHVSSLAKDYNLLDPIAVAV  215

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I ++ IV   STK +S  N + +I HV    FIIIAG  K  S NL        P+GVRG
Sbjct  216   ITIVCIVAILSTKGTSRFNYIASIIHVAVILFIIIAGLTKADSKNLKP----FTPYGVRG  271

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+Y+G+D+VSTMAEE  NP+K +P+G+VGS+ I +  YC +A++LCL+ PY
Sbjct  272   IFKASAVLFFAYVGFDAVSTMAEETKNPAKDIPIGLVGSMTITTLAYCTLAITLCLMQPY  331

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I    +FS AFK +G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +VP W
Sbjct  332   KSIDVNAAFSVAFKKVGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMVPPW  391

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy----r  769
             LA+VH  TGTP+NATI +    A VA FT+L I+ +++SI TL +F LVA AL+      
Sbjct  392   LAQVHSKTGTPINATIVMLCATAIVAFFTDLGILSQLLSISTLFIFMLVAVALLVRRYYV  451

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
                  N N   + ++ + L+ +SS+  +  W L+ + W      +P++ FL+  F  L  
Sbjct  452   SGDTSNTNRN-KFVVCIVLILASSIATATYWGLSKKGWIGYVVTVPIW-FLSTLFLGL--  507

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              +VP  R P+ W VP++PW  +LSI +N+FL+ +++ K++ RFGIWT L+  +Y  +G+H
Sbjct  508   -VVPQARAPKLWGVPMVPWLPSLSIAINIFLLGSIDGKSFMRFGIWTALLLKYYFFFGLH  566

Query  423   STYK  412
             ++Y 
Sbjct  567   ASYD  570



>ref|XP_003535010.1| PREDICTED: cationic amino acid transporter 1-like [Glycine max]
Length=594

 Score =   348 bits (893),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 225/537 (42%), Positives = 342/537 (64%), Gaps = 8/537 (1%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +Y  +L +TP++LK R L       E+ ++R RS   MK+ L W+DL+ LG+G ++G G+
Sbjct  37    SYGRALMETPRRLKDRILTRSNESAEVGEMRARSSHQMKKTLNWWDLMWLGIGAVIGAGI  96

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  AR+ AGP+V +SY+V+G SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV 
Sbjct  97    FVLTGIEAREVAGPAVVLSYVVSGFSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVA  156

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NIL++YV+S AAVSRS+T Y +  L   NPD +R+ V  +   YN  D  AV ++
Sbjct  157   FIAAGNILLEYVISCAAVSRSWTSYFA-TLCNKNPDDFRIVVHNMNPNYNHFDPIAVIVL  215

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
               + I+  +STK SS+ N + ++ HVV   FI+I G       N V      APFGVRGV
Sbjct  216   AAICILAIYSTKGSSIFNYIASVVHVVIIAFIVIVGLIHVKPQNYVP----FAPFGVRGV  271

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
                +A+++F+Y+G+D+V+TMAEE  NPS+ +P+G+VGS+++ +  YCL++ +LCL+ PY 
Sbjct  272   FQASAVLFFAYVGFDAVATMAEETKNPSRDIPIGLVGSMVVTTIAYCLLSATLCLMQPYT  331

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I     FS AF  +GW WA  +V +GA  G+   LLV+++GQARYL  + R  ++P W 
Sbjct  332   SIDVNAPFSVAFSAIGWDWAKYIVSLGALKGMTTVLLVSVVGQARYLTHIARTHMMPPWF  391

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---ry  763
             A V   TGTP+NATI + +  A +A FT+L+I+  ++SI TL +F LVA ALI R     
Sbjct  392   ALVDEHTGTPVNATIAMVVVSAVIAFFTDLQILSNLLSISTLFIFMLVAIALIVRRYYSS  451

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVR  583
              +        +++F+  + +SS G S  W L+  W    +F  +    T      VP  +
Sbjct  452   GVTTKRNQITLIVFIVFIIASSCGISCYWALSEGWIGYAIFVPIWALSTGGLCLFVPKAK  511

Query  582   RPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              P+ W VPL+PW  ++SIF+N+FL+ +++  ++ RFG WT  + ++YV +G+H++Y 
Sbjct  512   EPKFWGVPLVPWIPSISIFINIFLLGSIDKDSFIRFGFWTVFLLVYYVFFGLHASYD  568



>ref|XP_002869906.1| hypothetical protein ARALYDRAFT_329490 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46165.1| hypothetical protein ARALYDRAFT_329490 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score =   348 bits (892),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 225/541 (42%), Positives = 348/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             YL +L +TP +   R +       E+N+++ RSG +MK+ LTW+DL+  G+G ++G G+F
Sbjct  36    YLKALKETPSRFMDRIMTRSLDSDEINEMKARSGHEMKKTLTWWDLMWFGIGAVIGSGIF  95

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  +GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  96    VLTGLEARNASGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  155

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+RS+T Y +  L    P+ +R+    L E Y+ LD  AV +  
Sbjct  156   IAAGNIILEYVVGGAAVARSWTSYFATLLNH-KPEDFRIIAHSLGEDYSHLDPIAVGVCA  214

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS  N + +I H+V   F+IIAGF K      VK+     P+GVRGV 
Sbjct  215   IICVLAVLGTKGSSRFNYIASIIHMVVILFVIIAGFTKAD----VKNYSDFTPYGVRGVF  270

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               AA+++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY  
Sbjct  271   KSAAVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVALCLMQPYQQ  330

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WLA
Sbjct  331   IDPDAPFSVAFSAVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARAHMMPPWLA  390

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             +V+  TGTP+NAT+ +    A +A FT+LKI+ +++S+ TL +F  VA AL+ R      
Sbjct  391   QVNAKTGTPINATVVMLAATALIAFFTKLKILADLLSVSTLFIFMFVAVALLVRRYYVTG  450

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               +     + L+ L L+ +SS    + W L  + W      +P++ FL+   T     LV
Sbjct  451   ETSSRDRNKFLVLLGLILASSTATGVYWALEKEGWIGYCITVPIW-FLS---TVGMKFLV  506

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++ K++ RF IWTG++ ++YV++G+H+TY
Sbjct  507   PQARAPKIWGVPLVPWLPSASIAINIFLLGSIDKKSFVRFAIWTGILLVYYVLFGLHATY  566

Query  414   K  412
              
Sbjct  567   D  567



>ref|XP_006836312.1| hypothetical protein AMTR_s00092p00050170 [Amborella trichopoda]
 gb|ERM99165.1| hypothetical protein AMTR_s00092p00050170 [Amborella trichopoda]
Length=592

 Score =   347 bits (891),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 227/541 (42%), Positives = 352/541 (65%), Gaps = 18/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+ +L +TP +LK R LA      E+ +VR +S  DMK+ L W+DL+  G+G ++G G+F
Sbjct  31    YMRALGKTPSRLKDRLLARSLDATEITEVRAQSQNDMKKSLNWWDLIWFGLGAVIGAGIF  90

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ AGP+V ISY+V+GLSALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  91    VLTGLEARQDAGPAVVISYVVSGLSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  150

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
                 NIL +Y++SNAAV+R++T YL+ +L   +PD +R+    L   YN+LD  AVA+I+
Sbjct  151   ITAGNILFEYIVSNAAVARAWTSYLA-SLCNRSPDSFRITTS-LAPDYNVLDPIAVAVIL  208

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
              +++    STK SS  N + +I HV+   F+IIAG      +NL +     AP+G RG+ 
Sbjct  209   AVSLAALFSTKHSSRFNYIASIVHVIIILFVIIAGLIHAHPENLSE----FAPYGARGIF  264

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A++YF+Y+G+D+++TMAEE  NP++ +P+G+VGS++  +A+YC++AL+LCL+ PYN 
Sbjct  265   KASAVLYFAYVGFDALATMAEETKNPARDIPIGLVGSMVTTTAIYCVLALTLCLMQPYNK  324

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF+ +G  WA  +V  GA  G+   LLVA +GQARYL  + R  + P+WLA
Sbjct  325   IDPDAPFSIAFQAVGMGWAKYIVAFGALKGMTTVLLVAAVGQARYLTHIARTHMAPAWLA  384

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              VHP   TP+N+T+ +GI  + +ALFT+L ++  ++S+ TL +F +VA AL+ R      
Sbjct  385   LVHPKYRTPVNSTVVMGITSSVIALFTDLSVLANLLSLSTLFIFLMVALALLVRRYYVSG  444

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRL-----V  595
                 +  ++++ FL ++  SS+  S+ W      W     G+   + + L   L     V
Sbjct  445   ATTNSDRWKLIGFLIVILGSSVALSIVWSTGTNGW----VGYTVAATSWLLGTLGLWVWV  500

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R+P+ W  PL+PW  + SI +N+FL+ +L+  ++ RF IWTG + L+YV +G+H++Y
Sbjct  501   PMARKPQFWGTPLVPWLPSASIAINIFLLGSLDGASFVRFMIWTGCLLLYYVFFGLHASY  560

Query  414   K  412
              
Sbjct  561   D  561



>ref|XP_011096669.1| PREDICTED: cationic amino acid transporter 1-like isoform X3 
[Sesamum indicum]
Length=615

 Score =   348 bits (893),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 238/543 (44%), Positives = 355/543 (65%), Gaps = 18/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y ++L QTP +L  R     + + EL +V+ RSG +MK+ L+W+DL+  G+G ++G G
Sbjct  38    SNYASALKQTPYRLVDRIFTRSSVEAEL-EVKARSGNEMKKTLSWWDLMWFGMGAVIGAG  96

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR+ AGP+V +SY V+GLSALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV
Sbjct  97    IFVLTGLEAREHAGPAVVLSYAVSGLSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFV  156

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y +  L   +PD +R+ V GL +GYN LD  AV +
Sbjct  157   AFIAAGNILLEYVIGGAAVARSWTSYFA-TLCNHDPDDFRILVHGLTDGYNQLDPIAVGI  215

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             +I++ I+   STK SS LN + ++ H+V   FIIIAG  K    N        APFG RG
Sbjct  216   MIVICIIAVVSTKGSSRLNYIASVVHMVVILFIIIAGLIKADPKNYTP----FAPFGPRG  271

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I + +YCL+A++LCL+ PY
Sbjct  272   IFKASAVLFFAYVGFDAVSTMAEETKNPARDVPIGLVGSMVITTTIYCLLAITLCLMQPY  331

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I     FS AF+M+GW WA  VV  GA  G+ + LLV+ +GQARYL  + R  ++P W
Sbjct  332   TSIDVNAPFSRAFEMVGWSWAQYVVAAGALKGMTSVLLVSAVGQARYLTHIARTHMMPPW  391

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              AKV   TGTP+NATI +    A +A FT+L I+ E++SI TL +F LVA AL+ RRY +
Sbjct  392   FAKVDHKTGTPINATIVMLAATAVIAFFTKLDILSELLSISTLFIFMLVALALLVRRYYV  451

Query  756   INGNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                  P    +++ FL L+  SS+  S  W ++   W      +P++    LS   L+  
Sbjct  452   SGETTPENRNKLIAFLALIVGSSIATSAYWGISKTGWIAYCITVPIW---ILSTAGLWF-  507

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  R P+ W VPL+PW  + SI +N+FL+ +++  +++RF  WT  + ++Y  +G+H+
Sbjct  508   FVPPARTPKLWGVPLVPWLPSASIAINIFLLGSIDKHSFERFAAWTAFLLVYYFFFGLHA  567

Query  420   TYK  412
             +Y 
Sbjct  568   SYD  570



>ref|XP_011096668.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Sesamum indicum]
Length=638

 Score =   348 bits (893),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 238/543 (44%), Positives = 355/543 (65%), Gaps = 18/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y ++L QTP +L  R     + + EL +V+ RSG +MK+ L+W+DL+  G+G ++G G
Sbjct  61    SNYASALKQTPYRLVDRIFTRSSVEAEL-EVKARSGNEMKKTLSWWDLMWFGMGAVIGAG  119

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR+ AGP+V +SY V+GLSALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV
Sbjct  120   IFVLTGLEAREHAGPAVVLSYAVSGLSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFV  179

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y +  L   +PD +R+ V GL +GYN LD  AV +
Sbjct  180   AFIAAGNILLEYVIGGAAVARSWTSYFA-TLCNHDPDDFRILVHGLTDGYNQLDPIAVGI  238

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             +I++ I+   STK SS LN + ++ H+V   FIIIAG  K    N        APFG RG
Sbjct  239   MIVICIIAVVSTKGSSRLNYIASVVHMVVILFIIIAGLIKADPKNYTP----FAPFGPRG  294

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I + +YCL+A++LCL+ PY
Sbjct  295   IFKASAVLFFAYVGFDAVSTMAEETKNPARDVPIGLVGSMVITTTIYCLLAITLCLMQPY  354

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I     FS AF+M+GW WA  VV  GA  G+ + LLV+ +GQARYL  + R  ++P W
Sbjct  355   TSIDVNAPFSRAFEMVGWSWAQYVVAAGALKGMTSVLLVSAVGQARYLTHIARTHMMPPW  414

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              AKV   TGTP+NATI +    A +A FT+L I+ E++SI TL +F LVA AL+ RRY +
Sbjct  415   FAKVDHKTGTPINATIVMLAATAVIAFFTKLDILSELLSISTLFIFMLVALALLVRRYYV  474

Query  756   INGNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                  P    +++ FL L+  SS+  S  W ++   W      +P++    LS   L+  
Sbjct  475   SGETTPENRNKLIAFLALIVGSSIATSAYWGISKTGWIAYCITVPIW---ILSTAGLWF-  530

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  R P+ W VPL+PW  + SI +N+FL+ +++  +++RF  WT  + ++Y  +G+H+
Sbjct  531   FVPPARTPKLWGVPLVPWLPSASIAINIFLLGSIDKHSFERFAAWTAFLLVYYFFFGLHA  590

Query  420   TYK  412
             +Y 
Sbjct  591   SYD  593



>ref|XP_010051968.1| PREDICTED: cationic amino acid transporter 1-like [Eucalyptus 
grandis]
 ref|XP_010051969.1| PREDICTED: cationic amino acid transporter 1-like [Eucalyptus 
grandis]
 gb|KCW75804.1| hypothetical protein EUGRSUZ_D00193 [Eucalyptus grandis]
Length=607

 Score =   347 bits (890),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 223/541 (41%), Positives = 349/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +L+ R L+      EL++V+ +SG +MKR LTW+DL+  G+G ++G G+F
Sbjct  34    YWGALKETPARLRDRVLSRSLETTELHEVKAQSGHEMKRTLTWWDLMWFGIGAVIGAGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG   R+ AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  94    VLTGQETREGAGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L   +P  + + V  L + YN LD  AV +  
Sbjct  154   IAAGNILLEYVIGGAAVARSWTSYFATLLNH-DPSDFVITVHSLAKNYNELDPIAVGVCC  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++      STK SS LN + +I H++   FII+AG  K +++N        APFG RGV 
Sbjct  213   IICAFAVLSTKGSSRLNYIASIVHILVIIFIIVAGLTKANANNYTP----FAPFGARGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS+++V+  YC++ ++LCL+ PY+ 
Sbjct  269   KASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMVVVTVAYCVLVITLCLMQPYDQ  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AFK +G  WA  VV  GA  G+   LLV  +GQARYL  + R  ++P W A
Sbjct  329   IDVDAPFSLAFKAVGMDWAKYVVAFGALKGMTTVLLVGAVGQARYLTHIARTHMMPPWFA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KV+  TGTP+NAT+ +    A +A FT+L I+  ++SI TL +F LVA AL+ RRY +  
Sbjct  389   KVNEKTGTPVNATVTMLAATAVIAFFTKLNILSNLLSISTLFIFMLVAVALLVRRYYVSG  448

Query  750   GNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
                P    ++++ + L+  SS+  +  W L+   W      +P++   T++        V
Sbjct  449   VTKPADRNKLIICISLIVGSSIATAAYWGLSEHGWIGYVITVPIWFLATVALRV----FV  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++  +++RFG+WT L+ L+Y  +G+H++Y
Sbjct  505   PHARDPKLWGVPLVPWLPSASIAINIFLLGSIDRASFERFGLWTALLLLYYFFFGLHASY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_004253188.1| PREDICTED: cationic amino acid transporter 1-like [Solanum lycopersicum]
Length=599

 Score =   346 bits (888),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 226/542 (42%), Positives = 350/542 (65%), Gaps = 20/542 (4%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y N+L QTP +L  R L T + D+E  + + RS  +MK+ LTW+DL+  G+G ++G G+F
Sbjct  38    YANALIQTPTRLIDRIL-TRSEDEEELEAKSRSQNEMKKTLTWWDLIWFGLGAVIGAGIF  96

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A + AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  97    VLTGLEANQEAGPAVVLSYVVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  156

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV++ AAV+R++T Y +  L   + D + +KVD L EGYN LD  AV + I
Sbjct  157   IAAGNILLEYVIAGAAVARTWTSYFATLLNFSS-DKFLIKVDSLAEGYNELDPIAVGVCI  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I+   STK SS LN + TI H+    FII+ G  K  + N        APF VRG+ 
Sbjct  216   IICIIAILSTKGSSRLNYIATIVHIFVIFFIIVCGLIKSDTKNYTP----FAPFKVRGIF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP + +P+G++GS++I + LYCL+A++LCL+ PY  
Sbjct  272   KASAVLFFAYVGFDAVSTMAEETKNPGRDIPIGLIGSMVITTFLYCLLAMTLCLMQPYQK  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AFK +GW WA  +V  GA  G+ + LLV  +GQARYL  + R  ++P W +
Sbjct  332   IDTQAPFSVAFKSVGWSWAQYIVAAGALKGMTSVLLVGAVGQARYLTHISRTHMMPPWFS  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             +V+  TGTP+NAT  +    A +ALFT+L I+  ++SI TL +F ++ A  +  R   ++
Sbjct  392   QVNAKTGTPVNATAVMSCATAIIALFTKLDILSNLLSISTLFIF-MLVALALLVRRYYVH  450

Query  750   GNPPF----QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRL  598
             G+       +++  L ++ +SS+  S  W L+   W      LP++   T+         
Sbjct  451   GDTTIANRNKLITSLLIILASSIATSTYWGLSKDGWIGYCITLPIWLLATIG----LWYF  506

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R+P+ W VPL+PW  + SI +N+FL+ +L+  ++ RFG+WTG + ++Y+ +G+H++
Sbjct  507   VPQARKPKLWGVPLVPWLPSASIAINIFLLGSLDRASFMRFGVWTGFLLVYYLFFGLHAS  566

Query  417   YK  412
             Y 
Sbjct  567   YD  568



>ref|XP_009408749.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=602

 Score =   346 bits (887),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 223/544 (41%), Positives = 347/544 (64%), Gaps = 19/544 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + Y+ +L +T  +LK R  A    D E+N+VR RSG +MKR L+W+DL+  G+G ++G G
Sbjct  44    ANYMKALRETGMRLKNRIAARSMDDTEINEVRARSGHEMKRNLSWWDLIWFGIGAVIGAG  103

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR  AGP+V +S++V+G+S++LS  CYTEF+VE+PVAGG+F+YLR+  G+FV
Sbjct  104   IFVLTGQEARNAAGPAVILSFVVSGVSSMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFV  163

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+S AAV+RS+T Y +  L    PD +R+ +  L   Y+ LD  AV +
Sbjct  164   AFIAAGNILLEYVVSCAAVARSWTSYFATLLNH-QPDDFRIHIASLSPDYSRLDPIAVVV  222

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I+ + +    STK +S  N V +I H+    FII AG  +    NL        PFG RG
Sbjct  223   IVAICLAAVFSTKATSRFNYVSSIIHLAIIVFIIAAGLSRADPKNL----SDFMPFGARG  278

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+Y+G+D+VSTMAEE  NP+K +P+G+VG++ I +  YCL+A +LCL+ PY
Sbjct  279   LFSASAVLFFAYVGFDAVSTMAEETKNPAKDIPLGLVGAMCITTLCYCLLAFTLCLMQPY  338

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             + I     FS AF+ +G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +VP W
Sbjct  339   SQIDPNAPFSVAFEAVGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMVPPW  398

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              A+VH +TGTP+NAT+ + +  A++ALFTEL I+  ++SI TL +F ++ A  +  R   
Sbjct  399   FAQVHATTGTPINATVAMLVATATIALFTELSILSNLLSISTLFIF-MLVAVALLVRRYY  457

Query  756   INGNPPF----QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
             +NG        ++++ + L+  SS+G +  W   +  W      +P++ FL+  F  L  
Sbjct  458   VNGETSATERNKLIVCIVLILGSSVGAAGYWAAGVDGWVGYVVAIPVW-FLSTGFLWLG-  515

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               VP  ++P+ W VP++PW  + SI +N+FL+ +++  +Y RFGIWT L+ ++Y   G+H
Sbjct  516   --VPQAKKPKMWGVPMVPWLPSASIAINIFLLGSIDGLSYMRFGIWTALLLVYYFFLGLH  573

Query  423   STYK  412
             ++Y 
Sbjct  574   ASYD  577



>ref|XP_006342695.1| PREDICTED: cationic amino acid transporter 1-like [Solanum tuberosum]
Length=601

 Score =   345 bits (886),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 232/544 (43%), Positives = 353/544 (65%), Gaps = 24/544 (4%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y N+L QTP +L  R L T + D+E  + + RS  +MK+ LTW+DL+  G+G ++G G+F
Sbjct  40    YANALIQTPTRLIDRIL-TRSEDEEELESKSRSQNEMKKTLTWWDLIWFGMGAVIGAGIF  98

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A + AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  99    VLTGLEANQEAGPAVVLSYVVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  158

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV++ AAV+R++T Y +  L   + D + +KVD L EGYN LD  AV + I
Sbjct  159   IAAGNILLEYVIAGAAVARTWTSYFATLL-NFSSDKFLIKVDSLAEGYNELDPIAVGVCI  217

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I+   STK SS LN + TI H+    FIII G  K  + N        APF VRG+ 
Sbjct  218   IICIIAILSTKGSSRLNYIATIVHIFVIFFIIICGLIKSDTKNYTP----FAPFKVRGIF  273

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VST+AEE  NP + +P+G++GS++I + LYCL+A++LCL+ PY +
Sbjct  274   KASAVLFFAYVGFDAVSTLAEETKNPGRDIPIGLIGSMVITTFLYCLLAITLCLMQPYQM  333

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AFK +GW WA  +V  GA  G+ + LLV  +GQARYL  + R  ++P W +
Sbjct  334   IDTQAPFSVAFKSVGWNWAQYIVAAGALKGMTSVLLVGAVGQARYLTHISRTHMMPPWFS  393

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr------  769
             +V+  TGTP+NAT  +    A +ALFT+L I+  ++SI TL +F LVA AL+ R      
Sbjct  394   QVNAKTGTPVNATAVMSCATAIIALFTKLDILSNLLSISTLFIFMLVALALLVRRYYVHG  453

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
                I N N   +++ FL ++ +SS+  +  W L+   W      LP++   T+       
Sbjct  454   ETTIANRN---KLITFLLIILASSVATATYWGLSKDGWIGYCITLPIWLLATIG----LW  506

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               VP  R+P+ W VPL+PW  + SI +N+FL+ +L+  ++ RFG+WTG + ++Y+ +G+H
Sbjct  507   YFVPQARKPKLWGVPLVPWLPSASIAINIFLLGSLDRASFMRFGVWTGFLLVYYLFFGLH  566

Query  423   STYK  412
             ++Y 
Sbjct  567   ASYD  570



>ref|XP_011041665.1| PREDICTED: cationic amino acid transporter 1-like [Populus euphratica]
 ref|XP_011041666.1| PREDICTED: cationic amino acid transporter 1-like [Populus euphratica]
Length=602

 Score =   345 bits (886),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 224/545 (41%), Positives = 353/545 (65%), Gaps = 18/545 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  YL +L +TP + K R L       E+++++ RS  +MK+ LTW+DL+  G+G ++G 
Sbjct  38    FGNYLQALKETPMRFKDRLLTRSKDTTEIHEIKGRSEHEMKKTLTWWDLIWFGIGAVIGA  97

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG  AR+ AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F
Sbjct  98    GIFVLTGLEAREHAGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDF  157

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             + + A  NIL++YV+  AAVSR++T Y +  L    PD +R+    L + Y  LD  AV 
Sbjct  158   MAFIAAGNILLEYVIGGAAVSRAWTSYFA-TLCNHKPDDFRIIAHSLPDDYGHLDPIAVL  216

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             + +++ I+   STK SS  N V +I HVV   FII+AG  K  + N        AP G  
Sbjct  217   VGVVICILAVLSTKGSSRFNYVASIIHVVVILFIIVAGLAKADTKNYAD----FAPNGAH  272

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+   +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS+ I +  YCL+A++LCL++P
Sbjct  273   GIFTASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMAITTLAYCLLAVTLCLMVP  332

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y +I  +  FS AF+ +GW WA  +V  GA  G+   LLV+ +GQARYL  + R  ++P 
Sbjct  333   YKMIDVDAPFSVAFESVGWGWAKYIVAAGALKGMTTVLLVSAVGQARYLTHIARTHMMPP  392

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLA V+  TGTP+NAT+ +    A +A FT+L I+  ++SI TL +F LVA +L+ RRY 
Sbjct  393   WLAHVNAKTGTPVNATVVMLAATAIIAFFTKLDILSNLLSISTLFIFMLVAVSLLVRRYY  452

Query  759   iINGNPP---FQvllflflvsssslgfslSWKLNLQ--W----WNLPLFGFLTLSFTALF  607
             +     P    ++++ +  +  SS+  +L W  + Q  W      +P++ F TL+     
Sbjct  453   VTGVTTPVNRVKLIVCIVAILVSSIATALIWGTSDQASWIGYVITIPIWFFATLALKI--  510

Query  606   HRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
                VP  R P+ W VPL+PW  + SI +N+FL+ +++V+++KRF +WTG++ ++Y+++G+
Sbjct  511   --FVPQARDPKLWGVPLVPWLPSASILINMFLLGSIDVQSFKRFAVWTGILLIYYLLFGL  568

Query  426   HSTYK  412
             H++Y 
Sbjct  569   HASYD  573



>ref|XP_009407711.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407712.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407713.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=592

 Score =   345 bits (885),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 235/543 (43%), Positives = 351/543 (65%), Gaps = 17/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + Y  +L +T K+L+ R  A      EL++VRLRSG DMK+ LTW+DL+  G+G ++G G
Sbjct  35    ANYGRALRETGKRLRDRVTARSLEQSELHEVRLRSGHDMKKNLTWWDLIWFGIGAVIGSG  94

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR+  GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  95    IFVLTGQEAREDVGPAVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  154

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y S  L     D +R+    L +GYN LD  AVA+
Sbjct  155   AFIAAGNILLEYVIGGAAVARSWTSYFSTLLNHEAND-FRIHATALADGYNRLDPIAVAV  213

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I ++ +V   STK +S  N + +I HV    FIIIAG  K    N  +       FG RG
Sbjct  214   ICIICLVAALSTKGTSRFNYLASIVHVAVILFIIIAGLTKAKVSNYDQ----FFHFGARG  269

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+Y+G+D+VSTMAEE  NP+K +P+G+VGS+ I +  YC++A++LCL+ PY
Sbjct  270   IFKASAVLFFAYVGFDAVSTMAEETKNPAKDIPIGLVGSMTITTLAYCILAVTLCLMQPY  329

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I  +  FS AFK +G  WA+ +V  GA  G+   LLV+ +GQARYL  + R  +VP W
Sbjct  330   GQIDVDAPFSVAFKAVGMNWATYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMVPPW  389

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LA V+  TGTP+NAT+ + +  A +A FT+L I+  ++SI TL +F LVA ALI RRY +
Sbjct  390   LAHVNSRTGTPINATVVMLVATAIIAFFTDLGILANLLSISTLFIFMLVAVALIVRRYYV  449

Query  756   INGNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                       ++++FL L+  SS+  +  W  + + W      +P++ FL+   TA    
Sbjct  450   SGETSEANRSKLVVFLLLILGSSIATASYWAASEKGWVGYLVTVPVW-FLS---TAGLWW  505

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  R P  W VPL+PW  + SI +N+FL+ +++ ++Y RFGIWTGL+ ++Y  +G+H+
Sbjct  506   FVPQARAPRLWGVPLVPWLPSASIAINIFLLGSIDGRSYMRFGIWTGLLLIYYFFFGLHA  565

Query  420   TYK  412
             +Y 
Sbjct  566   SYD  568



>ref|XP_002321859.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
 gb|EEF05986.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
Length=602

 Score =   345 bits (885),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 224/545 (41%), Positives = 353/545 (65%), Gaps = 18/545 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  YL +L +TP + K R L       E+++++ RS  +MK+ LTW+DL+  G+G ++G 
Sbjct  38    FGNYLQALKETPMRFKDRLLTRSKDTTEIHEIKARSEHEMKKTLTWWDLIWFGIGAVIGA  97

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG  AR+ AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F
Sbjct  98    GIFVLTGLEAREHAGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDF  157

