BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26815_g1_i1 len=1358 path=[1:0-1357]

Length=1358
                                                                      Score     E

ref|XP_011074698.1|  PREDICTED: GDSL esterase/lipase EXL3-like          489   3e-168   
ref|XP_009772833.1|  PREDICTED: GDSL esterase/lipase EXL3               486   4e-167   
ref|XP_009768390.1|  PREDICTED: GDSL esterase/lipase EXL3-like          478   1e-163   
ref|XP_009617736.1|  PREDICTED: GDSL esterase/lipase EXL3-like          476   4e-163   
ref|XP_009614809.1|  PREDICTED: GDSL esterase/lipase EXL3-like          469   3e-160   
ref|XP_009594700.1|  PREDICTED: GDSL esterase/lipase EXL3-like          467   3e-159   
ref|XP_010320438.1|  PREDICTED: GDSL esterase/lipase EXL3 isoform X1    465   1e-158   
ref|XP_009627260.1|  PREDICTED: GDSL esterase/lipase EXL3-like          461   7e-157   
ref|XP_009779479.1|  PREDICTED: GDSL esterase/lipase EXL3-like          461   1e-156   
ref|XP_009627261.1|  PREDICTED: GDSL esterase/lipase EXL3-like          460   1e-156   
ref|XP_009786862.1|  PREDICTED: GDSL esterase/lipase EXL3-like          459   4e-156   
ref|XP_006342238.1|  PREDICTED: uncharacterized protein LOC102603803    471   2e-155   
ref|XP_009786860.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    456   5e-155   
emb|CDP07368.1|  unnamed protein product                                449   5e-152   
ref|XP_006342563.1|  PREDICTED: GDSL esterase/lipase EXL3-like          446   7e-151   
gb|KHN45938.1|  GDSL esterase/lipase EXL3                               446   7e-151   
gb|KHN09073.1|  GDSL esterase/lipase EXL3                               444   1e-150   
gb|AFK34909.1|  unknown                                                 444   4e-150   
ref|XP_010061080.1|  PREDICTED: GDSL esterase/lipase EXL3-like          443   6e-150   
gb|ACU24478.1|  unknown                                                 443   8e-150   Glycine max [soybeans]
ref|XP_011003064.1|  PREDICTED: GDSL esterase/lipase EXL3-like          443   1e-149   
ref|XP_008221228.1|  PREDICTED: GDSL esterase/lipase EXL3-like          442   2e-149   
ref|XP_010692505.1|  PREDICTED: GDSL esterase/lipase EXL3-like          442   3e-149   
ref|XP_004252803.2|  PREDICTED: GDSL esterase/lipase EXL3-like is...    441   4e-149   
ref|XP_006342239.1|  PREDICTED: GDSL esterase/lipase EXL3-like          441   6e-149   
ref|XP_002306948.2|  family II extracellular lipase 3 family protein    439   4e-148   Populus trichocarpa [western balsam poplar]
gb|AES59777.2|  GDSL-like lipase/acylhydrolase                          440   3e-147   
gb|KDO84926.1|  hypothetical protein CISIN_1g017687mg                   436   5e-147   
ref|XP_003603782.1|  GDSL esterase/lipase EXL3                          436   8e-147   
ref|XP_009622933.1|  PREDICTED: GDSL esterase/lipase EXL3-like          435   1e-146   
ref|XP_007160639.1|  hypothetical protein PHAVU_001G004300g             435   1e-146   
ref|XP_003589526.1|  GDSL esterase/lipase                               440   2e-146   
gb|AFK48612.1|  unknown                                                 434   2e-146   
ref|XP_003589534.1|  GDSL esterase/lipase                               432   1e-145   
ref|XP_008221227.1|  PREDICTED: GDSL esterase/lipase EXL3-like          432   3e-145   
ref|XP_002279381.1|  PREDICTED: GDSL esterase/lipase EXL3               431   3e-145   Vitis vinifera
ref|XP_007136105.1|  hypothetical protein PHAVU_009G018200g             431   4e-145   
gb|KHN09074.1|  GDSL esterase/lipase EXL3                               430   4e-145   
ref|XP_006435224.1|  hypothetical protein CICLE_v10001578mg             431   7e-145   
ref|XP_009776282.1|  PREDICTED: GDSL esterase/lipase EXL3-like          431   7e-145   
ref|XP_007017868.1|  JHL20J20.8 protein                                 430   8e-145   
ref|XP_002279353.2|  PREDICTED: GDSL esterase/lipase EXL3               430   8e-145   Vitis vinifera
ref|XP_007160640.1|  hypothetical protein PHAVU_001G004400g             429   4e-144   
ref|XP_003634393.1|  PREDICTED: GDSL esterase/lipase EXL3-like          428   6e-144   
emb|CBI19908.3|  unnamed protein product                                428   1e-143   
ref|XP_010105284.1|  GDSL esterase/lipase EXL3                          426   3e-143   
ref|XP_002301955.2|  family II extracellular lipase 3 family protein    427   6e-143   Populus trichocarpa [western balsam poplar]
ref|XP_006435222.1|  hypothetical protein CICLE_v10001561mg             425   1e-142   
ref|XP_003550433.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    425   1e-142   
ref|XP_003545022.1|  PREDICTED: GDSL esterase/lipase EXL3               424   2e-142   
ref|XP_006435221.1|  hypothetical protein CICLE_v10003119mg             423   3e-142   
ref|XP_011034987.1|  PREDICTED: GDSL esterase/lipase EXL3-like          425   3e-142   
ref|XP_006473698.1|  PREDICTED: GDSL esterase/lipase EXL1-like          436   4e-142   
gb|KHN39410.1|  GDSL esterase/lipase EXL3                               422   5e-142   
gb|KHN12627.1|  GDSL esterase/lipase EXL3                               421   1e-141   
gb|KDO84924.1|  hypothetical protein CISIN_1g042648mg                   422   1e-141   
gb|ACU19367.1|  unknown                                                 422   1e-141   Glycine max [soybeans]
ref|XP_009605224.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     423   1e-141   
ref|XP_006473907.1|  PREDICTED: GDSL esterase/lipase EXL3-like          422   1e-141   
gb|KHG24596.1|  GDSL esterase/lipase EXL3 -like protein                 421   2e-141   
ref|XP_009605226.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    421   3e-141   
ref|XP_003589528.1|  GDSL esterase/lipase                               421   6e-141   
ref|XP_002279335.1|  PREDICTED: GDSL esterase/lipase EXL3               419   1e-140   Vitis vinifera
ref|XP_008221397.1|  PREDICTED: GDSL esterase/lipase EXL3-like          419   1e-140   
ref|XP_008445321.1|  PREDICTED: GDSL esterase/lipase EXL3-like          419   3e-140   
emb|CBI19910.3|  unnamed protein product                                418   3e-140   
ref|XP_003550432.1|  PREDICTED: GDSL esterase/lipase EXL3-like          416   3e-139   
ref|XP_003544388.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    416   3e-139   
ref|XP_010266339.1|  PREDICTED: GDSL esterase/lipase EXL3-like          416   3e-139   
ref|XP_002510573.1|  zinc finger protein, putative                      427   4e-139   Ricinus communis
ref|XP_010539839.1|  PREDICTED: GDSL esterase/lipase EXL3-like          416   5e-139   
ref|XP_007225000.1|  hypothetical protein PRUPE_ppa020405mg             414   1e-138   
ref|XP_006601361.1|  PREDICTED: GDSL esterase/lipase EXL1-like          415   1e-138   
ref|XP_006596537.1|  PREDICTED: GDSL esterase/lipase EXL1-like          414   1e-138   
ref|XP_004499293.1|  PREDICTED: GDSL esterase/lipase EXL3-like          414   1e-138   
ref|XP_006390257.1|  hypothetical protein EUTSA_v10018728mg             414   1e-138   
ref|XP_002270500.1|  PREDICTED: GDSL esterase/lipase EXL3               414   1e-138   Vitis vinifera
gb|KHN39412.1|  GDSL esterase/lipase EXL1                               414   2e-138   
ref|XP_010416497.1|  PREDICTED: GDSL esterase/lipase EXL1-like          414   3e-138   
ref|XP_008221398.1|  PREDICTED: GDSL esterase/lipase EXL3-like          414   3e-138   
emb|CAN73607.1|  hypothetical protein VITISV_035505                     413   3e-138   Vitis vinifera
ref|XP_010471731.1|  PREDICTED: GDSL esterase/lipase EXL1-like is...    414   3e-138   
ref|XP_003603778.1|  GDSL esterase/lipase                               412   5e-138   
ref|XP_009757107.1|  PREDICTED: uncharacterized protein LOC104210014    425   5e-138   
gb|ACU20672.1|  unknown                                                 413   5e-138   Glycine max [soybeans]
emb|CDY70534.1|  BnaAnng34060D                                          413   6e-138   
gb|KDP36891.1|  hypothetical protein JCGZ_08182                         412   6e-138   
ref|XP_009336671.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    426   7e-138   
ref|XP_010428638.1|  PREDICTED: GDSL esterase/lipase EXL1-like          412   9e-138   
ref|XP_006302332.1|  hypothetical protein CARUB_v10020390mg             414   1e-137   
ref|XP_008242093.1|  PREDICTED: GDSL esterase/lipase EXL3-like          412   1e-137   
ref|XP_007136104.1|  hypothetical protein PHAVU_009G018100g             411   2e-137   
ref|XP_008350488.1|  PREDICTED: GDSL esterase/lipase EXL3-like          412   3e-137   
ref|XP_008387915.1|  PREDICTED: GDSL esterase/lipase EXL3-like          411   3e-137   
ref|XP_004142994.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    411   4e-137   
ref|XP_004238377.2|  PREDICTED: GDSL esterase/lipase EXL3-like          412   4e-137   
ref|XP_011083479.1|  PREDICTED: uncharacterized protein LOC105166004    422   6e-137   
ref|XP_009334750.1|  PREDICTED: GDSL esterase/lipase EXL3-like          410   8e-137   
emb|CDX85928.1|  BnaC06g22060D                                          410   1e-136   
gb|KFK42027.1|  hypothetical protein AALP_AA2G202600                    409   2e-136   
ref|XP_004292937.1|  PREDICTED: uncharacterized protein LOC101306013    422   2e-136   
ref|XP_004499292.1|  PREDICTED: GDSL esterase/lipase EXL1-like          409   2e-136   
ref|XP_010664850.1|  PREDICTED: uncharacterized protein LOC100264374    421   2e-136   
ref|XP_003589529.1|  GDSL esterase/lipase                               408   4e-136   
emb|CBI19913.3|  unnamed protein product                                407   4e-136   
gb|KFK42028.1|  hypothetical protein AALP_AA2G202700                    408   5e-136   
ref|XP_008387913.1|  PREDICTED: GDSL esterase/lipase EXL3-like          408   5e-136   
ref|XP_004499298.1|  PREDICTED: GDSL esterase/lipase EXL1-like          407   5e-136   
ref|XP_010471732.1|  PREDICTED: GDSL esterase/lipase EXL1-like is...    408   6e-136   
ref|XP_007160641.1|  hypothetical protein PHAVU_001G004500g             408   6e-136   
ref|NP_974149.1|  GDSL esterase/lipase EXL1                             408   7e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266839.1|  PREDICTED: GDSL esterase/lipase EXL3-like          419   8e-136   
ref|XP_009106246.1|  PREDICTED: GDSL esterase/lipase EXL2               407   1e-135   
emb|CDX73210.1|  BnaC06g36580D                                          407   2e-135   
gb|EYU38779.1|  hypothetical protein MIMGU_mgv1a026265mg                405   2e-135   
gb|KHN09072.1|  GDSL esterase/lipase                                    405   4e-135   
ref|XP_009106244.1|  PREDICTED: GDSL esterase/lipase EXL1 isoform X1    405   4e-135   
ref|XP_010105283.1|  GDSL esterase/lipase EXL3                          405   4e-135   
ref|XP_008393902.1|  PREDICTED: GDSL esterase/lipase EXL3-like          405   1e-134   
emb|CDX87652.1|  BnaA07g32210D                                          404   1e-134   
ref|NP_565120.1|  GDSL esterase/lipase EXL1                             404   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536419.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     416   2e-134   
ref|XP_006301398.1|  hypothetical protein CARUB_v10021812mg             404   3e-134   
ref|XP_009363463.1|  PREDICTED: GDSL esterase/lipase EXL3-like          403   4e-134   
ref|XP_004499299.1|  PREDICTED: GDSL esterase/lipase EXL1-like          403   4e-134   
ref|XP_010033517.1|  PREDICTED: GDSL esterase/lipase EXL3-like          403   5e-134   
ref|XP_010428639.1|  PREDICTED: GDSL esterase/lipase EXL2-like          402   7e-134   
ref|XP_009379345.1|  PREDICTED: GDSL esterase/lipase EXL3-like          402   1e-133   
ref|XP_009363464.1|  PREDICTED: GDSL esterase/lipase EXL3-like          402   1e-133   
gb|KHN45939.1|  GDSL esterase/lipase                                    401   1e-133   
ref|XP_008363081.1|  PREDICTED: GDSL esterase/lipase EXL3-like          402   1e-133   
ref|XP_009379346.1|  PREDICTED: GDSL esterase/lipase EXL3-like          401   2e-133   
ref|XP_006302445.1|  hypothetical protein CARUB_v10020529mg             399   8e-133   
ref|XP_010266840.1|  PREDICTED: GDSL esterase/lipase EXL3-like          400   8e-133   
ref|XP_007224778.1|  hypothetical protein PRUPE_ppa023913mg             397   8e-133   
ref|XP_006596538.1|  PREDICTED: GDSL esterase/lipase EXL3-like          399   9e-133   
gb|KDP23987.1|  hypothetical protein JCGZ_25375                         398   9e-133   
ref|XP_010034703.1|  PREDICTED: GDSL esterase/lipase EXL3-like          399   1e-132   
ref|XP_010314650.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    397   2e-132   
gb|KCW53198.1|  hypothetical protein EUGRSUZ_J02472                     398   3e-132   
gb|KDP23988.1|  hypothetical protein JCGZ_25376                         397   4e-132   
ref|XP_010416498.1|  PREDICTED: GDSL esterase/lipase EXL2               397   5e-132   
gb|AES59784.2|  GDSL-like lipase/acylhydrolase                          399   5e-132   
ref|NP_177718.1|  GDSL esterase/lipase EXL3                             397   1e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008354621.1|  PREDICTED: GDSL esterase/lipase EXL3-like          397   1e-131   
ref|XP_008357124.1|  PREDICTED: GDSL esterase/lipase EXL3-like          397   2e-131   
ref|XP_010320440.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    396   3e-131   
ref|XP_009104692.1|  PREDICTED: GDSL esterase/lipase EXL3-like          395   3e-131   
ref|XP_006425399.1|  hypothetical protein CICLE_v10025900mg             395   5e-131   
ref|XP_009334746.1|  PREDICTED: GDSL esterase/lipase EXL3-like          395   5e-131   
ref|XP_010033516.1|  PREDICTED: GDSL esterase/lipase EXL3-like          395   6e-131   
dbj|BAC41809.1|  putative family II lipase EXL3                         395   6e-131   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85929.1|  BnaC06g22050D                                          394   8e-131   
ref|NP_001077829.1|  GDSL esterase/lipase EXL2                          394   2e-130   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28470.1|  unknown                                                 394   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336660.1|  PREDICTED: GDSL esterase/lipase EXL1-like          393   3e-130   
ref|XP_006601360.1|  PREDICTED: GDSL esterase/lipase EXL3-like          393   4e-130   
emb|CDX68113.1|  BnaA07g21530D                                          393   4e-130   
ref|XP_008387914.1|  PREDICTED: GDSL esterase/lipase EXL3-like          392   6e-130   
ref|XP_003589533.1|  GDSL esterase/lipase                               397   7e-130   
gb|KHN39411.1|  GDSL esterase/lipase EXL3                               390   8e-130   
ref|XP_010428640.1|  PREDICTED: GDSL esterase/lipase EXL3-like          392   1e-129   
ref|XP_010471733.1|  PREDICTED: GDSL esterase/lipase EXL1-like is...    391   2e-129   
ref|XP_007160642.1|  hypothetical protein PHAVU_001G004600g             391   2e-129   
ref|XP_009106247.1|  PREDICTED: GDSL esterase/lipase EXL3               391   2e-129   
emb|CDX73211.1|  BnaC06g36590D                                          391   2e-129   
ref|XP_006390254.1|  hypothetical protein EUTSA_v10018754mg             390   5e-129   
ref|XP_007136106.1|  hypothetical protein PHAVU_009G018300g             389   9e-129   
dbj|BAJ53101.1|  JHL20J20.8                                             399   1e-128   
ref|XP_008344249.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    388   2e-128   
ref|XP_002887618.1|  T4O12.12                                           398   4e-128   
ref|XP_010471741.1|  PREDICTED: GDSL esterase/lipase EXL3-like          387   5e-128   
ref|XP_008344250.1|  PREDICTED: GDSL esterase/lipase EXL3-like          387   7e-128   
ref|NP_565121.1|  GDSL esterase/lipase EXL2                             386   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416499.1|  PREDICTED: GDSL esterase/lipase EXL3               385   2e-127   
ref|XP_010920107.1|  PREDICTED: GDSL esterase/lipase EXL3               385   3e-127   
gb|EYU38777.1|  hypothetical protein MIMGU_mgv1a009038mg                384   8e-127   
ref|XP_002887619.1|  T4O12.13                                           395   1e-126   
ref|XP_007156185.1|  hypothetical protein PHAVU_003G265500g             384   1e-126   
ref|XP_010026063.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     383   1e-126   
ref|XP_009385168.1|  PREDICTED: GDSL esterase/lipase EXL3-like          383   2e-126   
ref|XP_009379344.1|  PREDICTED: GDSL esterase/lipase EXL3-like          384   2e-126   
ref|XP_003527436.1|  PREDICTED: GDSL esterase/lipase EXL3-like          383   3e-126   
ref|XP_004240848.2|  PREDICTED: uncharacterized protein LOC101249647    402   4e-126   
ref|XP_009400370.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     382   4e-126   
ref|XP_008440851.1|  PREDICTED: GDSL esterase/lipase EXL3-like          382   7e-126   
ref|XP_007046630.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    382   1e-125   
ref|XP_007046631.1|  Serine transhydroxymethyltransferase 1 isofo...    382   2e-125   
ref|NP_001242335.1|  uncharacterized protein LOC100810354               380   2e-125   
gb|KHN41131.1|  GDSL esterase/lipase EXL3                               380   2e-125   
ref|XP_003527440.1|  PREDICTED: GDSL esterase/lipase EXL3-like          380   3e-125   
ref|XP_010920106.1|  PREDICTED: GDSL esterase/lipase EXL3-like          381   3e-125   
ref|XP_010680078.1|  PREDICTED: uncharacterized protein LOC104895310    394   3e-125   
ref|XP_007157889.1|  hypothetical protein PHAVU_002G106300g             380   3e-125   
ref|XP_008807138.1|  PREDICTED: GDSL esterase/lipase EXL3               380   3e-125   
ref|XP_010026062.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     379   4e-125   
ref|XP_010679879.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    380   4e-125   
ref|XP_004287786.1|  PREDICTED: GDSL esterase/lipase EXL3-like          379   7e-125   
ref|XP_010934102.1|  PREDICTED: GDSL esterase/lipase EXL3-like          379   8e-125   
gb|KFK42029.1|  hypothetical protein AALP_AA2G202800                    379   9e-125   
ref|XP_004134848.1|  PREDICTED: GDSL esterase/lipase EXL3-like          379   1e-124   
gb|EYU38772.1|  hypothetical protein MIMGU_mgv1a008997mg                378   1e-124   
ref|XP_008807139.1|  PREDICTED: GDSL esterase/lipase EXL3-like          378   2e-124   
ref|XP_004158854.1|  PREDICTED: GDSL esterase/lipase EXL3-like          378   3e-124   
ref|XP_003612218.1|  GDSL esterase/lipase                               377   6e-124   
gb|KHN41128.1|  GDSL esterase/lipase EXL3                               377   7e-124   
ref|XP_010266977.1|  PREDICTED: GDSL esterase/lipase At3g14820-like     387   7e-124   
ref|XP_007223323.1|  hypothetical protein PRUPE_ppa009528mg             373   2e-123   
ref|XP_010029654.1|  PREDICTED: GDSL esterase/lipase EXL3-like          376   2e-123   
ref|XP_006574669.1|  PREDICTED: GDSL esterase/lipase EXL3-like          375   2e-123   
ref|XP_003612217.1|  GDSL esterase/lipase                               375   3e-123   
gb|KHN00457.1|  GDSL esterase/lipase EXL3                               375   3e-123   
ref|XP_004512156.1|  PREDICTED: GDSL esterase/lipase EXL3-like          374   8e-123   
emb|CDX87653.1|  BnaA07g32200D                                          371   2e-122   
ref|XP_007132710.1|  hypothetical protein PHAVU_011G118200g             373   2e-122   
ref|XP_003527438.1|  PREDICTED: GDSL esterase/lipase EXL3-like          373   3e-122   
gb|AAF79814.1|AC007396_7  T4O12.12                                      383   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199032.2|  GDSL esterase/lipase                                  372   5e-122   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79815.1|AC007396_8  T4O12.13                                      384   8e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289076.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    370   2e-121   
ref|XP_009106245.1|  PREDICTED: GDSL esterase/lipase EXL1 isoform X2    368   3e-121   
ref|XP_008806618.1|  PREDICTED: GDSL esterase/lipase EXL3-like          369   4e-121   
ref|XP_003571815.1|  PREDICTED: GDSL esterase/lipase EXL3-like          369   8e-121   
gb|KCW58232.1|  hypothetical protein EUGRSUZ_H00934                     366   3e-120   
ref|XP_010933356.1|  PREDICTED: GDSL esterase/lipase EXL3-like          367   4e-120   
ref|XP_004983037.1|  PREDICTED: GDSL esterase/lipase EXL3-like          367   5e-120   
ref|XP_009786861.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    364   5e-120   
emb|CDP07367.1|  unnamed protein product                                367   6e-120   
ref|XP_009398920.1|  PREDICTED: GDSL esterase/lipase EXL3-like          367   6e-120   
ref|XP_010320539.1|  PREDICTED: GDSL esterase/lipase EXL3-like          375   6e-120   
gb|KHN35532.1|  GDSL esterase/lipase EXL3                               365   7e-120   
ref|XP_003548834.1|  PREDICTED: GDSL esterase/lipase EXL3-like          365   2e-119   
ref|XP_006342070.1|  PREDICTED: GDSL esterase/lipase EXL3-like          364   4e-119   
ref|XP_010935130.1|  PREDICTED: GDSL esterase/lipase EXL3-like          363   2e-118   
ref|NP_001150849.1|  anther-specific proline-rich protein APG pre...    363   2e-118   Zea mays [maize]
emb|CBI19911.3|  unnamed protein product                                360   3e-118   
ref|XP_008809448.1|  PREDICTED: uncharacterized protein LOC103721152    378   3e-118   
ref|XP_010266838.1|  PREDICTED: GDSL esterase/lipase EXL3-like          362   4e-118   
ref|XP_007223325.1|  hypothetical protein PRUPE_ppa009531mg             359   5e-118   
gb|EPS65517.1|  hypothetical protein M569_09255                         360   6e-118   
gb|EMT27012.1|  GDSL esterase/lipase EXL3                               362   8e-118   
ref|XP_002464577.1|  hypothetical protein SORBIDRAFT_01g021130          361   2e-117   Sorghum bicolor [broomcorn]
tpg|DAA49872.1|  TPA: anther-specific proline-rich protein APG          360   2e-117   
gb|EYU38776.1|  hypothetical protein MIMGU_mgv1a009257mg                358   5e-117   
emb|CBI19912.3|  unnamed protein product                                356   5e-117   
dbj|BAK03291.1|  predicted protein                                      359   7e-117   
ref|XP_004957497.1|  PREDICTED: GDSL esterase/lipase EXL3-like          359   1e-116   