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             + + A  NIL++YV+  AAVSR++T Y +  L    PD +R+    L + Y  LD  AV 
Sbjct  158   MAFIAAGNILLEYVIGGAAVSRAWTSYFA-TLCNHKPDDFRIIAHSLPDDYGHLDPIAVL  216

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             + +++ I+   STK SS  N V +I HVV   FII+AG  K  + N        AP G  
Sbjct  217   VGVVICILAVLSTKGSSRFNYVASIIHVVVILFIIVAGLAKADTKNYAD----FAPNGAH  272

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+   +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS+ I +  YCL+A++LCL++P
Sbjct  273   GIFTASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMAITTLAYCLLAVTLCLMVP  332

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y +I  +  FS AF+ +GW WA  +V  GA  G+   LLV+ +GQARYL  + R  ++P 
Sbjct  333   YKMIDVDAPFSVAFESVGWGWAKYIVAAGALKGMTTVLLVSAVGQARYLTHIARTHMMPP  392

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLA V+  TGTP+NAT+ +    A +A FT+L I+  ++SI TL +F LVA +L+ RRY 
Sbjct  393   WLAHVNAKTGTPVNATVVMLAATAIIAFFTKLDILSNLLSISTLFIFMLVAVSLLVRRYY  452

Query  759   iINGNPP---FQvllflflvsssslgfslSWKLNLQ--W----WNLPLFGFLTLSFTALF  607
             +     P    ++++ +  +  SS+  +L W  + Q  W      +P++ F TL+     
Sbjct  453   VSGVTTPVNRVKLIVCIVAILVSSIATALIWGTSDQASWIGYVITIPIWFFATLALKI--  510

Query  606   HRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGV  427
                VP  R P+ W VPL+PW  + SI +N+FL+ +++V+++KRF +WTG++ ++Y+++G+
Sbjct  511   --SVPQARDPKLWGVPLVPWLPSASILINMFLLGSIDVQSFKRFAVWTGILLIYYLLFGL  568

Query  426   HSTYK  412
             H++Y 
Sbjct  569   HASYD  573



>ref|XP_004964213.1| PREDICTED: cationic amino acid transporter 1-like [Setaria italica]
Length=596

 Score =   345 bits (884),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 224/539 (42%), Positives = 344/539 (64%), Gaps = 8/539 (1%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y  +L +T  +L+ R  A      E+N+VR RSGADMKR LTW+DL+  G+G ++G G
Sbjct  35    SAYGRALLETGPRLRDRVTARSLDSAEVNEVRGRSGADMKRTLTWWDLIWFGIGAVIGSG  94

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  A++ AGP+V +SY V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  95    IFVLTGQEAKEAAGPAVVVSYAVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  154

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++Y +  AAV+RS+T Y +  L   +P+ +R+    L + Y+ LD  AVA+
Sbjct  155   AFIAAGNILLEYCIGGAAVARSWTSYFATLLNH-HPNDFRIHATSLADDYSRLDPIAVAV  213

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             ++L+ +    STK SS  N +++I H+    FI++AG  +  + NL       APFG RG
Sbjct  214   VLLICLFAVLSTKGSSRFNYILSIVHLAVIAFIVVAGLTRAKASNLTAD---FAPFGARG  270

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V   +A+++F+YIG+D+VSTMAEE  NP++ +P+G+VG++ + + +YC++AL LCL+ PY
Sbjct  271   VFAASAVLFFAYIGFDAVSTMAEETRNPARDIPIGLVGAMTLTTVVYCVLALVLCLMQPY  330

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               +  +  FS AF   G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +VP  
Sbjct  331   AELDPDAPFSVAFTAAGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMVPPC  390

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LA VHP  GTP+NAT+ + I  A +ALFT+L I+  ++SI TL +F LVA AL+ RRY +
Sbjct  391   LAAVHPRFGTPVNATVVMAIATAVIALFTDLGILSNLLSISTLFIFMLVAVALLVRRYYV  450

Query  756   INGNPPF---QvllflflvsssslgfslSWKLNLQWW-NLPLFGFLTLSFTALFHRLVPC  589
                       ++   L ++ +SS+  ++ W +    W    + G   L+ TA     VP 
Sbjct  451   AGETSTADRNKLAACLAVMLASSVATAVCWGMAASGWVPYAVTGAAWLAATAFLQVGVPM  510

Query  588   VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              R P +W VPL+PW  A SI +N+FL+ +++  ++ RFG+WT  +  +Y ++G+H++Y 
Sbjct  511   ARTPRTWGVPLVPWLPAASILINIFLLGSIDAASFVRFGVWTAALLAYYFLFGLHASYD  569



>ref|XP_011096667.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Sesamum indicum]
Length=710

 Score =   348 bits (892),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 238/543 (44%), Positives = 355/543 (65%), Gaps = 18/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y ++L QTP +L  R     + + EL +V+ RSG +MK+ L+W+DL+  G+G ++G G
Sbjct  133   SNYASALKQTPYRLVDRIFTRSSVEAEL-EVKARSGNEMKKTLSWWDLMWFGMGAVIGAG  191

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR+ AGP+V +SY V+GLSALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV
Sbjct  192   IFVLTGLEAREHAGPAVVLSYAVSGLSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFV  251

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y +  L   +PD +R+ V GL +GYN LD  AV +
Sbjct  252   AFIAAGNILLEYVIGGAAVARSWTSYFA-TLCNHDPDDFRILVHGLTDGYNQLDPIAVGI  310

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             +I++ I+   STK SS LN + ++ H+V   FIIIAG  K    N        APFG RG
Sbjct  311   MIVICIIAVVSTKGSSRLNYIASVVHMVVILFIIIAGLIKADPKNYTP----FAPFGPRG  366

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I + +YCL+A++LCL+ PY
Sbjct  367   IFKASAVLFFAYVGFDAVSTMAEETKNPARDVPIGLVGSMVITTTIYCLLAITLCLMQPY  426

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I     FS AF+M+GW WA  VV  GA  G+ + LLV+ +GQARYL  + R  ++P W
Sbjct  427   TSIDVNAPFSRAFEMVGWSWAQYVVAAGALKGMTSVLLVSAVGQARYLTHIARTHMMPPW  486

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              AKV   TGTP+NATI +    A +A FT+L I+ E++SI TL +F LVA AL+ RRY +
Sbjct  487   FAKVDHKTGTPINATIVMLAATAVIAFFTKLDILSELLSISTLFIFMLVALALLVRRYYV  546

Query  756   INGNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                  P    +++ FL L+  SS+  S  W ++   W      +P++    LS   L+  
Sbjct  547   SGETTPENRNKLIAFLALIVGSSIATSAYWGISKTGWIAYCITVPIW---ILSTAGLWF-  602

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  R P+ W VPL+PW  + SI +N+FL+ +++  +++RF  WT  + ++Y  +G+H+
Sbjct  603   FVPPARTPKLWGVPLVPWLPSASIAINIFLLGSIDKHSFERFAAWTAFLLVYYFFFGLHA  662

Query  420   TYK  412
             +Y 
Sbjct  663   SYD  665



>ref|XP_006468282.1| PREDICTED: cationic amino acid transporter 1-like [Citrus sinensis]
Length=605

 Score =   345 bits (884),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 226/541 (42%), Positives = 349/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+ +L  TP +LK R L       E+++++ RS  +MK+ LTW+DL+  G+G ++G G+F
Sbjct  34    YVQALKATPLRLKDRVLTRSLDTTEIHEIKARSEHEMKKTLTWWDLIWFGIGAVIGAGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ AGP+V +S++V+GLSA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  94    VLTGQEARQEAGPAVVLSFVVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+ V  + E Y  LD  AV +  
Sbjct  154   VAAGNILLEYVIGGAAVARSWTSYFA-TLCNKQPEDFRIIVHSMPEDYGQLDPIAVGVSA  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I+   STK SS  N + +I HVV   FIII     G ++   K+    APFG RGV 
Sbjct  213   VICILAVVSTKGSSRFNYIASIIHVVVILFIII----GGFANADTKNYKAFAPFGTRGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+YIG+D+VSTMAEE  NP+K +P+G+VGS+ + +  YCL+A++LCL+ PY  
Sbjct  269   KASAVLFFAYIGFDAVSTMAEETKNPAKDIPIGLVGSMAVTTLAYCLLAIALCLMQPYYA  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF+ +GW WA  VV  GA  G+   LLV+ +GQARYL  + R  ++P WLA
Sbjct  329   INVDAPFSVAFEAVGWDWAKYVVAFGALKGMTTVLLVSAVGQARYLTHIARTHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             +VH  TGTP+NATI +    A +A FT+L ++  ++SI TL +F LVA AL+ R      
Sbjct  389   QVHGKTGTPVNATIVMLTATAIIAFFTKLNVLSNLLSISTLFIFMLVAVALLVRRYYVSG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
             +   +   ++++ + L+  SS+  +  W L+   W      +P++ FL   + A+F   V
Sbjct  449   VTTTSNQVKLIVCILLILISSIATAAYWGLSKHGWIGYCITVPIW-FLGTLYLAVF---V  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++  ++ RFG+WT ++ L+Y+ +G+H++Y
Sbjct  505   PQARAPKLWGVPLVPWLPSASIAINIFLLGSIDRASFARFGVWTVILLLYYIFFGLHASY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_010449114.1| PREDICTED: cationic amino acid transporter 1-like [Camelina sativa]
Length=598

 Score =   344 bits (883),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 226/541 (42%), Positives = 353/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R         E+N+++ RSG +MK+ LTW+DL+  G+G ++G G+F
Sbjct  35    YFKALKETPSRFLDRITTRSLDTDEINEIKARSGHEMKKTLTWWDLMWFGIGAVIGSGIF  94

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ +GP+V +SY V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  95    VLTGLEAREFSGPAVVVSYAVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  154

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+RS+T Y +  L    PD +RV V  L E Y+ LD  AV + +
Sbjct  155   IAAGNIILEYVVGGAAVARSWTSYFATLLNH-KPDDFRVIVPRLGEDYSHLDPIAVGVCV  213

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS  N + +I H+V   F++IAGF K +    +K+     P+GVRGV 
Sbjct  214   IICVLAVLGTKGSSRFNYIASIIHMVVILFVVIAGFTKAN----LKNYSDFTPYGVRGVF  269

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               AA+++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY+ 
Sbjct  270   KSAAVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVALCLMQPYSQ  329

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + R  ++P WLA
Sbjct  330   IDPDAPFSVAFSDVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARTHMLPPWLA  389

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             +V+  TGTP+NAT+ +    A +A FT+L+I+ +++S+ TL +F  VA AL+ R      
Sbjct  390   QVNAKTGTPINATVVMLAATALIAFFTKLRILADLLSVSTLFIFMFVAVALLVRRYYVTG  449

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               +     + L+FL L+ +SS   ++ W L  + W     + P++ FL+   TA    LV
Sbjct  450   ETSSRDRNKFLVFLGLIFASSTATAVYWALGKEDWIGYCVSAPIW-FLS---TAGMKFLV  505

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++VK++ RF IWTG++ ++YV++G+H+TY
Sbjct  506   PQARAPKVWGVPLVPWLPSASIAINIFLLGSIDVKSFIRFAIWTGVLLVYYVLFGLHATY  565

Query  414   K  412
              
Sbjct  566   D  566



>ref|XP_002526614.1| cationic amino acid transporter, putative [Ricinus communis]
 gb|EEF35773.1| cationic amino acid transporter, putative [Ricinus communis]
Length=587

 Score =   343 bits (881),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 221/542 (41%), Positives = 351/542 (65%), Gaps = 17/542 (3%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +YL +LS+TP + K R LA      E+N+++ RS   MK+ LTW+DL+  G+G ++G G+
Sbjct  34    SYLKALSETPMRFKDRLLARSMDSTEINEIKARSEHQMKKNLTWWDLIWFGIGAVIGAGI  93

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  A+  AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ 
Sbjct  94    FVLTGLEAQSVAGPAVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMA  153

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NIL++YV+  AAV+R++T Y +  L    P+ +R+    L E Y  LD  AV +I
Sbjct  154   FIAAGNILLEYVIGGAAVARAWTSYFATLLNH-KPENFRIIAHSLPEDYGHLDPIAVVVI  212

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
              ++ ++   STK SS  N + +I H+V   FIIIAG     + N        AP+G RGV
Sbjct  213   AVICVLAVLSTKGSSRFNYIASIIHIVVILFIIIAGLVNADTKNYRD----FAPYGARGV  268

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
              + +A+++F+Y+G+D+VSTMAEE  +P++ +P+G+VGS+ + + LYCLMA++LCL++PY 
Sbjct  269   FNASAVLFFAYVGFDAVSTMAEETKDPARDIPIGLVGSMALTTLLYCLMAITLCLMVPYK  328

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I  +  FS AF+ +GW WA  +V +GA  G+   LLV+ +GQARYL  + R  ++P WL
Sbjct  329   QIDPDAPFSVAFQSVGWGWAKYIVSLGALKGMTTVLLVSAVGQARYLTHIARTHMMPPWL  388

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiI  754
             A V+  TGTP+NATI +    A +A FT+L+++  ++SI TL +F LVA AL+ RRY + 
Sbjct  389   AHVNAKTGTPVNATIVMLTATAVIAFFTKLEVLSNLLSISTLFIFMLVALALLVRRYYVS  448

Query  753   NGNPP---FQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRL  598
                      ++ + L ++  +S+  +  W   +  W      +P++ F TL  +      
Sbjct  449   GETTSANRLKLTVCLVVILVTSIANAAIWGAQVDGWIGYAITVPIWFFATLGISV----F  504

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R P+ W VPL+PW  + S+F+N+FL+ +++  ++ RF IWTG++ ++Y ++G+H++
Sbjct  505   VPQARAPKLWGVPLVPWLPSASVFINIFLLGSIDRDSFVRFAIWTGILLIYYFLFGLHAS  564

Query  417   YK  412
             Y 
Sbjct  565   YD  566



>ref|XP_002281463.1| PREDICTED: cationic amino acid transporter 1 [Vitis vinifera]
 ref|XP_003633038.1| PREDICTED: cationic amino acid transporter 1 [Vitis vinifera]
Length=606

 Score =   344 bits (882),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 230/549 (42%), Positives = 353/549 (64%), Gaps = 20/549 (4%)
 Frame = -2

Query  2025  EIFSTYLN---SLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvg  1855
             E F T+ N   +L++ P +LK R L       E+N+++ RS  +MK+ LTW+DL+  G+G
Sbjct  25    ESFKTWGNYGRALAEIPARLKDRLLTRSLDTTEMNEIKARSAHEMKKTLTWWDLMWFGIG  84

Query  1854  gmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRI  1675
              ++G G+FV TG  AR  AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+
Sbjct  85    AVIGAGIFVLTGIQARDVAGPAVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRV  144

Query  1674  TFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLD  1495
               G+F+ + A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+    L E YN LD
Sbjct  145   ELGDFMAFIAAGNILLEYVIGGAAVARSWTSYFA-TLCNHKPEDFRIIAHSLKEDYNQLD  203

Query  1494  FPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLA  1315
               AV +I ++ ++   STK SS  N + +IFHV+   FIIIAG  K  + N        A
Sbjct  204   PIAVGVITIICLLAVFSTKGSSRFNYIASIFHVIVILFIIIAGLCKADTSNYTP----FA  259

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             P GVRG+   +A+++F+YIG+D+VSTMAEE  NP + +P+G+VGS+ I +  YCL+A++L
Sbjct  260   PNGVRGIFKSSAVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMSITTLAYCLLAVTL  319

Query  1134  cllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
             CL+  Y  I ++  FS AF+ +GW WA  +V  GA  G+   LLV+ +GQARYL  + R 
Sbjct  320   CLMQKYTDIDKDAPFSVAFEAVGWNWAKYIVAAGALKGMTTVLLVSAVGQARYLTHIART  379

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              ++P WLA V+  TGTP+NATI + +  A +A FT+L I+  ++SI TL +F LVA  L+
Sbjct  380   HMMPPWLAHVNSRTGTPVNATIVMLVATAIIAFFTDLGILSNLLSISTLFIFMLVAVGLL  439

Query  774   yrryaiINGNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSF  619
              RRY + N   P    ++++ L L+  SS+  +  W L+   W      +P++   T++ 
Sbjct  440   VRRYYVSNVTTPTNRNKLIVCLVLIIGSSIATATYWGLSETGWVGYVVTVPIWLLATVAL  499

Query  618   TALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYV  439
              A     VP  R P+ W VPL+PW  + SI +N+FL+ +++  +++RFGIWT ++ ++Y 
Sbjct  500   WA----FVPKAREPKLWGVPLVPWLPSASIAINIFLLGSIDKASFERFGIWTAVLMVYYF  555

Query  438   VYGVHSTYK  412
              +G+H++Y 
Sbjct  556   FFGLHASYD  564



>gb|EPS73601.1| cationic amino acid transporter, partial [Genlisea aurea]
Length=563

 Score =   342 bits (878),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 231/544 (42%), Positives = 348/544 (64%), Gaps = 24/544 (4%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  ++ +TP +L  R L   + + E+ +VR RS  ++KRKL+W+DL+  G+G ++G G+F
Sbjct  30    YARAMRETPARLMNRVLTRSSVEAEV-EVRSRSENELKRKLSWWDLMWFGMGAVIGAGIF  88

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A + AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  GEFV +
Sbjct  89    VLTGQEASQAAGPAVVLSYVVSGISALLSVFCYTEFAVEIPVAGGSFAYLRVELGEFVAF  148

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+   GL  GY+ LD  AV +II
Sbjct  149   IAAGNILLEYVIGGAAVARSWTSYFA-TLCNHQPNDFRIHAHGLASGYDELDPVAVGVII  207

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++   STK SS LN V +I HVV   FIIIAG  K +  N        APFG RG+ 
Sbjct  208   IICVITVLSTKASSRLNYVASIVHVVIIVFIIIAGLIKSNVHNYTP----FAPFGARGIF  263

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I +ALYC++A++LCL+ PY  
Sbjct  264   QASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMVITTALYCILAVTLCLMQPYKA  323

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I     FS AF+ +GW WA  +V  GA  G+ + LLV  +GQARYL  + R  ++P W A
Sbjct  324   IDPNAPFSRAFQAVGWDWAQYIVAAGALKGMTSVLLVGAVGQARYLMHIARTHMLPPWFA  383

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal------iyr  769
             KV   TGTP+NAT+ +    A +A FT L I+  ++SI TL +F LVA AL         
Sbjct  384   KVDSKTGTPVNATVVMLAATAIIAFFTSLGILSNLLSISTLFIFMLVAVALIVRRYYAAG  443

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
               +  N N   ++++ + L+  SS+  +  W L+   W      +P++   TL       
Sbjct  444   ETSAANRN---KLMVLMALILGSSIATATYWGLSADGWIAYCITVPIWFLSTLG----LW  496

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
              LVP  + P+ W VPL+PW  + SI +N+FL+ +++  ++ RFG+WTGL+  +YV +G+H
Sbjct  497   LLVPQAKTPKLWGVPLVPWVPSASIAINIFLLGSIDKDSFIRFGVWTGLLLAYYVFFGLH  556

Query  423   STYK  412
             ++Y 
Sbjct  557   ASYD  560



>gb|KDO75318.1| hypothetical protein CISIN_1g007398mg [Citrus sinensis]
Length=605

 Score =   344 bits (882),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 225/541 (42%), Positives = 348/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+ +L  TP +LK R L       E+++++ RS  +MK+ LTW+DL+  G+G ++G G+F
Sbjct  34    YVQALKATPLRLKDRVLTRSLDTTEIHEIKARSEHEMKKTLTWWDLIWFGIGAVIGAGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ AGP+V +S++V+GLSA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  94    VLTGQEARQEAGPAVVLSFVVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+ V  + E Y  LD  AV +  
Sbjct  154   VAAGNILLEYVIGGAAVARSWTSYFA-TLCNKQPEDFRIIVHSMPEDYGQLDPIAVGVSA  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I+   STK SS  N + +I HV+   FIII     G ++   K+    APFG RGV 
Sbjct  213   VICILAVVSTKGSSRFNYIASIIHVIVILFIII----GGFANADTKNYKAFAPFGTRGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+YIG+D+VSTMAEE  NP+K +P+G+VGS+ + +  YCL+A++LCL+ PY  
Sbjct  269   KASAVLFFAYIGFDAVSTMAEETKNPAKDIPIGLVGSMAVTTLAYCLLAIALCLMQPYYA  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF+ +GW WA  VV  GA  G+   LLV+ +GQARYL  + R  ++P WLA
Sbjct  329   INVDAPFSVAFEAVGWDWAKYVVAFGALKGMTTVLLVSAVGQARYLTHIARTHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             +VH  TGTP+NATI +    A +A FT+L ++  ++SI TL +F LVA AL+ R      
Sbjct  389   QVHGKTGTPVNATIVMLTATAIIAFFTKLNVLSNLLSISTLFIFMLVAVALLVRRYYVSG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
             +       ++++ + L+  SS+  +  W L+   W      +P++ FL   + A+F   V
Sbjct  449   VTTTANQVKLIVCILLILISSIATAAYWGLSKHGWIGYCITVPIW-FLGTLYLAVF---V  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++  ++ RFG+WT ++ L+Y+ +G+H++Y
Sbjct  505   PQARAPKLWGVPLVPWLPSASIAINIFLLGSIDRASFARFGVWTVILLLYYIFFGLHASY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_010905430.1| PREDICTED: cationic amino acid transporter 1-like [Elaeis guineensis]
Length=590

 Score =   343 bits (880),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 224/546 (41%), Positives = 349/546 (64%), Gaps = 17/546 (3%)
 Frame = -2

Query  2025  EIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggml  1846
             E +++Y  +L +T  +L+ R  A    + EL++VR RSG +MK+ L+W+DL+  G+G ++
Sbjct  32    ESWASYGKALRETGMRLRDRVTARSLEETELHEVRARSGHEMKKNLSWWDLIWFGIGAVI  91

Query  1845  gvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFG  1666
             G G+FV TG  A + AGP+V +SY+V+G+ A+LS  CYTEF+VE+PVAGG+F+YLR+  G
Sbjct  92    GAGIFVLTGQEANEVAGPAVVLSYVVSGICAMLSVFCYTEFAVEIPVAGGSFAYLRVELG  151

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             +F+ + A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+    L + YN LD  A
Sbjct  152   DFMAFVAAGNILLEYVIGGAAVARSWTSYFATLLNHA-PNDFRIHATALADDYNRLDPIA  210

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             V +I ++ I    STK +S  N + +I H+    FIIIAG  K ++ N        AP+G
Sbjct  211   VVVISVICIAAVLSTKGTSRFNYIASIIHLAVILFIIIAGLTKANAANYTP----FAPYG  266

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             VRG+   +A+++F+YIG+D+VSTMAEE  NP+K +P+G+VGS+ IV+  YC +A++LCL+
Sbjct  267   VRGIFSASAVLFFAYIGFDAVSTMAEETKNPAKDVPIGLVGSMAIVTLAYCALAVTLCLM  326

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
              PYN I  +  FS AF++ G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +V
Sbjct  327   QPYNTIDVDAPFSVAFQVAGMDWAKYIVAFGALKGMTTVLLVSAIGQARYLTHIARTHMV  386

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr-  769
             P WLA+VH  TGTP+NATI +    A +A FT L I+  ++SI TL +F LVA AL+ R 
Sbjct  387   PPWLAQVHGKTGTPINATIVMLCATAVIAFFTNLGILSNLLSISTLFIFMLVAVALLVRR  446

Query  768   --ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTAL  610
                    + +   +++  + L+ +SS+  +  W L+ + W      +P++ FL+  F  L
Sbjct  447   YYVAGETSDSDRNKLVACIVLILASSIATATYWGLSEKGWIGYVVTVPIW-FLSTLFLWL  505

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
                 VP  R P  W  P++PW  + SI +N+FL+ +++  ++ RFGIWT  + ++Y+ +G
Sbjct  506   ---AVPKAREPRLWGAPMVPWLPSASIAVNIFLLGSIDRDSFARFGIWTAALLIYYLFFG  562

Query  429   VHSTYK  412
             +H++Y 
Sbjct  563   LHASYD  568



>gb|KDP34956.1| hypothetical protein JCGZ_09244 [Jatropha curcas]
Length=582

 Score =   342 bits (878),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 218/541 (40%), Positives = 349/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+ +LS+TP + K R L       EL++++ RS  DMK+ LTW+DL+  G+G ++G G+F
Sbjct  37    YMKALSETPMRFKDRLLTRSMDSTELHEIKARSEHDMKKDLTWWDLIWFGIGVVIGSGIF  96

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  AGP++ +SY+++G+SA+L+  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  97    VLTGLEARDHAGPAILLSYVISGVSAMLAVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  156

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L   NPD +R+ V  L + Y  LD  AV +  
Sbjct  157   IAAGNILLEYVIGGAAVARSWTSYFA-TLCNHNPDDFRIIVHSLPDDYGHLDPIAVVVSS  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I+   STK SS  N + +I HV+   FIIIAG  K  + N         P G RG+ 
Sbjct  216   VICILAVLSTKGSSRFNYIASIVHVITIVFIIIAGLTKAEAKNY----SSFTPHGARGIF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+V+F+Y+G+D+++TMAEE  NP++ +P+G+VGS+ +++  YCL+A +LCL++PY  
Sbjct  272   VASAVVFFAYVGFDAIATMAEETKNPARDIPIGLVGSMTVIALAYCLLAATLCLMVPYKQ  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             +  + +FS AF+ +G  WA  +V +GA  G+  +LLV  +GQARYL  + R  ++P WLA
Sbjct  332   LDPDAAFSVAFEYVGLSWAKYIVALGALQGMTTALLVGAVGQARYLTHISRTHMMPPWLA  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
              V+  TGTP+NATI +    A VA FT++ I+  ++SI TL +F LVA AL+ RRY +  
Sbjct  392   HVNGRTGTPVNATIVMITATAIVAFFTKMDILANLLSISTLFIFTLVAVALLVRRYYVTG  451

Query  750   GNPP---FQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
                P    ++++ + L+ +SS+  ++ W  N   W      +P++   TL         V
Sbjct  452   VTAPVNRVKLVVCILLILASSIATAIIWAENGDGWIGYVITIPIWFLATLGLKI----FV  507

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  + P+ W VP +PW  + SI +N+FL+ +++  ++ RFG+WTG++ ++Y+++G+H++Y
Sbjct  508   PQAKDPKLWGVPFVPWLPSASILINIFLLGSIDGLSFARFGVWTGVLLIYYLLFGLHASY  567

Query  414   K  412
              
Sbjct  568   D  568



>ref|XP_010434234.1| PREDICTED: cationic amino acid transporter 1 [Camelina sativa]
Length=598

 Score =   342 bits (878),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 225/541 (42%), Positives = 352/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R         E+N+++ RSG +MK+ LTW+DL+  G+G ++G G+F
Sbjct  35    YFKALKETPSRFLDRITTRSLDTDEINEIKARSGHEMKKTLTWWDLMWFGIGAVIGSGIF  94

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ +GP+V +SY V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  95    VLTGLEAREYSGPAVVLSYAVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  154

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+RS+T Y +  L    PD +RV V  L E Y+ LD  AV + +
Sbjct  155   IAAGNIILEYVVGGAAVARSWTSYFATLLNH-KPDDFRVIVPRLGEDYSHLDPIAVGVCV  213

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS  N + +I H+V   F++IAGF K +    +K+     P+GVRGV 
Sbjct  214   IICVLAVLGTKGSSRFNYIASIIHMVVILFVVIAGFTKAN----LKNYSDFTPYGVRGVF  269

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               AA+++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY+ 
Sbjct  270   KSAAVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVALCLMQPYSQ  329

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + R  ++P WLA
Sbjct  330   IDPDAPFSVAFSDVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARTHMLPPWLA  389

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             +V+  TGTP+NAT+ +    A +A FT+L+I+ +++S+ TL +F  VA AL+ R      
Sbjct  390   QVNAKTGTPINATVVMLAATALIAFFTKLRILADLLSVSTLFIFMFVAVALLVRRYYVTG  449

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               +     + L+FL L+ +SS   ++ W L  + W     + P++ FL+   T     LV
Sbjct  450   ETSSRDRNKFLVFLGLIFASSTATAVYWALGKEDWIGYCVSAPIW-FLS---TVGMKFLV  505

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++VK++ RF IWTG++ ++YV++G+H+TY
Sbjct  506   PQARAPKVWGVPLVPWLPSASIAINIFLLGSIDVKSFIRFAIWTGILLVYYVLFGLHATY  565

Query  414   K  412
              
Sbjct  566   D  566



>gb|KFK28695.1| hypothetical protein AALP_AA7G034300 [Arabis alpina]
Length=599

 Score =   342 bits (878),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 223/541 (41%), Positives = 346/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R         E+++++ RSG +MK+ L W+DL+  G+G ++G G+F
Sbjct  36    YFKALKETPSRFMDRVTTRSLDSAEIHEMKARSGNEMKKTLNWWDLMWFGIGAVIGSGIF  95

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ +GP+V +S++V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  96    VLTGLEAREVSGPAVVLSFVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  155

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++Y++  AAV+RS+T Y +  L   NPD +R+    L E Y  LD  AV +  
Sbjct  156   IAAGNIILEYIVGGAAVARSWTSYFA-TLCNHNPDDFRIIAHSLGEDYGHLDPIAVGVCA  214

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS+ N + +I H+V   F++IAGF K      +K+     PFGVRGV 
Sbjct  215   IICVLAVVGTKGSSVFNYIASIIHMVVILFVVIAGFTKAD----LKNYSVFVPFGVRGVF  270

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               AA ++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY  
Sbjct  271   KSAATLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVALCLMQPYQQ  330

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WLA
Sbjct  331   IDRDAPFSVAFSAVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARAHMIPPWLA  390

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             +V+  TGTP+NAT+ +    A +A FT+L I+ +++S+ TL +F  VA AL+ RRY +  
Sbjct  391   QVNAKTGTPINATVVMLAATALIAFFTKLSILADLLSVSTLFIFMFVAVALLVRRYYVTG  450

Query  750   GNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               P     + L+FL L+ +SS    + W L    W      +P++ FL+   T     LV
Sbjct  451   QTPTSDRNKFLVFLGLILASSTATGVYWALEKDGWIGYCITVPIW-FLS---TVAMKFLV  506

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++VK+Y RF +WT  + ++Y ++G+H+TY
Sbjct  507   PQARAPKIWGVPLVPWLPSASIAINIFLLASIDVKSYVRFALWTAFLLVYYFLFGLHATY  566

Query  414   K  412
              
Sbjct  567   D  567



>ref|XP_010439517.1| PREDICTED: cationic amino acid transporter 1 [Camelina sativa]
Length=598

 Score =   342 bits (876),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 224/541 (41%), Positives = 350/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R         E+N+++ RSG +MK+ LTW+DL+  G+G ++G G+F
Sbjct  35    YFKALKETPSRFLDRITTRSLDTDEINEIKARSGHEMKKTLTWWDLMWFGIGAVIGSGIF  94

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ +GP+V +SY V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  95    VLTGLEAREYSGPAVVLSYAVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  154

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+RS+T Y +  L    PD +RV V  L E Y+ LD  AV + +
Sbjct  155   IAAGNIILEYVVGGAAVARSWTSYFATLLNH-KPDDFRVIVPRLGEDYSHLDPIAVGVCV  213

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS  N + +I H+V   F++IAG  K      +K+     P+GVRGV 
Sbjct  214   IICVLAVLGTKGSSRFNYIASIIHMVVILFVVIAGLTKAD----LKNYSDFTPYGVRGVF  269

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               AA+++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY+ 
Sbjct  270   KSAAVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVTLCLMEPYSQ  329

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + R  ++P WLA
Sbjct  330   IDPDAPFSVAFSDVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARTHMMPPWLA  389

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             +V+  TGTP+NAT+ +    A +A FT+L+I+ +++S+ TL +F  VA AL+ R      
Sbjct  390   QVNAKTGTPINATVVMLAATALIAFFTKLRILADLLSVSTLFIFMFVAVALLVRRYYVTG  449

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               +     + L+FL L+ +SS   ++ W L  + W     + P++ FL+   TA    LV
Sbjct  450   ETSSRDRNKFLVFLGLILASSTATAVYWALEKEDWIGYCVSAPIW-FLS---TAGMKFLV  505

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R  + W VPL+PW  + SI +N+FL+ +++VK++ RF IWTG++ ++YV++G+H+TY
Sbjct  506   PQARAQKVWGVPLVPWLPSASIAINIFLLGSIDVKSFIRFAIWTGILLVYYVLFGLHATY  565

Query  414   K  412
              
Sbjct  566   D  566



>ref|XP_002319043.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
 gb|EEE94966.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
Length=604

 Score =   342 bits (876),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 225/543 (41%), Positives = 347/543 (64%), Gaps = 17/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + Y++++ QTP +   R L       ELN+++ RS  DMK+ LTW+DL+  GVG ++G G
Sbjct  34    TNYVHAIRQTPVRFSDRLLTRSLDSTELNEIKSRSEHDMKKNLTWWDLMWFGVGAVVGAG  93

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR+  GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  94    IFVLTGLEARENTGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  153

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y +  L    PD +R+    L + Y  LD  AV +
Sbjct  154   AFIAAGNILLEYVIGGAAVARSWTSYFA-TLCNHQPDDFRIIAHSLPDDYGHLDPIAVVV  212

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
               L+ ++   STK SS  N + +I HV    FIIIAG  K    N         P+ VRG
Sbjct  213   SSLICVLAVLSTKGSSRFNYITSIMHVAVIVFIIIAGLTKADRGNYKP----FMPYDVRG  268

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +  G+A+++F+Y+G+D+VSTMAEE  NP++ +P+G++GS+ IV+  YCL+A +LCL++PY
Sbjct  269   IFVGSAVLFFAYVGFDAVSTMAEETENPARDIPIGLLGSMTIVTVAYCLLAATLCLMVPY  328

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               +  E +FS+AF  +G  WA  +V + A  G+  +LLV+ +GQARYL  + R  ++P W
Sbjct  329   KQLDGEAAFSSAFDYVGLHWAKYIVALCALAGMTTALLVSAVGQARYLTHIARTHMMPPW  388

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LA V+  TGTP+NAT+ +    A VA FT+L I+  ++SI TL +F LVA AL+ RRY +
Sbjct  389   LAHVNAKTGTPVNATVIMLGATAIVAFFTKLNILSNLLSISTLFIFTLVAVALLGRRYYV  448

Query  756   INGNPP---FQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                  P    + +L +  +  SS   S+ W L    W      +P++   TL+       
Sbjct  449   SGVTTPVNHIKFILCIATILGSSTATSIIWGLGGDGWVGYVITVPIWFLGTLALKV----  504

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             LVP  R P+ W VPL+PW  + SIF+N+FL+ +++  +++RFG+WTG++ ++Y ++G+H+
Sbjct  505   LVPQARDPKLWGVPLVPWLPSASIFINIFLLGSIDKASFERFGVWTGILLIYYFLFGLHA  564

Query  420   TYK  412
             +Y 
Sbjct  565   SYD  567



>ref|XP_002464178.1| hypothetical protein SORBIDRAFT_01g013690 [Sorghum bicolor]
 gb|EER91176.1| hypothetical protein SORBIDRAFT_01g013690 [Sorghum bicolor]
Length=595

 Score =   341 bits (875),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 224/543 (41%), Positives = 339/543 (62%), Gaps = 17/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y  +L  T  +L  R  +      EL++VR RSGADMKR LTW+DL   GVG ++G G
Sbjct  32    SAYGRALRSTVSRLADRVTSRSLETTELHEVRARSGADMKRDLTWWDLAWFGVGAVIGAG  91

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR+  GP+V ISY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  92    IFVLTGQEAREDVGPAVVISYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  151

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++Y +  AAV+R++T Y +  L    P  +R+   GL   Y+ LD  AV +
Sbjct  152   AFVAAGNILLEYCIGGAAVARAWTSYFATLLNH-QPSDFRIHASGLDANYSELDPIAVVV  210

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I L+ I    STK +S  N V+++ H+    FII+AG  K  + N+        PFGVRG
Sbjct  211   IALVCIFASASTKGTSRFNYVLSVVHIAVIIFIIVAGLTKADAANMRD----FMPFGVRG  266

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+YIG+D+VSTMAEE  NP++ +P+G+VG++ + +ALYC++A++LCL+ PY
Sbjct  267   IFSASAVLFFAYIGFDAVSTMAEETKNPARDIPIGLVGAMTLTTALYCVLAVTLCLMQPY  326

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             + I  +  FS AF   G  WA  +V  GA  G+   LLV+ +GQARYL  + R  ++P W
Sbjct  327   SSIDADAPFSVAFSARGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMMPPW  386

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal------i  775
             LA+VHP TGTP+NAT+ + +  A +A FT+L I+  ++SI TL +F LVA AL      +
Sbjct  387   LAQVHPRTGTPVNATVVMLVATAVIAFFTDLGILSNLLSISTLFIFKLVAVALLVRRYYV  446

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSF--TALFHR  601
                    N N   ++   +  + ++S   +  W +++  W +P    +T  F  T     
Sbjct  447   AGETTTANRN---KLAACIAAILATSTATATCWGVDINGW-VPYAVTVTAWFVSTVCLWA  502

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  R P+ W VPL+PW  + SI +NVFL+ +++ K++ RFG WT  + ++Y+  G+H+
Sbjct  503   FVPQARAPKLWGVPLVPWLPSASIAINVFLLGSIDSKSFMRFGYWTAALLVYYLFVGLHA  562

Query  420   TYK  412
             +Y 
Sbjct  563   SYD  565



>ref|XP_006448936.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 ref|XP_006448937.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 ref|XP_006448938.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 gb|ESR62176.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 gb|ESR62177.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
 gb|ESR62178.1| hypothetical protein CICLE_v10014647mg [Citrus clementina]
Length=605

 Score =   342 bits (876),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 225/541 (42%), Positives = 347/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+ +L  TP + K R L       E+++++ RS  +MK+ LTW+DL+  G+G ++G G+F
Sbjct  34    YVQALKATPLRFKDRVLTRSLDTTEIHEIKARSEHEMKKTLTWWDLIWFGIGAVIGAGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ AGP+V +S++V+GLSA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  94    VLTGQEARQEAGPAVVLSFVVSGLSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+ V  + E Y  LD  AV +  
Sbjct  154   VAAGNILLEYVIGGAAVARSWTSYFA-TLCNKQPEDFRIIVHSMPEDYGQLDPIAVGVSA  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I+   STK SS  N + +I HVV   FIII     G ++   K+    APFG RGV 
Sbjct  213   VICILAVVSTKGSSRFNYIASIIHVVVILFIII----GGFANADTKNYKPFAPFGTRGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+YIG+D+VSTMAEE  NP+K +P+G+VGS+ + +  YCL+A++LCL+ PY  
Sbjct  269   KASAVLFFAYIGFDAVSTMAEETKNPAKDIPIGLVGSMAVTTLAYCLLAIALCLMQPYYT  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF+ +GW WA  VV  GA  G+   LLV+ +GQARYL  + R  ++P WLA
Sbjct  329   INVDAPFSVAFEAVGWDWAKYVVAFGALKGMTTVLLVSAVGQARYLTHIARTHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             +VH  TGTP+NATI +    A +A FT+L ++  ++SI TL +F LVA AL+ R      
Sbjct  389   QVHGKTGTPVNATIVMLTATAIIAFFTKLNVLSNLLSISTLFIFMLVAVALLVRRYYVSG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
             +       ++++ + L+  SS+  +  W L+   W      +P++ FL   + A+F   V
Sbjct  449   VTTTANQVKLIVCILLILISSIATAAYWGLSKHGWIGYCITVPIW-FLGTLYLAVF---V  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++  ++ RFG+WT ++ L+Y+ +G+H++Y
Sbjct  505   PQARAPKLWGVPLVPWLPSASIAINIFLLGSIDRASFARFGVWTVILLLYYIFFGLHASY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_008784883.1| PREDICTED: cationic amino acid transporter 1-like, partial [Phoenix 
dactylifera]
Length=587

 Score =   340 bits (873),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 219/549 (40%), Positives = 348/549 (63%), Gaps = 23/549 (4%)
 Frame = -2

Query  2025  EIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggml  1846
             E +++Y  +L +T  +L+ R  A    + EL++VR RSG +MK+ L+W+DL+  G+G ++
Sbjct  29    ESWASYGQALRETGSRLRDRVTARSLDETELHEVRARSGHEMKKNLSWWDLIWFGIGAVI  88

Query  1845  gvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFG  1666
             G G+FV TG  A K AGP+V +SY+++G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G
Sbjct  89    GAGIFVLTGQEANKEAGPAVVLSYVISGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELG  148

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             +F+ + A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+    L   YN LD  A
Sbjct  149   DFMAFIAAGNILLEYVIGGAAVARSWTSYFATLLNH-KPNDFRIHASALAADYNRLDPIA  207

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             V +I  + +    STK +S  N + +I HV    FI++AG  K    N        AP+G
Sbjct  208   VVVITAVCLAAVLSTKATSRFNYIASIIHVAIILFIVVAGLTKADVANYTP----FAPYG  263

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
              RG+   +A+++F+Y+G+D+VSTMAEE  NP+K +P+G+VG++ + +  YC++A++LCL+
Sbjct  264   PRGIFSASAVLFFAYVGFDAVSTMAEETRNPAKDIPIGLVGAMTVTTLAYCILAVTLCLM  323

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
              PY+ I  +  FS AF+ +G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +V
Sbjct  324   QPYSNIDIDAPFSVAFQAVGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMV  383

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr-  769
             P WLA+VH  TGTP+NATI +    A +A FT L I+  ++SI TL +F LVA AL+ R 
Sbjct  384   PPWLAQVHGKTGTPINATIVMLCATAIIAFFTNLSILSNLLSISTLFIFMLVAVALLVRR  443

Query  768   -----ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSF  619
                    +  N N   +++  + L+ +SS+  +  W ++ + W      +P++ FL+   
Sbjct  444   YYVSGETSDSNRN---KLIACIVLILASSIAMAAYWGVSEKGWIGYVVTVPIW-FLS---  496

Query  618   TALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYV  439
             T   H  VP  R+P  W VP++PW  + SI +N+FL+ +++  ++ RFG+WT L+ ++Y+
Sbjct  497   TLFLHLAVPRARKPRLWGVPMVPWLPSASIAINIFLLGSIDRDSFARFGVWTALLLIYYL  556

Query  438   VYGVHSTYK  412
               G+H++Y 
Sbjct  557   FLGLHASYD  565



>ref|XP_009600414.1| PREDICTED: cationic amino acid transporter 1-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   341 bits (875),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 227/543 (42%), Positives = 347/543 (64%), Gaps = 20/543 (4%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y N+L QTP +L  R L T + D E  + + RS  +MK+ LTW+DL+  G+G ++G G+
Sbjct  41    NYANALIQTPTRLIDRIL-TRSEDGEELQAKSRSQNEMKKTLTWWDLIWFGMGAVIGAGI  99

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  A + AGP+V +SY V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV 
Sbjct  100   FVLTGLEANQEAGPAVVLSYAVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVA  159

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NIL++YV++ AAV+R++T Y +  L   N D + +KV+ L +GYN LD  AV + 
Sbjct  160   FIAAGNILLEYVIAGAAVARTWTSYFATLL-NFNSDRFLIKVNSLADGYNELDPIAVGVC  218

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
             +++ ++  +STK SS LN + TI H+    FIII G  K  + N        APFGVRG+
Sbjct  219   LIVCLIAIYSTKGSSRLNYIATIIHIFVIFFIIICGLIKSDTKNYTP----FAPFGVRGI  274

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
                +A+++F+Y+G+D+VSTMAEE  NP + +P+G++GS++I + LYCL+A++LCL+ PY 
Sbjct  275   FKASAVLFFAYVGFDAVSTMAEETKNPGRDIPIGLIGSMVITTFLYCLLAITLCLMQPYQ  334

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I     FS AFK +GW WA  +V  GA  G+ + LLV  +GQARYL  + R  ++P W 
Sbjct  335   NIDIHAPFSVAFKSVGWNWAQYIVAAGALKGMTSVLLVGAVGQARYLTHISRTHMMPPWF  394

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy----rr  766
             ++V+  TGTP+NAT  +    A +ALFT+L I+  ++SI TL +F LVA AL+       
Sbjct  395   SQVNAKTGTPVNATAVMSCATAIIALFTKLDILSNLLSISTLFIFMLVALALLVRRYYVS  454

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                 N N   +++ FL ++  SS+  +  W L+   W      +P++   T+        
Sbjct  455   GETTNANRN-KLIAFLLIILGSSIATATYWGLSKHGWIGYCITVPIWLLATIG----LWY  509

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  R P+ W VPL+PW  + SI +N+FL+ +++ K++ RFG WTG + ++Y+ +G+H+
Sbjct  510   FVPHARNPKLWGVPLVPWLPSASIAINIFLLGSIDKKSFIRFGAWTGFLLVYYLFFGLHA  569

Query  420   TYK  412
             +Y 
Sbjct  570   SYD  572



>gb|KDP34958.1| hypothetical protein JCGZ_09246 [Jatropha curcas]
Length=598

 Score =   340 bits (872),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 220/544 (40%), Positives = 350/544 (64%), Gaps = 17/544 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             FS Y  +L +TP + K R         E+ +V+ +S  +MK+ LTW+DL+  G+G ++G 
Sbjct  39    FSNYGKALLETPMRFKDRLFTRSVDSVEITEVKAQSEHEMKKNLTWWDLIWFGIGAVIGA  98

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG  A++ +GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F
Sbjct  99    GIFVLTGLEAKEVSGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDF  158

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             + + A  NIL++YV+  AAV+RS+T YL+  L    PD +R+    L + Y  LD  AV 
Sbjct  159   MAFIAAGNILLEYVIGGAAVARSWTSYLA-TLCNHKPDDFRIIAHSLPDDYGHLDPVAVG  217

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             +  ++ ++   STK SS  N V +I H+    FIIIAG     + N        AP+G R
Sbjct  218   ITAVICVLAVLSTKGSSRFNYVASIVHIAVILFIIIAGLINADTKNY----SDFAPYGSR  273

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+ + AA+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS+ I + LYCL+A++LCL++P
Sbjct  274   GIFNSAAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMAITTLLYCLLAVTLCLMVP  333

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             +  I  +  FS AF+++GW WA  +V  GA  G+   LLV+ +GQARYL  + R  ++P 
Sbjct  334   FKQIDADAPFSVAFQLVGWDWAKYIVAAGALKGMTTVLLVSAVGQARYLTHIARTHMMPP  393

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             WLA+V+  TGTP+NATI +    A +A FT+L I+ +++SI TL +F LVA +L+ RRY 
Sbjct  394   WLAQVNSRTGTPVNATIVMLTATAIIAFFTKLDILSDLLSISTLFIFMLVALSLLVRRYY  453

Query  759   iINGNPP---FQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
             +     P    +++L + ++  SS+  +  W      W      +P++   TL  +    
Sbjct  454   VPGVTTPANRMKLILCILVILGSSIATAAIWGAGGNGWIGYVITIPIWFLATLVLSV---  510

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               VP  + P+ W VPL+PW  + SI +N+FL+ +++ K+++RFGIWT ++ ++Y ++G+H
Sbjct  511   -FVPKAKAPKLWGVPLVPWIPSGSIIINIFLLGSIDAKSFERFGIWTVVLLIYYFLFGLH  569

Query  423   STYK  412
             +TY 
Sbjct  570   ATYD  573



>gb|EYU19131.1| hypothetical protein MIMGU_mgv1a003219mg [Erythranthe guttata]
Length=599

 Score =   340 bits (871),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 229/541 (42%), Positives = 348/541 (64%), Gaps = 18/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+++L QTP +L  R L   T + E+ +++ RSG +MKR L+W+DL+ LG+G ++G G+F
Sbjct  40    YVSALRQTPARLADRVLTRSTVEAEM-EMKTRSGNEMKRTLSWWDLIWLGLGAVIGAGIF  98

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A   AGP+V +SY+V+GLSALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  99    VLTGLEAHDDAGPAVVLSYVVSGLSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  158

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++Y++  AAV+RS+T Y +  L    P+ +R+    L EGYN LD  AVA+ I
Sbjct  159   IAAGNILLEYIIGGAAVARSWTSYFA-TLCNHKPEQFRIHATSLAEGYNQLDPIAVAVCI  217

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++   STK SS  N V ++ H+    FIIIAGF K  + NL       APFG RG+ 
Sbjct  218   VICLIAVLSTKGSSRFNYVASVVHIAVILFIIIAGFIKSDTKNLTP----FAPFGPRGIF  273

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP + +P+G+VGS+++ +A+YCLMA++L ++ PY  
Sbjct  274   RASAVLFFAYVGFDAVSTMAEETKNPGRDIPIGLVGSMVLTTAIYCLMAIALTMMQPYTT  333

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I     FS AFK +GW WA  +V  GA  G+ + LLV  +GQARYL  + R  ++P W A
Sbjct  334   IDVNAPFSMAFKQVGWGWAQYLVAFGALKGMTSVLLVNSVGQARYLTHIARTHMMPPWFA  393

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             KV P TGTP+NAT+ +    A +A FT+L I+  ++SI TL +F LV+ AL+ R      
Sbjct  394   KVDPKTGTPINATVVMLAATAVIAFFTKLDILSNLLSISTLFIFMLVSVALLVRRFYVSG  453

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
             +   +   ++++ L L+  SS+  +  W ++   W      +P++ FL    TA     V
Sbjct  454   VTTNDHRNKLIVCLVLIIGSSITTAAYWGISETGWIAYCITVPVW-FLA---TAGLWFFV  509

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P   +P  W VPL+PW  + SI +N+FL+ +++  ++ RF  WTG +  +YV +G+H++Y
Sbjct  510   PQAHKPTLWGVPLVPWLPSASIAINIFLLGSIDKDSFIRFLGWTGFLLAYYVFFGLHASY  569

Query  414   K  412
              
Sbjct  570   D  570



>ref|XP_007214130.1| hypothetical protein PRUPE_ppa018024mg [Prunus persica]
 gb|EMJ15329.1| hypothetical protein PRUPE_ppa018024mg [Prunus persica]
Length=597

 Score =   338 bits (867),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 217/536 (40%), Positives = 336/536 (63%), Gaps = 7/536 (1%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+++L+ T  +L  R LA     QEL ++R RS   MK+ L W+DL+  G+G ++G G+F
Sbjct  40    YVHALANTKTRLTDRILARSMDHQELEQMRARSNNQMKKTLNWWDLIWFGIGAVMGAGIF  99

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  AGP+V ISY ++G+SALLS LCYTEFSVE+PVAGG+FSYLR+  G+FV Y
Sbjct  100   VLTGQAARNDAGPAVVISYFISGVSALLSVLCYTEFSVELPVAGGSFSYLRVELGDFVAY  159

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL +YV++ A+V+RS+T Y +  L   NP+ +R+ V  L + +N LD  AV + I
Sbjct  160   IAAGNILFEYVVAGASVARSWTSYFA-TLCNHNPNDFRINVPALADNFNHLDPIAVVISI  218

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I    S K SS  N V TI H+V   FI I G  K +  N   +     PFG RGVL
Sbjct  219   VVCIGAALSMKASSRFNSVTTIVHLVVLVFIFITGMTKANPANFTTN---FLPFGFRGVL  275

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D V+T+ EEI NP + +P+G++GS+L+    YC+++ +LCL+ PY+ 
Sbjct  276   KASAVLFFAYVGFDGVATLGEEIKNPGRDIPIGLIGSMLVTITTYCVLSATLCLMQPYSQ  335

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  + SF+ AF+  G  WA  +V +GA  G+   LL  ++ QARY   +GR  + P+ LA
Sbjct  336   IDADASFTMAFQAAGMNWAKYIVALGAIKGMTTVLLANLIAQARYFTHIGRTHMAPAILA  395

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              +HP TGTP+NAT+ + +    VALFT L ++  ++SI TL +F LV+ ALI R      
Sbjct  396   SIHPKTGTPVNATVIMTVANCLVALFTSLDVLANLLSISTLFIFSLVSLALIVRRYYVTG  455

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
               + +   ++++FL L+  SS+  ++ W L+  W    + G +  + T      +   ++
Sbjct  456   ETSTSDRNKLIIFLTLIVGSSIATAVYWVLSQGWIGYVVTGVIWFAATLGLQLTLKQAKK  515

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             P+ W VPL+PW  + SI  NVF++ +++V ++ RF IWT ++ ++Y+   +H++Y 
Sbjct  516   PKLWGVPLVPWLPSASIAFNVFILGSIDVPSFIRFAIWTLVLLVYYIFVALHASYD  571



>emb|CDY58484.1| BnaA03g58530D [Brassica napus]
Length=595

 Score =   338 bits (866),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 218/541 (40%), Positives = 349/541 (65%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R +       E++ ++ RSG +MK+ LTW+DL+  GVG ++G G+F
Sbjct  34    YFKALKETPSRFIDRVMTRSDDSAEIHDMKARSGNEMKKTLTWWDLMWFGVGAVIGSGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A+  +GP+V +S++V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  94    VLTGQQAKGESGPAVVLSFVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+RS+T Y +  L    P+ +R+    L E Y+ LD  AV +  
Sbjct  154   IAAGNIILEYVVGGAAVARSWTSYFATLLNH-KPEDFRIIAHSLNEDYSHLDPIAVGVCA  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS+ N + ++ H+V   F+IIAG  +      +K+    APFGVRGV 
Sbjct  213   IICVLAVVGTKGSSVFNYIASMIHMVVIAFVIIAGLTRAD----LKNYSDFAPFGVRGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               A++++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY+ 
Sbjct  269   KSASVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVTLCLMQPYSQ  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WLA
Sbjct  329   IDPDAPFSVAFSAVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARAHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              V+  TGTP+NAT+ +    A +A FT+L+I+ +++S+ TL +F  VA AL+ R      
Sbjct  389   HVNAKTGTPINATVVMLAATALIAFFTKLEILADLLSVSTLFIFMFVAVALLVRRYYVTG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               +     + L+FL L+ +SS+  ++ W +    W      +P++ FL+   T     LV
Sbjct  449   ETSSRDLNKFLMFLGLILASSIATAVYWAMERDGWIVYAVTVPIW-FLS---TVGMKFLV  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++ K++ RFGIWTG++ ++Y ++G+H+TY
Sbjct  505   PQARAPKLWGVPLVPWLPSASIAINIFLLGSIDEKSFVRFGIWTGVLLVYYFLFGLHATY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_009362250.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
 ref|XP_009362251.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
 ref|XP_009362252.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
Length=614

 Score =   338 bits (868),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 227/540 (42%), Positives = 346/540 (64%), Gaps = 13/540 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y+N+L +TP++   R L+    + EL +V+ RS  +MK+KL W+DL+  G+G ++G G+
Sbjct  35    NYVNALKKTPRRFVDRVLSRSADNTELVEVKARSHHEMKKKLNWWDLIWFGIGVVIGAGI  94

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  A++ AG +V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV 
Sbjct  95    FVLTGLEAKRHAGAAVVLSYLVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVA  154

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NIL++YV+S AAV+RS+T Y +      + + +R+   G  E Y  LD  AVA++
Sbjct  155   FIAAGNILLEYVISGAAVARSWTSYFTTLCNRSDTNDFRIIAHGFPEDYKYLDPIAVAVL  214

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
             I +  +   S K SS LN + +IFH++   FIIIAG  K  + N +      APFG RGV
Sbjct  215   IGICCLAVLSIKGSSRLNYIASIFHIIVIVFIIIAGLTKADTKNYID----FAPFGPRGV  270

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
                +A+V+F+Y+G+D+VSTMAEE  NP+K +P+G+VGS++I++ LYCL+AL+L L+ PYN
Sbjct  271   FQASAVVFFAYVGFDAVSTMAEETKNPAKDIPIGLVGSMVIITVLYCLLALTLGLMQPYN  330

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I E+ +F  AF+ +G  WA  +V  GA  G+ ++LL   +GQARYL  + R  +VP W 
Sbjct  331   QIDEQAAFPVAFEAVGMGWAKYIVAAGALEGMTSALLGGAVGQARYLTHIARTHMVPPWF  390

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr-----  769
             A+V   TGTP+NAT+ L    A +A FT L ++  ++SI TL +F LVA AL+ R     
Sbjct  391   AQVDSKTGTPVNATVTLLAATAVIAFFTSLDVLANLVSISTLFIFSLVAIALLVRRYYVS  450

Query  768   -ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVP  592
                   N N   + +  LF++ SSS+  S+ W     W    +   L    T     LVP
Sbjct  451   GVTTQANRN---KFIACLFIIISSSIATSVYWSRTDDWIAYVVTAPLWFLGTLGIWLLVP  507

Query  591   CVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
               R P+ W VPL+PW  +LSI +N+FL+ +++  ++ RFG+WT ++ ++Y ++G+H++Y 
Sbjct  508   QARSPKLWGVPLVPWLPSLSIAINIFLLGSIDHASFIRFGVWTLIILVYYFIFGLHASYD  567



>ref|NP_001050746.1| Os03g0641200 [Oryza sativa Japonica Group]
 dbj|BAF12660.1| Os03g0641200 [Oryza sativa Japonica Group]
 gb|EAY91164.1| hypothetical protein OsI_12773 [Oryza sativa Indica Group]
 gb|EAZ27904.1| hypothetical protein OsJ_11862 [Oryza sativa Japonica Group]
Length=593

 Score =   338 bits (866),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 231/549 (42%), Positives = 348/549 (63%), Gaps = 19/549 (3%)
 Frame = -2