ref|XP_009123675.1|  PREDICTED: GDSL esterase/lipase At5g42170          358   2e-116   
ref|XP_009397996.1|  PREDICTED: GDSL esterase/lipase EXL3-like          357   4e-116   
ref|XP_003629270.1|  GDSL esterase/lipase                               356   5e-116   
gb|EYU17581.1|  hypothetical protein MIMGU_mgv1a008769mg                356   6e-116   
ref|NP_001064682.1|  Os10g0438600                                       356   9e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006661793.1|  PREDICTED: GDSL esterase/lipase EXL3-like          355   1e-115   
gb|KDO45611.1|  hypothetical protein CISIN_1g045030mg                   354   2e-115   
gb|EMS55624.1|  GDSL esterase/lipase EXL3                               355   2e-115   
ref|XP_002462749.1|  hypothetical protein SORBIDRAFT_02g031310          355   2e-115   Sorghum bicolor [broomcorn]
ref|XP_006485151.1|  PREDICTED: GDSL esterase/lipase EXL3-like          354   3e-115   
ref|NP_001241717.1|  uncharacterized protein LOC100856895 precursor     355   3e-115   
ref|XP_010266003.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    353   9e-115   
ref|XP_008651330.1|  PREDICTED: uncharacterized protein LOC100279...    355   2e-114   
gb|EAZ16202.1|  hypothetical protein OsJ_31652                          352   2e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651333.1|  PREDICTED: uncharacterized protein LOC100279...    354   2e-114   
ref|XP_004509383.1|  PREDICTED: GDSL esterase/lipase EXL3-like          351   6e-114   
ref|XP_006390255.1|  hypothetical protein EUTSA_v10019532mg             352   6e-114   
ref|NP_001146030.1|  uncharacterized protein LOC100279561               352   1e-113   Zea mays [maize]
gb|KDO36514.1|  hypothetical protein CISIN_1g019467mg                   349   1e-113   
ref|XP_006435225.1|  hypothetical protein CICLE_v10001578mg             348   1e-113   
gb|KHN00461.1|  GDSL esterase/lipase EXL3                               350   2e-113   
ref|XP_010511053.1|  PREDICTED: GDSL esterase/lipase At1g58725-like     349   2e-113   
ref|XP_006574671.1|  PREDICTED: GDSL esterase/lipase EXL3-like          350   3e-113   
ref|XP_010030870.1|  PREDICTED: GDSL esterase/lipase EXL3-like          347   4e-113   
ref|NP_188100.2|  GDSL esterase/lipase                                  348   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463471.1|  hypothetical protein SORBIDRAFT_01g000430          349   6e-113   Sorghum bicolor [broomcorn]
ref|XP_010470233.1|  PREDICTED: GDSL esterase/lipase At1g58725-like     348   7e-113   
ref|XP_006301689.1|  hypothetical protein CARUB_v10022144mg             348   8e-113   
ref|XP_006480518.1|  PREDICTED: GDSL esterase/lipase EXL3-like          347   2e-112   
ref|XP_009397974.1|  PREDICTED: GDSL esterase/lipase At3g14820-like     347   2e-112   
gb|KDO84927.1|  hypothetical protein CISIN_1g017687mg                   345   8e-112   
ref|XP_006301261.1|  hypothetical protein CARUB_v10021661mg             345   9e-112   
ref|XP_007156186.1|  hypothetical protein PHAVU_003G265600g             345   9e-112   
ref|XP_010465393.1|  PREDICTED: GDSL esterase/lipase At3g14820-li...    344   2e-111   
gb|KDO45326.1|  hypothetical protein CISIN_1g046560mg                   343   3e-111   
gb|ACG32957.1|  anther-specific proline-rich protein APG precursor      344   3e-111   
gb|ACR34471.1|  unknown                                                 344   3e-111   
ref|XP_006301957.1|  hypothetical protein CARUB_v10022436mg             344   3e-111   
ref|XP_010487287.1|  PREDICTED: GDSL esterase/lipase At3g14820 is...    343   4e-111   
ref|XP_010679880.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    344   4e-111   
ref|XP_006392286.1|  hypothetical protein EUTSA_v10024141mg             343   5e-111   
gb|EYU17582.1|  hypothetical protein MIMGU_mgv1a008769mg                343   7e-111   
tpg|DAA64318.1|  TPA: anther-specific proline-rich protein APG          343   2e-110   
ref|XP_010935132.1|  PREDICTED: GDSL esterase/lipase EXL3-like          342   2e-110   
ref|XP_008651332.1|  PREDICTED: uncharacterized protein LOC100279...    345   3e-110   
emb|CDY12974.1|  BnaC02g29810D                                          347   4e-110   
ref|XP_010414724.1|  PREDICTED: GDSL esterase/lipase At1g58725-li...    340   8e-110   
ref|XP_009113303.1|  PREDICTED: GDSL esterase/lipase At1g58725-li...    340   8e-110   
ref|XP_010470243.1|  PREDICTED: GDSL esterase/lipase At1g58725 is...    340   1e-109   
ref|XP_006416432.1|  hypothetical protein EUTSA_v10008023mg             340   1e-109   
ref|XP_009113300.1|  PREDICTED: GDSL esterase/lipase At1g58725-li...    340   1e-109   
gb|AFW66909.1|  anther-specific proline-rich protein APG                340   2e-109   
ref|XP_006407041.1|  hypothetical protein EUTSA_v10021047mg             338   4e-109   
ref|XP_010419187.1|  PREDICTED: GDSL esterase/lipase At3g14820-like     338   4e-109   
ref|XP_006304433.1|  hypothetical protein CARUB_v10011033mg             340   4e-109   
ref|XP_010511065.1|  PREDICTED: GDSL esterase/lipase At1g58725          338   5e-109   
ref|NP_001150794.1|  anther-specific proline-rich protein APG pre...    337   2e-108   
ref|XP_006282175.1|  hypothetical protein CARUB_v10028437mg             337   2e-108   
ref|XP_003629267.1|  GDSL esterase/lipase                               338   2e-108   
ref|XP_006299788.1|  hypothetical protein CARUB_v10015984mg             336   2e-108   
ref|XP_010459694.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    338   5e-108   
ref|XP_003629269.1|  GDSL esterase/lipase                               336   6e-108   
ref|XP_006392281.1|  hypothetical protein EUTSA_v10023563mg             335   7e-108   
ref|XP_009103357.1|  PREDICTED: GDSL esterase/lipase At1g20120          337   7e-108   
ref|XP_010459696.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    337   8e-108   
ref|XP_002888210.1|  hypothetical protein ARALYDRAFT_475383             335   9e-108   
ref|XP_010459695.1|  PREDICTED: GDSL esterase/lipase At1g20120-li...    336   1e-107   
ref|XP_010501533.1|  PREDICTED: GDSL esterase/lipase At1g20120          336   1e-107   
ref|XP_003570760.2|  PREDICTED: GDSL esterase/lipase EXL3-like          338   1e-107   
gb|AEM36355.1|  At1g59406                                               334   2e-107   
dbj|BAB02648.1|  GDSL-motif lipase/hydrolase-like protein               333   2e-107   
dbj|BAJ87048.1|  predicted protein                                      335   2e-107   
ref|XP_002886683.1|  predicted protein                                  334   2e-107   
ref|NP_564104.1|  GDSL esterase/lipase                                  335   4e-107   
gb|EMS62537.1|  GDSL esterase/lipase EXL3                               333   5e-107   
ref|XP_006392463.1|  hypothetical protein EUTSA_v10023950mg             332   7e-107   
ref|XP_004509384.1|  PREDICTED: GDSL esterase/lipase EXL3-like          333   8e-107   
gb|AAM64323.1|  anter-specific proline-rich protein APG precursor...    334   9e-107   
gb|EEC84967.1|  hypothetical protein OsI_32213                          333   9e-107   
ref|XP_004142995.1|  PREDICTED: GDSL esterase/lipase EXL3-like is...    332   1e-106   
ref|NP_001051965.1|  Os03g0859100                                       333   1e-106   
ref|XP_010477245.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     333   1e-106   
gb|AET03745.2|  GDSL-like lipase/acylhydrolase                          332   2e-106   
ref|XP_010113314.1|  GDSL esterase/lipase EXL3                          336   2e-106   
ref|XP_002882894.1|  GDSL-motif lipase/hydrolase family protein         330   2e-106   
ref|XP_009109873.1|  PREDICTED: GDSL esterase/lipase At1g58725-like     331   3e-106   
ref|XP_010477243.1|  PREDICTED: GDSL esterase/lipase At1g20120          333   4e-106   
ref|NP_001063808.1|  Os09g0540400                                       331   4e-106   
ref|XP_006416431.1|  hypothetical protein EUTSA_v10007776mg             333   5e-106   
ref|XP_006390256.1|  hypothetical protein EUTSA_v10018728mg             330   6e-106   
ref|NP_564741.3|  GDSL esterase/lipase                                  330   7e-106   
ref|XP_009129206.1|  PREDICTED: GDSL esterase/lipase At1g58725 is...    330   1e-105   
ref|XP_010465394.1|  PREDICTED: GDSL esterase/lipase At3g14820-li...    328   2e-105   
ref|XP_006599317.1|  PREDICTED: GDSL esterase/lipase EXL3-like          329   2e-105   
emb|CDY32339.1|  BnaC01g36580D                                          328   3e-105   
ref|XP_002459341.1|  hypothetical protein SORBIDRAFT_02g002860          330   6e-105   
ref|XP_010487288.1|  PREDICTED: GDSL esterase/lipase At3g14820 is...    326   8e-105   
emb|CDY44206.1|  BnaC05g15630D                                          328   8e-105   
ref|XP_006416429.1|  hypothetical protein EUTSA_v10007849mg             328   9e-105   
emb|CDY20086.1|  BnaA01g29160D                                          327   1e-104   
ref|XP_009124095.1|  PREDICTED: GDSL esterase/lipase At3g14820          327   1e-104   
ref|XP_006416428.1|  hypothetical protein EUTSA_v10007871mg             328   1e-104   
ref|XP_004980964.1|  PREDICTED: GDSL esterase/lipase EXL3-like          327   1e-104   
ref|XP_009113399.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    327   2e-104   
ref|NP_001131302.1|  uncharacterized protein LOC100192615 precursor     327   2e-104   
ref|XP_009149502.1|  PREDICTED: anther-specific proline-rich prot...    327   2e-104   
gb|EMT30559.1|  GDSL esterase/lipase EXL3                               327   3e-104   
ref|XP_009110239.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     328   4e-104   
gb|KFK44140.1|  hypothetical protein AALP_AA1G220300                    326   8e-104   
ref|XP_004951174.1|  PREDICTED: GDSL esterase/lipase EXL3-like          325   9e-104   
ref|NP_001150585.1|  anther-specific proline-rich protein APG           326   1e-103   
ref|XP_009113400.1|  PREDICTED: GDSL esterase/lipase At1g58725 is...    324   1e-103   
ref|XP_004965425.1|  PREDICTED: GDSL esterase/lipase EXL1-like          325   2e-103   
ref|XP_003576900.1|  PREDICTED: GDSL esterase/lipase EXL3-like          325   2e-103   
ref|XP_007202420.1|  hypothetical protein PRUPE_ppa009721mg             321   3e-103   
gb|ABK26503.1|  unknown                                                 323   3e-103   
gb|AFW69692.1|  LOW QUALITY PROTEIN: anther-specific proline-rich...    327   4e-103   
gb|ACG31357.1|  anther-specific proline-rich protein APG precursor      323   5e-103   
emb|CDY65553.1|  BnaAnng20620D                                          322   6e-103   
ref|XP_010266001.1|  PREDICTED: GDSL esterase/lipase EXL3-like          323   7e-103   
emb|CDY67439.1|  BnaCnng55000D                                          338   9e-103   
ref|XP_004288853.1|  PREDICTED: GDSL esterase/lipase At5g42170-like     320   2e-102   
ref|XP_002451338.1|  hypothetical protein SORBIDRAFT_04g000310          322   2e-102   
ref|XP_010459698.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     322   3e-102   
gb|AGT15972.1|  anther-specific proline-rich protein                    327   5e-102   
gb|AGT15973.1|  anther-specific proline-rich protein APG precursor      322   5e-102   
ref|XP_002437412.1|  hypothetical protein SORBIDRAFT_10g026470          320   1e-101   
ref|XP_007160638.1|  hypothetical protein PHAVU_001G004200g             319   1e-101   
ref|XP_010414725.1|  PREDICTED: GDSL esterase/lipase At1g58480-li...    318   1e-101   
ref|XP_010470244.1|  PREDICTED: GDSL esterase/lipase At1g58480 is...    318   2e-101   
ref|XP_009113304.1|  PREDICTED: GDSL esterase/lipase At1g58480-li...    318   2e-101   
ref|XP_009113301.1|  PREDICTED: GDSL esterase/lipase At1g58480-li...    318   2e-101   
gb|ABK26273.1|  unknown                                                 319   3e-101   
emb|CDY48852.1|  BnaA09g14610D                                          317   3e-101   
ref|XP_010498445.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     320   3e-101   
ref|XP_006648199.1|  PREDICTED: GDSL esterase/lipase EXL3-like          318   4e-101   
ref|XP_006295451.1|  hypothetical protein CARUB_v10024554mg             316   6e-101   
ref|NP_001117317.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    318   7e-101   
ref|XP_006428644.1|  hypothetical protein CICLE_v10013506mg             316   7e-101   
gb|EMS63525.1|  GDSL esterase/lipase EXL3                               318   7e-101   
ref|XP_010229809.1|  PREDICTED: GDSL esterase/lipase EXL3-like          318   1e-100   
ref|XP_004243509.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     317   2e-100   
ref|NP_564738.2|  GDSL esterase/lipase                                  314   3e-100   
ref|XP_003528475.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     316   3e-100   
emb|CDO96723.1|  unnamed protein product                                316   4e-100   
ref|XP_009113302.1|  PREDICTED: GDSL esterase/lipase At3g43570-li...    313   7e-100   
ref|XP_010414726.1|  PREDICTED: GDSL esterase/lipase At3g43570-li...    313   9e-100   
ref|XP_010470245.1|  PREDICTED: GDSL esterase/lipase At3g43570 is...    313   1e-99    
ref|XP_004965426.1|  PREDICTED: GDSL esterase/lipase At1g58725-li...    315   1e-99    
gb|KEH30938.1|  GDSL-like lipase/acylhydrolase                          314   2e-99    
ref|XP_004305842.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     313   2e-99    
dbj|BAG68919.1|  carboxylic ester hydrolase                             311   3e-99    
ref|XP_006436510.1|  hypothetical protein CICLE_v10031929mg             312   9e-99    
gb|KFK44138.1|  hypothetical protein AALP_AA1G220000                    310   1e-98    
ref|XP_003562055.1|  PREDICTED: GDSL esterase/lipase EXL1-like          312   1e-98    
ref|XP_010675786.1|  PREDICTED: GDSL esterase/lipase At4g26790          311   2e-98    
ref|XP_006656957.1|  PREDICTED: GDSL esterase/lipase EXL1-like          311   2e-98    
emb|CDY29371.1|  BnaA06g14250D                                          325   2e-98    
ref|XP_008463972.1|  PREDICTED: GDSL esterase/lipase At1g06990          310   5e-98    
ref|XP_010539110.1|  PREDICTED: GDSL esterase/lipase At1g20120-like     311   6e-98    
ref|XP_007215624.1|  hypothetical protein PRUPE_ppa007979mg             309   1e-97    
gb|EMT05955.1|  GDSL esterase/lipase EXL3                               309   2e-97    
ref|XP_006357973.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     308   2e-97    
ref|XP_009129207.1|  PREDICTED: GDSL esterase/lipase At1g58480 is...    308   2e-97    
emb|CDY36116.1|  BnaA08g19320D                                          307   2e-97    
gb|EMS48896.1|  GDSL esterase/lipase EXL3                               309   2e-97    
gb|KHN46112.1|  GDSL esterase/lipase                                    308   2e-97    
ref|XP_002528958.1|  zinc finger protein, putative                      308   2e-97    
ref|XP_004505116.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     309   2e-97    
ref|XP_004151059.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     308   3e-97    
ref|XP_008380187.1|  PREDICTED: GDSL esterase/lipase At2g42990          308   3e-97    
ref|XP_003518328.2|  PREDICTED: GDSL esterase/lipase At2g30310-like     308   3e-97    
emb|CDY53577.1|  BnaC09g51560D                                          307   3e-97    
ref|XP_007020707.1|  Zinc finger protein, putative                      308   3e-97    
gb|KHN39409.1|  GDSL esterase/lipase EXL3                               308   3e-97    
emb|CDY51993.1|  BnaC03g75690D                                          306   4e-97    
ref|XP_006424351.1|  hypothetical protein CICLE_v10030240mg             306   5e-97    
ref|XP_008463830.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     308   6e-97    
dbj|BAD07804.1|  putative family II extracellular lipase 3 (EXL3)       307   6e-97    
emb|CDP05713.1|  unnamed protein product                                307   7e-97    
ref|NP_001057586.2|  Os06g0351700                                       307   7e-97    
ref|XP_008463828.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     307   8e-97    
gb|KDP30830.1|  hypothetical protein JCGZ_13773                         306   8e-97    
gb|EAY84073.1|  hypothetical protein OsI_05454                          306   8e-97    
ref|NP_001154437.1|  protein RXW8                                       306   1e-96    
ref|XP_004143225.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     306   1e-96    
ref|NP_189943.1|  GDSL esterase/lipase                                  305   1e-96    
ref|XP_003544387.2|  PREDICTED: GDSL esterase/lipase At1g23500-like     306   1e-96    
emb|CDY64565.1|  BnaC02g47690D                                          305   2e-96    
ref|XP_010260393.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     306   2e-96    
ref|XP_010260394.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     306   3e-96    
gb|EEE65668.1|  hypothetical protein OsJ_21277                          305   4e-96    
gb|EYU28037.1|  hypothetical protein MIMGU_mgv1a008421mg                306   5e-96    
gb|KDP45756.1|  hypothetical protein JCGZ_17363                         305   5e-96    
ref|XP_004168797.1|  PREDICTED: GDSL esterase/lipase At2g30310-like     305   6e-96    
ref|XP_009356602.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     305   6e-96    
ref|XP_002273045.2|  PREDICTED: GDSL esterase/lipase At5g45960          305   7e-96    
emb|CDY09420.1|  BnaA02g25900D                                          303   7e-96    
ref|XP_004499972.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     304   9e-96    
ref|XP_007153177.1|  hypothetical protein PHAVU_003G013500g             304   9e-96    
ref|XP_010257136.1|  PREDICTED: GDSL esterase/lipase At2g40250-like     305   1e-95    
ref|XP_008439785.1|  PREDICTED: GDSL esterase/lipase At5g45960          305   1e-95    
emb|CBI30638.3|  unnamed protein product                                305   1e-95    
gb|KHN47206.1|  GDSL esterase/lipase                                    305   1e-95    
ref|XP_009395858.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     304   1e-95    
gb|KCW53195.1|  hypothetical protein EUGRSUZ_J02469                     301   1e-95    
ref|XP_009129208.1|  PREDICTED: GDSL esterase/lipase At3g43570 is...    303   1e-95    
ref|XP_002301596.1|  GDSL-motif lipase/hydrolase family protein         303   1e-95    
ref|XP_010052245.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     304   2e-95    
ref|XP_003542710.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     304   2e-95    
ref|XP_004134939.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     304   2e-95    
emb|CAN76714.1|  hypothetical protein VITISV_018794                     303   2e-95    
emb|CDY42062.1|  BnaC09g15250D                                          301   2e-95    
ref|XP_008229570.1|  PREDICTED: GDSL esterase/lipase At2g42990          303   2e-95    
gb|EYU27381.1|  hypothetical protein MIMGU_mgv1a025165mg                303   2e-95    
ref|XP_011076825.1|  PREDICTED: GDSL esterase/lipase At2g40250          305   2e-95    
ref|XP_007153690.1|  hypothetical protein PHAVU_003G056700g             303   2e-95    
ref|XP_009113401.1|  PREDICTED: GDSL esterase/lipase At1g58480 is...    303   2e-95    
emb|CDY41727.1|  BnaA09g15550D                                          301   3e-95    
ref|XP_002528324.1|  zinc finger protein, putative                      303   4e-95    
ref|XP_007017006.1|  GDSL-like Lipase/Acylhydrolase family protei...    302   4e-95    
ref|XP_010644495.1|  PREDICTED: GDSL esterase/lipase At4g26790          302   4e-95    
ref|XP_010052243.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    303   4e-95    
ref|XP_010279182.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     303   5e-95    
gb|KHM99646.1|  GDSL esterase/lipase                                    302   5e-95    
ref|XP_006418560.1|  hypothetical protein EUTSA_v10002592mg             302   5e-95    
ref|XP_008357836.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     302   6e-95    
gb|KDO51878.1|  hypothetical protein CISIN_1g018844mg                   302   6e-95    
ref|XP_011003480.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     303   6e-95    
emb|CBI26692.3|  unnamed protein product                                301   7e-95    
gb|KHG24676.1|  hypothetical protein F383_10019                         302   7e-95    
ref|XP_006437131.1|  hypothetical protein CICLE_v10031968mg             301   9e-95    
ref|XP_007206827.1|  hypothetical protein PRUPE_ppa026294mg             301   1e-94    
dbj|BAJ87897.1|  predicted protein                                      302   1e-94    
ref|XP_006828972.1|  hypothetical protein AMTR_s00001p00237870          300   1e-94    
ref|XP_009804685.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     301   1e-94    
ref|NP_001057585.1|  Os06g0351500                                       302   1e-94    
ref|XP_006484904.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     301   1e-94    
gb|EEC80567.1|  hypothetical protein OsI_22891                          302   1e-94    
ref|XP_009334183.1|  PREDICTED: GDSL esterase/lipase At4g26790-like     301   1e-94    
ref|XP_003545614.1|  PREDICTED: GDSL esterase/lipase At2g42990-like     301   2e-94    
ref|XP_010252590.1|  PREDICTED: GDSL esterase/lipase At2g42990-li...    301   2e-94    
ref|XP_011100466.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     301   2e-94    
ref|XP_002883649.1|  GDSL-motif lipase/hydrolase family protein         301   2e-94    
ref|XP_007017007.1|  GDSL-like Lipase/Acylhydrolase family protei...    305   2e-94    
ref|XP_009606234.1|  PREDICTED: GDSL esterase/lipase At2g04570-like     301   2e-94    
ref|XP_010045391.1|  PREDICTED: GDSL esterase/lipase At2g30310 is...    301   2e-94    
ref|XP_007141675.1|  hypothetical protein PHAVU_008G215600g             300   3e-94    
ref|XP_008349532.1|  PREDICTED: GDSL esterase/lipase At2g30220-like     301   3e-94    
ref|XP_010441648.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     301   3e-94    
ref|XP_011096385.1|  PREDICTED: GDSL esterase/lipase At5g45960-like     300   4e-94    
emb|CDY41728.1|  BnaA09g15560D                                          299   4e-94    
ref|XP_009618391.1|  PREDICTED: GDSL esterase/lipase At5g45960-li...    300   5e-94    