Query  2025  EIFST---YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvg  1855
             E FS+   Y  +L  T  +L  R  A      EL++VR RSGADMKR LTW+DL   GVG
Sbjct  27    ESFSSWEAYGRALRSTGARLADRLTARSLDATELHEVRARSGADMKRDLTWWDLAWFGVG  86

Query  1854  gmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRI  1675
              ++G G+FV TG  AR   GP+V ISY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+
Sbjct  87    AVIGAGIFVLTGQEARNAVGPAVVISYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRV  146

Query  1674  TFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLD  1495
               G+F+ + A  NIL++Y +  AAV+R++T Y +  L   +P+ +R+    L   Y+ LD
Sbjct  147   ELGDFMAFVAAGNILLEYCIGGAAVARAWTSYFATLLNH-HPNDFRIHAASLAADYSRLD  205

Query  1494  FPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLA  1315
               AVA+I ++ ++   STK SS  N V+++ HV    FII+AG  K  + NL +      
Sbjct  206   PIAVAVIAIICLLSVLSTKASSRFNYVLSVLHVAVIAFIIVAGLTKADAANLTRD---FM  262

Query  1314  PFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalsl  1135
             P+G RGV   +A+++F+YIG+D+VSTMAEE  +P++ +PVG+VG++ + +ALYC +A++L
Sbjct  263   PYGPRGVFAASAVLFFAYIGFDAVSTMAEETRDPARDIPVGLVGAMALTTALYCALAVTL  322

Query  1134  cllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRA  955
             CL++PY  I  +  FS AF   G  WA  VV  GA  G+   LLV+ +GQARYL  + R 
Sbjct  323   CLMVPYGEIDPDAPFSVAFADRGMGWAKYVVAFGALKGMTTVLLVSAVGQARYLTHIART  382

Query  954   RLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaali  775
              ++P WLA+VHP TGTP+NAT+ + +  A +A FT+L ++  ++SI TL +F LVA AL+
Sbjct  383   HMMPPWLARVHPGTGTPVNATVAMLLATAVIAFFTDLNVLSNLLSISTLFIFMLVAVALL  442

Query  774   yrryaiINGNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSF  619
              RRY +          ++   +  + +SS+  +  W L+   W      +P +    L+ 
Sbjct  443   VRRYYVSGETSRADRNRLAACIAAILASSVATATCWGLDRGGWVPYAVTVPAW----LAA  498

Query  618   TALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYV  439
             TA    LVP  R P+ W VP++PW  + SI +NVFL+ +++ K++ RFGIWT  + ++Y+
Sbjct  499   TASLWALVPQARAPKLWGVPMVPWLPSASIAINVFLLGSIDSKSFMRFGIWTAALLVYYL  558

Query  438   VYGVHSTYK  412
               G+H++Y 
Sbjct  559   FVGLHASYD  567



>gb|KHN10383.1| Cationic amino acid transporter 7, chloroplastic [Glycine soja]
Length=474

 Score =   333 bits (855),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 224/445 (50%), Positives = 312/445 (70%), Gaps = 12/445 (3%)
 Frame = -2

Query  1713  VPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRV  1534
             +PV GGAFSYL +TFGEF  +  GAN++ DYVLSNAAV+R  T YL   +G  +   WR+
Sbjct  1     MPVTGGAFSYLCVTFGEFAAFLTGANLVADYVLSNAAVARGLTVYLGTTIGISSAK-WRL  59

Query  1533  KVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKG  1354
              V    +G+N +D  AVA+++++T+V+C+ST+ESS++N+++T+ H++F  F+I+ GF++G
Sbjct  60    TVPSFPKGFNEIDIVAVAVVLVITLVICYSTRESSVVNMILTLLHILFIAFVIMVGFWRG  119

Query  1353  SSDNLV-----KSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGI  1189
             S  N       +S  G  P G  GV  GAA VY SYIGYD+VSTMAEE+ +P K +PVG+
Sbjct  120   SWKNFTEPANPQSPTGFFPHGAAGVFKGAAAVYLSYIGYDAVSTMAEEVRDPVKDIPVGV  179

Query  1188  VGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAF--KMMGWKWASNVVGVGASLGIV  1015
              GSV+IV+ LYCLMA S+  LLPY++I  E  FSAAF  +  GW W S V+GVGAS GI+
Sbjct  180   SGSVVIVTVLYCLMAASMTKLLPYDMINAEAPFSAAFSGRSDGWGWISGVIGVGASFGIL  239

Query  1014  ASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIV  835
              SLLVAMLGQARY+CV+GR+ +VPSW A+VHP T TP+NA+ FLGI  A++ALFT+L ++
Sbjct  240   TSLLVAMLGQARYMCVIGRSNVVPSWFARVHPKTSTPVNASAFLGIFTAAIALFTDLDVL  299

Query  834   IEIISIGTLVVFylvaaaliyrryaiINGNPPFQvllflflvsssslgfslSWKL----N  667
             + ++SIGTL VFY+VA A+IYRRY       P+  L FL   S +++ F+L WK      
Sbjct  300   LNLVSIGTLFVFYMVANAVIYRRYVATGTTNPWPTLSFLCSFSITAIMFTLIWKFVPTGG  359

Query  666   LQWWNLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKA  487
              +   L + G + ++   LFH +VP VR+PE W VP MPW  ++SIFLNVFL+ +L+  +
Sbjct  360   AKAGMLSVSGVIAIAILQLFHCMVPQVRKPEFWGVPFMPWIPSISIFLNVFLLGSLDGPS  419

Query  486   YKRFGIWTGLMSLFYVVYGVHSTYK  412
             Y RFG ++ +  LFYV Y VH+++ 
Sbjct  420   YVRFGFFSAVAVLFYVFYSVHASFD  444



>ref|XP_009340268.1| PREDICTED: cationic amino acid transporter 5-like [Pyrus x bretschneideri]
Length=590

 Score =   337 bits (865),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 229/543 (42%), Positives = 348/543 (64%), Gaps = 18/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             STY  +LSQT  + K R L+    + E+ ++R +S  DMKR LTW+DL+  G G ++G G
Sbjct  34    STYRAALSQTGHRFKNRLLSRSNDNDEIRELRKQSENDMKRCLTWWDLIWFGFGSVIGAG  93

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG    K AGP++ +SY+ +G+SA+LS  CYTEFSVEVPVAGGAF+YLRI  G+FV
Sbjct  94    IFVLTGQETHKHAGPAIVLSYVASGISAMLSVFCYTEFSVEVPVAGGAFAYLRIELGDFV  153

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +    NIL++ ++ +AAV+R++T Y +  L   + +  R+  + L EG+N+LD  AVA+
Sbjct  154   AFITAGNILLESIVGSAAVARAWTSYFTTLLNRPS-NSLRIHTN-LAEGFNLLDPIAVAV  211

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             + +   +   ST+++S LN + +  + V   F+I+A F      NL        PFG +G
Sbjct  212   LAVAATIAMISTRKTSYLNWIASAVNNVIILFVIVAAFVHAKPSNLKP----FFPFGAKG  267

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V   AAIVYF+Y G+D+++TMAEE  NPS+ +P+G++GS+ I++ +YCLMALSL ++  Y
Sbjct  268   VFQAAAIVYFAYGGFDNIATMAEETKNPSRDIPLGLLGSMTIITVVYCLMALSLPMMQKY  327

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I    ++S AF+ +G  WA  +V +GA  G+   LLV  LGQARY+  + RA ++P W
Sbjct  328   TDIDPNAAYSVAFQSVGMTWAKYLVALGALKGMTTVLLVGTLGQARYITHIARAHMIPPW  387

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              A VHP TGTP+NAT+ + I    +A F+ L ++  ++S+ TL +F ++A AL+ RRY +
Sbjct  388   FALVHPKTGTPINATVLIAISSGCIAFFSSLDVLASLLSVSTLFIFMMMAVALLVRRYYV  447

Query  756   INGNPP---FQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                 P    +++  FL ++ +SS+G S  W LN   W      +PL+ F TL+  A+F  
Sbjct  448   REITPQQHLWKLASFLLIIIASSMGTSAYWGLNPNGWVGYVVTVPLWFFGTLAM-AVF--  504

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              +P  R P+ W VPL+PW  +LSI  N+FLM +L  +A++RFGI T +M ++YV +G+H+
Sbjct  505   -LPQQRSPKVWGVPLVPWLPSLSIATNIFLMGSLGPEAFERFGICTVVMLIYYVFFGLHA  563

Query  420   TYK  412
             TY 
Sbjct  564   TYD  566



>emb|CDP05623.1| unnamed protein product [Coffea canephora]
Length=598

 Score =   337 bits (865),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 225/547 (41%), Positives = 343/547 (63%), Gaps = 24/547 (4%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F  Y+N+L QTP +L  R L T + DQ    V+ RS  +MK+ LTW+DL+  G+G ++G 
Sbjct  36    FGNYINALKQTPNRLVDRVL-TRSKDQAEMAVKNRSQNEMKKTLTWWDLIWFGMGAVIGA  94

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG  A++ AGP+V +S++V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F
Sbjct  95    GIFVLTGLEAKEEAGPAVVLSFVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDF  154

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             + + A  NIL++YV+  AAV+RS+T Y +  L   +P  +R+    L   YN LD  AV 
Sbjct  155   MAFIAAGNILLEYVIGGAAVARSWTSYFATLLNH-HPSDFRIHAHALANNYNELDPIAVG  213

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             + I + I+   STK SS LN + +I H+V   FIIIAG  K  + N         PFG R
Sbjct  214   VCICICILAVLSTKGSSRLNYIASIVHIVVILFIIIAGLAKSDTKNYTP----FTPFGAR  269

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+   +A+++F+Y+G+D+VSTMAEE  +P+K +P+G+VGS++I + LYCL+A++LCL++P
Sbjct  270   GIFKASAVLFFAYVGFDAVSTMAEETKDPAKDIPIGLVGSMIITTTLYCLLAITLCLMVP  329

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  +  +  FS AFK +GW WA  +V +GA  G+ + LLV  +GQARYL  + R  ++P 
Sbjct  330   YQDVDPDAPFSVAFKHVGWSWAQYLVALGALKGMTSVLLVGAVGQARYLTHIARTHMMPP  389

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---  769
             W A V   TGTP+NAT+ +    A +A FT+L+I+  ++SI TL +F LVA AL+ R   
Sbjct  390   WFAIVDAKTGTPVNATVVMLAATAIIAFFTKLEILSNLLSISTLFIFMLVAVALLVRRYY  449

Query  768   ---ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNL-----PLFGFLTLSFTA  613
                     N N   +++ F+  +  S++  +  W ++   W L     P++   T     
Sbjct  450   VSGVTTAANRN---KLIGFVLTIVGSAIATAAYWGVSTNGWILYCITVPIWLLATFG---  503

Query  612   LFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVY  433
                  VP    P  W VP +PW  + SIF+N+FL+ +++  ++ RF IWTG + L+YV +
Sbjct  504   -LWYFVPQAHNPRLWGVPFVPWLPSASIFINIFLLGSIDKDSFIRFAIWTGFLLLYYVFF  562

Query  432   GVHSTYK  412
             G+H++Y 
Sbjct  563   GLHASYD  569



>ref|XP_007041134.1| Amino acid transporter 1 [Theobroma cacao]
 gb|EOX96965.1| Amino acid transporter 1 [Theobroma cacao]
Length=604

 Score =   337 bits (865),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 219/542 (40%), Positives = 351/542 (65%), Gaps = 18/542 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+ +L +TP +   R L       EL++++ RS  +MK+ L+W+DL+  G+G ++G G+F
Sbjct  36    YVQALKETPSRFMDRVLTRSLDSTELHEIKARSQHEMKKNLSWWDLIWFGIGAVIGAGIF  95

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A++ AGP+V +SY+++G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  96    VLTGLQAKEVAGPAVVLSYVISGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  155

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+ V  +   Y  LD  AV ++ 
Sbjct  156   IAAGNILLEYVIGGAAVARSWTSYFA-TLCNHQPEDFRIIVHSMPADYGHLDPIAVVVVS  214

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++   STK SS  N + ++ HV+   FIIIAGF K    N         PFGVRG+ 
Sbjct  215   VICVLAVLSTKGSSRFNYIASVIHVIVILFIIIAGFTKADPKNY----SDFTPFGVRGIF  270

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I +  YCL+A++LCL+ P++ 
Sbjct  271   KSSAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMVITTTAYCLLAVALCLMQPFSQ  330

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I ++  FS AF+ +GW WA  +V  GA  G+   LLV+ +GQARYL  + R  ++P WLA
Sbjct  331   IDKDAPFSVAFEAVGWSWAKYIVAAGALKGMTTVLLVSAVGQARYLTHIARTHMMPPWLA  390

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             +VHP TGTP+NATI +    A +A FT+L I+ +++SI TL +F LVA AL+ RRY +  
Sbjct  391   QVHPKTGTPINATIVMLTATAIIAFFTDLGILADLLSISTLFIFMLVALALLVRRYYVSG  450

Query  750   GNPPF---QvllflflvsssslgfslSWKL--NLQW----WNLPLFGFLTLSFTALFHRL  598
                     +++  + L+  SS+  +L W +  +  W      +P++ F T++        
Sbjct  451   ETTTADRNKLIACIALILGSSIASALYWGISDDNDWITYVITVPIWFFATMA----IQIF  506

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R P+ W VPL+PW  + SI +N+FL+ +++  ++ RFGIWT ++ L+Y  +G+H++
Sbjct  507   VPHARNPKLWGVPLVPWLPSASIAINIFLLGSIDGASFIRFGIWTCVLLLYYFFFGLHAS  566

Query  417   YK  412
             Y 
Sbjct  567   YD  568



>ref|XP_009137166.1| PREDICTED: cationic amino acid transporter 1 [Brassica rapa]
Length=595

 Score =   337 bits (864),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 216/541 (40%), Positives = 347/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R +       E++ ++ RSG +MK+ LTW+DL+  GVG ++G G+F
Sbjct  34    YFKALKETPSRFIDRVMTRSDDSAEIHDMKARSGNEMKKTLTWWDLMWFGVGAVIGSGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  +GP+V +S++V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  94    VLTGQQARGESGPAVVLSFVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+R++  Y +  L    P+ +R+    L E Y+ LD  AV +  
Sbjct  154   IAAGNIILEYVVGGAAVARAWASYFATLLNH-KPEDFRIIAHSLNEDYSHLDPIAVGVCA  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS+ N + ++ H+V   F+IIAG  +      +K+    APFGVRGV 
Sbjct  213   IICVLAVVGTKGSSVFNYIASMIHMVVIAFVIIAGLTRAD----LKNYSDFAPFGVRGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               A++++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY+ 
Sbjct  269   KSASVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVTLCLMQPYSQ  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WLA
Sbjct  329   IDPDAPFSVAFSAVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARAHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              V+  TGTP+NAT+ +    A +A FT+L+I+ +++S+ TL +F  VA AL+ R      
Sbjct  389   HVNAKTGTPINATVVMLAATALIAFFTKLEILADLLSVSTLFIFMFVAVALLVRRYYVTG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               +     + L+FL  + +SS+  ++ W +    W      +P++ FL+   T     LV
Sbjct  449   ETSSRDRNKFLMFLGSILASSIATAVYWAMEKDGWIVYAVTVPIW-FLS---TVGMKILV  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++ K++ RFGIWTG++ ++Y ++G+H+TY
Sbjct  505   PQARAPKLWGVPLVPWLPSASIAINIFLLGSIDEKSFVRFGIWTGVLLVYYFLFGLHATY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_011023494.1| PREDICTED: cationic amino acid transporter 1-like [Populus euphratica]
Length=604

 Score =   337 bits (863),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 223/543 (41%), Positives = 345/543 (64%), Gaps = 17/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + Y++++ QTP + + R L       ELN+++ RS  DMK+ LTW+DL+  GVG ++G G
Sbjct  34    TNYVHAIRQTPVRFRDRLLTRSLDSTELNEIKSRSEHDMKKNLTWWDLMWFGVGAVVGAG  93

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  AR   GP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  94    IFVLTGLEARDNTGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  153

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++YV+  AAV+RS+T Y +  L    PD +R+    L + Y  LD  AV +
Sbjct  154   AFIAAGNILLEYVIGGAAVARSWTSYFA-TLCNYQPDDFRIIAHSLPDDYGHLDPIAVVV  212

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
               L+ ++   STK SS  N + +I HV    FIIIAG  K    N         P+ VRG
Sbjct  213   SSLICVLAVLSTKGSSRFNYITSIMHVAVIVFIIIAGLTKADRGNYKP----FMPYDVRG  268

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +  G+A+++F+Y+G+D+VSTMAEE  NP++ +P+G++GS+ IV+  YCL+A +LCL++PY
Sbjct  269   IFVGSAVLFFAYVGFDAVSTMAEETENPARDIPIGLLGSMTIVTVAYCLLAATLCLMVPY  328

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               +  E +FS+AF  +G  WA  +V + A  G+  +LL + +GQARYL  + R  ++P W
Sbjct  329   KQLDGEAAFSSAFDYVGLNWAKYIVALCALAGMTTALLASAVGQARYLTHIARTHMMPPW  388

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
             LA V+  TGTP+NAT+ +    A VA FT+L I+  ++SI TL +F LVA AL+ RRY +
Sbjct  389   LAHVNAKTGTPVNATVIMLGATAIVAFFTKLSILSNLLSISTLFIFTLVAVALLVRRYYV  448

Query  756   INGNPP---FQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                  P    + +L +  +  SS   S+ W L    W      +P++   TL+       
Sbjct  449   TGVTTPVNHIKFILCIATILGSSTATSIIWGLGGDGWVGYVITVPIWFLGTLALKV----  504

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             LVP  R P+ W VPL+PW  + SIF+N+FL+ +++  +++RFG+WT ++ ++Y ++G+H+
Sbjct  505   LVPQARDPKLWGVPLVPWLPSASIFINIFLLGSIDKASFERFGVWTCILLIYYFLFGLHA  564

Query  420   TYK  412
             +Y 
Sbjct  565   SYD  567



>ref|XP_008372219.1| PREDICTED: cationic amino acid transporter 1-like [Malus domestica]
Length=614

 Score =   337 bits (864),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 227/539 (42%), Positives = 343/539 (64%), Gaps = 13/539 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+N+L +TP +   R L+      EL +V+ RS  +MK+KL W+DL+  G+G ++G G+F
Sbjct  36    YVNALKKTPFRFVDRVLSRSADSTELVEVKARSHHEMKKKLNWWDLIWFGIGVVIGAGIF  95

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
               TG  AR+ AG ++ +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  96    ALTGLEARRHAGAAIVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  155

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+S AAV+RS+T Y +      + + +R+   G  E Y  LD  AVA++I
Sbjct  156   IAAGNILLEYVISGAAVARSWTSYFTTLCNRSDTNDFRIIAHGFPEDYKYLDPIAVAVLI  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
              +  +   S K SS LN + +IFH++   FIIIAG  K  + N +      APFG RGV 
Sbjct  216   CICCLAVLSIKGSSRLNYIASIFHIIVIVFIIIAGLTKADTKNYID----FAPFGPRGVF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+V+F+Y+G+D+VSTMAEE  NP+K +P+G+VGS++IV+ LYCL+AL+L L+ PYN 
Sbjct  272   QASAVVFFAYVGFDAVSTMAEETKNPAKDIPIGLVGSMVIVTVLYCLLALTLGLMQPYNQ  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I E+ +F  AF+ +G  WA  +V  GA  G+ ++LL   +GQARYL  + R  +VP W A
Sbjct  332   IDEQAAFPVAFQAVGMGWAKYLVAAGALEGMTSALLGGAVGQARYLTHIARTHMVPPWFA  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr------  769
             +V   TGTP+NAT+ L    A +A FT L ++  ++SI TL +F LVA AL+ R      
Sbjct  392   QVDSKTGTPVNATVTLLAATAVIAFFTSLDVLANLVSISTLFIFSLVAIALLVRRYYVSG  451

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPC  589
                  N N   + +  LF++ SSS+  S+ W     W    +   L    T     LVP 
Sbjct  452   VTTQANRN---KFIACLFIIISSSIATSVYWSRTDDWIAYVVTAPLWFLGTLGIWLLVPQ  508

Query  588   VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              R P+ W VPL+PW  +LSI +N+FL+ +++  ++ RFG+WT ++ ++Y ++G+H++Y 
Sbjct  509   ARSPKLWGVPLVPWLPSLSIAINIFLLGSIDHASFIRFGVWTLIILVYYFIFGLHASYD  567



>ref|XP_008383266.1| PREDICTED: cationic amino acid transporter 5-like [Malus domestica]
Length=590

 Score =   336 bits (862),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 227/543 (42%), Positives = 344/543 (63%), Gaps = 18/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             STY  +LSQT  + K R L+    + E+ ++R +S  DMKR LTW+DL+  G G ++G G
Sbjct  34    STYGAALSQTGHRFKNRLLSRSNDNDEIRELRKQSENDMKRCLTWWDLIWFGFGSVIGAG  93

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG    K AGP++ +SY+ +G+SA+LS  CYTEFSVEVPVAGGAF+YLRI  G+FV
Sbjct  94    IFVLTGQETHKHAGPAIVLSYVASGISAMLSVFCYTEFSVEVPVAGGAFAYLRIELGDFV  153

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +    NIL++ ++ +AAV+R++T Y +  L   + +  R+  + L EG+N+LD  AVA+
Sbjct  154   AFITAGNILLESIVGSAAVARAWTSYFTTLLNRPS-NSLRIHTN-LAEGFNLLDPIAVAV  211

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             + +   +   ST+++S LN + +  + V   F+I+A F      NL        PFG +G
Sbjct  212   LAIAATIAMISTRKTSYLNWIASAVNNVIILFVIVAAFVHAKPSNLKP----FFPFGAKG  267

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V   AAIVYF+Y G+D+++TMAEE  NPS+ +P+G++GS+ I++ +YCLMALSL ++  Y
Sbjct  268   VFQAAAIVYFAYGGFDNIATMAEETKNPSRDIPLGLLGSMTIITVVYCLMALSLPMMQKY  327

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I    ++S AF+ +G  WA  +V  GA  G+   LLV  LGQARY+  + RA ++P W
Sbjct  328   TDIDPNAAYSVAFQSVGMTWAKYLVAFGALKGMTTVLLVGTLGQARYITHIARAHMIPPW  387

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              A VHP TGTP+NAT+ + I    +A F+ L ++  ++S+ TL +F ++A AL+ RRY +
Sbjct  388   FALVHPKTGTPINATVMIAIASGCIAFFSSLDVLASLLSVSTLFIFMMMAVALLVRRYYV  447

Query  756   INGNPP---FQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                 P     +++ FL ++ +SS+G S  W LN   W      +PL+ F TL+       
Sbjct  448   REITPQQHLLKLVSFLVIIIASSMGTSAYWGLNPNGWVGYVVTVPLWFFGTLAMAV----  503

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              +P  R P+ W VPL+PW  +LSI  N+FLM +L  +A++RFGI T +M ++YV +G+H+
Sbjct  504   FLPQQRSPKVWGVPLVPWLPSLSIATNIFLMGSLGPEAFERFGICTVVMLIYYVFFGLHA  563

Query  420   TYK  412
             TY 
Sbjct  564   TYD  566



>ref|XP_004141615.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis sativus]
 gb|KGN52612.1| hypothetical protein Csa_5G647350 [Cucumis sativus]
Length=584

 Score =   335 bits (859),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 227/543 (42%), Positives = 343/543 (63%), Gaps = 22/543 (4%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L  TP +L  R  A      EL +++ RS   MK+ LTW+DL+  GVG ++G G+F
Sbjct  38    YTKALKATPFRLFNRLTARSADHTELVEMKARSQHQMKKTLTWWDLMWFGVGAVIGAGIF  97

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG   +K AGP+V +SYIV+G+SA+LS  CYTEF+VE+P AGG+F+YLR+  G+FV +
Sbjct  98    VLTGLETKKHAGPAVVLSYIVSGISAMLSVFCYTEFAVEIPAAGGSFAYLRVELGDFVAF  157

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++Y++ +AAV+R++T Y +  L   +P+ +RV +    + YN LD  A+ +I+
Sbjct  158   IAAGNILLEYIIGSAAVARAWTSYFA-TLCNHHPNDFRVHISAFPDDYNQLDPIAIVVIL  216

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I    STK SS LN V +I HVV   FIIIAG  + +  N        AP+G RG+ 
Sbjct  217   IIGIFALVSTKGSSRLNYVASILHVVVIVFIIIAGLTQANPKNFTP----FAPYGPRGIF  272

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VST+AEE  NP+K +P+G+VGS++I + LYC++A++LCL+ PY  
Sbjct  273   VASAVLFFAYVGFDAVSTLAEETKNPAKDIPIGLVGSMVITTVLYCILAVTLCLMQPYQQ  332

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF+ +GW WA  +V  GA  G+   LLV  +GQARYL  + R  +V  W A
Sbjct  333   IDADAPFSMAFEAVGWSWAKYIVAAGAIKGMTTVLLVGSVGQARYLTHIARTHMVSPWFA  392

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal------iyr  769
             KVH  TGTP+NAT  + I  A VA FT + I+  ++SI TL +F LVA AL         
Sbjct  393   KVHEKTGTPVNATATMLIATAMVAFFTSMNILSNLLSISTLFIFMLVAIALIIRRYYSSS  452

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW----NLPLFGFLTLSFTALFHR  601
                  N N   ++L+ L L+  SS+  +  W  +  W      LP++ F TL+       
Sbjct  453   ETTTSNRN---KLLICLVLIIGSSMATATYWSTSDNWIGYAVTLPIWFFSTLA----LWL  505

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  ++P+ W VPL+PW  +LSI +N FL+ +++  +++RFGIWTG++ ++Y ++G+H+
Sbjct  506   GVPQAKKPQVWGVPLVPWLPSLSIAINFFLLGSIDRASFERFGIWTGILLIYYFLFGLHA  565

Query  420   TYK  412
             +Y 
Sbjct  566   SYD  568



>ref|XP_004156240.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
1-like [Cucumis sativus]
Length=584

 Score =   335 bits (858),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 227/543 (42%), Positives = 343/543 (63%), Gaps = 22/543 (4%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L  TP +L  R  A      EL +++ RS   MK+ LTW+DL+  GVG ++G G+F
Sbjct  38    YTKALKATPFRLFNRLTARSADHTELVEMKARSQHQMKKTLTWWDLMWFGVGAVIGAGIF  97

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG   +K AGP+V +SYIV+G+SA+LS  CYTEF+VE+P AGG+F+YLR+  G+FV +
Sbjct  98    VLTGLETKKHAGPAVVLSYIVSGISAMLSVFCYTEFAVEIPAAGGSFAYLRVELGDFVAF  157

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++Y++ +AAV+R++T Y +  L   +P+ +RV +    + YN LD  A+ +I+
Sbjct  158   IAAGNILLEYIIGSAAVARAWTSYFA-TLCNHHPNDFRVHISAFPDDYNQLDPIAIVVIL  216

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I    STK SS LN V +I HVV   FIIIAG  + +  N        AP+G RG+ 
Sbjct  217   IIGIFALVSTKGSSRLNYVASILHVVVIVFIIIAGLTQANPKNFTP----FAPYGPRGIF  272

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VST+AEE  NP+K +P+G+VGS++I + LYC++A++LCL+ PY  
Sbjct  273   VASAVLFFAYVGFDAVSTLAEETKNPAKDIPIGLVGSMVITTVLYCILAVTLCLMQPYQQ  332

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF+ +GW WA  +V  GA  G+   LLV  +GQARYL  + R  +V  W A
Sbjct  333   IDADAPFSMAFEAVGWSWAKYIVAAGAIKGMTTVLLVGSVGQARYLTHIARTHMVSPWFA  392

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal------iyr  769
             KVH  TGTP+NAT  + I  A VA FT + I+  ++SI TL +F LVA AL         
Sbjct  393   KVHEKTGTPVNATATMLIATAMVAFFTSMNILSNLLSISTLFIFMLVAIALIIRRYYSSS  452

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW----NLPLFGFLTLSFTALFHR  601
                  N N   ++L+ L L+  SS+  +  W  +  W      LP++ F TL+       
Sbjct  453   ETTTSNRN---KLLICLVLIIGSSMATATYWSTSDNWIGYAVTLPIWFFSTLA----LWL  505

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  ++P+ W VPL+PW  +LSI +N FL+ +++  +++RFGIWTG++ ++Y ++G+H+
Sbjct  506   GVPQAKKPQVWGVPLVPWLPSLSIAINXFLLGSIDRASFERFGIWTGILLIYYFLFGLHA  565

Query  420   TYK  412
             +Y 
Sbjct  566   SYD  568



>gb|EPS73602.1| hypothetical protein M569_01155 [Genlisea aurea]
Length=612

 Score =   335 bits (860),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 229/537 (43%), Positives = 351/537 (65%), Gaps = 10/537 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+ +L +TP +L  R     + ++EL +V+ RS  +MK+ L+W+DL+  G+G ++G G+F
Sbjct  42    YVTALRETPSRLVDRVFTRSSVEEEL-EVKKRSQHEMKKTLSWWDLIWFGMGAVIGAGIF  100