>ref|XP_011074698.1| PREDICTED: GDSL esterase/lipase EXL3-like [Sesamum indicum]
Length=356

 Score =   489 bits (1260),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 275/341 (81%), Gaps = 0/341 (0%)
 Frame = -1

Query  1220  LLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTG  1041
             LL    C+  IKLPPGV + GV  +GDSIVDQG NN ++T  +CN+PPYG+DF G +PTG
Sbjct  15    LLCISCCDGAIKLPPGVTIPGVFAYGDSIVDQGNNNVVKTLLKCNFPPYGKDFQGGVPTG  74

Query  1040  RFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIP  861
             R+ NGKTP D IAEELG+   +PAY DPNL+ +D  TGVSFASGGCG+DP T+QI + I 
Sbjct  75    RYSNGKTPPDLIAEELGITNFIPAYLDPNLKAQDLPTGVSFASGGCGYDPQTSQIVSVIS  134

Query  860   LSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINA  681
             LS QL +FKEY GKLK  VGE + N I+ N+L +VVAG++D+ NTYF++ IRR +YDI++
Sbjct  135   LSDQLKHFKEYMGKLKGAVGEERANNIVSNSLHLVVAGSDDLANTYFTIGIRRAQYDISS  194

Query  680   YADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIV  501
             YADL++  A+ FIQELY LGARR  +FGIPP GC+P+QRTLAGG  R C EEYN+A+Q+V
Sbjct  195   YADLVVSSASSFIQELYQLGARRIAVFGIPPIGCLPAQRTLAGGSLRVCSEEYNQAAQLV  254

Query  500   NSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLC  321
             N+KLS+ ++SLN  LPQS +VY+DIYNPLLDLIQ+PQNYGFEV DRGCCGTG IEV  LC
Sbjct  255   NAKLSSTLESLNQSLPQSRVVYIDIYNPLLDLIQHPQNYGFEVNDRGCCGTGNIEVVILC  314

Query  320   NKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             NKY+GTCPD +KY+FWDS+HPTE+AY ILVHQI+QKYV  F
Sbjct  315   NKYSGTCPDDSKYIFWDSYHPTEQAYKILVHQIIQKYVNSF  355



>ref|XP_009772833.1| PREDICTED: GDSL esterase/lipase EXL3 [Nicotiana sylvestris]
Length=348

 Score =   486 bits (1252),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/346 (65%), Positives = 280/346 (81%), Gaps = 1/346 (0%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             V+F +L     CE K++LP  VVV+ V  FGDSIVDQG NN++ T A+CN+PPYG+DF G
Sbjct  3     VIFFVLFSISSCEGKVQLPKNVVVKAVFAFGDSIVDQGNNNDIITLAKCNFPPYGKDFNG  62

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
              +PTGRFCNGKTP D + EELGV EL+PAY DPNL+ ED KTGVSFASGGCGFDPLT  +
Sbjct  63    GIPTGRFCNGKTPPDILVEELGVAELVPAYLDPNLKTEDLKTGVSFASGGCGFDPLTTTL  122

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
             ATAIPLSTQLN F+EY  KLK +VGE +TNYI+EN+LF+VVAG++D+ NTYFS  I R K
Sbjct  123   ATAIPLSTQLNQFEEYIEKLKALVGEEETNYILENSLFLVVAGSDDIANTYFSAGI-RLK  181

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
              DIN+Y + M+  A++F+QELY LGAR+   FGIPP GC+PSQRTLAGG +R CV+EYN+
Sbjct  182   QDINSYTNFMVAKASEFLQELYKLGARKIGFFGIPPLGCLPSQRTLAGGFNRVCVQEYNQ  241

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+Q+ N+KLSA ++SL+  LPQS +V++DIYNP+LDLI NPQ YG E  ++GCCGTG IE
Sbjct  242   AAQLANTKLSAALNSLSKNLPQSKLVFIDIYNPILDLIVNPQKYGLEEVEKGCCGTGKIE  301

Query  335   VTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             VT LCNK++GTC D  KY+FWDS+HPTE+AY ILV+QIL+KY+  F
Sbjct  302   VTLLCNKFSGTCEDDTKYLFWDSYHPTEKAYRILVNQILKKYINNF  347



>ref|XP_009768390.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana sylvestris]
Length=362

 Score =   478 bits (1231),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 221/350 (63%), Positives = 273/350 (78%), Gaps = 2/350 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             ++V V+F  LL    C+ K++LP  V V  V  FGDSIVDQG NN++ T  +CN+ PYG+
Sbjct  14    ILVHVLF--LLFVASCKGKVQLPENVTVRAVFAFGDSIVDQGNNNHIATVVKCNFEPYGK  71

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G  PTGRF N KTPSD I +ELG+KEL+PAY DPNLQ ED KTGVSFASG  GFDP 
Sbjct  72    DFMGGKPTGRFSNAKTPSDLIVDELGIKELMPAYLDPNLQAEDLKTGVSFASGATGFDPQ  131

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T  + + IPLSTQL++F+EY GKLK++VGE + N I+ N++F+VVAG++D+ NTYF++ I
Sbjct  132   TPALVSVIPLSTQLDHFREYIGKLKQLVGEEEANDILRNSVFLVVAGSDDLANTYFTVGI  191

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             RR +YD+N Y DLM  GA++FIQELY LGAR+  IFG+PP GC+PSQRTL GGKSR C E
Sbjct  192   RRLQYDVNGYTDLMAAGASEFIQELYKLGARKIAIFGVPPIGCLPSQRTLGGGKSRECSE  251

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
             EYN+A+Q+ N+KLSA IDSL+  L QS +V+VDIY+ LLDLI NPQ +GFEV DRGCCGT
Sbjct  252   EYNQAAQLANTKLSAAIDSLSKNLLQSKLVFVDIYSSLLDLIVNPQKHGFEVVDRGCCGT  311

Query  347   GVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G IEV  LCNKY+GTC D  KY+FWDS+HPTE+ Y ILV QIL+KYV  F
Sbjct  312   GNIEVVILCNKYSGTCEDDTKYLFWDSYHPTEKGYRILVDQILKKYVNSF  361



>ref|XP_009617736.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=351

 Score =   476 bits (1226),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 222/350 (63%), Positives = 280/350 (80%), Gaps = 1/350 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L++  V  +L     CE K++LP  VVV+ V  FGDSIVDQG NN++ T A+CN+PPYG+
Sbjct  2     LVIFFVCFVLFSISSCEGKVQLPNNVVVKAVFAFGDSIVDQGNNNDMTTLAKCNFPPYGK  61

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G +PTGRFCNGKTP D + EELG+ EL+PAY DPNL  ED KTGVSFASGGCGFDPL
Sbjct  62    DFKGGIPTGRFCNGKTPPDILVEELGIAELVPAYLDPNLNTEDLKTGVSFASGGCGFDPL  121

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T+ +ATAIPLS+QL  FKEY  KLK +VGE +TNYI++N+LF+VVAG++D+ NTYF+  I
Sbjct  122   TSTLATAIPLSSQLTQFKEYIEKLKGLVGEEETNYILQNSLFMVVAGSDDLANTYFTGGI  181

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              R K DIN+Y +LM+  A++F+QELY LGAR+   FGIPP GC+PSQRTLAGG +R CV+
Sbjct  182   -RLKQDINSYTNLMMAKASEFVQELYKLGARKIGFFGIPPLGCLPSQRTLAGGFNRECVQ  240

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
             EYN+A+Q+ N+KLSA I+SL+  LPQS +V++DIY PLLD I NP+ YGFE  ++GCCGT
Sbjct  241   EYNQAAQLANTKLSAAINSLSKNLPQSKLVFIDIYYPLLDFIVNPKKYGFEEVEKGCCGT  300

Query  347   GVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G IEVT LCNK++GTC D+ KY+FWDS+HPTE+AY ILV QIL+KY+  F
Sbjct  301   GKIEVTLLCNKFSGTCEDNTKYLFWDSYHPTEKAYRILVDQILKKYINNF  350



>ref|XP_009614809.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=362

 Score =   469 bits (1208),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 216/349 (62%), Positives = 268/349 (77%), Gaps = 0/349 (0%)
 Frame = -1

Query  1244  MVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             MV      LL    C+ K++LP  V V+ V  FGDSIVDQG NN++ T A+CN+ PYG+D
Sbjct  13    MVLFHVLFLLFVASCKGKVQLPENVTVKAVFAFGDSIVDQGNNNHITTVAKCNFEPYGKD  72

Query  1064  FAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLT  885
             F G  PTGRF N KTPSD I +ELG+KEL+PAY DPNLQ ED KTGVSFASG  GFDP T
Sbjct  73    FMGGKPTGRFSNAKTPSDLIVDELGIKELMPAYLDPNLQTEDLKTGVSFASGASGFDPQT  132

Query  884   AQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIR  705
               + + I LSTQL++F+EY GKLK++VGE + N I+ N++F+VVAG++D+ NTYF++ IR
Sbjct  133   PALVSVISLSTQLDHFREYIGKLKQLVGEEEANDILRNSVFLVVAGSDDLANTYFTVGIR  192

Query  704   RYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEE  525
             R +YD+N Y DLM  GA++FIQELY LGAR+  +FGIPP GC+PSQRTL GG SR C EE
Sbjct  193   RLQYDVNGYTDLMAAGASEFIQELYKLGARKIAVFGIPPIGCLPSQRTLGGGISRECSEE  252

Query  524   YNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTG  345
             YN+A+Q+ N+KLSA IDSL+    Q+ +V++DIY+ LLDLI NPQ +GFEV DRGCCGTG
Sbjct  253   YNQAAQLANTKLSAAIDSLSKNFLQTKLVFIDIYSSLLDLIVNPQKHGFEVVDRGCCGTG  312

Query  344   VIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              IEV  LCNKY+GTC D  KY+FWDS+HPTE+ Y ILV QIL+KYV  F
Sbjct  313   NIEVVILCNKYSGTCEDDTKYLFWDSYHPTEKGYRILVDQILKKYVDNF  361



>ref|XP_009594700.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=361

 Score =   467 bits (1201),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 219/353 (62%), Positives = 277/353 (78%), Gaps = 3/353 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGR-RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYG  1071
             L V + F ++LL    CE K +LP  + ++ V VFGDSIVDQG NNN+ T  +CN+PPYG
Sbjct  10    LRVMLWFYVVLLWLCACEGKTQLPKNLNIKAVFVFGDSIVDQGNNNNITTLMKCNFPPYG  69

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
             +DF    PTGRF N KTP+D I EELG+KEL+PAY DP LQ +D KTGVSFASG CG+DP
Sbjct  70    KDFIDGKPTGRFTNAKTPADLIVEELGIKELMPAYLDPKLQAKDLKTGVSFASGACGYDP  129

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
              TA IA+ IPLSTQLN+F+EY GKLK +VGE + N I+ ++L+ VVAG+ND+ NTYF++ 
Sbjct  130   QTAAIASVIPLSTQLNHFQEYVGKLKGLVGEEEANTILHSSLYFVVAGSNDLANTYFTIG  189

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
             +R+ +YDIN+Y DLM+ GAADFI+ELY LGAR+  +FGIPP GC+P QRT++GG  R CV
Sbjct  190   LRQKQYDINSYTDLMVDGAADFIRELYKLGARKIGVFGIPPVGCLPFQRTMSGGIFRMCV  249

Query  530   EEYNEASQIVNSKLSAEI-DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCC  354
             EEYNEA+Q+ N+KLSA I DSL+NKLPQS +V++D+Y+P+LDLI NPQ YGFEV ++GCC
Sbjct  250   EEYNEAAQLANTKLSAAINDSLSNKLPQSKLVFIDLYDPMLDLIVNPQKYGFEVVEKGCC  309

Query  353   GTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             GTG IEV  LC KY GTC D  KY+FWDS+HPTER Y ILV Q+++KY+  F 
Sbjct  310   GTGNIEVLLLC-KYGGTCEDDTKYLFWDSYHPTERGYRILVDQMMKKYINSFT  361



>ref|XP_010320438.1| PREDICTED: GDSL esterase/lipase EXL3 isoform X1 [Solanum lycopersicum]
Length=355

 Score =   465 bits (1196),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 270/342 (79%), Gaps = 1/342 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
             +LL    CE K++LP  +VV+ V  FGDSIVDQG NN + T  +CN+PPYG+DF G +PT
Sbjct  14    LLLFINCCEGKVQLPNNMVVKAVFAFGDSIVDQGSNNYVSTIVKCNFPPYGKDFNGGLPT  73

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRF NGKTP D I EELG+K+ +PAY DPNL+ ED  TGVSFASGGCG+DPLTA I +AI
Sbjct  74    GRFSNGKTPPDLIVEELGIKDFVPAYLDPNLKIEDLITGVSFASGGCGYDPLTATIVSAI  133

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
             PLSTQLN FKEY  KL+ +VGE + N I++N+LF+VVAG++D+ NTYF+  +R  K D+N
Sbjct  134   PLSTQLNQFKEYLSKLEVLVGEEEANDILKNSLFLVVAGSDDLANTYFTAGVR-LKKDVN  192

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
             +Y DLM+  A++F+QELY+LGAR+  IFGIPP GCVPSQRTLAGG  R C EEYNEA+Q+
Sbjct  193   SYTDLMVAKASEFVQELYNLGARKIGIFGIPPIGCVPSQRTLAGGPHRVCSEEYNEAAQL  252

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
              N+K S +I SL+ KL QS +V+++IYNPLLDLI NP+ YGFE  D+GCCGTG IEVT L
Sbjct  253   ANTKFSTQIHSLSQKLAQSKLVFLEIYNPLLDLIVNPKKYGFEEVDKGCCGTGKIEVTVL  312

Query  323   CNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CNK++GTC D  KY+FWDS+HPTE+ Y ILV Q+L KYV +F
Sbjct  313   CNKFSGTCEDDTKYLFWDSYHPTEKGYKILVDQLLNKYVNQF  354



>ref|XP_009627260.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=364

 Score =   461 bits (1186),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 215/345 (62%), Positives = 267/345 (77%), Gaps = 1/345 (0%)
 Frame = -1

Query  1232  VFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGE  1053
             ++ +L +   CEA+++LP  V  + V  FGDSIVDQG NNN+ T  +CN+ PYG+DF G 
Sbjct  20    IYVVLFIISACEARVQLPNNVFFKAVFAFGDSIVDQGNNNNITTLIKCNFQPYGKDFMGG  79

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
             MPTGRF NGKTP+D IAEELG+KE + AY DPNL+ ED KTGVSFASGGCG+DP TA I 
Sbjct  80    MPTGRFSNGKTPADLIAEELGIKEFVSAYLDPNLKSEDIKTGVSFASGGCGYDPQTATIG  139

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
              AIPLSTQL  FKEY  KLK +VGE + NYI++N+LF+VVAG++D+ NTYF+  +R  K 
Sbjct  140   AAIPLSTQLTQFKEYIVKLKGLVGEEEANYILKNSLFLVVAGSDDLANTYFTYGVR-LKQ  198

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             DIN+Y DLM+  A+ F++ELY LGAR+  IFGIPP G +PSQRTLAGG +R CV+EYNEA
Sbjct  199   DINSYTDLMVAEASKFLKELYKLGARKCCIFGIPPIGYLPSQRTLAGGINRVCVQEYNEA  258

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             +Q+ N+K S   DSL+ KLPQS +V VDIYNPLLDLI NPQ YGFE  ++GCCGTG IEV
Sbjct  259   AQLANTKFSITFDSLSKKLPQSRLVLVDIYNPLLDLILNPQKYGFEEVEKGCCGTGKIEV  318

Query  332   TFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             T LCNK++GTC D  KY+FWDS+HPTE+AY  +V QI+ K +  F
Sbjct  319   TLLCNKFSGTCEDDTKYIFWDSYHPTEKAYRTIVDQIINKIINSF  363



>ref|XP_009779479.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana sylvestris]
Length=371

 Score =   461 bits (1185),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 269/340 (79%), Gaps = 2/340 (1%)
 Frame = -1

Query  1229  FPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEM  1050
             + +LL    CE K +LP  + ++ V+VFGDSIVDQG NNN+ T  +CN+PPYG+DF    
Sbjct  17    YVILLWLGACEGKTELPKNLNIKAVLVFGDSIVDQGNNNNITTLIKCNFPPYGKDFIDGK  76

Query  1049  PTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIAT  870
             PTGRF N KTP+D I EELG+KEL+PAY DP LQ ED KTGVSFASG CG+DP TA I +
Sbjct  77    PTGRFTNAKTPADLIVEELGIKELMPAYLDPKLQAEDLKTGVSFASGACGYDPQTAVITS  136

Query  869   AIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYD  690
              IPLSTQLNYF+EY GKLK +VGE + N I+ N+L++VVAG+ND+ NTYF++ +R+ +YD
Sbjct  137   VIPLSTQLNYFQEYVGKLKGLVGEKEGNDILHNSLYLVVAGSNDLANTYFTVGLRQKQYD  196

Query  689   INAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEAS  510
             IN+Y DLM+ GAADFIQELY LGAR+  +FGIPP GC+P QRT++GG  R CVEEYNEA+
Sbjct  197   INSYTDLMVDGAADFIQELYKLGARKIGVFGIPPVGCLPFQRTVSGGIFRMCVEEYNEAA  256

Query  509   QIVNSKLSAEI-DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
              + N+KLSA I DSL+ KLPQS +V++D+Y+P+LDLI NPQ YGFEV ++GCCGTG IEV
Sbjct  257   LLANTKLSAAINDSLSKKLPQSKLVFIDLYDPMLDLIVNPQKYGFEVVEKGCCGTGNIEV  316

Query  332   TFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQK  213
               LC KY GTC D  KY+FWDS+HPTER Y ILV Q+++K
Sbjct  317   LMLC-KYGGTCEDDTKYLFWDSYHPTERGYRILVDQMMKK  355



>ref|XP_009627261.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=362

 Score =   460 bits (1184),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 214/346 (62%), Positives = 268/346 (77%), Gaps = 1/346 (0%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             +++   +L   CEAK++LP  V+ + V  FGDSIVDQG NNN+ T  +CN+ PYG+DF G
Sbjct  17    LLYVTFVLFSVCEAKVQLPQNVIFKAVFAFGDSIVDQGNNNNITTLIKCNFQPYGKDFVG  76

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
              MPTGRF NGKTP D IA+ELG+K+L+PAY DPNL+ ED KTGVSFASGGCG+DPLTA +
Sbjct  77    GMPTGRFSNGKTPPDLIADELGIKKLIPAYLDPNLKTEDIKTGVSFASGGCGYDPLTATL  136

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
               AI LSTQL  FKEY GKLK +VGE + NYI++N+LF+VVAGT+D+ NTYF+  I R K
Sbjct  137   VAAIHLSTQLTQFKEYIGKLKGLVGEEEANYILKNSLFMVVAGTDDLANTYFTAGI-RLK  195

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
              DIN+Y DLM+  A+ F++ELY LGAR+  I GIPP GC+PSQRTLAGG  R C +EYNE
Sbjct  196   QDINSYTDLMVAEASKFLKELYKLGARKFWILGIPPIGCLPSQRTLAGGIYRVCSQEYNE  255

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+Q+ N+K S  I+S +  LPQS +V++DIYNPLL LI NPQ YGFE  ++GCCGTG IE
Sbjct  256   AAQLANTKFSTAINSSSKNLPQSKLVFIDIYNPLLGLIFNPQKYGFEEVEKGCCGTGTIE  315

Query  335   VTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
                LCNK++GTC D  KY+FWDS+HPTE+AY I+V QIL+KY+  F
Sbjct  316   GAKLCNKFSGTCEDDTKYLFWDSYHPTEKAYKIIVDQILKKYINSF  361



>ref|XP_009786862.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana sylvestris]
Length=363

 Score =   459 bits (1181),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 267/347 (77%), Gaps = 2/347 (1%)
 Frame = -1

Query  1244  MVSVVFPM-LLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             MV V+  +  +L   CEA +KLP  ++ + V  FGDSIVDQG NN L+T  +CN+ PYG+
Sbjct  13    MVKVLLYVNFVLFSVCEANVKLPHNMIFKAVFAFGDSIVDQGNNNYLKTLIKCNFQPYGK  72

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G MPTGRF NGKTP+D IAEELG+KEL+PAY DPNL+ ED KTGVSFASGGCG+DP 
Sbjct  73    DFMGGMPTGRFSNGKTPADLIAEELGIKELMPAYSDPNLKSEDIKTGVSFASGGCGYDPQ  132

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             TA I  AIPLSTQL  FKEY  KLK +VGE + NYI++N+LF+VVAGT+D+ NTYF+  I
Sbjct  133   TATIVAAIPLSTQLTQFKEYIVKLKGLVGEEEANYILKNSLFMVVAGTDDLANTYFTAGI  192

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
                K DIN+Y DLM+  A+ F++ELY LGAR+  IFGIPP GC+PSQRTLAGG SR C++
Sbjct  193   -HLKQDINSYTDLMVAEASKFLKELYKLGARKYWIFGIPPIGCLPSQRTLAGGLSRECIK  251

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
             +YN+ +Q+ N+K S   DSL+ KLPQS +V VDIYNPLLDLI  PQ YGFE A +GCCGT
Sbjct  252   KYNDGAQLANTKFSIAFDSLSKKLPQSRLVLVDIYNPLLDLILKPQKYGFEEAAKGCCGT  311

Query  347   GVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             G IEV  LCNK++GTC D  KY+FWDS+HPTE+ Y  +V Q++ KY+
Sbjct  312   GNIEVALLCNKFSGTCEDDTKYIFWDSYHPTEKVYTTIVDQLITKYI  358



>ref|XP_006342238.1| PREDICTED: uncharacterized protein LOC102603803 [Solanum tuberosum]
Length=742

 Score =   471 bits (1211),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/335 (65%), Positives = 268/335 (80%), Gaps = 1/335 (0%)
 Frame = -1

Query  1202  CEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGK  1023
             CE K++LP  VVV+ V  FGDSIVDQG NN + T  +C++PPYG+DF G MPTGRF NGK
Sbjct  21    CEGKVQLPKNVVVKAVFAFGDSIVDQGSNNYVATIVKCDFPPYGKDFNGGMPTGRFSNGK  80

Query  1022  TPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLN  843
             TP D I EELG+K+ +PAY DPNL+ ED KTGVSFASGGCG+DPLTA I +AIPLSTQLN
Sbjct  81    TPPDLIVEELGIKDFVPAYLDPNLKIEDLKTGVSFASGGCGYDPLTATIVSAIPLSTQLN  140

Query  842   YFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMI  663
              FKEY GKL+ +VGE + N I +N+LF+VVAG++D+ NTYF+  +R  K D+N+Y DLM+
Sbjct  141   QFKEYIGKLEGLVGEEEANDIFKNSLFLVVAGSDDLANTYFTAGVR-LKKDVNSYTDLMV  199

Query  662   QGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSA  483
               A++F+QELY+LGAR+  IFGIPP GC+P+QRTLAGG  R C EEYNEA+Q+ N+K S 
Sbjct  200   AKASEFVQELYNLGARKIGIFGIPPIGCLPAQRTLAGGLHRVCSEEYNEAAQMANTKFST  259

Query  482   EIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT  303
             EIDSL+ KL QS +V++DIYNPLLDLI NPQ YGFE  D+GCCGTG IEVT LCNK++GT
Sbjct  260   EIDSLSKKLAQSKLVFLDIYNPLLDLIVNPQKYGFEEVDKGCCGTGKIEVTVLCNKFSGT  319

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D  KY+FWDS+HPTE+ Y ILV Q+L K V +F
Sbjct  320   CEDDTKYLFWDSYHPTEKGYKILVDQVLNKNVNKF  354


 Score =   469 bits (1206),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 273/346 (79%), Gaps = 1/346 (0%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             + F ++L  R CE K++LP  VVV+ V  FGDSIVDQG NN + T A+CN+PPYG+DF G
Sbjct  397   ICFVLMLTIRSCEGKVQLPNNVVVKAVFAFGDSIVDQGNNNYIPTIAKCNFPPYGKDFNG  456

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
              +PTGRFCNGKTP D I EELG+KE +PAY D NL+ ED KTGVSFASGG G+DP T+ +
Sbjct  457   GIPTGRFCNGKTPPDLIVEELGIKEYVPAYLDSNLRSEDLKTGVSFASGGSGYDPRTSTL  516

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
             A+AIPLSTQLN FKEY GKL+ +VGE + NYI++N+LF+VV G++D+ NTYF+L + R K
Sbjct  517   ASAIPLSTQLNQFKEYIGKLEGLVGEEEANYILKNSLFLVVVGSDDLANTYFTLGV-RLK  575

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
              DI++Y DLM+  A +F+QELY+LGAR+  IFGIPP GC+PSQRTLAGG +R C +EYNE
Sbjct  576   QDIDSYTDLMVAKATEFLQELYNLGARKIGIFGIPPIGCLPSQRTLAGGPNRECAKEYNE  635

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+Q+ N+K S  IDSL+ KL QS +V +DIYNP  D+I NPQ YG E  ++GCCGTG IE
Sbjct  636   AAQLANTKFSIGIDSLSKKLAQSKLVLIDIYNPFPDIIVNPQKYGLEEVEKGCCGTGNIE  695