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A  TAGP+V +SY+V+G+SA+LS  CYTEF++E+P+AGG+F+YLR+  G+FV +
Sbjct  101   VLTGQEAHNTAGPAVVLSYVVSGISAMLSVFCYTEFAIEIPIAGGSFAYLRVELGDFVAF  160

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+S AAV+RS+T Y +  L   NP+ +R+   GL +GYN LD  AV ++I
Sbjct  161   IAAGNIILEYVVSGAAVARSWTSYFA-TLCNHNPNDFRIHAHGLADGYNELDPIAVIVLI  219

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I++  STK +S LN + +I H++   FIIIAG  +  + NL        PFGVRG+ 
Sbjct  220   VVCIIIVVSTKGTSRLNYIASIVHMLIIAFIIIAGLLRADTKNLAP----FTPFGVRGIF  275

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+V+TMAEE  NP + +P+G+VGS++I +A+YC++A++LCL+  Y  
Sbjct  276   KASAVLFFAYVGFDAVATMAEETKNPGRDIPIGLVGSMVITTAIYCVLAVTLCLMQSYKT  335

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF+M G  WA  VV  GA  G+ + LLV  +GQARYL  + R  LVP W A
Sbjct  336   IDTDAPFSRAFQMAGMGWAQYVVAAGALKGMSSVLLVNSVGQARYLTHISRTHLVPPWFA  395

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
             KV   TGTP+NA + L    A +A FTEL I+  I+SI TL +F LVA ALI R      
Sbjct  396   KVDAETGTPINAAVVLLAASALIAFFTELDILANILSIATLFIFMLVAIALIVRRYYVSG  455

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNL-PLFGFLTLSFTALFHRLVPCVR  583
               +     ++++FL L+  SS+  S+ W ++   W +  + G +    T      VP  R
Sbjct  456   ETSAENKKKMIVFLILILGSSIVTSVYWGVSENGWVVYCITGPVWFLSTGGLWFFVPQAR  515

Query  582   RPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              P  W+VPL+PW  + S+ +N+FLM +++  +Y RF IWTG++ L+Y V+G+H++Y 
Sbjct  516   TPTIWAVPLVPWMPSASVAINIFLMGSIDKDSYIRFVIWTGILLLYYFVFGLHASYD  572



>ref|XP_006413819.1| hypothetical protein EUTSA_v10024732mg [Eutrema salsugineum]
 gb|ESQ55272.1| hypothetical protein EUTSA_v10024732mg [Eutrema salsugineum]
Length=597

 Score =   335 bits (858),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 220/542 (41%), Positives = 347/542 (64%), Gaps = 17/542 (3%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +YL +L +TP +   R         E+++++ RSG +MK+ LTW+DL+  GVG ++G G+
Sbjct  33    SYLKALKETPSRFMDRVTTRSLDSVEIHEMKARSGNEMKKTLTWWDLMWFGVGAVIGSGI  92

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  AR+ +GP+V +SY+++G+SA+LS  CYTEF+VE+PVAGG+F+Y+R+  G+F+ 
Sbjct  93    FVLTGLEAREHSGPAVVLSYVISGVSAMLSVFCYTEFAVEIPVAGGSFAYMRVELGDFMA  152

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NI+++Y++  AAV+RS+T Y +  L    PD +R+    L E Y+ LD  AV + 
Sbjct  153   FIAAGNIILEYIVGGAAVARSWTSYFATLLNH-KPDDFRIIAHSLSEDYSHLDPIAVGVC  211

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
             + + I+    TK SS+ N + +I H+V   F++IAGF K      +K+    APFG RGV
Sbjct  212   VAICIITVLGTKGSSIFNYIASIVHMVVILFVVIAGFTKAD----IKNYSDFAPFGARGV  267

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
                AA+++F+YIG+D+VSTMAEE  NP K++P+G+VGS+++ +  YCLMA++LCL+ PY 
Sbjct  268   FKSAAVLFFAYIGFDAVSTMAEETKNPGKNIPIGLVGSMVVTTVCYCLMAVALCLMQPYG  327

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WL
Sbjct  328   QIDPDAPFSVAFSAVGWNWAKYLVAFGALKGMTTVLLVGAIGQARYMTHIARAHMMPPWL  387

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---ry  763
             A V+  TGTP+NAT+ +    A +A FT+L I+ +++S+ TL +F LVA AL+ R     
Sbjct  388   AHVNAKTGTPINATVVMLTATAVIAFFTKLGILADLLSVSTLFIFMLVAVALLVRRYYVA  447

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRL  598
                      + L+FL L+ +SS+  ++ W +    W      +P++   TL        L
Sbjct  448   GETTTRDRNKFLVFLGLILASSIATAVYWAVEKDGWIGYCVTVPIWVLSTLG----MKFL  503

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R P+ W VPL+P+  + SI +N+FL+ +++ K++ RF +WTG++ ++Y  +G+H+T
Sbjct  504   VPQARAPKLWGVPLVPFLPSASIAINIFLLGSIDEKSFIRFAMWTGVLLVYYFFFGLHAT  563

Query  417   YK  412
             Y 
Sbjct  564   YD  565



>ref|XP_003559648.1| PREDICTED: cationic amino acid transporter 1-like [Brachypodium 
distachyon]
Length=600

 Score =   335 bits (858),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 220/546 (40%), Positives = 338/546 (62%), Gaps = 23/546 (4%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + Y  +L  T  +L  R  +      EL++VR RSGADMKR LTW+DL   GVG ++G G
Sbjct  35    AAYGRALRSTGPRLADRLTSRSLEATELHEVRARSGADMKRDLTWWDLAWFGVGAVIGAG  94

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  A++  GP+V ISY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  95    IFVLTGQEAKEVVGPAVVISYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  154

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++Y + +AAV+R++T Y +  L    P  +R+    L   Y+ LD  AV +
Sbjct  155   AFVAAGNILLEYCIGSAAVARAWTSYFATLLNH-QPAQFRIHASSLAADYSELDPIAVVV  213

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I L+      STK SS  N V++I H+    FII+AG  K  + N+        P+G RG
Sbjct  214   ITLICAFAVVSTKGSSRFNYVLSIVHIAVILFIIVAGLTKADTANMRD----FMPYGPRG  269

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+YIG+D+VSTMAEE  +P++ +P+G+VGS+ I +ALYC++A+ LCL+ PY
Sbjct  270   IFAASAVLFFAYIGFDAVSTMAEETKDPARDIPIGLVGSMAITTALYCVLAVVLCLMQPY  329

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I ++  FS AF   G  WA  +V  GA  G+   LLV+ +GQARYL  + R  ++P W
Sbjct  330   GDIDKDAPFSVAFAARGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMMPPW  389

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal------i  775
             LA+VHP TGTP+NAT+ +    A +A FT+L I+  ++SI TL +F LVA AL      +
Sbjct  390   LAEVHPRTGTPVNATVVMLFATAVIAFFTDLAILSNLLSISTLFIFMLVAVALLVRRYYV  449

Query  774   yrryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTAL  610
                    N N   +++  +  + +SS+  +  W L+ + W      +P +     + T  
Sbjct  450   AGETTDANRN---KLVACVAAILASSVATATYWGLDAKGWVPYAVTVPAW----FASTVC  502

Query  609   FHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYG  430
                LVP  R P+ W  PL+PW  + SI +N+FL+ +++ K+++RFG+WT  + ++Y+  G
Sbjct  503   LWALVPQARTPKVWGAPLVPWLPSASIAINIFLLGSIDAKSFERFGMWTAALLVYYLFVG  562

Query  429   VHSTYK  412
             +H++Y 
Sbjct  563   LHASYD  568



>ref|XP_004135553.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis sativus]
 gb|KGN65930.1| hypothetical protein Csa_1G538280 [Cucumis sativus]
Length=582

 Score =   334 bits (856),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 227/541 (42%), Positives = 345/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y N+L  TP +L  R  A      EL +++ RS  +MK+ LTW+DL+  GVG ++G G+F
Sbjct  35    YANALKATPFRLMNRLTARSAEQTELVEMKARSEHEMKKNLTWWDLIWFGVGAVIGAGIF  94

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG   RK AGP+V +SY+V+G+SA+LS  CYTEF+VE+P AGG+F+YLR+  G+FV +
Sbjct  95    VLTGLETRKHAGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPAAGGSFAYLRVELGDFVAF  154

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L    P+ +R+ +      YN LD  AV +II
Sbjct  155   IAAGNILLEYVIGGAAVARSWTSYFA-TLCNHRPNDFRIHIPSFAHDYNRLDPIAVVVII  213

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I    STK SS  N + +I HV+   FI+IAG  K +  N        APFG RG+ 
Sbjct  214   VICIFAVMSTKGSSRFNYIASILHVIVILFIVIAGLTKANPKNFTP----FAPFGPRGIF  269

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VST+AEE  NP K +P+G+VGS++I ++ YC++A++LCL+  Y  
Sbjct  270   VASAVLFFAYVGFDAVSTLAEETKNPGKDIPIGLVGSMVITTSAYCILAVTLCLMQSYQQ  329

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I E+  FS AF+ +GW WA  +V  GA  G+   LLV+ +GQARYL  + R  +V  W A
Sbjct  330   IDEDAPFSVAFEAVGWSWAKYIVAAGAIKGMTTVLLVSAVGQARYLTHIARTHMVSPWFA  389

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KV+  TGTP+NAT  +    A +A FT L+I+  ++SI TL +F LVA  LI RRY +  
Sbjct  390   KVNERTGTPVNATTSMMAATAVIAFFTTLEILSNLLSISTLFIFMLVAVGLIVRRYYVSG  449

Query  750   GNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
                P    ++++ L L+  SS+G +  W  +   W      LP++   TL+        V
Sbjct  450   ETTPLNRNKLIICLILIVGSSIGTAAYWASSDDGWIGFAVTLPIWFLSTLA----LWLGV  505

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  ++P  W VPL+PW  +LSI +N+FL+ +++  +++RFGIWTG++ ++Y+++G+H++Y
Sbjct  506   PQAKKPRVWGVPLVPWLPSLSIAINIFLLGSIDKASFERFGIWTGVLLVYYLLFGLHASY  565

Query  414   K  412
              
Sbjct  566   D  566



>ref|XP_004293998.1| PREDICTED: cationic amino acid transporter 1-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=612

 Score =   335 bits (858),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 224/548 (41%), Positives = 345/548 (63%), Gaps = 22/548 (4%)
 Frame = -2

Query  2025  EIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggml  1846
             E +  Y+N+L  TP + K R L       EL +++ RS  +MK+ L W+DL+  G+G ++
Sbjct  36    ESWGNYVNALRSTPARFKDRFLTRSADSTELVEMKARSQHEMKKTLNWWDLIWFGIGAVI  95

Query  1845  gvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFG  1666
             G G+FV TG  A+  AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G
Sbjct  96    GAGIFVLTGIEAKNHAGPAVVMSYVVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELG  155

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             +FV Y A  NIL++YV+  AAV+RS+T Y +  L   N + +R+ VDG  E Y  LD  A
Sbjct  156   DFVAYIAAGNILLEYVIGGAAVARSWTSYFT-TLCNRNSNDFRITVDGWSENYKYLDPIA  214

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             + +II + I+   STK SS LN + +I HV+   FIIIAG  K  ++N        AP G
Sbjct  215   IGVIICICILAVMSTKGSSRLNYIASIVHVIVILFIIIAGLTKADTNNYKD----FAPHG  270

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
              RG+   +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I + +YCL+A++LCL+
Sbjct  271   ARGIFQASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMVITTTVYCLLAVTLCLM  330

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             +PY +I E+  FS AF+ +G  WA  VV  GA  G+ + LLV  +GQARYL  + R  ++
Sbjct  331   VPYGMIDEQAPFSKAFETVGMSWAKYVVAAGALKGMTSVLLVGAVGQARYLTHIARTHML  390

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal----  778
             P W A+V   TGTP++ATI +    A +A FT L ++  ++SI TL +F LVA AL    
Sbjct  391   PPWFAQVDAKTGTPVHATIVMLAATAVIAFFTSLDVLANLLSISTLFIFSLVATALLVRR  450

Query  777   --iyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQW----WNLPLFGFLTLSFT  616
               +       N N   ++++ + ++   ++  S  W ++  W       P++   TL   
Sbjct  451   YYVTGVTTDANRN---KLIVCISMIYGGAIATSAYWGVSDDWVGYCATAPIWFLGTLG--  505

Query  615   ALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
                  LVP  R P+ W VPL+PW  ALSI +N+FL+ +++  ++ RF  WT ++ ++Y+ 
Sbjct  506   --IWFLVPQARSPKLWGVPLVPWLPALSIGINIFLLGSIDGDSFIRFAAWTVIILVYYIF  563

Query  435   YGVHSTYK  412
             +G+H++Y 
Sbjct  564   FGLHASYD  571



>ref|XP_008225625.1| PREDICTED: cationic amino acid transporter 1-like [Prunus mume]
Length=597

 Score =   334 bits (856),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 218/536 (41%), Positives = 333/536 (62%), Gaps = 7/536 (1%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+++L+ T  +L  R LA     QEL ++R RS   MK+ L W+DL+  G+G ++G G+F
Sbjct  40    YVHALANTKTRLTDRILARSMDHQELEQMRARSHNQMKKTLNWWDLIWFGIGAVMGAGIF  99

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR  AGP+V ISY ++G+S LLS LCYTEFSVE+PVAGG+FSYLR+  G+FV Y
Sbjct  100   VLTGQAARNDAGPAVVISYFISGVSELLSVLCYTEFSVELPVAGGSFSYLRVELGDFVAY  159

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL +YV++ A+V+RS+T Y +  L   NP+ +R+ V  L + +N LD  AV + I
Sbjct  160   IAAGNILFEYVVAGASVARSWTSYFA-TLCNHNPNDFRINVPALADNFNHLDPIAVVISI  218

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             L+ I    S K SS  N V TI H+V   FI I G  K +  N   +     PFG RGVL
Sbjct  219   LVCIGAALSMKASSRFNSVTTIVHLVVLVFIFITGMTKANPANFTTN---FLPFGFRGVL  275

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+YIG+D V+T+ EEI NP + +P+G++GS+L+    YC+++ +LCL+ PY+ 
Sbjct  276   KASAVLFFAYIGFDGVATLGEEIKNPGRDIPIGLIGSMLVTITTYCVLSATLCLMQPYSQ  335

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  + SF+ AF+  G  WA  +V +GA  G+   LL  ++ QARY   +GR  + P  LA
Sbjct  336   IDADASFTMAFQAAGMNWAKYIVALGAIKGMTTVLLANLIAQARYFTHIGRTHMAPPILA  395

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              +HP TGTP+NAT+ + +  + VALFT L ++  ++SI TL +F LV+ ALI R      
Sbjct  396   SIHPKTGTPVNATVIMTVANSLVALFTSLDVLANLLSISTLFIFSLVSLALIVRRYYVTG  455

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVRR  580
               + +   +++ FL L+  SS+  ++ W L+  W    + G L  + +      +   ++
Sbjct  456   ETSTSDRNKLIGFLTLIVGSSIATAVYWVLSQGWIGYVVTGVLWFAASLGLQLTLKQAKK  515

Query  579   PESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             P+ W VPL+PW  + SI  NVF++ +++V ++ RF IWT  + ++Y+   +H++Y 
Sbjct  516   PKLWGVPLVPWLPSASIAFNVFILGSIDVPSFIRFAIWTLALLVYYIFVALHASYD  571



>ref|XP_009419637.1| PREDICTED: cationic amino acid transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=577

 Score =   333 bits (855),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 220/542 (41%), Positives = 343/542 (63%), Gaps = 9/542 (2%)
 Frame = -2

Query  2025  EIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggml  1846
             + ++ Y  +L +T  +LK R  +    + EL +++ RSG +MK+ L+W+DL+  G+G ++
Sbjct  31    QSWANYTKALKETGTRLKDRITSRSLDNLELTEIKGRSGFEMKKTLSWWDLIWFGIGAVI  90

Query  1845  gvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFG  1666
             G G+FV TG  AR +AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G
Sbjct  91    GAGIFVLTGQEARDSAGPAVILSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELG  150

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             +F+ + A  NIL++YV+  AAV+RS+T Y +  L   + D +R+    L   Y+ LD  A
Sbjct  151   DFIAFIAAGNILLEYVIGGAAVARSWTSYFATLLNHHSND-FRIHATSLNPDYSRLDPIA  209

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             V +I L+ +    STK +S  N V +I H+    FIIIAG  + +  NL        PFG
Sbjct  210   VVVIALVCLAAVSSTKATSRFNYVASIIHLAIIVFIIIAGLTQANPKNL----SDFTPFG  265

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
             VRG+   +A+++F+Y+G+D+VSTMAEE  NP+K +P+G+VG++ I +  YCL+AL+LCL+
Sbjct  266   VRGIFSASAVLFFAYVGFDAVSTMAEETKNPAKDIPLGLVGAMTITTGCYCLLALTLCLM  325

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
              PY+ I  +  FS AF+ +G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +V
Sbjct  326   QPYSQIDPDAPFSVAFQAIGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMV  385

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr-  769
             P WLA+VH +TGTP+NAT+ + +  A +A FT L I+  ++SI TL +F +VA AL+ R 
Sbjct  386   PPWLAEVHATTGTPVNATVVMLVATAVIAFFTNLGILSNLLSISTLFIFMMVAVALLVRR  445

Query  768   --ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRL-  598
                      +   +++  L L+ +SS+  +  W      W   L   L      +F    
Sbjct  446   YYVSGETTDSDRNKLIAALVLILASSIATAAYWAAGGMGWVGYLVSVLVWFLATVFLWWG  505

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R P++W VPL+PW  + SI +N+FL+ +++  ++ RFGIWT L+ ++Y  +G+H++
Sbjct  506   VPQARAPQTWGVPLVPWLPSASIAINIFLLGSIDGPSFVRFGIWTALLLVYYFFFGLHAS  565

Query  417   YK  412
             Y 
Sbjct  566   YD  567



>ref|XP_008225925.1| PREDICTED: cationic amino acid transporter 5-like [Prunus mume]
Length=590

 Score =   333 bits (855),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 228/543 (42%), Positives = 347/543 (64%), Gaps = 18/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             STY  +LSQT  + K R ++    + E+ ++  RS  DMKR LTW+DL+  G G ++G G
Sbjct  34    STYRTALSQTGYRFKNRLISRSDDNNEIGELPKRSENDMKRCLTWWDLIWFGFGSVIGAG  93

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG      AGP++ +SY+ +G+SA+LS  CYTEFSVEVPVAGGAF+YLRI  G+F+
Sbjct  94    IFVLTGQETHDHAGPAIVLSYVASGVSAMLSVFCYTEFSVEVPVAGGAFAYLRIELGDFI  153

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              +    NIL++  + +AAV+RS+T Y +  L   + +  R+  + L EGYN+LD  AVA+
Sbjct  154   AFITAGNILLEGFVGSAAVARSWTSYFTSLLNRPS-NSLRIHTN-LTEGYNLLDPIAVAV  211

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             + +   +   ST+++S LN + +I + V   F+IIA F   +  N+        PFG +G
Sbjct  212   LTIAATIAMISTRKTSYLNWIASIVNNVVILFVIIAAFIHANPSNMKP----FFPFGAKG  267

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V   AAIVYF+Y G+D+++TMAEE  NPS+ +P+G++GS+ I++ +YCLMA+SL ++  Y
Sbjct  268   VFQAAAIVYFAYGGFDNIATMAEETKNPSRDIPIGLIGSMSIITVVYCLMAVSLPMMQKY  327

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I    ++S AF+ +G  WA  +V +GA  G+   LLV  LGQARY+  + RA ++P W
Sbjct  328   TDIDTNAAYSVAFQSVGMTWAKYLVALGALKGMTTVLLVGTLGQARYITHIARAHMIPPW  387

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              A VHP TGTP+NAT+ + I    +ALF+ L ++  ++S+ TL +F ++A AL+ RRY +
Sbjct  388   FALVHPKTGTPINATLLIVIPSGCIALFSSLNVLAGLLSVSTLFIFMMMAVALLVRRYYV  447

Query  756   INGNPP---FQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHR  601
                 P     ++++FL ++ +SS+G S  W LN   W      +PL+ F TL+       
Sbjct  448   REITPQQHLLKLVIFLLIIIASSIGTSAYWGLNPNGWVGYVVTVPLWFFGTLAMAV----  503

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             L+P  R P+ W VPL+PW  +LSI  N+FLM +L  +A++RFGI T +M ++YV +G+H+
Sbjct  504   LLPQQRSPKVWGVPLVPWLPSLSIATNIFLMGSLGHQAFERFGICTVVMLIYYVFFGLHA  563

Query  420   TYK  412
             TY 
Sbjct  564   TYD  566



>ref|XP_004293997.1| PREDICTED: cationic amino acid transporter 1-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=636

 Score =   334 bits (857),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 224/548 (41%), Positives = 345/548 (63%), Gaps = 22/548 (4%)
 Frame = -2

Query  2025  EIFSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggml  1846
             E +  Y+N+L  TP + K R L       EL +++ RS  +MK+ L W+DL+  G+G ++
Sbjct  60    ESWGNYVNALRSTPARFKDRFLTRSADSTELVEMKARSQHEMKKTLNWWDLIWFGIGAVI  119

Query  1845  gvgvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFG  1666
             G G+FV TG  A+  AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G
Sbjct  120   GAGIFVLTGIEAKNHAGPAVVMSYVVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELG  179

Query  1665  EFVGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPa  1486
             +FV Y A  NIL++YV+  AAV+RS+T Y +  L   N + +R+ VDG  E Y  LD  A
Sbjct  180   DFVAYIAAGNILLEYVIGGAAVARSWTSYFT-TLCNRNSNDFRITVDGWSENYKYLDPIA  238

Query  1485  valiilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFG  1306
             + +II + I+   STK SS LN + +I HV+   FIIIAG  K  ++N        AP G
Sbjct  239   IGVIICICILAVMSTKGSSRLNYIASIVHVIVILFIIIAGLTKADTNNYKD----FAPHG  294

Query  1305  VRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcll  1126
              RG+   +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I + +YCL+A++LCL+
Sbjct  295   ARGIFQASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMVITTTVYCLLAVTLCLM  354

Query  1125  LPYNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLV  946
             +PY +I E+  FS AF+ +G  WA  VV  GA  G+ + LLV  +GQARYL  + R  ++
Sbjct  355   VPYGMIDEQAPFSKAFETVGMSWAKYVVAAGALKGMTSVLLVGAVGQARYLTHIARTHML  414

Query  945   PSWLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal----  778
             P W A+V   TGTP++ATI +    A +A FT L ++  ++SI TL +F LVA AL    
Sbjct  415   PPWFAQVDAKTGTPVHATIVMLAATAVIAFFTSLDVLANLLSISTLFIFSLVATALLVRR  474

Query  777   --iyrryaiINGNPPFQvllflflvsssslgfslSWKLNLQW----WNLPLFGFLTLSFT  616
               +       N N   ++++ + ++   ++  S  W ++  W       P++   TL   
Sbjct  475   YYVTGVTTDANRN---KLIVCISMIYGGAIATSAYWGVSDDWVGYCATAPIWFLGTLG--  529

Query  615   ALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
                  LVP  R P+ W VPL+PW  ALSI +N+FL+ +++  ++ RF  WT ++ ++Y+ 
Sbjct  530   --IWFLVPQARSPKLWGVPLVPWLPALSIGINIFLLGSIDGDSFIRFAAWTVIILVYYIF  587

Query  435   YGVHSTYK  412
             +G+H++Y 
Sbjct  588   FGLHASYD  595



>emb|CAA17531.1| amino acid transport protein AAT1 [Arabidopsis thaliana]
 emb|CAB79112.1| amino acid transport protein AAT1 [Arabidopsis thaliana]
Length=533

 Score =   331 bits (848),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 219/513 (43%), Positives = 337/513 (66%), Gaps = 17/513 (3%)
 Frame = -2

Query  1926  VRLRSGADMKRKLTWYDlvalgvggmlgvgvfVTTGPVARKTAGPSVFISYIVAGLSALL  1747
             ++ RSG +MK+ LTW+DL+  G+G ++G G+FV TG  AR  +GP+V +SY+V+G+SA+L
Sbjct  1     MKARSGHEMKKTLTWWDLMWFGIGAVIGSGIFVLTGLEARNHSGPAVVLSYVVSGVSAML  60

Query  1746  SSLCYTEFSVEVPVAGGAFSYLRITFGEFVGYFAGANILMDYVLSNAAVSRSFTEYLSYA  1567
             S  CYTEF+VE+PVAGG+F+YLR+  G+F+ + A  NI+++YV+  AAV+RS+T Y +  
Sbjct  61    SVFCYTEFAVEIPVAGGSFAYLRVELGDFMAFIAAGNIILEYVVGGAAVARSWTSYFATL  120

Query  1566  LGEGNPDCWRVKVDGLMEGYNMLDFPavaliilltivLCHSTKESSLLNLVMTifhvvff  1387
             L    P+ +R+ V  L E Y+ LD  AV +  ++ ++    TK SS  N + +I H+V  
Sbjct  121   LNH-KPEDFRIIVHKLGEDYSHLDPIAVGVCAIICVLAVVGTKGSSRFNYIASIIHMVVI  179

Query  1386  gfiiiagFYKGSSDNLVKSGGGLAPFGVRGVLDGAAIVYFSYIGYDSVSTMAEEITNPSK  1207
              F+IIAGF K      VK+     P+GVRGV   AA+++F+YIG+D+VSTMAEE  NP +
Sbjct  180   LFVIIAGFTKAD----VKNYSDFTPYGVRGVFKSAAVLFFAYIGFDAVSTMAEETKNPGR  235

Query  1206  SLPVGIVGSVLIVsalyclmalslcllLPYNLIPEEGSFSAAFKMMGWKWASNVVGVGAS  1027
              +P+G+VGS+++ +  YCLMA++LCL+ PY  I  +  FS AF  +GW WA  +V  GA 
Sbjct  236   DIPIGLVGSMVVTTVCYCLMAVTLCLMQPYQQIDPDAPFSVAFSAVGWDWAKYIVAFGAL  295

Query  1026  LGIVASLLVAMLGQARYLCVVGRARLVPSWLAKVHPSTGTPLNATIFLGICQASVALFTE  847
              G+   LLV  +GQARY+  + RA ++P WLA+V+  TGTP+NAT+ +    A +A FT+
Sbjct  296   KGMTTVLLVGAIGQARYMTHIARAHMMPPWLAQVNAKTGTPINATVVMLAATALIAFFTK  355

Query  846   LKIVIEIISIGTLVVFylvaaaliyr---ryaiINGNPPFQvllflflvsssslgfslSW  676
             LKI+ +++S+ TL +F  VA AL+ R        +     + L+FL L+ +SS   ++ W
Sbjct  356   LKILADLLSVSTLFIFMFVAVALLVRRYYVTGETSTRDRNKFLVFLGLILASSTATAVYW  415

Query  675   KLNLQWW-----NLPLFGFLTLSFTALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFL  511
              L  + W      +P++ FL+   T     LVP  R P+ W VPL+PW  + SI +N+FL
Sbjct  416   ALEEEGWIGYCITVPIW-FLS---TVAMKFLVPQARAPKIWGVPLVPWLPSASIAINIFL  471

Query  510   MTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             + +++ K++ RF IWTG++ ++YV++G+H+TY 
Sbjct  472   LGSIDTKSFVRFAIWTGILLIYYVLFGLHATYD  504



>ref|XP_002443551.1| hypothetical protein SORBIDRAFT_08g021380 [Sorghum bicolor]
 gb|EES17389.1| hypothetical protein SORBIDRAFT_08g021380 [Sorghum bicolor]
Length=598

 Score =   332 bits (852),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 223/542 (41%), Positives = 336/542 (62%), Gaps = 11/542 (2%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y  +L +T  +L+ R  A      E+N+VR RSGADM+R LTW+DL+  G+G ++G G
Sbjct  32    SAYGRALLETGPRLRDRLTARSLDATEVNEVRGRSGADMRRNLTWWDLIWFGIGAVIGAG  91

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  A++ AGP+V +SY ++G+SA+L+  CYTEF++E+PVAGG+F+YLR+  G+F+
Sbjct  92    IFVLTGQEAKEAAGPAVVVSYAISGVSAMLAVFCYTEFAIEIPVAGGSFAYLRVELGDFM  151

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NI+++Y +  AAV+RS+T Y +  L   +PD +RV    L EGY+ LD  AVA+
Sbjct  152   AFIAAGNIILEYCIGGAAVARSWTSYFATLLNH-HPDDFRVHAAALAEGYSELDPIAVAV  210

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
                +  +   STK SS  N V++I H+V   FI++ G  K ++ NL       APFG RG
Sbjct  211   TAAICALAVLSTKGSSRFNYVLSILHLVVIAFIVVVGLTKANAANLTAD---FAPFGARG  267