Query  335   VTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             VT LCNK++GTC D  KY+FWDS+HPTE+ Y ILV QIL+KYV RF
Sbjct  696   VTILCNKFSGTCEDDTKYLFWDSYHPTEKGYRILVDQILKKYVNRF  741



>ref|XP_009786860.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Nicotiana 
sylvestris]
Length=362

 Score =   456 bits (1173),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 209/336 (62%), Positives = 263/336 (78%), Gaps = 1/336 (0%)
 Frame = -1

Query  1202  CEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGK  1023
             CEAK++LP  V+ + V  FGDSIVDQG NN ++T  +CN+ PYG+DF G MPTGRF NGK
Sbjct  28    CEAKVQLPQNVIFKAVFAFGDSIVDQGNNNYIKTLVKCNFQPYGKDFMGGMPTGRFSNGK  87

Query  1022  TPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLN  843
             TP D IA ELG+K+L+PAY DPNL+ ED K+GVSFASGGCG+DPLTA +   IPLS QL 
Sbjct  88    TPPDLIAVELGIKKLIPAYLDPNLKTEDIKSGVSFASGGCGYDPLTATLVAVIPLSRQLT  147

Query  842   YFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMI  663
              F EY GKLK +VGE + NYI++N+LF+VVAGT+D+ NTYF+  IR  K DIN+Y DLM+
Sbjct  148   QFIEYTGKLKVLVGEEEANYILKNSLFMVVAGTDDLANTYFTAGIR-LKQDINSYTDLMV  206

Query  662   QGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSA  483
               A+ F+ ELY LGAR+  I GIPP GC+PSQRTLAGG +R C +EYN+A+Q+ N+K S 
Sbjct  207   AEASKFLNELYKLGARKFWILGIPPIGCLPSQRTLAGGHNRMCSQEYNQAAQLANTKFSI  266

Query  482   EIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT  303
              I+SL+ KLPQS +V++DIYNPLLDLI NP+ YGFE  ++GCCGTG IE   LCNK++GT
Sbjct  267   AINSLSKKLPQSKLVFIDIYNPLLDLIFNPEKYGFEEVEKGCCGTGTIEGAKLCNKFSGT  326

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             C D  KY+FWDS+HPTE+AY I+V QI++KY+  F 
Sbjct  327   CEDDTKYLFWDSYHPTEKAYKIIVDQIIKKYINNFT  362



>emb|CDP07368.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   449 bits (1154),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 201/342 (59%), Positives = 259/342 (76%), Gaps = 0/342 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
             +L+     EA++KLP    V  +  FGDSIVDQG NNNL T  +CN+ PYG+DFAG +PT
Sbjct  30    LLMFSDTGEARVKLPKNATVTAIFAFGDSIVDQGNNNNLSTLVKCNFHPYGKDFAGGVPT  89

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRFCN KTP D IAEELGVK+++PAY DP+LQP D +TGVSFASGG G+DP T Q+ + I
Sbjct  90    GRFCNAKTPPDIIAEELGVKDIVPAYLDPHLQPNDLQTGVSFASGGSGYDPQTPQLVSVI  149

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
              L  QL YFKEY GKLK +VG  + +YI+ N +F++VAG++D+ NTYF+  IR+ +YD+N
Sbjct  150   SLQQQLEYFKEYIGKLKGLVGGEKASYILANAMFLIVAGSDDIANTYFTFGIRKAQYDVN  209

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
             +YADL++  A+ FIQ+L+ LGA +  +F +PP GCVPSQRTLAGG  R C    N+A+Q+
Sbjct  210   SYADLVVSSASSFIQDLHKLGASKIAVFSVPPIGCVPSQRTLAGGSLRVCASSQNQAAQL  269

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
             VN KLSAEI SL+   PQ  IVYV+++ PLLD+IQNP+NYGFEV D GCCGTG +EV  L
Sbjct  270   VNGKLSAEISSLSRNYPQGKIVYVEVFQPLLDIIQNPRNYGFEVVDYGCCGTGQVEVAIL  329

Query  323   CNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CN+YT TC D +KY+FWDS+HPTE+ Y +LV QIL+ Y+  F
Sbjct  330   CNEYTKTCEDDSKYLFWDSYHPTEQGYRMLVKQILKNYLNDF  371



>ref|XP_006342563.1| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum tuberosum]
Length=360

 Score =   446 bits (1146),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 209/353 (59%), Positives = 270/353 (76%), Gaps = 4/353 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKL-PPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYG  1071
             L+ S+ + M L    CE K +L      ++ V  FGDSIVDQG NNN+ T  +CN+ PYG
Sbjct  8     LLFSLHYVMFLY-LLCEGKTQLLSKNSTIKAVFAFGDSIVDQGNNNNITTIVKCNFSPYG  66

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
             +DF     TGRF N KTP+D I EELG+KEL+PAY DPNLQ ED KTGVSFASG  G+DP
Sbjct  67    KDFVDGKATGRFTNAKTPADLIVEELGIKELMPAYRDPNLQVEDLKTGVSFASGASGYDP  126

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
              TA I + IPLSTQLNYF+EY GKLK +VGE + N I+ N+L++VVAG+ND+ NTY+++ 
Sbjct  127   QTASIVSVIPLSTQLNYFEEYIGKLKGLVGEKEANKIVNNSLYLVVAGSNDLANTYYTIG  186

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
             +R+ +YDI++Y DLM+  A DFIQELY LGAR+  +FGIPP GC+P QRTL+GG  R CV
Sbjct  187   LRQKQYDIDSYTDLMVDKAEDFIQELYKLGARKIGVFGIPPIGCMPCQRTLSGGLGRLCV  246

Query  530   EEYNEASQIVNSKLSAEID-SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCC  354
             EE+N+A+Q+ N+K+S  ++ SL+ KLPQS +V++DIY+P+LDLI NPQ YGFEV D+GCC
Sbjct  247   EEHNQAAQLANTKISLALNGSLSKKLPQSKLVFIDIYDPMLDLILNPQKYGFEVVDKGCC  306

Query  353   GTGVIEVTFLCNKY-TGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             GTG IEV  LCN+Y + TC D +KY+FWDS+HPTER Y ILV Q+++KY+ RF
Sbjct  307   GTGNIEVVILCNRYMSSTCEDGSKYLFWDSYHPTERGYRILVDQMIKKYINRF  359



>gb|KHN45938.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=364

 Score =   446 bits (1146),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 201/341 (59%), Positives = 260/341 (76%), Gaps = 0/341 (0%)
 Frame = -1

Query  1220  LLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTG  1041
             L+L  R +A +KLPP + +  VI FGDSIVD G NN ++T  +C++PPYG+DF G +PTG
Sbjct  23    LVLSFRAKAVVKLPPNITIPAVIAFGDSIVDPGNNNKVKTLVKCDFPPYGKDFEGGIPTG  82

Query  1040  RFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIP  861
             RFCNGK PSD + EELG+KELLPAY DPNL+P D  TGV FASG  G+DPLT +IA+ I 
Sbjct  83    RFCNGKIPSDLLVEELGIKELLPAYLDPNLKPSDLVTGVCFASGASGYDPLTPKIASVIS  142

Query  860   LSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINA  681
             +S QL+ FKEY GKLK +VGE++T +I+ N+ F+VVAG++D+ NTYF   +R+ +YDI A
Sbjct  143   MSEQLDMFKEYIGKLKHIVGEDRTKFILANSFFLVVAGSDDIANTYFIARVRQLQYDIPA  202

Query  680   YADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIV  501
             Y DLM+  A++F++ELY LGARR  +   PP GCVPSQRTLAGG  R C EEYN A+++ 
Sbjct  203   YTDLMLHSASNFVKELYGLGARRIGVLSAPPIGCVPSQRTLAGGFQRECAEEYNYAAKLF  262

Query  500   NSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLC  321
             NSKLS E+D+L + LP S IVY+D+YNPL+D+I N Q +G++V DRGCCGTG +EV  LC
Sbjct  263   NSKLSRELDALKHNLPNSRIVYIDVYNPLMDIIVNYQRHGYKVVDRGCCGTGKLEVAVLC  322

Query  320   NKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             N    TCPD ++YVFWDS+HPTE  Y  L+ Q+LQKY+ RF
Sbjct  323   NPLGATCPDASQYVFWDSYHPTEGVYRQLIVQVLQKYLTRF  363



>gb|KHN09073.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=349

 Score =   444 bits (1143),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 260/342 (76%), Gaps = 0/342 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
             +L+L  R +A +KLPP +    VI FGDSIVD G NN ++T  +C++PPYG+DF G +PT
Sbjct  7     LLVLSFRTKAVVKLPPNITFPAVIAFGDSIVDPGNNNKVKTLVKCDFPPYGKDFEGGIPT  66

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRFCNGK PSD +AEELG+KELLPAY DPNL+P D  TGV FASG  G+DPLT +IA+ I
Sbjct  67    GRFCNGKIPSDLLAEELGIKELLPAYLDPNLKPSDLVTGVCFASGASGYDPLTPKIASVI  126

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
              +S QL+ FKEY GKLK +VGE++T +I+ N+ F+VVAG++D+ NTYF   +R+ +YDI 
Sbjct  127   SMSEQLDMFKEYIGKLKHIVGEDRTKFILANSFFLVVAGSDDIANTYFIARVRQLQYDIP  186

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
             AY DLM+  A++F++ELY LGARR  +   PP GCVPSQRTLAGG  R C EEYN A+++
Sbjct  187   AYTDLMLHSASNFVKELYGLGARRIGVLSAPPIGCVPSQRTLAGGLQRDCAEEYNYAAKL  246

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
              NSKLS E+DSL + L  S IVY+D+YNPL+D+I N Q YG++V DRGCCGTG +EV  L
Sbjct  247   FNSKLSRELDSLKHNLRNSRIVYIDVYNPLMDIIVNYQRYGYKVVDRGCCGTGKLEVAVL  306

Query  323   CNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CN    TCPD ++YVFWDS+HPTE  Y  L+ Q+LQKY+ RF
Sbjct  307   CNPLGATCPDASQYVFWDSYHPTEGVYRQLIVQVLQKYLTRF  348



>gb|AFK34909.1| unknown [Lotus japonicus]
Length=364

 Score =   444 bits (1141),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 205/342 (60%), Positives = 260/342 (76%), Gaps = 0/342 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
             +L+L  R +A +KLPP V V  V+ FGD IVD G NN ++T  +CN+PPYG+DF G  PT
Sbjct  22    LLVLTSRTKAVVKLPPNVEVPAVMAFGDPIVDPGNNNKIKTLVKCNFPPYGKDFEGGNPT  81

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRFCNGK PSD +AEELG+KELLPAY  PNL+P D  TGVSFASG  G+DPLT +IA+ I
Sbjct  82    GRFCNGKIPSDLLAEELGIKELLPAYKQPNLKPSDLLTGVSFASGASGYDPLTPKIASVI  141

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
              +S QL+ FKEY GKLK +VGEN+TNYII N+L +VVAG++D+ NTYF   +R+  YD+ 
Sbjct  142   SMSDQLDMFKEYIGKLKNIVGENRTNYIIANSLMLVVAGSDDIANTYFIARVRQLHYDVP  201

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
             AY DLM+  A+ F++ELY LGARR  +   PP GCVPSQRTLAGG  R C  +YN+A+++
Sbjct  202   AYTDLMVNSASQFVKELYILGARRIGVISAPPIGCVPSQRTLAGGIHRECSGKYNDAAKL  261

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
              NSKLS E+DSL++  P S IVY+DIYNPLLD+I N Q YGF+VAD+GCCGTG++EV+ L
Sbjct  262   FNSKLSKELDSLHHNSPNSRIVYIDIYNPLLDIIVNYQKYGFKVADKGCCGTGLLEVSIL  321

Query  323   CNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CN    +C D ++YVFWDS+HPTE  Y  L+ Q+LQKY+ R 
Sbjct  322   CNPLGDSCSDASQYVFWDSYHPTEVVYRKLIDQVLQKYLNRL  363



>ref|XP_010061080.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
 gb|KCW67977.1| hypothetical protein EUGRSUZ_F01671 [Eucalyptus grandis]
Length=364

 Score =   443 bits (1140),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 200/351 (57%), Positives = 267/351 (76%), Gaps = 7/351 (2%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L +S++FP         A +KLPP V V  +IVFGDSIVD G NN+L T  +CN+PPYG+
Sbjct  19    LFISIMFP------PARAAVKLPPNVTVPAIIVFGDSIVDAGNNNDLSTLVKCNFPPYGE  72

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G +PTGRFC+GK PSD +AE+LG+K+ +PAY DPNLQ +D  TGV+FASGG G+DPL
Sbjct  73    DFKGGIPTGRFCDGKVPSDIMAEQLGIKDTVPAYLDPNLQDQDLVTGVTFASGGTGYDPL  132

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T  + + I +S QL+ FK+Y GKLK  VGE + N+I+ N++++VV+G++D+ N YF+  +
Sbjct  133   TPTLVSVISMSEQLDLFKKYIGKLKGFVGEEKANFILANSMYLVVSGSDDIANNYFTARV  192

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             R+ +Y++  Y DLM+  A++F+Q LYDLGARR  +FG PP GCVPSQRTLAGG  R C E
Sbjct  193   RQLQYNVPEYTDLMVDAASNFLQGLYDLGARRIAVFGSPPIGCVPSQRTLAGGPLRGCAE  252

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
             +YN A+Q+ N+KLS+ +DSLN KLP+S +VY+D+YNPLLDLIQ PQ  GF V+D+GCCGT
Sbjct  253   QYNAAAQLFNTKLSSNLDSLNRKLPRSKMVYIDVYNPLLDLIQYPQKQGFVVSDKGCCGT  312

Query  347   GVIEVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G IEVT LCNK++  TC D + YVFWDS+HPTE+AY  L+  ++ KY+ RF
Sbjct  313   GTIEVTLLCNKFSPDTCTDVSDYVFWDSYHPTEKAYRALLTPLVNKYINRF  363



>gb|ACU24478.1| unknown [Glycine max]
Length=364

 Score =   443 bits (1139),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 200/341 (59%), Positives = 259/341 (76%), Gaps = 0/341 (0%)
 Frame = -1

Query  1220  LLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTG  1041
             L+L  R +A +KLPP + +  VI FGDSIVD G NN ++T  +C++PPY +DF G +PTG
Sbjct  23    LVLSFRAKAVVKLPPNITIPAVIAFGDSIVDPGNNNKVKTLVKCDFPPYDKDFEGGIPTG  82

Query  1040  RFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIP  861
             RFCNGK PSD + EELG+KELLPAY DPNL+P D  TGV FASG  G+DPLT +IA+ I 
Sbjct  83    RFCNGKIPSDLLVEELGIKELLPAYLDPNLKPSDLVTGVCFASGASGYDPLTPKIASVIS  142

Query  860   LSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINA  681
             +S QL+ FKEY GKLK +VGE++T +I+ N+ F+VVAG++D+ NTYF   +R+ +YDI A
Sbjct  143   MSEQLDMFKEYIGKLKHIVGEDRTKFILANSFFLVVAGSDDIANTYFIARVRQLQYDIPA  202

Query  680   YADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIV  501
             Y DLM+  A++F++ELY LGARR  +   PP GCVPSQRTLAGG  R C EEYN A+++ 
Sbjct  203   YTDLMLHSASNFVKELYGLGARRIGVLSAPPIGCVPSQRTLAGGFQRECAEEYNYAAKLF  262

Query  500   NSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLC  321
             NSKLS E+D+L + LP S IVY+D+YNPL+D+I N Q +G++V DRGCCGTG +EV  LC
Sbjct  263   NSKLSRELDALKHNLPNSRIVYIDVYNPLMDIIVNYQRHGYKVVDRGCCGTGKLEVAVLC  322

Query  320   NKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             N    TCPD ++YVFWDS+HPTE  Y  L+ Q+LQKY+ RF
Sbjct  323   NPLGATCPDASQYVFWDSYHPTEGVYRQLIVQVLQKYLTRF  363



>ref|XP_011003064.1| PREDICTED: GDSL esterase/lipase EXL3-like [Populus euphratica]
Length=366

 Score =   443 bits (1139),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 201/334 (60%), Positives = 257/334 (77%), Gaps = 1/334 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
              + +KLPP V V  ++VFGDSIVD G NN+LQT  + N+PPYG+DF G +PTGRFCNGK 
Sbjct  31    SSSLKLPPNVTVPALLVFGDSIVDAGNNNDLQTLVKSNFPPYGKDFEGGIPTGRFCNGKI  90

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA+ELG+K+ +PAY DP + P+D  TGV+FAS G GFDPLT+++ + + LS QL +
Sbjct  91    PSDIIAKELGIKDTVPAYLDPAVLPQDLITGVTFASSGSGFDPLTSKLVSVLSLSDQLEH  150

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKLK ++GE  T + I N+LF+VVAG++D+ NTYF+L  R  +YD+ AY DLM  
Sbjct  151   FKEYIGKLKAIIGEENTIFTIRNSLFLVVAGSDDIANTYFTLRARNLQYDVPAYTDLMAN  210

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F QELYDLGARR VIF  PP GCVPSQRTLAGG  R C E +NEA+++ NSKLS +
Sbjct  211   SASSFAQELYDLGARRIVIFSAPPVGCVPSQRTLAGGAERECAENFNEAAKLFNSKLSKK  270

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +DSL + LP S +VYVD+YNPLLD+IQN Q YGF+VAD+GCCGTG +EV  LCN++T  T
Sbjct  271   LDSLASSLPNSRLVYVDVYNPLLDVIQNHQKYGFQVADKGCCGTGNLEVAILCNQHTSET  330

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYR  201
             C D + Y+FWDS+HPTERAY  LV+ +L KY+ +
Sbjct  331   CADVSDYIFWDSYHPTERAYKALVNPVLGKYLTK  364



>ref|XP_008221228.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=379

 Score =   442 bits (1138),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 200/334 (60%), Positives = 259/334 (78%), Gaps = 0/334 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +K+PPG  +  VIVFGDSI+D G NN+L++  +CN+ PYG+DF G  PTGRF NGK 
Sbjct  42    EAAVKIPPGQTIPAVIVFGDSIMDTGNNNHLKSLVKCNFSPYGRDFQGHKPTGRFGNGKV  101

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDFI EELG+K+ LPAY DP+L+PED  TGV FASGG G+DP+T +I + I LS QL+ 
Sbjct  102   PSDFIVEELGIKKYLPAYLDPSLRPEDLATGVCFASGGTGYDPMTPEIVSVISLSDQLSM  161

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKLK +VGE +TN+I+ N LF+VVAG++D+ NTYF++ +R+ +YDI AY DLM+ 
Sbjct  162   FKEYIGKLKGIVGEERTNFILSNALFLVVAGSDDLANTYFTIRVRKAQYDIPAYTDLMVD  221

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F++ELY LGARR  +F  PP GCVPSQRTL GG +R C EEYNEA+++ N+KLS  
Sbjct  222   SASSFVKELYGLGARRIGLFSAPPIGCVPSQRTLGGGLARDCAEEYNEAAKLFNAKLSRS  281

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             ++SLN  LP S +VYVD+YNPLL++I NP   GF+VA++GCCGTGVIEV  LCNKY  TC
Sbjct  282   LNSLNTALPNSRVVYVDVYNPLLEIILNPAKDGFKVAEKGCCGTGVIEVAVLCNKYDATC  341

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + + +VFWDS+HPTER Y +L+  +LQ+YV  F
Sbjct  342   ANASDHVFWDSYHPTERTYSVLIPPLLQRYVNDF  375



>ref|XP_010692505.1| PREDICTED: GDSL esterase/lipase EXL3-like [Beta vulgaris subsp. 
vulgaris]
Length=367

 Score =   442 bits (1136),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 251/329 (76%), Gaps = 0/329 (0%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLPP V V  ++ FGDSI+D G NNN++T  +CN+PPYGQDF G + TGRF NG+ P
Sbjct  34    ATLKLPPNVTVPAILGFGDSIIDPGNNNNIKTIIKCNFPPYGQDFMGGISTGRFSNGRIP  93

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             +DF+AEE  +KE LPAY D NL P+D  TGVSFASG  GFDPLT+Q+A+ I LS QL YF
Sbjct  94    TDFLAEEFSIKEYLPAYLDTNLSPQDLLTGVSFASGAAGFDPLTSQVASVISLSEQLEYF  153

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             KEY  K+K++VGE +TN+I+ N+++ +VAG++D+ NTYF  P RR  YD+ +Y DLM++ 
Sbjct  154   KEYTEKVKQLVGEEKTNFILTNSIYFIVAGSDDIANTYFGTPFRRLHYDVESYTDLMVES  213

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F+QELY LGARR  +F  PP GCVPSQRT+ GG  R C E YN+A+Q+ NSKLS E+
Sbjct  214   ASSFVQELYKLGARRMGLFSAPPIGCVPSQRTIGGGIVRECAEHYNQAAQLYNSKLSIEL  273

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCP  297
             DSL +KLP + +VY+DIY+PLLDLIQNP  YG E   +GCCGTG++EV+ LCNK    CP
Sbjct  274   DSLAHKLPHTKVVYIDIYSPLLDLIQNPDKYGLEEVVKGCCGTGLLEVSVLCNKLDSVCP  333

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKY  210
             D +KY+FWDS+HPTER Y +L   I++KY
Sbjct  334   DDSKYLFWDSYHPTERGYQLLFDAIIKKY  362



>ref|XP_004252803.2| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Solanum 
lycopersicum]
Length=346

 Score =   441 bits (1133),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 205/345 (59%), Positives = 264/345 (77%), Gaps = 3/345 (1%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKL-PPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMP  1047
             M+ L   CE K +L      ++ V  FGDSIVDQG NNN+ T  +CN+PPYG+DF     
Sbjct  1     MMFLFLLCEGKTQLLSKNSTIKAVFAFGDSIVDQGNNNNITTIVKCNFPPYGKDFVDGKA  60

Query  1046  TGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATA  867
             TGRF N KTP+D I EEL +KEL+PAY DPNLQ ED KTGVSFASG CG+DP TA I + 
Sbjct  61    TGRFTNAKTPADLIVEELEIKELMPAYRDPNLQTEDLKTGVSFASGACGYDPQTASIVSV  120

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             IPLSTQLNYF+EY GKLK +VGE + N I+ N+L++VVAG+ND+ NTY+++  R+ +YDI
Sbjct  121   IPLSTQLNYFEEYIGKLKGLVGEKEANKILNNSLYLVVAGSNDLANTYYTIGFRQKQYDI  180

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
             ++Y D M+  A  FIQELY LGAR+  +FGIPP GC+P QRTL+GG SR CVEE+N+A+Q
Sbjct  181   DSYTDFMVDKAEHFIQELYKLGARKIGVFGIPPIGCLPFQRTLSGGLSRVCVEEHNQAAQ  240

Query  506   IVNSKLSAEID-SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVT  330
             + N+K+S  I+ SL+NKLPQS +V++DIY+P+LDLI NP+ +GFEV D+GCCGTG IEV 
Sbjct  241   LANTKISLAINGSLSNKLPQSKLVFIDIYDPMLDLILNPKKHGFEVVDKGCCGTGNIEVV  300

Query  329   FLCNKY-TGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              LCN+Y + TC D  KY+F+DS+HPTER Y ILV Q+++KY+  F
Sbjct  301   ILCNRYMSSTCEDDTKYLFFDSYHPTERGYRILVDQMIKKYINSF  345



>ref|XP_006342239.1| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum tuberosum]
Length=377

 Score =   441 bits (1135),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 255/325 (78%), Gaps = 1/325 (0%)
 Frame = -1

Query  1172  VVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEEL  993
             +VV+ +  FGDSIVDQG NN + T A+ N+ PYG+DF G +PTGRF NGKTP D + EEL
Sbjct  53    IVVKAIFAFGDSIVDQGNNNYISTMAKSNFLPYGKDFNGGIPTGRFSNGKTPPDLLVEEL  112

Query  992   GVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLK  813
              +KE+LPAY D NL+  D+KTGVSFASGGCGFDPLT+ I +A+ LSTQLN F+EY GKL+
Sbjct  113   RIKEILPAYLDSNLKSGDFKTGVSFASGGCGFDPLTSIITSALSLSTQLNQFREYIGKLE  172

Query  812   EMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQEL  633
              +VGE +  YI++N+LF+VVAG++D+ NTYF+L   R K+DIN+Y DLM+  A +F+QEL
Sbjct  173   RLVGEEEATYILKNSLFLVVAGSDDLANTYFTLG-GRLKHDINSYTDLMVAKATEFLQEL  231

Query  632   YDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLP  453
             Y+LGAR+  IFGIPP GC+PSQRTLAGG  R C EEYNEA+Q+ N+K S EIDSL+ KL 
Sbjct  232   YNLGARKIGIFGIPPIGCLPSQRTLAGGLHRVCSEEYNEAAQMANTKFSTEIDSLSKKLV  291

Query  452   QSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCPDHNKYVFW  273
             QS +V++DIYN  LDLI NP+ YGFE  ++GCCGTG IE   LCN+++G C D  KY+FW
Sbjct  292   QSKLVFIDIYNTFLDLIVNPKKYGFEEVEKGCCGTGTIEAIILCNEFSGICEDDTKYLFW  351

Query  272   DSFHPTERAYGILVHQILQKYVYRF  198
             DS+HPTE+ Y ILV +IL+KY+  F
Sbjct  352   DSYHPTEKGYKILVDEILKKYINNF  376



>ref|XP_002306948.2| family II extracellular lipase 3 family protein [Populus trichocarpa]
 gb|EEE93944.2| family II extracellular lipase 3 family protein [Populus trichocarpa]
Length=365

 Score =   439 bits (1128),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 197/332 (59%), Positives = 257/332 (77%), Gaps = 1/332 (0%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             +KLPP V +  ++VFGDSIVD G NN+L+T  + N+PPYG+DF G +PTGRFCNGK PSD
Sbjct  33    VKLPPNVTIPALLVFGDSIVDAGNNNDLETLVKSNFPPYGKDFEGGIPTGRFCNGKIPSD  92

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              IA+ELG+K+ LPAY DP + P+D  TGV+FAS G GFDPLT ++ + + LS QL +FKE
Sbjct  93    IIAKELGIKDTLPAYLDPAVLPQDLITGVTFASSGSGFDPLTPKLVSVLSLSDQLEHFKE  152

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y GKLK ++GE  T + I N+LF+VVAG++D+ NTYF+L  R+ +YD+ AY DLM   A+
Sbjct  153   YIGKLKAIIGEENTIFTIRNSLFLVVAGSDDIANTYFTLRARKLQYDVPAYTDLMANSAS  212

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
              F QELY+LGARR V+F  PP GCVPSQRTLAGG  R C E +NEA+++ NSKLS ++DS
Sbjct  213   SFAQELYELGARRIVVFSAPPVGCVPSQRTLAGGAERECAENFNEAAKLFNSKLSKKLDS  272

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPD  294
             L + LP S++VY+D+YN LLD+IQ PQ YGF+VAD+GCCGTG +EV  LCN++T  TC D
Sbjct  273   LGSSLPNSSLVYIDVYNLLLDIIQKPQKYGFQVADKGCCGTGNLEVAVLCNQHTSETCAD  332

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + YVFWDS+HPTE+AY  LV+ +L KY+ +F
Sbjct  333   VSDYVFWDSYHPTEKAYKALVYPLLGKYLTKF  364



>gb|AES59777.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=457

 Score =   440 bits (1131),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 208/358 (58%), Positives = 260/358 (73%), Gaps = 1/358 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMP  1047
             +LL+  + +  ++LPP V V  V+VFGDSIVD G NNN L+T ARCN+PPYG+DF G +P
Sbjct  13    LLLVACKTKGIVQLPPNVSVPAVLVFGDSIVDTGNNNNNLRTTARCNFPPYGKDFKGGIP  72

Query  1046  TGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATA  867
             TGRF NGK PSDFI EELG+KE LPAY DPNLQP D  TGV FASGG GFDPLT+Q A+A
Sbjct  73    TGRFSNGKVPSDFIVEELGIKEFLPAYLDPNLQPSDLSTGVCFASGGAGFDPLTSQTASA  132

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             I LS QL+ FKEY GKL+E+VGE++TN+I+ N+LF+VV G+ND+ NTYF   IR+ +YD 
Sbjct  133   ISLSGQLDLFKEYIGKLRELVGEDRTNFILANSLFLVVLGSNDISNTYFLSHIRQLQYDF  192

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
               YADLM+  A++F++E+Y+LGARR  +F  PP GC+P QRT AGG  R  V EYNEA +
Sbjct  193   PDYADLMVNSASNFLKEIYELGARRIGVFNAPPIGCLPFQRTAAGGIERRIVVEYNEAVE  252

Query  506   IVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTF  327
             + NSKLS  + S N   P S IVY+D+YNPLLD+I N   YG++V D+GCCGTG+IEV  
Sbjct  253   LYNSKLSKGLASFNQNYPNSRIVYIDVYNPLLDIIVNSNKYGYKVDDKGCCGTGIIEVVL  312

Query  326   LCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA*TNCTSTNSLPQHW  153
             LCN  + TCP+  ++VFWDSFHPTE  Y  L+  I+QKYV  F    C         W
Sbjct  313   LCNHLSSTCPNDMEFVFWDSFHPTESVYKRLIAPIIQKYVNDFMEEECQDIERYRYEW  370



>gb|KDO84926.1| hypothetical protein CISIN_1g017687mg [Citrus sinensis]
Length=367

 Score =   436 bits (1121),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 210/344 (61%), Positives = 260/344 (76%), Gaps = 3/344 (1%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
             +L L RR EA IKLP  V V  VIVFGDSIVD G NNNL+T A+CN+PPYG+DF G   T
Sbjct  24    VLDLFRRTEAVIKLPGNVTVSAVIVFGDSIVDTGNNNNLKTPAKCNFPPYGRDFEGGAAT  83

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI-ATA  867
             GRF NGK PSD +AEELGVKEL PAY DP L+PED  TGV+FASGGCG+DPLT ++ A A
Sbjct  84    GRFSNGKVPSDILAEELGVKELSPAYLDPTLKPEDLLTGVNFASGGCGYDPLTTRLSAAA  143

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             + LS QL  FKEY  KL+ +VGE   N I E + F+VV G+ND+ N YF   IRR +YDI
Sbjct  144   LSLSDQLQLFKEYIDKLRAIVGEEGKNRIFETSFFLVVVGSNDINNNYFGSRIRRLQYDI  203

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
             + Y DL++  A+ F++E+Y LGARR  +FG P  GC+PS RT+AGG  R C +EYNEA+Q
Sbjct  204   STYTDLLVGHASTFLKEIYGLGARRIGVFGAPTLGCLPSTRTVAGGIKRDCAKEYNEAAQ  263

Query  506   IVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTF  327
             + NSKLSAE+DSLNN LP   IVY+DIY+PLLD+IQNP  YGF++ D+GCCGTG IEV  
Sbjct  264   LFNSKLSAELDSLNN-LPDVRIVYIDIYSPLLDIIQNPNKYGFDIVDKGCCGTGTIEVII  322

Query  326   LCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             LCN+++  TC + + Y+FWDSFHPTE+AY ILV  +++KY+ RF
Sbjct  323   LCNQFSPYTCTNDSGYLFWDSFHPTEKAYKILVSNLVKKYINRF  366



>ref|XP_003603782.1| GDSL esterase/lipase EXL3 [Medicago truncatula]
 gb|AES74033.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=369

 Score =   436 bits (1120),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 256/337 (76%), Gaps = 0/337 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNG  1026
             R  A +KLPP V +  +I FGDSI+D G NNN++T  +CN+PPYGQDF G +PTGRFCNG
Sbjct  32    RTNALVKLPPNVTIPALIAFGDSIMDTGNNNNIKTIVKCNFPPYGQDFEGGIPTGRFCNG  91

Query  1025  KTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQL  846
             K PSD I EELG+KELLPAY DPNL+P D  TGV FASG  G+DPLT +I + I +  QL
Sbjct  92    KNPSDLIVEELGIKELLPAYLDPNLKPSDLSTGVCFASGASGYDPLTPKIVSVISMGDQL  151

Query  845   NYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLM  666
               FKEY  KLK +VGEN+ N+I+ NTLF++VAG++D+ NTYF++  R+  YD+ AYADLM
Sbjct  152   KMFKEYIVKLKGVVGENRANFILANTLFLIVAGSDDLANTYFTIRTRQLHYDVPAYADLM  211

Query  665   IQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLS  486
             ++GA+DFI+E+Y LGARR  +F   P G +PSQ+TL GG  R   E+YNEA+++ NSKLS
Sbjct  212   VKGASDFIKEIYKLGARRIGVFSAAPIGYLPSQKTLGGGVFRKTNEKYNEAAKLFNSKLS  271

Query  485   AEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG  306
              E+D L++ LP S ++Y+DIY+PLLD+I  PQ YG++VAD+GCCGTG +EV+ LCN  + 
Sbjct  272   KELDYLHSNLPNSNVIYIDIYSPLLDIILKPQKYGYKVADKGCCGTGKLEVSVLCNPLSA  331

Query  305   TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             TCPD+++Y+FWDS+HPTE  Y  LV  +L KYV R  
Sbjct  332   TCPDNSEYIFWDSYHPTESVYRKLVAVVLPKYVGRLT  368



>ref|XP_009622933.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana tomentosiformis]
Length=366

 Score =   435 bits (1119),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 205/355 (58%), Positives = 262/355 (74%), Gaps = 4/355 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTF-ARCNYPPYG  1071
             L + +VF ML+    CEAK+KLPP +VV+ V  FGDSIVDQG NNN+ T   +CN+PPYG
Sbjct  12    LSLYIVFVMLISSSTCEAKVKLPPNLVVKAVYAFGDSIVDQGNNNNIVTTPVKCNFPPYG  71

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
             +DF G MPTGRF N KTP D IA+ELG+ EL+PAY DP L+ ED KTGVSFASGG G+DP
Sbjct  72    KDFMGGMPTGRFSNAKTPPDMIAKELGLNELIPAYLDPELKVEDLKTGVSFASGGSGYDP  131

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDV---LNTYF  720
              T+ I +AIPLS QLN+F EY GKLKE+VGE + NYI+ N+LF+VVAG+ D+     +Y+
Sbjct  132   RTSTINSAIPLSAQLNHFLEYIGKLKELVGEEEGNYILNNSLFIVVAGSVDIAGLTGSYY  191

Query  719   SLPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSR  540
                IR+  YD+++Y +L+   A DF+QELY LGAR     G+PP GCVP+QRTLAGG +R
Sbjct  192   EDVIRQKLYDMDSYTNLLAAYAFDFVQELYKLGARNIAFLGVPPLGCVPAQRTLAGGPAR  251

Query  539   ACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
              C EEYN+A+++ N+K S  IDSL+ K PQ  +V++D YN LLD I NPQ YG E   +G
Sbjct  252   MCAEEYNQAAELANTKFSLAIDSLHKKFPQYKLVFIDAYNSLLDCIVNPQKYGLEEVQKG  311

Query  359   CCGTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             CCG+G IEV+ LCNK++GTC D  KY+FWDS+H TE+ Y ILV QI++ Y   F+
Sbjct  312   CCGSGNIEVSILCNKFSGTCEDDTKYLFWDSYHLTEKGYRILVDQIIKNYTNSFS  366



>ref|XP_007160639.1| hypothetical protein PHAVU_001G004300g [Phaseolus vulgaris]
 gb|ESW32633.1| hypothetical protein PHAVU_001G004300g [Phaseolus vulgaris]
Length=356

 Score =   435 bits (1118),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 205/346 (59%), Positives = 262/346 (76%), Gaps = 3/346 (1%)
 Frame = -1

Query  1238  SVVFPMLLLGRRCEAK--IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             S++  +++ G  C  K  +KLPP V V  V+ FGDSIVD G NNNL T  +C++PPYG+D
Sbjct  8     SLLRLIVIFGLWCRTKGVVKLPPHVSVPAVLAFGDSIVDSGNNNNLTTLVKCDFPPYGKD  67