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+YIG+D+VSTMAEE  NP++ +PVG+VG++ + +A+YCL+AL LCL+ PY
Sbjct  268   IFAASAVLFFAYIGFDAVSTMAEETKNPARDIPVGLVGAMTLTTAVYCLLALVLCLMQPY  327

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I     FS AF  +G  WA  +V  GA  G+   LLV  +GQARYL  + R  +VP  
Sbjct  328   TEIDANAPFSVAFTAVGMDWAKYIVAFGALKGMTTVLLVGAVGQARYLTHIARTHMVPPC  387

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---r  766
             LA+VHP  GTP+ ATI + +  A +ALFT L I+  ++SI TL +F LVA AL+ R    
Sbjct  388   LAQVHPRFGTPVYATIVMMVATAVIALFTNLGILSNLLSISTLFIFTLVAMALLVRRYYV  447

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKLNLQ----WWNLPLFGFLTLSFTALFHRL  598
                   +   +++  L ++ +SS   +  W +       W    +     L+ TA     
Sbjct  448   AGETTASDRNKLVACLAVIVASSTATAACWGVTSSGGGGWVAYVVTVAAWLAATAYLQWG  507

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R P+ W VPL+PW  + SIF+N+FL+ +++  ++ RF IWT  +  +Y   G+H++
Sbjct  508   VPKARAPKMWGVPLVPWLPSASIFINIFLLGSIDGASFMRFLIWTAALLAYYFFVGLHAS  567

Query  417   YK  412
             Y 
Sbjct  568   YD  569



>ref|XP_009344397.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
Length=614

 Score =   333 bits (853),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 227/539 (42%), Positives = 342/539 (63%), Gaps = 13/539 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+N+L QTP +   R L       EL +++ RS ++MK+ L W+DL+  G+G ++G G+F
Sbjct  36    YVNALRQTPGRFMDRVLTRSADSTELVEMKARSHSEMKKTLNWWDLIWFGLGAVIGAGIF  95

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A+  AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  96    VLTGLEAKNHAGPAVVLSYVVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  155

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +      + + +R+    L E Y  LD  AV +II
Sbjct  156   IAAGNILLEYVIGGAAVARSWTSYFTTLCNRSDTNDFRIVAHDLPEDYRFLDPIAVVVII  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
              +  +   STK SS LN + +I HV+   FIIIAG  K  + N V      APFG RGV 
Sbjct  216   GICCLAVLSTKGSSRLNYIASIVHVIVIVFIIIAGLTKADTKNYVD----FAPFGPRGVF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I + +YCL+A++LCL+ PY+ 
Sbjct  272   QASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMVITTVVYCLLAVTLCLMQPYSS  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I E+  FS AF+ +G  WA  VV  GA  G+ + LLV  +GQARYL  + R  +VP W A
Sbjct  332   IDEQAPFSVAFEAVGMGWAKYVVAAGALKGMTSVLLVGAVGQARYLTHIARTHMVPPWFA  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr------  769
             +V   TGTP+NAT+ +    A +A FT L ++  ++SI TL +F LVA AL+ R      
Sbjct  392   QVDSKTGTPVNATVTMLAATAVIAFFTSLDVLANLLSISTLFIFSLVAMALLVRRYYVSG  451

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPC  589
                  N N   + +  LF++ SSS+  S+ W    +W    +   L    T     LVP 
Sbjct  452   VTTQANRN---KFIACLFIIISSSIATSIYWSRTDKWTAYVVTAPLWFLGTLGIWLLVPQ  508

Query  588   VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              R P+ W VPL+PW  +LSI +N+FL+ +++  ++ RFG+WT ++ ++Y ++G+H++Y 
Sbjct  509   ARNPKLWGVPLVPWLPSLSIAINIFLLGSIDHASFIRFGVWTLIILVYYFIFGLHASYD  567



>ref|XP_004233142.1| PREDICTED: cationic amino acid transporter 1-like [Solanum lycopersicum]
Length=604

 Score =   332 bits (852),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 226/542 (42%), Positives = 343/542 (63%), Gaps = 20/542 (4%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y N+L QTP +L +RAL     + EL + + RS  +MK+ LTW+DL+  G+G ++G G+F
Sbjct  38    YTNALRQTPTRLIERALTRSNDEAEL-EAKSRSHHEMKKTLTWWDLIWFGMGAVIGAGIF  96

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A + AGP+V +SY V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  97    VLTGLEASQDAGPAVVLSYAVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  156

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L    P+ + +   GL +GYN LD  AVA+  
Sbjct  157   IAAGNILLEYVIGGAAVARSWTSYFATLL-NFKPEKFLITAHGLAKGYNQLDPIAVAVCF  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I+   STK SS LN V +I H+V   FIII G  K  + N         PFGVRG+ 
Sbjct  216   IICIIAIRSTKGSSRLNYVASIIHIVVIVFIIICGLIKADTKNYTP----FTPFGVRGIF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  +P++ +P+G+VGS++I + +YCL+A++LCL+ PY  
Sbjct  272   KASAVLFFAYVGFDAVSTMAEETKDPARDIPIGLVGSMVITTTVYCLLAITLCLMQPYQS  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I     FS AFK +GW WA  +V  GA  G+ + LLV  +GQARYL  + R  ++P W +
Sbjct  332   IDPNAPFSVAFKAVGWSWAQYIVAAGALKGMTSVLLVGAVGQARYLTHIARTHMMPPWFS  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy----rry  763
              V   TGTP+NAT  +    A +A FT+L+I+  ++SI TL +F LVA AL+        
Sbjct  392   YVDEKTGTPVNATAVMMSATAIIAFFTKLEILSNLLSISTLFIFMLVALALLVRRYYVSG  451

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRL  598
                N N   ++++ + L+  SS+  +  W L+ + W      +P++    +S TA     
Sbjct  452   VTTNANRN-KLIICILLILGSSIATAAYWGLSEKGWIGYCFTVPIW----VSATAGICIF  506

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             +P  R P+ W VPL+PW  +LSI +N+FL+ +++  ++ RF  WTG +  +Y  +G+H++
Sbjct  507   IPQARNPKLWGVPLVPWLPSLSIAINIFLLGSIDKDSFIRFAGWTGFLLAYYFFFGLHAS  566

Query  417   YK  412
             Y 
Sbjct  567   YD  568



>ref|XP_002318265.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
 gb|EEE96485.2| cationic amino acid transporter 1 family protein [Populus trichocarpa]
Length=606

 Score =   332 bits (852),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 222/543 (41%), Positives = 341/543 (63%), Gaps = 18/543 (3%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              YL +L +TP + K R L       EL++++ RS  +MK+ LTW+DL+  G+G ++G G+
Sbjct  45    NYLQALKETPMRFKDRLLTRSLDSTELHEIKSRSDHEMKKNLTWWDLIWFGIGAVIGAGI  104

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  A++ AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ 
Sbjct  105   FVLTGLEAKEHAGPAVVLSYVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMA  164

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NI+++YV+  AAV+RS+T Y +  L    PD +R+    L E Y  LD  +V + 
Sbjct  165   FIAAGNIILEYVIGGAAVARSWTSYFA-TLCNHKPDDFRIIAHSLPEDYGHLDPISVFVC  223

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
               + ++   STK SS  N V +I HVV   FII+AG  K  + N        +P G RG+
Sbjct  224   AAICVLAVLSTKGSSRFNYVASIIHVVVILFIIVAGLAKADTKNYAD----FSPNGARGI  279

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
                +A+++F+YIG+D+V+TMAEE  NP++ +P+G+VGS+ I +  YCLMA++LCL++PY 
Sbjct  280   FVASAVLFFAYIGFDAVATMAEETRNPARDIPIGLVGSMSITTIAYCLMAVTLCLMVPYK  339

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I E+  FS AF+ +GW WA  VV  GA  G+   LLV+ +GQARYL  + R  ++P WL
Sbjct  340   KIDEDAPFSVAFETVGWGWAKYVVAAGALKGMTTVLLVSAVGQARYLTHIARTHMMPPWL  399

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---ry  763
             A V+  TGTP+NATI +    A V  FT+L I+  ++SI TL +F LVA AL+ R     
Sbjct  400   AHVNERTGTPVNATIVMLAATAIVGFFTKLDILSNLLSISTLFIFMLVALALLVRRYYVS  459

Query  762   aiINGNPPFQvllflflvsssslgfslSW-KLNLQWW-----NLPLFGFLTLSFTALFHR  601
              I       ++++ +  +  SS+  ++ W   +   W      +PL+   TL+       
Sbjct  460   GITTQENRVKLIMCIVAILGSSIATAVFWGTADEDSWLGYVITIPLWFCATLA----LKL  515

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
             LVP  R P+ W VPL+PW  + SI +N+FL+ +++ K++ RF  WTG + ++Y ++G+H+
Sbjct  516   LVPQARDPKLWGVPLVPWLPSASILINIFLLGSIDKKSFIRFAAWTGFLLVYYFLFGLHA  575

Query  420   TYK  412
             +Y 
Sbjct  576   SYD  578



>ref|XP_010051967.1| PREDICTED: cationic amino acid transporter 1-like [Eucalyptus 
grandis]
 gb|KCW75803.1| hypothetical protein EUGRSUZ_D00192 [Eucalyptus grandis]
Length=610

 Score =   332 bits (852),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 214/541 (40%), Positives = 343/541 (63%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +L+ R L       EL++VR RS  +MKR L W+DL+  G+G ++G G+F
Sbjct  37    YWGALKETPARLRDRLLTRSLETTELHEVRARSQHEMKRTLMWWDLIWFGIGAVIGAGIF  96

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG   ++ AGP++ +S++V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  97    VLTGLQTKEHAGPAIVLSFVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  156

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++Y++  AAV+RS+T Y +  L    P+ + +K  GL +GYN LD  AV +  
Sbjct  157   VAAGNIILEYLIGGAAVARSWTSYFATLLNH-KPEDFLIKAHGLADGYNELDPIAVCICG  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ +    STK SS LN + +I H++   FII+AG  K  + N         PF  RG+ 
Sbjct  216   IVCVFAVLSTKGSSRLNYIASIVHILVIVFIIVAGLTKADTANYTP----FTPFNSRGIF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP++ +P+G++GS+++ S  YC M ++LCL+ PY  
Sbjct  272   KASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLIGSMVMTSIAYCSMVITLCLMQPYYQ  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I     FS AFK +G  WA  +V  GA  G+  +LL   +G ARY+  + R  ++P W A
Sbjct  332   IDTHAPFSVAFKAVGMDWAKYIVAFGALEGMTTALLTGAVGLARYVTHIARTHMMPPWFA  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KV+  TGTP+NAT+ +    A +A FT++ I+ +++SI TL +F LVA AL+ RRY +  
Sbjct  392   KVNEKTGTPVNATVVMLSATAVIAFFTKMDILADLLSISTLFIFMLVAVALLVRRYYVNG  451

Query  750   GNPPF---QvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
                P    ++++ L L+  SS+  +  W L+   W      +P++   T++       LV
Sbjct  452   VTKPADRNKLIVCLSLMVGSSIATATYWGLSEHGWVGYVITVPIWFLATVALRV----LV  507

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R+P+ W VPL+PW  + SI +N+FL+ ++N  +++RFG+WTG + L+Y  +G+H++Y
Sbjct  508   PQARKPKLWGVPLVPWLPSASIAINIFLLGSINRASFERFGLWTGFLLLYYYFFGLHASY  567

Query  414   K  412
              
Sbjct  568   D  568



>emb|CDX94024.1| BnaC07g36580D [Brassica napus]
Length=594

 Score =   331 bits (848),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 215/540 (40%), Positives = 343/540 (64%), Gaps = 15/540 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R +       E++ ++ RSG +MK+ LTW+DL+  GVG ++G G+F
Sbjct  34    YFKALKETPSRFIDRVMTRSDDSAEIHDMKARSGNEMKKTLTWWDLMWFGVGAVIGSGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ +GP+V +S++V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  94    VLTGQEARERSGPAVVLSFVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI+++YV+  AAV+RS+T Y +  L    P+ +R+    L E Y+ LD  AV +  
Sbjct  154   IAAGNIILEYVVGGAAVARSWTSYFATLLNH-KPEDFRIIAHSLNEDYSHLDPIAVGVCA  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++     K SS+ N + ++ H+V   F+IIAG  +      +K+    APFG RGV 
Sbjct  213   IICVLAVVGIKGSSVFNYIASMIHMVVIAFVIIAGLTRAD----LKNYSDFAPFGPRGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               A++++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA++LCL+ PY  
Sbjct  269   KSASVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVVTTVCYCLMAVTLCLMQPYGQ  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WLA
Sbjct  329   IDPDAPFSVAFSAVGWDWAKYIVAFGALKGMTTVLLVGAIGQARYMTHIARAHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              V+  TGTP+NAT+ +    A +A FT+L I+ +++S+ TL +F  VA AL+ R      
Sbjct  389   HVNAKTGTPINATVVMLAATALIAFFTKLAILADLLSVSTLFIFMFVAVALLVRRYYVTG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSF----TALFHRLVP  592
               +     + L+FL L+ +SS+  ++ W +    W   +   +T+S     T     LVP
Sbjct  449   ETSSRDRNKFLMFLGLILASSIATAVYWAMEKDGW---IVYAVTVSIWFLSTVGMKFLVP  505

Query  591   CVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
               R P+ W VPL+PW  + SI +N+FL+ +++ K++ RFGIWT ++ ++Y ++G+H+TY 
Sbjct  506   QARAPKLWGVPLVPWLPSASIAINIFLLGSIDEKSFVRFGIWTAVLLVYYFLFGLHATYD  565



>ref|XP_006352988.1| PREDICTED: cationic amino acid transporter 1-like [Solanum tuberosum]
Length=607

 Score =   331 bits (849),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 228/544 (42%), Positives = 342/544 (63%), Gaps = 24/544 (4%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y N+L QTP +L +RAL   + + EL + + RS  +MK+ LTW+DL+  G+G ++G G+F
Sbjct  38    YANALRQTPTRLIERALTRSSDEAEL-EAKSRSHHEMKKTLTWWDLIWFGMGAVIGAGIF  96

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A + AGP+V +SY V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  97    VLTGLEASQDAGPAVVLSYAVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  156

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +  L     D + +   GL +GYN LD  AVA+  
Sbjct  157   IAAGNILLEYVIGGAAVARSWTSYFATLL-NFKSDKFLITAHGLAKGYNQLDPIAVAVCF  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I+   STK SS LN V +I H+V   FIII G  K  + N         PFG RG+ 
Sbjct  216   IICIIAIRSTKGSSRLNYVASIIHIVVIVFIIICGLIKADTKNYTP----FTPFGARGIF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  +P++ +P+G+VGS++I + +YCL+A++LCL+ PY  
Sbjct  272   KASAVLFFAYVGFDAVSTMAEETKDPARDIPIGLVGSMVITTTVYCLLAITLCLMQPYQS  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I     FS AFK +GW WA  +V  GA  G+ + LLV  +GQARYL  + R  ++P W +
Sbjct  332   IDPHAPFSVAFKAVGWSWAQYIVAAGALKGMTSVLLVGAVGQARYLTHIARTHMMPPWFS  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr------  769
              V   TGTP+NAT  +    A +A FT+L+I+  ++SI TL +F LVA AL+ R      
Sbjct  392   YVDEKTGTPVNATAVMMSATAIIAFFTKLEILSNLLSISTLFIFMLVALALLVRRYYVSG  451

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
                  N N   ++++ L L+  SS+  +  W L+ + W      LP++     S TA   
Sbjct  452   VTTDANRN---KLIICLLLILGSSIATAAYWGLSEKGWIAYCFTLPIW----FSATAGIC  504

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               +P  R P+ W VPL+PW  +LSI +N+FL+ +++  ++ RF  WTG +  +Y  +G+H
Sbjct  505   IFIPQARNPKLWGVPLVPWLPSLSIAINIFLLGSIDKDSFIRFAGWTGFLLAYYFFFGLH  564

Query  423   STYK  412
             ++Y 
Sbjct  565   ASYD  568



>gb|KDP34945.1| hypothetical protein JCGZ_09233 [Jatropha curcas]
Length=595

 Score =   330 bits (847),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 216/541 (40%), Positives = 335/541 (62%), Gaps = 16/541 (3%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y+ +LS T ++LK R L+      EL+ +R RS  +MK+ L W+D++  G+G ++G GV
Sbjct  43    NYVKALSSTKERLKDRILSRSKDSLELDVMRGRSDHEMKKTLNWWDIIWFGIGAVMGAGV  102

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  AR  AGP+V +SY+++G+SALLS LCY+EF+ E+PVAGG+F+YLR+  G+F+ 
Sbjct  103   FVLTGEAARNDAGPAVILSYLISGISALLSVLCYSEFAAELPVAGGSFAYLRVELGDFIA  162

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             Y A  NIL +Y++S A V+RS+T Y +  L   +P+ +R+ V  L E YN LD  +V + 
Sbjct  163   YIAAGNILFEYIVSGAGVARSWTSYFA-TLCNHDPNSFRIHVTSLAENYNYLDPISVVIS  221

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
             I++ I  C STK SS  N + T+ H++   FI++AG  K +  N        APFG+RG+
Sbjct  222   IIICIGACLSTKGSSRFNSIATMVHLLVLSFILVAGLMKANPKNYAN----FAPFGIRGI  277

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
             L  + +++F+Y+G+D V+T+AEEI NP + +P+G++GS+ IV  +YCL+A +L  + PY 
Sbjct  278   LKASGMLFFAYVGFDGVATLAEEIKNPGRDIPIGLIGSMSIVVLVYCLLAATLSFMQPYT  337

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I     FS AF+ +G  WA  +V +GA  G+   LL  ++GQARY   +GR  + P  L
Sbjct  338   EIDANAPFSVAFQAVGMNWAKYIVAIGALKGMTTVLLSNIIGQARYFTHIGRTHMAPPIL  397

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiI  754
             A V+  TGTP+NATI +    + VA FT L ++  ++SI TL +F LVA AL+ RRY + 
Sbjct  398   AVVNEKTGTPVNATIIMTFANSIVAFFTSLDVLSNLLSIATLFIFSLVALALLVRRYYVS  457

Query  753   NGNPPFQvllfl---flvsssslgfslSWKLNLQWW----NLPLFGFLTLSFTALFHRLV  595
                  F     +    L+ +SS+G +  W     W      +P++ F TL       +  
Sbjct  458   GETSEFDRKKLVGFLLLILASSIGSAAYWAAAHGWIGYAVTVPIWFFSTLGLQLTLKQ--  515

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
                ++P+ W VPL+PW  + SI +NVF++ +++ K++ RF IWTG++ L+Y    +H++Y
Sbjct  516   --AKKPKVWGVPLVPWLPSASIAVNVFILGSIDGKSFIRFLIWTGILLLYYFFIALHASY  573

Query  414   K  412
              
Sbjct  574   D  574



>ref|XP_004504162.1| PREDICTED: cationic amino acid transporter 1-like isoform X1 
[Cicer arietinum]
 ref|XP_004504163.1| PREDICTED: cationic amino acid transporter 1-like isoform X2 
[Cicer arietinum]
Length=593

 Score =   330 bits (847),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 230/538 (43%), Positives = 339/538 (63%), Gaps = 9/538 (2%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y  S+ +TP +LK R L   +   EL +V+ RSG +MK+ L W+DL+  G+G ++G G+
Sbjct  34    NYGRSVMETPFRLKDRVLKRSSDHSELFEVKARSGNEMKKTLNWWDLIWFGIGAVVGSGI  93

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  AR+ AGP+V +S++V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV 
Sbjct  94    FVLTGLEARQEAGPAVVLSFVVSGISALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVA  153

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NIL++YV+ NAAV+RS+T Y +  L    P+ +R+ V  +   Y  LD  AV  +
Sbjct  154   FIAAGNILLEYVIGNAAVARSWTSYFA-TLCNRAPEDFRIIVHSMNPDYGHLDPIAVVAL  212

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
             I++T +  +STK SS+ N V TIFH+    FIIIAG  K   +N         PFGV G+
Sbjct  213   IVITALAVYSTKGSSIFNYVATIFHMFVIVFIIIAGLIKAKPENYSP----FTPFGVHGM  268

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
             +D +A+++F+Y+G+D+VSTMAEE  NP + +P+G+VGS+LI + LYCL+A +LCL+  Y 
Sbjct  269   IDASAVLFFAYVGFDAVSTMAEETKNPGRDIPIGLVGSMLITTILYCLLATTLCLMQNYK  328

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I     FS AF  +G  WA  +V +GA  G+   LLV  +GQARYL  + R  ++P W 
Sbjct  329   DIDVNAPFSVAFSAVGMDWAKYIVSLGALKGMTTVLLVGAVGQARYLTHIARTHMMPPWF  388

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---ry  763
             A V   TGTP+NATI + +    VA FT+L I+  ++SI TL +F LVA AL+ R     
Sbjct  389   ALVDHRTGTPMNATISMLVTSGVVAFFTDLAILSNLLSISTLFIFSLVALALLVRRYYSS  448

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQ-WWNLPLFGFLTLSFTALFHRLVPCV  586
              +         +L L L+  SS+G S  W  +   W    +F  L +  T      VP  
Sbjct  449   GVTTKGDQRNFILGLVLIIGSSIGISAYWNNSTHGWIGYLVFVPLWILGTGGIWLFVPMA  508

Query  585   RRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
             ++P  W VPL+PW  +LSI +N+FL+ +++  +Y RF +WTGL+ ++Y++ G+H++Y 
Sbjct  509   KKPTIWGVPLVPWLPSLSIAINIFLLGSIDKDSYIRFAVWTGLLLVYYILLGLHASYD  566



>emb|CDY43646.1| BnaA04g20450D [Brassica napus]
Length=570

 Score =   329 bits (843),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 225/544 (41%), Positives = 336/544 (62%), Gaps = 16/544 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F +Y  +LSQT  + K R ++    + E  ++R +S  +MKR LTW+DLV  G G ++G 
Sbjct  25    FGSYRAALSQTCSRFKNRLVSRSDDETERVELRKQSENEMKRCLTWWDLVWFGFGSVVGA  84

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG  AR+ AGP++ +SY+V+G SA+LS  CYTEFSVEVPVAGG+F+YLRI  G+F
Sbjct  85    GIFVLTGQEAREEAGPAIVLSYVVSGFSAMLSVFCYTEFSVEVPVAGGSFAYLRIELGDF  144

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +    NIL++ V+  AAV R++T Y +  L   NPD  RVK D L  G+N+LD  AV 
Sbjct  145   AAFITAGNILLEGVVGTAAVGRAWTSYFATLLNR-NPDNLRVKTDTLSPGFNLLDPIAVV  203

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             +I     +   ST+++SLLN + +  + +   F+IIAGF    + NL        P+G  
Sbjct  204   VIAASATIASISTRKTSLLNWIASAVNTIVILFVIIAGFIHADASNLTP----FLPYGPE  259

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV   AA+VYF+Y G+DS++TMAEE  NPSK +P+G++GS+ I++ +YCLMAL+L ++  
Sbjct  260   GVFRAAAVVYFAYTGFDSIATMAEETKNPSKDIPIGLLGSMSIITVIYCLMALALSMMQK  319

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  I    ++S AF+ +G KW   +V +GA  G+   LLV  LGQARY+  + R  ++P 
Sbjct  320   YTDIDPNAAYSVAFQSVGMKWGKYLVALGALKGMTTVLLVGALGQARYVTHIARTHMIPP  379

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
               A VHP TGTP+NA + + I  A +A F+ L ++  ++SI TL +F ++  AL+ RRY 
Sbjct  380   LFALVHPKTGTPINANLLVTIPSALIAFFSGLDVLASLLSISTLFIFTMIPLALLVRRYY  439

Query  759   iINGNPP---FQvllflflvsssslgfslSWKLNLQ--WWNLPL---FGFLTLSFTALFH  604
             +    P     ++++ + +V  SS+  S  W +NL+  W    +   F F+       F 
Sbjct  440   VREVTPRADLLKLIICILVVVISSMCTSAYWGMNLKGSWIGYTITVPFWFMGTLGIVFF-  498

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               VP  R P+ W VPL+PW   LSI  N+FLM +L  +A+ RFG+ T +M L+Y ++G+H
Sbjct  499   --VPQQRSPKVWGVPLVPWIPCLSIATNIFLMGSLEAQAFVRFGVCTLVMLLYYFLFGLH  556

Query  423   STYK  412
             +T+ 
Sbjct  557   ATFD  560



>ref|XP_010687038.1| PREDICTED: cationic amino acid transporter 1-like [Beta vulgaris 
subsp. vulgaris]
Length=580

 Score =   329 bits (843),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 222/542 (41%), Positives = 350/542 (65%), Gaps = 15/542 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + YLN+L + P +   R +A      EL++V+ RS  +M + LT +DL+  GVG ++G G
Sbjct  24    TNYLNALKEIPTRFIDRVVARSQDYIELHEVKARSQNEMIKILTGWDLIWFGVGSLIGAG  83

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             VFV TG  A++ AGP+V +SY++AG SA+LS LCY EF++E+PVAGG+F+YL++  G+F+
Sbjct  84    VFVLTGLEAKEHAGPAVVVSYLIAGASAMLSVLCYIEFAIEIPVAGGSFAYLKVELGDFM  143

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++Y+L  AA++R++T Y +  L +  PD +RV    L + YN LD  AV +
Sbjct  144   AFLAAGNILLEYILGGAALARAWTSYFA-TLCDHVPDEFRVTAPSLGKDYNQLDPIAVVV  202

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             + ++ ++   STK SS +N   TI H+V   FIII G  K    N        AP+GVRG
Sbjct  203   VAVICVLAVTSTKVSSRVNFFATIIHMVVIVFIIIVGLTKADISNY----KPFAPYGVRG  258

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V   +A+++++++G+D+VSTMAEE  NPS+ +P G++GS++I    YCL+A+++CL+ PY
Sbjct  259   VFRSSAVLFYAFVGFDAVSTMAEETKNPSEDIPFGLIGSMVIAIVSYCLLAITVCLMQPY  318

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             + +  +  FS AF+  G  WA  VV +GA  G+   LLV  +GQARYL  + R  ++P W
Sbjct  319   SQLDPDAPFSIAFQKAGLGWAKYVVDIGALKGMTTVLLVNAMGQARYLTHIARTHMLPPW  378

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              A+V+ + GTP+NAT+ + I  A +ALFT+L ++  ++SI TLV+F +V  AL+ RRY  
Sbjct  379   FAQVNSTFGTPVNATVVMLIITAIIALFTDLLVLSNLLSISTLVMFMMVPVALLVRRYYD  438

Query  756   INGNP---PFQvllflflvsssslgfslSWKLNLQWWNLPLFG----FLTLSFTALFHRL  598
              N        ++   + L+ SS++G S+ W +N   W   +      F++ SF  +F   
Sbjct  439   ANVTSYINRIKLFCCIALILSSAIGSSIYWSINDTHWIGYIITTSIWFISTSFLKIF---  495

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R P+ W VPLMPW A+ SIF+N+FL+ +++  ++ RFGIWTG++ ++Y+ +G+H++
Sbjct  496   VPQARDPKIWGVPLMPWVASASIFINIFLLGSIDKDSFTRFGIWTGILMVYYLFFGLHAS  555

Query  417   YK  412
             Y 
Sbjct  556   YD  557



>ref|XP_010056965.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
1-like [Eucalyptus grandis]
Length=579

 Score =   329 bits (843),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 220/537 (41%), Positives = 334/537 (62%), Gaps = 8/537 (1%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +Y  +L +TP +L+ R L+      EL++V+ RS  +MKR L W+DL+  G+G ++G G+
Sbjct  27    SYGRALRETPARLRDRLLSRSLDSTELHEVKARSQHEMKRTLNWWDLIWFGIGAVIGAGI  86

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  AR  AGP+V +SY+V+G+SALLS  CYTEF+VE+P AGG+F+YLR+  G+FV 
Sbjct  87    FVLTGLEARDDAGPAVVLSYVVSGVSALLSVFCYTEFAVEIPSAGGSFAYLRVELGDFVA  146

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NI+++YV+  AAV+RS+T Y +  L    P  + +K  GL EGYN LD  AV + 
Sbjct  147   FIAAGNIILEYVIGGAAVARSWTSYCA-TLFNHKPTDFLIKAHGLAEGYNELDPLAVGVC  205

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
               + ++   STK SS+ N        V    +II     G S   +K+    AP+G RGV
Sbjct  206   AAICVLAVLSTKGSSIFN----SIASVIHIVVIIFIIVAGLSKADLKNYSDFAPYGARGV  261

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
                +A+++F+YIG+D+VSTMAEE  N  + +P+G+VGS++I +  YCLMA++LCL+ PY 
Sbjct  262   FQASAVLFFAYIGFDAVSTMAEETKNRPRDIPIGLVGSMVITTXCYCLMAVTLCLMQPYK  321

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I E   FS AF+ +GW WA  +V  GA  G+   LLV+ +GQARYL  + R  ++P W 
Sbjct  322   DIDENAPFSVAFQAVGWNWAKYIVAAGALKGMTTVLLVSAVGQARYLTHIARTHMMPPWF  381

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---ry  763
             A V+  TGTP+NAT+ + +  A +A FT+L+I+  ++SI TL +F +VA AL+ R     
Sbjct  382   AHVNERTGTPVNATVSMLLATAVIAFFTKLEILSNLLSISTLFIFMVVAVALLVRRYYVS  441

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVR  583
                      +++  + L+  SS+G S  W L+  W    +   + L  T      VP  R
Sbjct  442   GTTTATDRNKLVACILLIIGSSIGTSAYWGLSEGWIGYAVTVPIWLLATVALRVFVPHAR  501

Query  582   RPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              P+ W VPL+PW  + SI +N+FL+ +++  ++ RFG+WTG + ++YV+ G+H++Y 
Sbjct  502   NPKLWGVPLVPWLPSASIAINIFLLGSIDKDSFIRFGMWTGFLLVYYVLLGLHASYD  558



>ref|XP_009141413.1| PREDICTED: cationic amino acid transporter 5 [Brassica rapa]
Length=570

 Score =   328 bits (842),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 225/544 (41%), Positives = 335/544 (62%), Gaps = 16/544 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F +Y  +LSQT  + K R ++    + E  ++R +S  +MKR LTW+DLV  G G ++G 
Sbjct  25    FGSYRAALSQTCSRFKNRLVSRSDDETERVELRKQSENEMKRCLTWWDLVWFGFGSVVGA  84

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG  AR+ AGP++ +SY+V+G SA+LS  CYTEFSVEVPVAGG+F+YLRI  G+F
Sbjct  85    GIFVLTGQEAREEAGPAIVLSYVVSGFSAMLSVFCYTEFSVEVPVAGGSFAYLRIELGDF  144

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +    NIL++ V+  AAV R++T Y +  L   NPD  RVK D L  G+N+LD  AV 
Sbjct  145   AAFITAGNILLEGVVGTAAVGRAWTSYFATLLNR-NPDNLRVKTDTLSPGFNLLDPIAVV  203

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             +I     +   ST+++SLLN + +  + +   F+IIAGF    + NL        P+G  
Sbjct  204   VIAASATIASISTRKTSLLNWIASAVNTIVILFVIIAGFIHADASNLTP----FLPYGPE  259

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV   AA+VYF+Y G+DS++TMAEE  NPSK +PVG++GS+ I++ +YCLMAL+L ++  
Sbjct  260   GVFRAAAVVYFAYTGFDSIATMAEETKNPSKDIPVGLLGSMSIITVIYCLMALALSMMQK  319

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  I    ++S AF+ +G KW   +V +GA  G+   LLV  LGQARY+  + R  ++P 
Sbjct  320   YTDIDPNAAYSVAFQSVGMKWGKYLVALGALKGMTTVLLVGALGQARYVTHIARTHMIPP  379

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
               A VHP TGTP+NA + + I  A +A F+ L ++  ++SI TL +F ++  AL+ RRY 
Sbjct  380   LFALVHPKTGTPINANLLVTIPSALIAFFSGLDVLASLLSISTLFIFTMIPLALLVRRYY  439

Query  759   iINGNPP---FQvllflflvsssslgfslSWKLNLQ--WWNLPL---FGFLTLSFTALFH  604
             +    P     ++++ + +V  SS+  S  W +NL+  W    +   F F+       F 
Sbjct  440   VREVTPRADLLKLIICILVVVISSMCTSAYWGMNLKGSWIGYTITVPFWFMGTLGIVFF-  498

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               VP  R P+ W VPL+PW   LSI  N+FLM +L  +A+ RFG+ T +M  +Y ++G+H
Sbjct  499   --VPQQRSPKVWGVPLVPWIPCLSIATNIFLMGSLEAQAFVRFGVCTLVMLFYYFLFGLH  556

Query  423   STYK  412
             +T+ 
Sbjct  557   ATFD  560



>ref|XP_007214132.1| hypothetical protein PRUPE_ppa018037mg [Prunus persica]
 gb|EMJ15331.1| hypothetical protein PRUPE_ppa018037mg [Prunus persica]
Length=600

 Score =   329 bits (844),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 226/544 (42%), Positives = 342/544 (63%), Gaps = 18/544 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             +STY  +LSQT  + K R ++    + E+ ++  RS  DMKR LTW+DL+  G G ++G 
Sbjct  33    WSTYRTALSQTGYRFKNRLISRSDDNNEIGELPKRSENDMKRCLTWWDLIWFGFGSVIGA  92

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG      AGP++ +SY+ +G+SA+LS  CYTEFSVEVPVAGGAF+YLRI  G+F
Sbjct  93    GIFVLTGQETHDHAGPAIVLSYVASGVSAMLSVFCYTEFSVEVPVAGGAFAYLRIELGDF  152

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             + +    NIL++  + +AAV+RS+T Y +  L   + +  R+  + L EG+N+LD  AVA
Sbjct  153   IAFITAGNILLEGFVGSAAVARSWTSYFTSLLNRPS-NSLRIHTN-LTEGFNLLDPIAVA  210

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             ++ +   +   ST+++S LN + +I + V   F+IIA F   +  N+        PFG +
Sbjct  211   VLTIAATIAMISTRKTSYLNWIASIVNNVVILFVIIAAFIHANPSNMKP----FFPFGAK  266

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV   AAIVYF+Y G+D+++TMAEE  NPS+ +P+G++GS+ I++ +YCLMA+SL ++  
Sbjct  267   GVFQAAAIVYFAYGGFDNIATMAEETKNPSRDIPIGLIGSMSIITVIYCLMAVSLPMMQK  326

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  I    ++S AF+ +G  WA  +V +GA  G+   LLV  LGQARY+  + RA ++P 
Sbjct  327   YTDIDPNAAYSVAFQSVGMTWAKYLVALGALKGMTTVLLVGTLGQARYITHIARAHMIPP  386

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             W A VHP TGTP+NAT+ + I    +ALF+ L ++  ++S+ TL +F ++A AL+ RRY 
Sbjct  387   WFALVHPKTGTPINATLLIVIPSGCLALFSSLNVLAGLLSVSTLFIFMMMAVALLVRRYY  446

Query  759   iINGNPPFQvllflflvsssslg---fslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
             +    P   +L  + L+          S  W LN   W      +PL+ F TL+  A+F 
Sbjct  447   VREITPQQHLLKLVILLLIIIASSIGTSAYWGLNPNGWVGYVVTVPLWFFGTLAM-AVF-  504

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               +P  R P+ W VPL+PW  +LSI  N+FLM +L  KA++RFGI T +M ++YV +G+H
Sbjct  505   --LPQQRSPKVWGVPLVPWLPSLSIATNIFLMGSLGHKAFERFGICTVVMLIYYVFFGLH  562

Query  423   STYK  412
             +TY 
Sbjct  563   ATYD  566



>ref|XP_006664195.1| PREDICTED: cationic amino acid transporter 1-like [Oryza brachyantha]
Length=590

 Score =   329 bits (843),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 223/542 (41%), Positives = 340/542 (63%), Gaps = 18/542 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +T  +L+ R  A      EL++VR  SGA M+R LTW+DL+  GVG ++G G+F
Sbjct  30    YGRALMETGPRLRDRVTARSADAVELHEVRGWSGAKMRRTLTWWDLIWFGVGAVIGAGIF  89

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A++ AGP+V +SY V+G+SA+LS  CYTEF++E+PVAGG+F+YLR+  G+F+ +
Sbjct  90    VLTGQEAKEAAGPAVVLSYAVSGVSAMLSVFCYTEFAIEIPVAGGSFAYLRVELGDFMAF  149

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++Y +  AAV+RS+T Y +  L   +P+ +R+    L + Y+ LD  AVA+I+
Sbjct  150   IAAGNILLEYCIGGAAVARSWTSYFATLLNH-HPNDFRIHAASLSDDYSRLDPVAVAVIV  208

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             L+ ++   STK SS  N V++I H+    FII AG  +    NL       APFG  GV 
Sbjct  209   LICLLAVLSTKGSSRFNYVLSILHLAVILFIIAAGLSRARLSNLTAD---FAPFGAHGVF  265

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+YIG+D+VSTMAEE  NP++ +PVG+VG++ + +ALYC++AL+LCL+ PY  
Sbjct  266   AASAVLFFAYIGFDAVSTMAEETKNPARDIPVGLVGAMAVTTALYCVLALTLCLMQPYYE  325

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  F+ AF   G  WA  +V  GA  G+   LLV+ +GQARYL  + R  +VP  LA
Sbjct  326   IDADAPFTVAFTATGMDWAKYIVAFGALKGMTTVLLVSAVGQARYLTHIARTHMVPPCLA  385

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliy----rry  763
             +VHP  GTP+NAT+ +    A +ALFT+L I+  ++SI TL +F LVA AL+        
Sbjct  386   QVHPKLGTPVNATVVMLAATAVIALFTDLGILSNLLSISTLFIFMLVAVALLVRRYYVSG  445

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRL  598
                N +   ++   L +++++S+  +  W L+   W      +P +     + T      
Sbjct  446   ETTNADRN-KLAACLAVITAASVVTAAYWGLSADGWAAYAATVPAW----FAATLYLQLR  500

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             VP  R PE W VPL+PW  + SIF+N+FL+ +++ K++ RFGIWT  +  +Y  +G+H++
Sbjct  501   VPMARTPEKWGVPLVPWLPSASIFINIFLLGSIDGKSFMRFGIWTAALLAYYFFFGLHAS  560

Query  417   YK  412
             Y 
Sbjct  561   YD  562



>ref|XP_007138538.1| hypothetical protein PHAVU_009G217500g [Phaseolus vulgaris]
 gb|ESW10532.1| hypothetical protein PHAVU_009G217500g [Phaseolus vulgaris]
Length=588

 Score =   328 bits (841),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 224/537 (42%), Positives = 343/537 (64%), Gaps = 8/537 (1%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
              Y  +L +TP++LK R L       E+ ++ +RS   MK+ L W+DL+ LGVG ++G G+
Sbjct  30    NYKAALLETPRRLKDRFLTRSNERVEIGEMTVRSSHQMKKTLNWWDLIWLGVGSVIGAGI  89

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  AR   GP+V +S++V+G SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+FV 
Sbjct  90    FVLTGMEARNVTGPAVILSFVVSGFSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVA  149

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             + A  NIL++YV+S AAV+RS+T Y +  L   NPD +R+ +  +   Y+ LD  AV ++
Sbjct  150   FIAAGNILLEYVISCAAVARSWTSYFA-TLCNKNPDDFRIVIHNMNSNYSHLDPIAVLVL  208

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
             +L+ I+   STK SS+ N + ++ H++   FI+I G       N V      APFGVRGV
Sbjct  209   VLVCILAVRSTKGSSIFNYIASVVHIIIIVFIVITGLIHAKPQNYVP----FAPFGVRGV  264

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
                +A++YF+Y+G+D+V+TMAEE  NPS+ +P+G+VGS+LI +  YCL+A +LCL+ PY 
Sbjct  265   FQASAVLYFAYVGFDAVATMAEETKNPSRDIPIGLVGSMLIATLAYCLLAATLCLMQPYT  324

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I     FS AF  +GW WA  +V +GA  G+   LLV  +GQARYL  + R  ++P W 
Sbjct  325   NIDVNAPFSVAFSAIGWDWAKYIVSLGALKGMTTVLLVTAVGQARYLTHISRTHMMPPWF  384

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---ry  763
             A V   TGTP+NATIFL +  A +  FT+L+++  ++SI TL +F LVA AL+ R     
Sbjct  385   AFVDEHTGTPVNATIFLVLISALIGFFTDLEVLSNLLSISTLFIFMLVAVALLVRRYYSS  444

Query  762   aiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPCVR  583
              +   +   ++++F+ ++  SS G S  W L+  W    +F  + +  T     LVP  +
Sbjct  445   GVTTKSNQIKLIVFIVVIIGSSCGISSYWALSDGWIGYAVFCPIWVLATGGLWLLVPKAK  504

Query  582   RPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              P+ W VPL+PW  ++SIF+N+FL+ +++  ++ RF  WT L+ ++YV+ G+H++Y 
Sbjct  505   EPKLWGVPLVPWLPSISIFINIFLLGSIDKDSFIRFAFWTVLLLVYYVLLGLHASYD  561



>ref|XP_008372220.1| PREDICTED: cationic amino acid transporter 1-like [Malus domestica]
Length=614

 Score =   329 bits (843),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 229/539 (42%), Positives = 342/539 (63%), Gaps = 13/539 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+++L QTP +   R L     + EL +V+ RS  +MK+ L+W+DL+  G+G ++G G+F
Sbjct  36    YVDALKQTPGRFVDRVLTRSADNTELVEVKARSHHEMKKTLSWWDLIWFGLGAVIGAGIF  95

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  96    VLTGLEAREHAGPAVVLSYVVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  155

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +      + + +R+   G  E Y  LD  AVA+II
Sbjct  156   IAAGNILLEYVIGGAAVARSWTSYFTTLCNRSDTNDFRIIAHGFPEDYKYLDPIAVAVII  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
              +  +   STK SS LN + +I H++   FIIIAG  K   +N         PFG RGV 
Sbjct  216   GICCLAVLSTKGSSRLNYIASIVHIIVILFIIIAGLTKADINNYRD----FFPFGPRGVF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+YIG+D+VSTMAEE  NP++ +P+G+VGS++I + LYCL+A++LCL+ PY  
Sbjct  272   QASAVLFFAYIGFDAVSTMAEETKNPARDIPIGLVGSMVITTVLYCLLAVTLCLMRPYGQ  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I ++  FS AF+ +G  WA  VV  GA  G+ + LLV  +GQARYL  + R  +VP W A
Sbjct  332   IDKQAPFSVAFEDVGMGWAKYVVAAGALKGMTSVLLVGAVGQARYLTHIARTHMVPPWFA  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr------  769
             +V   TGTP+NAT+ +    A +A FT L I+  ++SI TL +F LVA AL+ R      
Sbjct  392   QVDYKTGTPVNATVTMLAATAIIAFFTSLDILANLLSISTLFIFSLVAIALLVRRYYVSG  451

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPC  589
                  N N   + + FLF++ SSS+  S+ W     W    +   L    T     LVP 
Sbjct  452   VTTRANRN---KFIAFLFIIISSSIATSVYWSRTDDWTAYVVTAPLWFLGTLGIWLLVPQ  508

Query  588   VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              R P+ W VPL+PW  +LSI +N+FL+ +++  ++ RFG+WT ++ ++Y ++G+H++Y 
Sbjct  509   ARSPKLWGVPLVPWLPSLSIAINIFLLGSIDHASFIRFGVWTLIILVYYFIFGLHASYD  567



>ref|XP_009108509.1| PREDICTED: cationic amino acid transporter 1-like [Brassica rapa]
Length=597

 Score =   328 bits (842),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 223/541 (41%), Positives = 346/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R L       E++ ++ RSG +MK+ LTW+DL+  GVG ++G G+F
Sbjct  34    YFKALKETPSRFVDRLLTRSQDSVEIHDMKARSGHEMKKTLTWWDLMWFGVGAVIGSGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR +AGP+V +S++V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  94    VLTGQEARDSAGPAVVVSFVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI++ Y++  AAV+RS+T Y +  L    PD +R+  + L E YN LD  +V +  
Sbjct  154   IAAGNIILQYIVGGAAVARSWTSYFATLLNH-KPDDFRIVANSLHEDYNHLDPISVGVCA  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS+ N + +I H++   FI+IAGF +    N        APFG RGV 
Sbjct  213   IICVLAAIGTKGSSVFNYIASIIHMLVILFIVIAGFIRADFKNY----SDFAPFGARGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               A++++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA +LCL+ PY +
Sbjct  269   KSASVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVLTTVCYCLMAAALCLMQPYGM  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WLA
Sbjct  329   IDPDAPFSVAFSAVGWDWAKYLVAFGALKGMTTVLLVGAIGQARYMTHIARAHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              V+  TGTP+NAT+ +    A +A FT+L I+ +++S+ TL +F LVA AL+ R      
Sbjct  389   HVNAKTGTPINATVIMLTATALIAFFTKLGILADLLSVSTLFIFMLVAVALLVRRYYVTG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               + +   + L+FL L+ +SS   ++ W L    W      +P++ FL+   TA    LV
Sbjct  449   ETSSSDRTKFLVFLGLILASSAATAVYWALEKDSWIGYCVTVPIW-FLS---TAGMKFLV  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
                R P+ W VPL+PW  + SI +N+FL+ +++ K+Y RF IWTG++ ++Y ++G+H+TY
Sbjct  505   AQARAPKLWGVPLVPWLPSASIAINIFLLGSIDAKSYIRFAIWTGVLLVYYFLFGLHATY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_008382964.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 
8, vacuolar [Malus domestica]
Length=589

 Score =   328 bits (841),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 225/539 (42%), Positives = 339/539 (63%), Gaps = 7/539 (1%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F++Y ++LS TP +LK R L   +   EL ++  +S   MKR LTW+DL+ LG G ++G 
Sbjct  36    FNSYKDALSHTPSRLKDRLLHRSSDSFELLQLPKQSENLMKRCLTWWDLIWLGFGAVVGS  95

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG   R  AGP++ +SY V+GLSA+LS LCYTEF+VEVPVAGG+FSYLRI  G+F
Sbjct  96    GIFVITGQATRDDAGPAIVLSYAVSGLSAMLSVLCYTEFAVEVPVAGGSFSYLRIELGDF  155

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             V + A  NIL++ ++ +A + RS++ Y +      + D  R++V  L +G+N+LD  AV 
Sbjct  156   VAFIAAGNILLEALVGSAGLGRSWSSYFASIFRTDDTDFLRIRVKSLPDGFNLLDPIAVV  215

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             +++++  +    T+ +S+LN + +    +   FI+I GF KG ++NLV       P+G +
Sbjct  216   VLLVVNSIAMSGTRRTSVLNWIASJASGLIIVFILIVGFVKGKTENLVP----FXPYGAK  271

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV + AA+VY+SY G+D V+ MAEE   PS+ +PVG+VGS+ +++ +YCLMAL LC++  
Sbjct  272   GVFEAAAVVYWSYTGFDMVANMAEEAKKPSRDIPVGLVGSMSLITVVYCLMALVLCMMQK  331

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  I  + ++S AF+ +G  WA  +V + A  G+  SLLV  +GQARY   + RA ++  
Sbjct  332   YTQIDRDAAYSVAFEAIGMNWAKYIVSICALKGMTTSLLVGSMGQARYTTQIARAHMISP  391

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             W A VHP TGTP+ AT+ + +  A VALFT L ++  + S  TL +F  VA AL+ RRY 
Sbjct  392   WFALVHPKTGTPIYATVLVTLVSAVVALFTSLDVLSSVFSFSTLCIFMFVAIALLVRRYY  451

Query  759   iINGNPP---FQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPC  589
             + +  P     + L+ LFL+  SS G + +W   ++ W   +   +      L+  L+P 
Sbjct  452   VKDVTPTTDLVKFLVCLFLIIGSSTGITTTWNTGMRGWVWYVVFSVIWLVGTLWMALLPK  511

Query  588   VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              R P+ W VPL+PW  ALSI +NVFL+ +L   A+ RF I T +M L+Y+  GVH+TY 
Sbjct  512   HRVPKVWGVPLVPWLPALSIGINVFLIGSLGYVAFLRFFICTAVMVLYYLFVGVHATYD  570



>ref|XP_004137314.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Cucumis 
sativus]
 gb|KGN53538.1| hypothetical protein Csa_4G075190 [Cucumis sativus]
Length=594

 Score =   328 bits (841),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 229/542 (42%), Positives = 331/542 (61%), Gaps = 15/542 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S+Y  +LSQT  +LK R L   + D EL ++   SG  MK+ LTW+DL+ L  G ++G G
Sbjct  39    SSYKYALSQTCSRLKDRLLDRSSDDNELIELPKASGIGMKKCLTWWDLIWLAFGSVVGSG  98

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +F  TG  AR  AGPS+ ISY+V+GLSALLS  CY+EF++EVPVAGG+FS+LRI  G+F+
Sbjct  99    IFTITGLEARDDAGPSIVISYVVSGLSALLSVFCYSEFAIEVPVAGGSFSFLRIELGDFI  158

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NI ++ ++  A + RS++ Y +  +   NPD  R KV  L EG+N+LD  AV +
Sbjct  159   AFIAAGNIFLEAIVGAAGLGRSWSSYFASMINSDNPDFLRFKVSFLSEGFNLLDPIAVIV  218

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             +++   +    T+ +S L  + ++   +   F+I+ GF KG+S NLV       PFG RG
Sbjct  219   LLVANGIAVSGTRRTSFLTWITSVISTLLIIFVIVIGFVKGNSANLVP----FFPFGARG  274

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V   AA+VY+SY G+D V+TMAEE   PS+ +PVG++GS+ ++S +YCLMALSL +L  Y
Sbjct  275   VFRAAAVVYWSYTGFDMVATMAEETKKPSRDIPVGLIGSMSVISVIYCLMALSLTMLQKY  334

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I    +FS AF  +G  WA  +V + A  G+  SLLV  +GQARY   + RA L+P  
Sbjct  335   TEIDRNAAFSVAFDKIGMTWAKYLVSIVAIKGMTTSLLVGSMGQARYTTQIARAHLIPPL  394

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              A VHP TGTP+ AT+   I  A VALF+ L ++  + S  TL +F L+A AL+ RRY  
Sbjct  395   FALVHPKTGTPVYATLLTTITSAIVALFSSLDVLSSVFSFSTLAIFMLMAVALLVRRYYN  454

Query  756   INGNPP---FQvllflflvsssslgfslSWKLNLQWW---NLPL-FGFLTLSFTALFHRL  598
              +  P     + L+ LF +  S L  +  W L+ Q W    +P  F FL    + L    
Sbjct  455   KDTTPSSDYIKFLICLFSILGSCLALTTVWNLDRQGWIEYVVPASFWFL----STLAMSF  510

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             +P  R P+ W VPL+PW  +LSI +N+ L+ +L  +A+ RF I + +M L+Y+  G+H+T
Sbjct  511   LPKYRSPKVWGVPLVPWLPSLSIGMNLILIGSLGTEAFLRFFICSAVMLLYYLFIGLHAT  570

Query  417   YK  412
             Y 
Sbjct  571   YD  572



>ref|XP_009591377.1| PREDICTED: cationic amino acid transporter 1-like [Nicotiana 
tomentosiformis]
Length=610

 Score =   328 bits (841),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 225/544 (41%), Positives = 340/544 (63%), Gaps = 18/544 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             +S Y N+L QTP++L +R L     + EL   + RS  +MK+ L W+DL+  G+G ++G 
Sbjct  37    WSNYANALRQTPRRLIERVLTRSGDEAELES-KSRSQHEMKKTLNWWDLIWFGMGAVIGA  95

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG  A + AGP+V +SY V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+F
Sbjct  96    GIFVLTGLEASQDAGPAVVLSYAVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDF  155

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             V + A  NIL++YV+  AAV+RS+T Y +  L     D + +  +GL +GYN LD  AV 
Sbjct  156   VAFIAAGNILLEYVIGGAAVARSWTSYFATLL-NFRADKFLITANGLAKGYNQLDPIAVG  214

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             +  ++ I+   STK SS LN V +I H+V   FIII G  K  + N         PFG R
Sbjct  215   VCFIICIIAIRSTKGSSRLNYVASIIHIVVIIFIIICGLIKSDTKNYTP----FTPFGTR  270

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             G+   +A+++F+Y+G+D+VSTMAEE  +P++ +P+G+VGS++I + +YC++A++LCL+ P
Sbjct  271   GIFKASAVLFFAYVGFDAVSTMAEETKDPARDIPIGLVGSMVITTTIYCILAITLCLMQP  330

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  I     FS AFK +GW WA  +V  GA  G+ + LLV  +GQARYL  + R  ++P 
Sbjct  331   YQNIDPNAPFSVAFKAVGWSWAQYIVAAGALKGMTSVLLVGAVGQARYLTHIARTHMMPP  390

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---  769
             W + V   TGTP+NAT  +    A VA FT+LKI+  ++SI TL +F LVA AL+ R   
Sbjct  391   WFSYVDAKTGTPVNATAVMMSATAIVAFFTKLKILSNLLSISTLFIFMLVALALLVRRYY  450

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFH  604
                +       +++  L L+  SS+  +  W L+   W      LP++ F+    TA  +
Sbjct  451   ASGVTTNADRNKLIACLLLILGSSIATAAYWGLSENGWIAYCITLPIW-FMA---TAGIY  506

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               VP  R P+ W VPL+PW  + SI +N+FL+ +++  ++ RF  WTG + ++Y  +G+H
Sbjct  507   IFVPQARNPKLWGVPLVPWLPSASIAINIFLLGSIDKDSFIRFAGWTGFLLVYYFFFGLH  566

Query  423   STYK  412
             ++Y 
Sbjct  567   ASYD  570



>emb|CDY64649.1| BnaAnng19530D [Brassica napus]
Length=570

 Score =   327 bits (838),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 225/544 (41%), Positives = 336/544 (62%), Gaps = 16/544 (3%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F +Y  +LSQT  + K R ++    + E  ++R +S  +MKR LTW+DLV  G G ++G 
Sbjct  25    FGSYRAALSQTCSRFKNRLVSRSDDETERVELRKQSENEMKRCLTWWDLVWFGFGSVVGA  84

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG  AR+ AGP++ +SY+V+G SA+LS  CYTEFSVEVPVAGG+F+YLRI  G+F
Sbjct  85    GIFVLTGQEAREEAGPAIVLSYVVSGFSAMLSVFCYTEFSVEVPVAGGSFAYLRIELGDF  144

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
               +    NIL++ V+  AAV R++T Y +  L   NPD  RVK D L  G+N+LD  AV 
Sbjct  145   AAFITAGNILLEGVVGTAAVGRAWTSYFATLLNR-NPDNLRVKTDTLSPGFNLLDPIAVV  203

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             +I     +   ST+++SLLN + +  + +   F+IIAGF    + NL        P+G  
Sbjct  204   VIAASATIASISTRKTSLLNWIASAVNTIVILFVIIAGFIHADASNLTP----FLPYGPE  259

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV   AA+VYF+Y G+DS++TMAEE  NPSK +P+G++GS+ I++ +YCLMAL+L ++  
Sbjct  260   GVFRAAAVVYFAYTGFDSIATMAEETKNPSKDIPIGLLGSMSIITVIYCLMALALSMMQK  319

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  I    ++S AF+ +G KW   +V +GA  G+   LLV  LGQARY+  + R  ++P 
Sbjct  320   YTDIDPNAAYSVAFQSVGMKWGKYLVALGALKGMTTVLLVGALGQARYVTHIARTHMIPP  379

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
               A VHP TGTP+NA + + I  A +A F+ L ++  ++SI TL +F ++  AL+ RRY 
Sbjct  380   LFALVHPKTGTPINANLLVTIPSALIAFFSGLDVLASLLSISTLFIFTMIPLALLVRRYY  439

Query  759   iINGNP---PFQvllflflvsssslgfslSWKLNLQ--WWNLPL---FGFLTLSFTALFH  604
             +    P     ++++ + +V  SS+  S  W +NL+  W    +   F F+       F 
Sbjct  440   VREVTPRADLLKLIICILIVVISSMCTSAYWGMNLKGSWIGYTITVPFWFMGTLGIVFF-  498

Query  603   RLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVH  424
               VP  R P+ W VPL+PW   LSI  N+FLM +L  +A+ RFG+ T +M L+Y ++G+H
Sbjct  499   --VPQQRSPKVWGVPLVPWIPCLSIATNIFLMGSLEAQAFVRFGVCTLVMLLYYFLFGLH  556

Query  423   STYK  412
             +T+ 
Sbjct  557   ATFD  560



>ref|XP_003579146.1| PREDICTED: cationic amino acid transporter 1-like [Brachypodium 
distachyon]
Length=587

 Score =   327 bits (839),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 217/543 (40%), Positives = 338/543 (62%), Gaps = 16/543 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             + Y  +L++T  +L+ R  A    + E + VR RSGA+M+R+L W+DL   GVG ++G G
Sbjct  24    AAYGRALTETGPRLRDRLTARSAAETETDAVRGRSGAEMRRELNWWDLAWFGVGAVIGAG  83

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  A++ AGP+V +SY V+G+SA+LS  CYTEF++E+PVAGG+F+YLR+  G+F+
Sbjct  84    IFVLTGQEAKEAAGPAVVLSYAVSGVSAMLSVFCYTEFAIEIPVAGGSFAYLRVELGDFM  143

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NIL++Y +  AAV+RS+T Y +  L    PD +R+   GL E Y+ LD  AV +
Sbjct  144   AFIAAGNILLEYCIGGAAVARSWTSYFATLLNH-RPDDFRIHASGLAEDYSRLDPIAVVV  202

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             I ++ ++   STK SS  N +++I H     FIIIAG  K  + NL  +    APFG RG
Sbjct  203   IAIICVLAVVSTKGSSRFNYILSIVHFGVILFIIIAGLTKAHASNLTDN---FAPFGARG  259