Query  1064  FAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLT  885
             F G  PTGRFCNGK PSD IAEELG+KE LPAY DPNL+  D  TGV FASG  G+DPLT
Sbjct  68    FQGGKPTGRFCNGKIPSDIIAEELGIKEYLPAYMDPNLKSSDLATGVCFASGASGYDPLT  127

Query  884   AQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIR  705
              +IA+ I LS+QL+ FKEY GKLK +VGE++TN+I+ N+LF+VVAG++D+ NTYF    R
Sbjct  128   PEIASVISLSSQLDMFKEYIGKLKGIVGESRTNFILGNSLFLVVAGSDDIANTYFVTHAR  187

Query  704   RYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEE  525
               +YDI +Y DLM+  A++F++ELY+LGARR  +   PP GCVPSQRTLAGG  R C E+
Sbjct  188   ILQYDIPSYTDLMVNSASNFVKELYNLGARRIGVLSAPPIGCVPSQRTLAGGLVRGCSEK  247

Query  524   YNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTG  345
             YN+A+++ NSKLS E+DSL +K  +S IVY+D+YNPLLD+IQN QNYGF+V DRGCCGTG
Sbjct  248   YNDAAKLFNSKLSKELDSL-HKSSKSRIVYIDVYNPLLDIIQNYQNYGFKVMDRGCCGTG  306

Query  344   VIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
              +EV  LCN    TC + ++YVFWDS+HPTE  Y  LV  +L+KY+
Sbjct  307   KLEVAVLCNPLDSTCSNASEYVFWDSYHPTEGVYRKLVSHVLKKYM  352



>ref|XP_003589526.1| GDSL esterase/lipase [Medicago truncatula]
Length=510

 Score =   440 bits (1131),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 208/358 (58%), Positives = 260/358 (73%), Gaps = 1/358 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMP  1047
             +LL+  + +  ++LPP V V  V+VFGDSIVD G NNN L+T ARCN+PPYG+DF G +P
Sbjct  13    LLLVACKTKGIVQLPPNVSVPAVLVFGDSIVDTGNNNNNLRTTARCNFPPYGKDFKGGIP  72

Query  1046  TGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATA  867
             TGRF NGK PSDFI EELG+KE LPAY DPNLQP D  TGV FASGG GFDPLT+Q A+A
Sbjct  73    TGRFSNGKVPSDFIVEELGIKEFLPAYLDPNLQPSDLSTGVCFASGGAGFDPLTSQTASA  132

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             I LS QL+ FKEY GKL+E+VGE++TN+I+ N+LF+VV G+ND+ NTYF   IR+ +YD 
Sbjct  133   ISLSGQLDLFKEYIGKLRELVGEDRTNFILANSLFLVVLGSNDISNTYFLSHIRQLQYDF  192

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
               YADLM+  A++F++E+Y+LGARR  +F  PP GC+P QRT AGG  R  V EYNEA +
Sbjct  193   PDYADLMVNSASNFLKEIYELGARRIGVFNAPPIGCLPFQRTAAGGIERRIVVEYNEAVE  252

Query  506   IVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTF  327
             + NSKLS  + S N   P S IVY+D+YNPLLD+I N   YG++V D+GCCGTG+IEV  
Sbjct  253   LYNSKLSKGLASFNQNYPNSRIVYIDVYNPLLDIIVNSNKYGYKVDDKGCCGTGIIEVVL  312

Query  326   LCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA*TNCTSTNSLPQHW  153
             LCN  + TCP+  ++VFWDSFHPTE  Y  L+  I+QKYV  F    C         W
Sbjct  313   LCNHLSSTCPNDMEFVFWDSFHPTESVYKRLIAPIIQKYVNDFMEEECQDIERYRYEW  370



>gb|AFK48612.1| unknown [Medicago truncatula]
Length=369

 Score =   434 bits (1117),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 196/337 (58%), Positives = 255/337 (76%), Gaps = 0/337 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNG  1026
             R  A +KLPP V +  +I FGDSI+D G NNN++T  +CN+PPYGQDF G +PTGRFCNG
Sbjct  32    RTNALVKLPPNVTIPALIAFGDSIMDTGNNNNIKTIVKCNFPPYGQDFEGGIPTGRFCNG  91

Query  1025  KTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQL  846
             K PSD I EELG+KELLPAY DPNL+P D  TGV FASG  G+DPLT +I + I +  QL
Sbjct  92    KNPSDLIVEELGIKELLPAYLDPNLKPSDLSTGVCFASGASGYDPLTPKIVSVISMGDQL  151

Query  845   NYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLM  666
               FKEY  KLK +VGEN+ N+I+ NTLF++VAG++D+ NTYF++  R+  YD+ AYADLM
Sbjct  152   KMFKEYIVKLKGVVGENRANFILANTLFLIVAGSDDLANTYFTIRTRQLHYDVPAYADLM  211

Query  665   IQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLS  486
             ++GA+DFI+E+Y LGARR  +F   P G +PSQ+TL GG  R   E+YNEA+++ NSKLS
Sbjct  212   VKGASDFIKEIYKLGARRIGVFSAAPIGYLPSQKTLGGGVFRKTNEKYNEAAKLFNSKLS  271

Query  485   AEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG  306
              E+D L++ LP S ++Y+DIY+PLLD+I  PQ YG++VAD+GCCGTG +EV+ LCN  + 
Sbjct  272   KELDYLHSNLPNSNVIYIDIYSPLLDIILKPQKYGYKVADKGCCGTGKLEVSVLCNPLSA  331

Query  305   TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             TCPD+++Y+FWDS HPTE  Y  LV  +L KYV R  
Sbjct  332   TCPDNSEYIFWDSHHPTESVYRKLVAVVLPKYVGRLT  368



>ref|XP_003589534.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59785.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=361

 Score =   432 bits (1111),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 201/342 (59%), Positives = 253/342 (74%), Gaps = 1/342 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
             +  L  + +  IKLPP V V  VI FGDSIVD G NN+L+T  +CN+PPYG+DF G +PT
Sbjct  20    LFALCYKTKGLIKLPPNVTVPAVIAFGDSIVDSGNNNDLKTLVKCNFPPYGKDFQGGVPT  79

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRFCNGK PSD +AE+ G+K  +PAY DPNL+  D  TGV FASG  G+DPLT QIA+ I
Sbjct  80    GRFCNGKIPSDILAEQFGIKGYVPAYLDPNLKSSDLLTGVGFASGASGYDPLTPQIASVI  139

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
             PLS QL+ FKEY GKLK +VGE +TN+I+ N+LFVVV G++D+ NTY+ +   R +YDI 
Sbjct  140   PLSAQLDMFKEYIGKLKGIVGEERTNFILANSLFVVVGGSDDIANTYYVVH-ARLQYDIP  198

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
             AY DLM   A +FI+E+Y LGARR  + G PP GCVPSQRTLAGG  R C E+YN+A+++
Sbjct  199   AYTDLMSNSATNFIKEIYKLGARRIAVLGAPPIGCVPSQRTLAGGIVRECAEKYNDAAKL  258

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
              NSKLS ++DSL+   P S IVY+D+Y PLLD+I N Q YGF+V DRGCCGTG +EV  L
Sbjct  259   FNSKLSKQLDSLSQNSPNSRIVYIDVYTPLLDIIVNYQKYGFKVVDRGCCGTGKLEVAVL  318

Query  323   CNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CN    TC D ++YVFWDS+HPTERAY  LV  +L++Y+ R 
Sbjct  319   CNPLDATCSDASEYVFWDSYHPTERAYRKLVDSVLERYLNRL  360



>ref|XP_008221227.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=389

 Score =   432 bits (1112),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 207/336 (62%), Positives = 250/336 (74%), Gaps = 3/336 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A+IKLP    V  VI+FGDSIVD G NNN  +T AR N+PPYG+D  G MPTGR+ NGK 
Sbjct  53    ARIKLPGNASVSAVIIFGDSIVDTGNNNNNFKTLARSNFPPYGKDLKGGMPTGRYSNGKV  112

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD I EELG+KELLPAY DP LQP+D  TGV  A+GG G+DPLTAQ+A    LS QL  
Sbjct  113   PSDLIVEELGIKELLPAYLDPTLQPKDLLTGVVIAAGGAGYDPLTAQVAGVASLSDQLKQ  172

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK + GE + N+II N+L  VVAG+ND+ NTYF   +R+ +YD+ +Y DLM+ 
Sbjct  173   FKEYIKKLKAIAGEERANFIISNSLIFVVAGSNDISNTYFLTGMRKLEYDVPSYTDLMLN  232

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A++F+++LY LGARR  +   PP GCVPSQRT+AGG  R C E+ N+ASQ+ NSKLSAE
Sbjct  233   YASEFVKDLYGLGARRIGLLNTPPIGCVPSQRTVAGGVLRECDEKQNQASQLFNSKLSAE  292

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKY--TG  306
              D LN  LP S +VY+DIYNPLLDLI NP  YGFEVA++GCCG+G+IEVT LCN+    G
Sbjct  293   ADDLNKNLPNSRVVYIDIYNPLLDLINNPTKYGFEVANKGCCGSGIIEVTKLCNQIQPAG  352

Query  305   TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             TC D +KYVFWDS+HPTERAY I+V QIL KY   F
Sbjct  353   TCSDDSKYVFWDSYHPTERAYKIIVQQILDKYTKFF  388



>ref|XP_002279381.1| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
 ref|XP_010664851.1| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
 emb|CBI19907.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   431 bits (1108),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 252/335 (75%), Gaps = 3/335 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +KLP    V  VIVFGDSIVD G NNNL T A+CN+PPYG+DF G +PTGRF NGK 
Sbjct  23    EALVKLPDNEKVPAVIVFGDSIVDPGNNNNLVTVAKCNFPPYGRDFIGGIPTGRFSNGKI  82

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDFIAEELG+K+LLPAY DP LQP D  TGVSFASG  G+DPLT +I +   LS QL  
Sbjct  83    PSDFIAEELGIKKLLPAYLDPTLQPSDLLTGVSFASGASGYDPLTPKIPSVFSLSDQLEM  142

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKLK MVGE +TN I+  +LF VV G+ND+ +TYF+  IRR +YD  +YADL++ 
Sbjct  143   FKEYIGKLKGMVGEERTNTILSKSLFFVVQGSNDITSTYFN--IRRGQYDFASYADLLVI  200

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F +ELY LGARR  +F  PP GC+PSQR+LAGG  R CVE+YNEASQ+ N+KLS+ 
Sbjct  201   WASSFFKELYGLGARRIGVFSAPPLGCLPSQRSLAGGIQRECVEKYNEASQLFNTKLSSG  260

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +DSLN   P +  VYVDIYNPLLD+IQNPQ  GFEV ++GCCGTG+IEV+ LC++    T
Sbjct  261   LDSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVVNKGCCGTGLIEVSVLCDQLNPFT  320

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D  KYVFWDS+HPTERAY  ++ +I Q YV  F
Sbjct  321   CNDATKYVFWDSYHPTERAYKTIIGEIFQGYVDSF  355



>ref|XP_007136105.1| hypothetical protein PHAVU_009G018200g [Phaseolus vulgaris]
 gb|ESW08099.1| hypothetical protein PHAVU_009G018200g [Phaseolus vulgaris]
Length=362

 Score =   431 bits (1108),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 205/350 (59%), Positives = 259/350 (74%), Gaps = 3/350 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             LMV V+  +L+L  R +  +KLP  V +  VI FGDSI+D G NN ++T  +CN+PPYG+
Sbjct  15    LMVRVIL-LLVLSMRSKGLVKLPANVSIPAVIGFGDSIIDPGNNNKVKTLVKCNFPPYGK  73

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G  PTGRFCNGK PSD + EELG+K LLPAY DPNL+P+D  TGV FASG  G+DPL
Sbjct  74    DFQGG-PTGRFCNGKIPSDLLVEELGIKNLLPAYLDPNLKPDDLVTGVCFASGASGYDPL  132

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T +IA+ I +S Q+  FKEY GKLK++VG ++TN+I+ N+ F+VVAG++D+ NTYF    
Sbjct  133   TPKIASVISMSEQIEMFKEYIGKLKQIVGVDRTNFILANSFFLVVAGSDDIANTYFVARA  192

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             R+ +YDI AY DLM   A+DF++ELY LGARR  + G PP GCVPSQRTLAGG  R C E
Sbjct  193   RQLQYDIPAYTDLMCNSASDFVKELYGLGARRIGVLGAPPIGCVPSQRTLAGGLERECAE  252

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
             EYN A+++ NSKLS ++DSL++ LP S IVY+DIYNPL+D+I N   YG+EV D GCCGT
Sbjct  253   EYNYAAKLFNSKLSRKLDSLSH-LPNSRIVYIDIYNPLMDIIVNYHRYGYEVMDSGCCGT  311

Query  347   GVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G +EV  LCN    TC D +KYVFWDS+HPTE+ Y  LV  ILQ Y+ RF
Sbjct  312   GKLEVAVLCNHLDSTCSDASKYVFWDSYHPTEKVYRQLVAGILQNYISRF  361



>gb|KHN09074.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=346

 Score =   430 bits (1106),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 204/345 (59%), Positives = 260/345 (75%), Gaps = 3/345 (1%)
 Frame = -1

Query  1223  MLLLGRRCEAK--IKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGE  1053
             MLLL   C+AK  ++LPP V V  V+VFGDSI+D G NNN +QT A+CN+PPYG+DF G 
Sbjct  1     MLLLMVSCKAKGLVELPPNVTVPAVLVFGDSIMDTGNNNNNMQTLAKCNFPPYGRDFEGG  60

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
             +PTGRF NGK PSD +AEELG+KELLPAY DPNLQP D  TGV FASGG G+DPLT+++A
Sbjct  61    IPTGRFGNGKVPSDLVAEELGIKELLPAYLDPNLQPSDLVTGVCFASGGSGYDPLTSKLA  120

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
             +AI L+ Q++ FKEY  KLK +VGE++TN+I+ N + +VV G+ND+ NTYF    R  +Y
Sbjct  121   SAISLTGQIDMFKEYIRKLKGLVGEDKTNFILANGIVLVVEGSNDISNTYFLSHAREVEY  180

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             DI AY DLM++ A++F++E+Y LG RR  +F  PP GCVP QRTL GG  R C E+YN+A
Sbjct  181   DIPAYTDLMVKSASNFLKEIYQLGGRRIGVFSAPPIGCVPFQRTLVGGIVRKCAEKYNDA  240

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             +++ NSKL+ E+ SLN  LP + +VY+D+YNPLLD+I + QNYGF+V DRGCCGTG IE 
Sbjct  241   AKLFNSKLAKELASLNRNLPNARMVYLDVYNPLLDIIVHYQNYGFKVGDRGCCGTGKIEA  300

Query  332   TFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               LCN    TCPD   YVFWDSFHP+E  Y  LV  IL+KY+ +F
Sbjct  301   AVLCNPLHPTCPDVGDYVFWDSFHPSENVYRRLVAPILRKYLSQF  345



>ref|XP_006435224.1| hypothetical protein CICLE_v10001578mg [Citrus clementina]
 gb|ESR48464.1| hypothetical protein CICLE_v10001578mg [Citrus clementina]
Length=367

 Score =   431 bits (1107),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 207/338 (61%), Positives = 255/338 (75%), Gaps = 3/338 (1%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNG  1026
             R EA IKLP  V V  VIVFGDSIVD G NNNL+T A+CN+PPYG+DF G   TGRF NG
Sbjct  30    RTEAVIKLPGNVTVSAVIVFGDSIVDTGNNNNLKTPAKCNFPPYGRDFEGGAATGRFSNG  89

Query  1025  KTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI-ATAIPLSTQ  849
             K PSD +AEELGVKEL  AY DP L+PED  TGV+FASGGCG+DPLT ++ A A+ LS Q
Sbjct  90    KVPSDILAEELGVKELSLAYLDPTLKPEDLLTGVNFASGGCGYDPLTTRLSAAALSLSDQ  149

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L  FKEY  KL+ +VGE   N I E + F+VV G+ND+ N YF   IRR +YDI+ Y DL
Sbjct  150   LQLFKEYIDKLRAIVGEEGKNRIFERSFFLVVVGSNDINNNYFGSRIRRLQYDISTYTDL  209

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             ++  A+ F++E+Y LGARR  +FG P  GC+PS RT+AGG  R C +EYNEA+Q+ NSKL
Sbjct  210   LVGHASTFLKEIYGLGARRIGVFGAPTLGCLPSTRTVAGGIKRDCAKEYNEAAQLFNSKL  269

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             SAE+DSLNN LP   IVY+DIYNPLLD+IQNP  YGF++ D+GCCGTG IEV  LCN+++
Sbjct  270   SAELDSLNN-LPDVRIVYIDIYNPLLDIIQNPNKYGFDIVDKGCCGTGTIEVIILCNQFS  328

Query  308   G-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               TC + + Y+FWDSFHPTE+AY ILV  +++KY+ RF
Sbjct  329   PYTCTNDSGYLFWDSFHPTEKAYKILVSNLVKKYINRF  366



>ref|XP_009776282.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nicotiana sylvestris]
Length=376

 Score =   431 bits (1108),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 205/350 (59%), Positives = 260/350 (74%), Gaps = 4/350 (1%)
 Frame = -1

Query  1232  VFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAG  1056
             VF ML+    CEAK+KLPP VVV+ V  FGDSIVDQG NNN L T  +CN+PPYG+DF G
Sbjct  27    VFVMLISSSCCEAKVKLPPNVVVKAVYAFGDSIVDQGNNNNILTTPVKCNFPPYGKDFMG  86

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
              +PTGRF N KTP D IA+ELG+KEL+PAY DPNL+ ED KTGVSFASGG G+DP T+ I
Sbjct  87    GIPTGRFSNAKTPPDMIAKELGLKELIPAYPDPNLKDEDLKTGVSFASGGSGYDPRTSTI  146

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDV---LNTYFSLPIR  705
              +AIPLS QLN+F EY GKLKE+VGE + NYI+ N+LF++VAG+ D+     +Y+   IR
Sbjct  147   NSAIPLSAQLNHFLEYIGKLKELVGEEEGNYILNNSLFILVAGSVDIAGLTGSYYEDVIR  206