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+YIG+D+VST+AEE  NP+K +P+G+V ++ + +  YC++AL+LC + PY
Sbjct  260   IFAASAVLFFAYIGFDAVSTLAEETKNPAKDIPIGLVSAMTVTTVTYCVLALTLCAMRPY  319

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
              LI  +  FS AF+ +G  WA  +V  GA  G+   LLV  +GQARYL  + R+ + P  
Sbjct  320   ALIDADAPFSVAFQDVGMGWAKYIVAFGALKGMTTVLLVGAVGQARYLTHIARSHMAPPC  379

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---r  766
             LA+V P  GTP+ AT+ +    A +A FT+L I+  ++SI TL +F LVA AL+ R    
Sbjct  380   LAQVSPKFGTPVRATVAMMAATACIAFFTDLPILSNLLSISTLFIFMLVAVALLVRRYYV  439

Query  765   yaiINGNPPFQvllflflvsssslgfslSWKLNLQWWN-----LPLFGFLTLSFTALFHR  601
                 +     ++   + ++ +SS+  +  W +++  W      +P +     + TA    
Sbjct  440   SGETSAADRNKLAASIAVIIASSVATAACWGIDVGGWKVYAGTVPAWA----AATACLQW  495

Query  600   LVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHS  421
              VP  R P+ W VPL+PW  A SIF+N+FL+ +++ K++ RFGIWT  +  +Y   G+H+
Sbjct  496   AVPKARTPQKWGVPLVPWLPAASIFINIFLLGSIDGKSFMRFGIWTAALLAYYFFVGLHA  555

Query  420   TYK  412
             +Y 
Sbjct  556   SYD  558



>ref|XP_010051809.1| PREDICTED: cationic amino acid transporter 5-like [Eucalyptus 
grandis]
 gb|KCW75643.1| hypothetical protein EUGRSUZ_D00009 [Eucalyptus grandis]
Length=623

 Score =   328 bits (842),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 226/542 (42%), Positives = 342/542 (63%), Gaps = 18/542 (3%)
 Frame = -2

Query  2013  TYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgv  1834
             +Y ++L QT  +LK R  +      EL ++R RS  DMKR L W+DL   G G ++G G+
Sbjct  37    SYRSALRQTWFRLKDRIKSRSDDITELGELRKRSENDMKRCLNWWDLTWFGFGSVIGAGI  96

Query  1833  fVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVG  1654
             FV TG  A K AGP++ +SY+ +G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F  
Sbjct  97    FVLTGQEAHKHAGPAIVLSYVASGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFAA  156

Query  1653  YFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavali  1474
             +    N+L++ ++  AAV+R++T Y +  L   + +  R+    L +GYN+LD  AVA++
Sbjct  157   FITAGNLLLESIVGTAAVARAWTSYFTSLLNRPS-NSLRIHTS-LHDGYNLLDPIAVAVL  214

Query  1473  illtivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGV  1294
              +   +   ST+ +S +N V +  + V   F+IIAGF    + NL        PFG +GV
Sbjct  215   AIAATIAMISTRHTSSINWVASAINTVVILFVIIAGFIHADTSNLTP----FMPFGAKGV  270

Query  1293  LDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYN  1114
                AAIVYF+Y G+D+++TMAEE  NPSK +P+G++GS+ I+  +YCLMAL+L ++  Y 
Sbjct  271   FQAAAIVYFAYGGFDNIATMAEETKNPSKDIPLGLLGSMSIIMVIYCLMALALSMMQKYT  330

Query  1113  LIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWL  934
              I E  ++S AF+ +G KWA  +V +GA  G+   LLV  LGQARY   + RA ++P W 
Sbjct  331   EIDENAAYSMAFQSVGMKWAKYLVALGALKGMTTVLLVGALGQARYTTHIARAHMIPPWF  390

Query  933   AKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiI  754
             A VHP TGTP+NAT+ + I  A +A F+ L ++  ++S+ TL VF ++A AL+ RRY + 
Sbjct  391   ALVHPKTGTPINATLLITISSAVIAFFSSLDVLASLLSVSTLFVFTMMAVALLVRRYYVR  450

Query  753   NGNPPFQvllflf---lvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRL  598
             +  PP  + + +    ++ +SS+G S  W LN + W      +PL+ FL    T+  +  
Sbjct  451   DKTPPQNLSMLVAFLLIIVASSMGTSAYWGLNPKGWIGYCVTVPLW-FLG---TSGIYYF  506

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             +P  R P+ W VPL+PW  +LSI  N+FLM +L  +A+ RFGI T +M L+Y++ GVH+T
Sbjct  507   LPQQRTPKFWGVPLVPWLPSLSIATNLFLMGSLGAEAFVRFGICTVVMLLYYLLVGVHAT  566

Query  417   YK  412
             Y 
Sbjct  567   YD  568



>ref|XP_008445160.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis melo]
 ref|XP_008445169.1| PREDICTED: cationic amino acid transporter 1-like [Cucumis melo]
Length=581

 Score =   327 bits (838),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 225/540 (42%), Positives = 346/540 (64%), Gaps = 16/540 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y N+L  TP +L  R +       EL +++ RS  +MK+ LTW+DL+  GVG ++G G+F
Sbjct  35    YANALKATPSRLMDRLMTRSAEKTELVEMKARSEHEMKKNLTWWDLIWFGVGAVIGAGIF  94

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG   ++ AGP+V +SY+V+G+SALLS  CYTEF+VE+P AGG+F+YLR+  G+FV +
Sbjct  95    VLTGLETKEHAGPAVVLSYVVSGVSALLSVFCYTEFAVEIPAAGGSFAYLRVELGDFVAF  154

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+ +AAV+RS+T Y +  L   +P+ +R+ +    + YN LD  A+ +II
Sbjct  155   IAAGNILLEYVIGSAAVARSWTSYFA-TLCNHHPNDFRIHIPAFADNYNRLDPIAIVVII  213

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ I    STK SS  N + +I HVV   FI+IAG  K +  N        APFG RG+ 
Sbjct  214   VVCIFAVMSTKGSSRFNYIASILHVVVILFIVIAGLTKANPKNFTP----FAPFGPRGIF  269

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VST+AEE  NP K +P+G+VGS++I ++ YC++A++LCL+ PY  
Sbjct  270   VASAVLFFAYVGFDAVSTLAEETKNPGKDIPIGLVGSMVITTSAYCILAVTLCLMQPYQQ  329

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I E+  FS AF+ +GW WA  +V  GA  G+   LLV+ +GQARYL  + R  +V  W A
Sbjct  330   IDEDAPFSVAFEAVGWSWAKYIVAAGAIKGMTTVLLVSAVGQARYLTHIARTHMVSPWFA  389

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
             KV+  TGTP+NAT  +    A +A FT L I+  ++SI TL +F LVA  LI RRY +  
Sbjct  390   KVNERTGTPVNATASMMAATAVIAFFTSLGILSNLLSISTLFIFMLVAVGLIVRRYYVSG  449

Query  750   GNPPF---QvllflflvsssslgfslSWKLNLQWW----NLPLFGFLTLSFTALFHRLVP  592
                P    ++++ L L+  SS+G +  W L+  W      LP++   TL+        VP
Sbjct  450   ETTPLNRNKLIICLILIIGSSIGTAAYWGLSKGWIGFTVTLPIWFLSTLA----LWLGVP  505

Query  591   CVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
               + P  W VPL+PW  ++SI +N+FL+ +++  ++ RFGIWT ++ ++Y+++G+H++Y 
Sbjct  506   QAKEPRVWGVPLVPWLPSISIAINIFLLGSIDKASFGRFGIWTAVLLVYYLLFGLHASYD  565



>ref|XP_010687039.1| PREDICTED: cationic amino acid transporter 1-like [Beta vulgaris 
subsp. vulgaris]
Length=621

 Score =   328 bits (841),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 223/539 (41%), Positives = 339/539 (63%), Gaps = 7/539 (1%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S Y+ +L  TP + K R L     D EL++V+ +S  +MKR L+W+DL+  GVG ++G G
Sbjct  43    SNYMTALKDTPARFKNRLLTRSLDDTELHQVKAQSHHEMKRSLSWWDLIWFGVGAVIGAG  102

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +FV TG  A + AG +V +SY ++G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+
Sbjct  103   IFVLTGQEANQHAGSAVVLSYAISGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFM  162

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NI+++YV+S AAV+RS+T Y +  L    P  +R+    L   Y+ LD  AV +
Sbjct  163   AFIAAGNIILEYVISGAAVARSWTSYFA-TLCNQEPQTFRITAHNLSPDYSHLDPIAVVV  221

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             II++ IV  +S K SS LN V +I HV+   FIIIAG     + NL        P G RG
Sbjct  222   IIVICIVSVYSVKGSSRLNYVSSIIHVIIIIFIIIAGLTHADTKNLAYFA--TEPNGFRG  279

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             +   +A+++F+Y+G+D+VSTMAEE  NP K +P+G++GS+ IV+  YC+MAL+LCL++PY
Sbjct  280   IFQASAVLFFAYVGFDAVSTMAEETKNPGKDIPIGLIGSMTIVTFAYCVMALTLCLMVPY  339

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
             N I ++  F+ AF+ +G KWA  +V VGA  G+   LLV ++GQARYL  + R  ++P W
Sbjct  340   NQIDKDAPFTLAFEKVGMKWAKYIVAVGALKGMTTVLLVTVIGQARYLTHIARTHMMPPW  399

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---r  766
             LA+V+   GTP+NAT+ + I  A +A FT L I+  ++SI TL +F LVA AL+ R    
Sbjct  400   LAQVNEKLGTPVNATVVMMIATAIIAFFTNLDILSNLLSISTLFIFMLVAVALLVRRYYA  459

Query  765   yaiINGNPPFQvllflflvsssslgfslSW-KLNLQWWNLPLFGFLTLSFTALFHRLVPC  589
               +       + +  + L+  SS+  +  W   +  W    + G      T      VP 
Sbjct  460   SGVTTTRDRNKFITCVVLILGSSIATAAYWGSTHTGWIAYAVTGPTWFIGTLGLQLFVPQ  519

Query  588   VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              R P+ W VPL+PW  + SI +N+FL+ +++  ++ RFGIWT L+ ++Y ++G+H++Y 
Sbjct  520   AREPKVWGVPLVPWLPSASIAVNIFLLGSIDKDSFIRFGIWTCLLMVYYFLFGLHASYD  578



>emb|CDY65339.1| BnaC03g64380D [Brassica napus]
Length=597

 Score =   327 bits (839),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 223/541 (41%), Positives = 347/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +L +TP +   R L       E++ ++ RSG +MK+ LTW+DL+  GVG ++G G+F
Sbjct  34    YFKALKETPSRFVDRLLTRSQDSVEIHDMKARSGHEMKKTLTWWDLMWFGVGAVIGSGIF  93

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR +AGP+V +S++V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  94    VLTGQEARDSAGPAVVVSFVVSGVSAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  153

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NI++ Y++  AAV+RS+T Y +  L    PD +R+  + L E YN LD  +V + +
Sbjct  154   IAAGNIILQYIVGGAAVARSWTSYFATLLNH-KPDDFRIVANSLHEDYNHLDPISVGVCV  212

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
             ++ ++    TK SS+ N + +I H++   FI+IAGF +    N        APFG RGV 
Sbjct  213   IICVLAAIGTKGSSVFNYIASIIHMLVILFIVIAGFIRADFKNY----SDFAPFGARGVF  268

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               A++++F+YIG+D+VSTMAEE  NP + +P+G+VGS+++ +  YCLMA +LCL+ PY +
Sbjct  269   KSASVLFFAYIGFDAVSTMAEETKNPGRDIPIGLVGSMVLTTVCYCLMAAALCLMQPYGM  328

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I  +  FS AF  +GW WA  +V  GA  G+   LLV  +GQARY+  + RA ++P WLA
Sbjct  329   IDPDAPFSVAFSAVGWDWAKYLVAFGALKGMTTVLLVGAIGQARYMTHIARAHMMPPWLA  388

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr---rya  760
              V+  TGTP+NAT+ +    A +A FT+L I+ +++S+ TL +F LVA AL+ R      
Sbjct  389   HVNAKTGTPINATVIMLSATALIAFFTKLGILADLLSVSTLFIFMLVAVALLVRRYYVTG  448

Query  759   iINGNPPFQvllflflvsssslgfslSWKLNLQWW-----NLPLFGFLTLSFTALFHRLV  595
               + +   + L+FL L+ +SS   ++ W L    W      +P++ FL+   TA    LV
Sbjct  449   ETSSSDRTKFLVFLGLILASSAATAVYWALEKDSWIGYCVTVPIW-FLS---TAGMKFLV  504

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
                R P+ W VPL+PW  + SI +N+FL+ +++ K+Y RF IWTG++ ++Y ++G+H+TY
Sbjct  505   AQARAPKLWGVPLVPWLPSASIAINIFLLGSIDAKSYIRFAIWTGVLLVYYFLFGLHATY  564

Query  414   K  412
              
Sbjct  565   D  565



>ref|XP_009362249.1| PREDICTED: cationic amino acid transporter 1-like [Pyrus x bretschneideri]
Length=613

 Score =   328 bits (840),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 226/539 (42%), Positives = 339/539 (63%), Gaps = 13/539 (2%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+N+L QTP +   R L     + EL +V+ RS  +MKR L+W+ L+  G+G ++G G+F
Sbjct  35    YVNALKQTPGRFVDRVLTRSADNTELVEVKARSHHEMKRPLSWWALIWFGLGAVIGAGIF  94

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  AR+ AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  95    VLTGLEAREHAGPAVVLSYVVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  154

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +      + + +R+   G  E Y  LD  AV +II
Sbjct  155   IAAGNILLEYVIGGAAVARSWTSYFTTLCNRSDTNDFRIIAHGFPEDYKYLDPIAVVVII  214

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
              +  +   STK SS LN + +I H++   FI+IAG  K   +N        + FG RGV 
Sbjct  215   GICCLAVLSTKGSSRLNYIASIVHIIVILFIVIAGLTKADINNYRD----FSHFGPRGVF  270

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP+K +P+G+VGS++I + LYCL+A++LCL+ PY  
Sbjct  271   QASAVLFFAYVGFDAVSTMAEETKNPAKDIPIGLVGSMVITTVLYCLLAVTLCLMQPYGQ  330

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I ++  FS AF+ +G  WA  VV  GA  G+ + LLV  +GQARYL  + R  +VP W A
Sbjct  331   IDKQAPFSVAFEDVGMGWAKYVVAAGALKGMTSVLLVGAVGQARYLTHIARTHMVPPWFA  390

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaal------iyr  769
             +V   TGTP+NAT+ +    A +A FT L I+  ++SI TL +F LVA AL      +  
Sbjct  391   QVDFKTGTPVNATVTMLAATAIIAFFTSLDILANLLSISTLFIFSLVAIALLVRRYYVSS  450

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQWWNLPLFGFLTLSFTALFHRLVPC  589
                  N N   + + FLF++ SSS+  S+ W     W    +   L    T     LVP 
Sbjct  451   VTTQANRN---KFVAFLFIIISSSIATSVYWSRTDDWTAYVVTAPLWFLGTLGIWLLVPQ  507

Query  588   VRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
              R P+ W VPL+PW  +LSI +N+FL+ +++  ++ RFG+WT ++ ++Y ++G+H++Y 
Sbjct  508   ARSPKLWGVPLVPWLPSLSIAINIFLLGSIDHASFIRFGVWTLIILVYYFIFGLHASYD  566



>ref|XP_004164930.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Cucumis 
sativus]
Length=630

 Score =   328 bits (840),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 229/542 (42%), Positives = 331/542 (61%), Gaps = 15/542 (3%)
 Frame = -2

Query  2016  STYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvg  1837
             S+Y  +LSQT  +LK R L   + D EL ++   SG  MK+ LTW+DL+ L  G ++G G
Sbjct  39    SSYKYALSQTCSRLKDRLLDRSSDDNELIELPKASGIGMKKCLTWWDLIWLAFGSVVGSG  98

Query  1836  vfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFV  1657
             +F  TG  AR  AGPS+ ISY+V+GLSALLS  CY+EF++EVPVAGG+FS+LRI  G+F+
Sbjct  99    IFTITGLEARDDAGPSIVISYVVSGLSALLSVFCYSEFAIEVPVAGGSFSFLRIELGDFI  158

Query  1656  GYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPaval  1477
              + A  NI ++ ++  A + RS++ Y +  +   NPD  R KV  L EG+N+LD  AV +
Sbjct  159   AFIAAGNIFLEAIVGAAGLGRSWSSYFASMINSDNPDFLRFKVSFLSEGFNLLDPIAVIV  218

Query  1476  iilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRG  1297
             +++   +    T+ +S L  + ++   +   F+I+ GF KG+S NLV       PFG RG
Sbjct  219   LLVANGIAVSGTRRTSFLTWITSVISTLLIIFVIVIGFVKGNSANLVP----FFPFGARG  274

Query  1296  VLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPY  1117
             V   AA+VY+SY G+D V+TMAEE   PS+ +PVG++GS+ ++S +YCLMALSL +L  Y
Sbjct  275   VFRAAAVVYWSYTGFDMVATMAEETKKPSRDIPVGLIGSMSVISVIYCLMALSLTMLQKY  334

Query  1116  NLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSW  937
               I    +FS AF  +G  WA  +V + A  G+  SLLV  +GQARY   + RA L+P  
Sbjct  335   TEIDRNAAFSVAFDKIGMTWAKYLVSIVAIKGMTTSLLVGSMGQARYTTQIARAHLIPPL  394

Query  936   LAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryai  757
              A VHP TGTP+ AT+   I  A VALF+ L ++  + S  TL +F L+A AL+ RRY  
Sbjct  395   FALVHPKTGTPVYATLLTTITSAIVALFSSLDVLSSVFSFSTLAIFMLMAVALLVRRYYN  454

Query  756   INGNPP---FQvllflflvsssslgfslSWKLNLQWW---NLPL-FGFLTLSFTALFHRL  598
              +  P     + L+ LF +  S L  +  W L+ Q W    +P  F FL    + L    
Sbjct  455   KDTTPSSDYIKFLICLFSILGSCLALTTVWNLDRQGWIEYVVPASFWFL----STLAMSF  510

Query  597   VPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHST  418
             +P  R P+ W VPL+PW  +LSI +N+ L+ +L  +A+ RF I + +M L+Y+  G+H+T
Sbjct  511   LPKYRSPKVWGVPLVPWLPSLSIGMNLILIGSLGTEAFLRFFICSAVMLLYYLFIGLHAT  570

Query  417   YK  412
             Y 
Sbjct  571   YD  572



>ref|XP_010241173.1| PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera]
 ref|XP_010241174.1| PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera]
 ref|XP_010241175.1| PREDICTED: cationic amino acid transporter 1-like [Nelumbo nucifera]
Length=585

 Score =   326 bits (836),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 227/541 (42%), Positives = 347/541 (64%), Gaps = 17/541 (3%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y  +LSQT  +LK R L     + E++++R RS  DMK+ L+W+DL+  G+G ++G G+F
Sbjct  32    YAKALSQTGLRLKDRILTRSLDETEIHEIRARSQHDMKKNLSWWDLIWFGIGAVIGAGIF  91

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG   +  AGP+V +SY+V+G+SA+LS  CYTEF+VE+PVAGG+F+YLR+  G+F+ +
Sbjct  92    VLTGLEVKSVAGPAVVLSYVVSGISAMLSVFCYTEFAVEIPVAGGSFAYLRVELGDFMAF  151

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              AG NIL++Y++  AAV+RS+T Y +  L   +P+ +R+ V  L E Y  LD  +V +II
Sbjct  152   IAGGNILLEYIIGGAAVARSWTSYFA-TLCNHDPNDFRIHVHQLGEDYGYLDPISVGVII  210

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
              + I+   STK SS LN + +I HV+   FII+AGF K  + N         PFG RG+ 
Sbjct  211   GICILAVLSTKGSSRLNYIASIVHVIIIIFIIVAGFIKADTKNYTP----FTPFGARGIF  266

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP+K +P+G+VGS+LI +  YCLMA++LCL+ PY+ 
Sbjct  267   KASAVLFFAYVGFDAVSTMAEETKNPAKDIPIGLVGSMLITTTAYCLMAVTLCLMQPYSQ  326

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             + E+ +FS AF+ +G  WA  +V VGA  G+   LLV  +GQARYL  + R  +VP W A
Sbjct  327   VNEDAAFSVAFQAVGMNWAKYIVAVGALKGMTTVLLVNAVGQARYLTHIARTHMVPPWFA  386

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrryaiIN  751
              V+  TGTP+NATI + +  A +  FT+L I+  ++SI TL +F LVA AL+ RRY +  
Sbjct  387   HVNEKTGTPINATIVMLLATAIIGFFTKLDILSNLLSISTLFIFMLVAVALLVRRYYVTG  446

Query  750   GNPPFQvllflflvss---sslgfslSWKLNLQWWNL-----PLFGFLTLSFTALFHRLV  595
                     + +  +     SS+  ++ W  N   +       P++   TLS        V
Sbjct  447   VTSSVHRNVLILCILFILGSSVAAAVYWATNETGYIAYIIIGPIWFLATLSLQV----FV  502

Query  594   PCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTY  415
             P  R P+ W VPL+PW  + SI +N+FL+ +++ K++ RFG+W+G + L+Y+ +G+H++Y
Sbjct  503   PQARDPKLWGVPLVPWLPSASIAINIFLLGSIDGKSFMRFGVWSGFLLLYYLFFGLHASY  562

Query  414   K  412
              
Sbjct  563   D  563



>ref|XP_008383406.1| PREDICTED: cationic amino acid transporter 1-like [Malus domestica]
Length=614

 Score =   327 bits (838),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 225/548 (41%), Positives = 341/548 (62%), Gaps = 31/548 (6%)
 Frame = -2

Query  2010  YLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgvgvf  1831
             Y+++L QTP +   R L       EL +++ RS  +MK+ L W+DL+  G+G ++G G+F
Sbjct  36    YVHALCQTPGRFVDRVLTRSADSTELVEMKARSHNEMKKTLNWWDLIWFGLGAVIGAGIF  95

Query  1830  VTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEFVGY  1651
             V TG  A+  AGP+V +SY+V+G+SALLS  CYTEF+VE+PVAGG+F+YLR+  G+FV +
Sbjct  96    VLTGLEAKNHAGPAVVLSYVVSGVSALLSVFCYTEFAVEIPVAGGSFAYLRVELGDFVAF  155

Query  1650  FAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPavalii  1471
              A  NIL++YV+  AAV+RS+T Y +      + + +R+    L E Y  LD  AV +II
Sbjct  156   IAAGNILLEYVIGGAAVARSWTSYFTTLCNRSDTNDFRIVAHDLPEDYRFLDPIAVVVII  215

Query  1470  lltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVRGVL  1291
              +  +   STK SS LN + +I HV+   FIIIAG  K  + N +      APFG RGV 
Sbjct  216   GICCLAVLSTKGSSRLNYIASIVHVIVIIFIIIAGLTKADTKNYID----FAPFGPRGVF  271

Query  1290  DGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLPYNL  1111
               +A+++F+Y+G+D+VSTMAEE  NP++ +P+G+VGS++I + +YCL+A++LCL+ PY  
Sbjct  272   QASAVLFFAYVGFDAVSTMAEETKNPARDIPIGLVGSMVITTVVYCLLAVTLCLMQPYGS  331

Query  1110  IPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPSWLA  931
             I E+  FS AF+ +G  WA  +V  GA  G+ + LLV  +GQARYL  + R  +VP W A
Sbjct  332   IDEQAPFSVAFEAVGMGWAKYIVAAGALKGMTSVLLVGAVGQARYLTHIARTHMVPPWFA  391

Query  930   KVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyr------  769
             +V   TGTP+NAT+ +    A +A F+ L ++  ++SI TL +F LVA AL+ R      
Sbjct  392   QVDSKTGTPVNATVTMLAATAIIAFFSSLDVLANLLSISTLFIFSLVAMALLVRRYYVSG  451

Query  768   ryaiINGNPPFQvllflflvsssslgfslSWKLNLQW---------WNLPLFGFLTLSFT  616
                  N N   + + FLF++ +SS+  S+ W    +W         W L  FG       
Sbjct  452   VTTQANRN---KFIAFLFIIITSSIATSIYWSRTDKWTAYVVTAPLWFLGTFGIWL----  504

Query  615   ALFHRLVPCVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVV  436
                  LVP  R P+ W VPL+PW  +LSI +N+FL+ +++  ++ RFG+WT ++ ++Y  
Sbjct  505   -----LVPQARDPKLWGVPLVPWLPSLSIAINIFLLGSIDHASFVRFGVWTVIILVYYFF  559

Query  435   YGVHSTYK  412
             +G+H++Y 
Sbjct  560   FGLHASYD  567



>ref|XP_008356194.1| PREDICTED: cationic amino acid transporter 8, vacuolar-like [Malus 
domestica]
Length=589

 Score =   326 bits (836),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 228/540 (42%), Positives = 340/540 (63%), Gaps = 9/540 (2%)
 Frame = -2

Query  2019  FSTYLNSLSQTPKKLKKRALATWTPDQELNKVRLRSGADMKRKLTWYDlvalgvggmlgv  1840
             F++Y ++LS TP +LK R     +   EL ++  +S   MKR LTW+DL+ LGVG ++G 
Sbjct  36    FNSYKDALSHTPSRLKDRLFHRSSDSFELLQLPKQSENRMKRCLTWWDLIWLGVGSVVGS  95

Query  1839  gvfVTTGPVARKTAGPSVFISYIVAGLSALLSSLCYTEFSVEVPVAGGAFSYLRITFGEF  1660
             G+FV TG   R  AGP++ +SY ++G SALLS LCY+EF+VEVPVAGG+FSYLRI  G+F
Sbjct  96    GIFVITGQATRXNAGPAIVLSYAISGFSALLSVLCYSEFAVEVPVAGGSFSYLRIELGDF  155

Query  1659  VGYFAGANILMDYVLSNAAVSRSFTEYLSYALGEGNPDCWRVKVDGLMEGYNMLDFPava  1480
             V + A  NIL++ ++ +A + RS++ Y +  L   + D  R++V  L +G+N+LD  AV 
Sbjct  156   VAFIAXGNILLEALVGSAGLGRSWSSYFASILRTDDTDFLRIRVKSLPDGFNLLDPIAVV  215

Query  1479  liilltivLCHSTKESSLLNLVMTifhvvffgfiiiagFYKGSSDNLVKSGGGLAPFGVR  1300
             ++++   +    T+ +S+LN + +I   +   FI+I GF KG ++NLV       P+G +
Sbjct  216   VLLVANXIAISGTRRTSVLNWIASIASGLIIVFILIVGFVKGKTENLVP----FFPYGAK  271

Query  1299  GVLDGAAIVYFSYIGYDSVSTMAEEITNPSKSLPVGIVGSVLIVsalyclmalslcllLP  1120
             GV + AA+VY+SY G+D V+ MAEE   PS+ +PVG+VGS+ +++ +YCLMAL L ++  
Sbjct  272   GVFEAAAVVYWSYTGFDMVANMAEEAKKPSRDIPVGLVGSMSLITVVYCLMALVLSMMQK  331

Query  1119  YNLIPEEGSFSAAFKMMGWKWASNVVGVGASLGIVASLLVAMLGQARYLCVVGRARLVPS  940
             Y  I ++ ++S AF+ +G  WA  +V + A  G+  SLLV  +GQARY   + RA ++  
Sbjct  332   YTQIDKDAAYSVAFEAIGMSWAKYLVSICALKGMTTSLLVGSMGQARYTTQIARAHMISP  391

Query  939   WLAKVHPSTGTPLNATIFLGICQASVALFTELKIVIEIISIGTLVVFylvaaaliyrrya  760
             W A VHP TGTP+ AT  + +  A VALFT L ++  + S  TL +F  VA AL+ RRY 
Sbjct  392   WFALVHPKTGTPIYATALVTLISAVVALFTSLDVLSSVFSFSTLCIFMFVAIALLVRRYY  451

Query  759   iINGNPPF---QvllflflvsssslgfslSWKLNLQWWN-LPLFGFLTLSFTALFHRLVP  592
             + +  P     Q L+ LFL+   S G +  W   ++ W    +F  + LS T L+  L+P
Sbjct  452   VKDVTPTIDLVQFLVCLFLIIGGSTGITAVWDKGMRGWVWYVVFSVIWLSGT-LWMALLP  510

Query  591   CVRRPESWSVPLMPWPAALSIFLNVFLMTTLNVKAYKRFGIWTGLMSLFYVVYGVHSTYK  412
               R P+ W VPL+PW  ALSI +NVFL+ +L   A+ RF I T +M L+Y+  GVH+TY 
Sbjct  511   KHRVPKVWGVPLVPWLPALSIGINVFLIGSLGYVAFWRFFICTAVMVLYYLFVGVHATYD  570



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6330540990048