Query  704   RYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEE  525
             +  YDI++Y +L+   A DF+QELY LGAR     G+PP GC+P+QRTLAGG +R C EE
Sbjct  207   QKLYDIDSYTNLLAAYAFDFVQELYKLGARNIAFLGVPPLGCLPAQRTLAGGPARMCAEE  266

Query  524   YNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTG  345
             YN+AS++ N+K S  IDSL+ K PQ  +V++D YN LLD I NPQ YG E   +GCCG+G
Sbjct  267   YNQASELANTKFSIAIDSLHKKFPQYKLVFIDAYNSLLDCIVNPQKYGLEEVQKGCCGSG  326

Query  344   VIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
              IEV+ LCNK++G C D  KY+FWDS+H TE+ Y ILV +I++ Y   F+
Sbjct  327   NIEVSILCNKFSGICEDDTKYLFWDSYHLTEKGYRILVDRIIKNYTNSFS  376



>ref|XP_007017868.1| JHL20J20.8 protein [Theobroma cacao]
 gb|EOY15093.1| JHL20J20.8 protein [Theobroma cacao]
Length=366

 Score =   430 bits (1106),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 203/351 (58%), Positives = 259/351 (74%), Gaps = 2/351 (1%)
 Frame = -1

Query  1244  MVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             +VS +  + LL    +A +KLPP   V  VIVFGDSIVD G NN+L T  +CN+ PYGQD
Sbjct  15    LVSHLLVLALLICSTKALVKLPPNETVPAVIVFGDSIVDAGNNNDLSTLIKCNFLPYGQD  74

Query  1064  FAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLT  885
             F G +PTGRFCNGK PSD IA+E+G+K+ +PAY DP L P+D  TGV+FASGG G+DP+T
Sbjct  75    FDGGVPTGRFCNGKIPSDIIAKEMGIKDTVPAYLDPTLTPQDLLTGVTFASGGTGYDPMT  134

Query  884   AQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIR  705
              ++A+ I LS QL++FKEY  KLK +VGE +TN+II  +L+++VAG++D+ NTYF L +R
Sbjct  135   PKLASVISLSDQLDHFKEYIAKLKALVGEERTNFIIAKSLYLIVAGSDDIANTYFVLRVR  194

Query  704   RYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEE  525
             + +YDI AY DLM   A  F +ELY LGARR  +F  PP GCVPSQRTLAGG  R C E+
Sbjct  195   KLQYDIPAYTDLMANSAQTFFKELYALGARRMAVFSAPPIGCVPSQRTLAGGIERECAED  254

Query  524   YNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTG  345
             YN+A+++ N KL A ++SL   LP    VY D+YNPLL LI+NPQ YGFEVA++GCCGTG
Sbjct  255   YNQAARLFNKKLYAVLNSLQTSLPDGKFVYTDVYNPLLQLIENPQKYGFEVANKGCCGTG  314

Query  344   VIEVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQIL-QKYVYRF  198
              IEV  LCNK +  TC D +KY+FWDS+HPTE+AY +LV  IL Q +V  F
Sbjct  315   NIEVAILCNKLSPSTCTDDSKYIFWDSYHPTEKAYRVLVPLILDQDFVNNF  365



>ref|XP_002279353.2| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
 emb|CBI19909.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   430 bits (1106),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 254/335 (76%), Gaps = 3/335 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA IKLP    V  ++VFGDSIVD G NN+L TFA+ N+PPYG+DF G +PTGRF NGK 
Sbjct  25    EALIKLPDNETVPALLVFGDSIVDPGNNNDLVTFAKGNFPPYGRDFIGGIPTGRFSNGKI  84

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P+DFIAEELG+KE++PAY DP LQP D  TGVSFASG  G+DPLT++I     LS QL  
Sbjct  85    PADFIAEELGIKEIVPAYLDPTLQPSDILTGVSFASGASGYDPLTSKIPAVYSLSDQLEM  144

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKLK MVGE +TN I+  +LF+VV  +ND+ +TYF+  +RR +YD ++YADL++ 
Sbjct  145   FKEYTGKLKAMVGEERTNTILSKSLFLVVQSSNDIASTYFT--VRRVQYDFSSYADLLVT  202

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F +ELY LGARR  +FG PP GC+PSQ+++AGG  R CVE YNEA ++ N+KLS+ 
Sbjct  203   WASSFFKELYGLGARRIAVFGAPPLGCLPSQKSIAGGIERECVENYNEACKLFNTKLSSG  262

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +DSLN   P +  VY+DIYNPLLD+IQNPQ  GFEVA++GCCGTG+IEV  LCN+    T
Sbjct  263   LDSLNTNFPLAKFVYIDIYNPLLDIIQNPQKSGFEVANKGCCGTGLIEVALLCNRLNPFT  322

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D  KYVFWDS+HPTER Y IL+ +I+Q+YV  F
Sbjct  323   CNDVTKYVFWDSYHPTERVYKILIGRIIQEYVGSF  357



>ref|XP_007160640.1| hypothetical protein PHAVU_001G004400g [Phaseolus vulgaris]
 gb|ESW32634.1| hypothetical protein PHAVU_001G004400g [Phaseolus vulgaris]
Length=367

 Score =   429 bits (1102),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 198/335 (59%), Positives = 251/335 (75%), Gaps = 2/335 (1%)
 Frame = -1

Query  1208  RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFC  1032
             + CE+ +KLP  V V  V+VFGDSI+D G NNN L T ARCN+ PYG+DF G +PTGRFC
Sbjct  30    KSCES-VKLPADVSVPAVLVFGDSIMDTGNNNNKLATSARCNFSPYGKDFKGGIPTGRFC  88

Query  1031  NGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLST  852
             NGK PSD+IAEELG+KE LPAY DPNL+P++  TGV FASGG G+DPLT++ A +IPLS 
Sbjct  89    NGKVPSDYIAEELGIKEFLPAYLDPNLEPDELGTGVCFASGGAGYDPLTSETAGSIPLSG  148

Query  851   QLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYAD  672
             QL  FKEY  KLKE VGEN+TN+I+ N+ F +V GTND+ NTYF   +R  +YD+ AY+D
Sbjct  149   QLQMFKEYIVKLKEHVGENRTNFILSNSFFFIVLGTNDISNTYFLSHLRELQYDLPAYSD  208

Query  671   LMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSK  492
              ++  A++F++E+Y+LGARR  +FG PP GCVP  RTL+GG+ R C+++YN+A    N K
Sbjct  209   FLVNSASNFLKEIYELGARRIAVFGGPPVGCVPYHRTLSGGRERKCIQKYNDAMMFFNDK  268

Query  491   LSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKY  312
             L  E+ SLN KLP S I Y+D+Y+PLLD+ QN Q YG+EVADRGCCGTG +EV   CN  
Sbjct  269   LMKELHSLNQKLPNSRIAYLDVYSPLLDIFQNHQKYGYEVADRGCCGTGTLEVALTCNHL  328

Query  311   TGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
               TCP+   YVFWD FHPTE  Y  LV +ILQ+Y+
Sbjct  329   DATCPNVLDYVFWDGFHPTESVYKKLVPKILQEYI  363



>ref|XP_003634393.1| PREDICTED: GDSL esterase/lipase EXL3-like [Vitis vinifera]
Length=360

 Score =   428 bits (1100),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 203/335 (61%), Positives = 251/335 (75%), Gaps = 3/335 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +KLP    V  +IVFGDSIVD G NN+L + A+CN+PPYG+DF G +PTGRF NGK 
Sbjct  27    EALVKLPDNETVPALIVFGDSIVDPGNNNDLVSVAKCNFPPYGRDFIGGIPTGRFSNGKI  86

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDFIAEELG+K+LLPAY DP LQP D  TGVSFASG  G+DPLT +I++   LS QL  
Sbjct  87    PSDFIAEELGIKKLLPAYLDPALQPSDLLTGVSFASGASGYDPLTPKISSVFSLSDQLEQ  146

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKL  MVGE +TN I+  +LF+VV  +ND+  TYF   IR+ +YD  +YADL++ 
Sbjct  147   FKEYIGKLTAMVGEQRTNTILSKSLFLVVQSSNDIATTYFD--IRKVQYDFASYADLLVT  204

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F +ELY LGARR  +F  PP GC+PSQR+LA G  R CVE+YNEAS++ N+KLS+ 
Sbjct  205   WASSFFKELYGLGARRIAVFSAPPLGCLPSQRSLAAGIERECVEKYNEASKLFNTKLSSG  264

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +DSLN   P +  VYVDIYNPLLD+IQNPQ  GFEV ++GCCGTG+IEV  LCN++   T
Sbjct  265   LDSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVVNKGCCGTGLIEVAVLCNQFNPFT  324

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D  KYVFWDS+HPTER Y IL+ +I+Q+YV  F
Sbjct  325   CNDVTKYVFWDSYHPTERLYKILIGEIIQEYVDSF  359



>emb|CBI19908.3| unnamed protein product [Vitis vinifera]
Length=376

 Score =   428 bits (1100),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 203/335 (61%), Positives = 251/335 (75%), Gaps = 3/335 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +KLP    V  +IVFGDSIVD G NN+L + A+CN+PPYG+DF G +PTGRF NGK 
Sbjct  43    EALVKLPDNETVPALIVFGDSIVDPGNNNDLVSVAKCNFPPYGRDFIGGIPTGRFSNGKI  102

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDFIAEELG+K+LLPAY DP LQP D  TGVSFASG  G+DPLT +I++   LS QL  
Sbjct  103   PSDFIAEELGIKKLLPAYLDPALQPSDLLTGVSFASGASGYDPLTPKISSVFSLSDQLEQ  162

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKL  MVGE +TN I+  +LF+VV  +ND+  TYF   IR+ +YD  +YADL++ 
Sbjct  163   FKEYIGKLTAMVGEQRTNTILSKSLFLVVQSSNDIATTYFD--IRKVQYDFASYADLLVT  220

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F +ELY LGARR  +F  PP GC+PSQR+LA G  R CVE+YNEAS++ N+KLS+ 
Sbjct  221   WASSFFKELYGLGARRIAVFSAPPLGCLPSQRSLAAGIERECVEKYNEASKLFNTKLSSG  280

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +DSLN   P +  VYVDIYNPLLD+IQNPQ  GFEV ++GCCGTG+IEV  LCN++   T
Sbjct  281   LDSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVVNKGCCGTGLIEVAVLCNQFNPFT  340

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D  KYVFWDS+HPTER Y IL+ +I+Q+YV  F
Sbjct  341   CNDVTKYVFWDSYHPTERLYKILIGEIIQEYVDSF  375



>ref|XP_010105284.1| GDSL esterase/lipase EXL3 [Morus notabilis]
 gb|EXC04219.1| GDSL esterase/lipase EXL3 [Morus notabilis]
Length=366

 Score =   426 bits (1096),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 254/345 (74%), Gaps = 0/345 (0%)
 Frame = -1

Query  1232  VFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGE  1053
             +  ++ L    +A +KLPP V V  +IVFGDSI+D G NNNL+T  +C++PPYGQDFAG 
Sbjct  21    ILVLICLFHPSKAVLKLPPNVTVPALIVFGDSIMDTGNNNNLKTVVKCDFPPYGQDFAGR  80

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
              PTGRF NGK PSD I EELG+KE LPAY DPNL P+D  TGV FASGG GFDP+T QI 
Sbjct  81    KPTGRFGNGKVPSDLIVEELGIKEYLPAYLDPNLNPKDLATGVCFASGGSGFDPMTPQIV  140

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
             + +  S QL  F+EY GKLK  VG+ +T +I+EN++F+VVAG++D+ NTYF++ +R+ +Y
Sbjct  141   SVLSFSDQLRLFEEYLGKLKANVGKRRTKFILENSIFLVVAGSDDIANTYFTVRLRKLQY  200

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             D+ AY DLM+  A+DF+++LY LGARR  +F  PP GCVPSQRTL GG  R C EEYNEA
Sbjct  201   DVPAYTDLMLNSASDFVKQLYGLGARRIGLFSTPPIGCVPSQRTLGGGLLRDCAEEYNEA  260

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             + + NSKLSA +DSL  +LP   +VY+DIYNPLLDLI N + YGF+  D+GCCGTG IEV
Sbjct  261   ALLFNSKLSATLDSLKPQLPNGRLVYIDIYNPLLDLIVNHKKYGFDYVDKGCCGTGAIEV  320

Query  332   TFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               LCN  +  C +   ++FWDS+HP++ AY  LV  +L+KYV  F
Sbjct  321   AILCNPLSPPCENPAGHIFWDSYHPSDAAYKFLVPTLLKKYVNGF  365



>ref|XP_002301955.2| family II extracellular lipase 3 family protein [Populus trichocarpa]
 gb|EEE81228.2| family II extracellular lipase 3 family protein [Populus trichocarpa]
Length=399

 Score =   427 bits (1097),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 196/345 (57%), Positives = 256/345 (74%), Gaps = 3/345 (1%)
 Frame = -1

Query  1223  MLLLGRRCEAK--IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEM  1050
             +L L   C  K  +KLPP V V  +++FGDSIVD G NNN++T  +CN+PPYG+DF G +
Sbjct  54    LLFLTVVCSVKSSVKLPPNVTVPALLLFGDSIVDAGNNNNIKTLVKCNFPPYGKDFEGGV  113

Query  1049  PTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIAT  870
             PTGRFCNGK PSD IA+ELG+K+ LPAY DP + P+D  TGV+FASGG GFDPLT ++ +
Sbjct  114   PTGRFCNGKVPSDIIAKELGIKDTLPAYLDPTVLPQDLVTGVTFASGGSGFDPLTPKLVS  173

Query  869   AIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYD  690
              I LS QL Y KEY GKL+ M+GE +T +I++N+LF VVAG++D+ NTYF++  R+ +YD
Sbjct  174   VISLSDQLKYLKEYIGKLEAMIGEEKTKFILKNSLFFVVAGSDDIANTYFTIRARKSQYD  233

Query  689   INAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEAS  510
             + AY DLM   A+ F QELY+LGARR   F  PP GCVPSQRTLAGG  R C E  NEA+
Sbjct  234   VPAYTDLMANSASTFAQELYELGARRIGFFSTPPIGCVPSQRTLAGGAERKCAENLNEAA  293

Query  509   QIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVT  330
             ++ NSKLS ++DSL + LP    VY+D+YN LLDLIQNP+ YGF+V D+GCCGTG +EV+
Sbjct  294   KLFNSKLSKKLDSLGSSLPNGRFVYIDVYNLLLDLIQNPKKYGFQVVDKGCCGTGDLEVS  353

Query  329   FLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              LCN+YT   C + + ++FWDS+HPTE AY  LV  +L + + +F
Sbjct  354   ILCNQYTPVKCANVSDHIFWDSYHPTESAYKALVSPLLGENLNKF  398



>ref|XP_006435222.1| hypothetical protein CICLE_v10001561mg [Citrus clementina]
 gb|ESR48462.1| hypothetical protein CICLE_v10001561mg [Citrus clementina]
Length=369

 Score =   425 bits (1093),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 256/346 (74%), Gaps = 1/346 (0%)
 Frame = -1

Query  1232  VFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGE  1053
             +F + +L    EA IKLP  V +  VIVFGDSIVD G NNNL+T A+CN+PPYG+DF G 
Sbjct  17    LFSVFVLVVSTEAVIKLPGNVTIPAVIVFGDSIVDAGNNNNLKTPAKCNFPPYGRDFMGG  76

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
             + TGRF NGK PSD I EELG+KELLPAY  PNLQPED  TGV+FASGGCG+DPLT ++A
Sbjct  77    VSTGRFSNGKVPSDLIVEELGIKELLPAYLQPNLQPEDLLTGVTFASGGCGYDPLTTELA  136

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
             +AIPLS QL  FKEY  K+K++VGE   N I++    +VVAG+ND+ NTYF+  +R+ +Y
Sbjct  137   SAIPLSDQLQLFKEYTEKVKQIVGEEGQNRIMKTAFVLVVAGSNDIDNTYFASRVRKLQY  196

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             DI+AY DL++  A+ F +ELY LG RR  +F  PP GC+PS RTL GGK+R C  +YNEA
Sbjct  197   DISAYTDLIVGLASTFFKELYGLGVRRMGVFSAPPLGCLPSSRTLGGGKTRDCANDYNEA  256

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             +Q+ N+KLSAE+DSLN + P + ++ +DIYNPLL LIQNP  YGFEV ++GCCGTG +E 
Sbjct  257   AQMFNTKLSAELDSLNIQFPDARLLLIDIYNPLLYLIQNPIKYGFEVVNKGCCGTGTLEA  316

Query  332   TFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +  CN+++  TC + + Y+FWD +HPTER Y ILV  ++ K    F
Sbjct  317   SIFCNQFSLNTCTNVSGYIFWDGYHPTERTYKILVSSLINKIANGF  362



>ref|XP_003550433.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform 1 [Glycine 
max]
Length=363

 Score =   425 bits (1092),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 253/337 (75%), Gaps = 1/337 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVV-VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             R  A +KLPP    V  V+ FGDSIVD G NNN++T  +CN+PPYG+DF G  PTGRFCN
Sbjct  26    RTMALVKLPPNASSVPAVLAFGDSIVDSGNNNNIKTLIKCNFPPYGKDFQGGNPTGRFCN  85

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GK PSD I E+LG+KE LPAY DPNL+  D  TGV FASG  G+DPLT +I + I LSTQ
Sbjct  86    GKIPSDLIVEQLGIKEYLPAYLDPNLKSSDLVTGVGFASGASGYDPLTPKITSVISLSTQ  145

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L+ F+EY GKLK +VGE++TNYI+ N+L++VVAG++D+ NTYF    R  +YDI +Y DL
Sbjct  146   LDMFREYIGKLKGIVGESRTNYILANSLYLVVAGSDDIANTYFVAHARILQYDIPSYTDL  205

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             M+  A++F++ELY+LGARR  + G PP GCVPSQRTLAGG +R C E+YN A+++ NSKL
Sbjct  206   MVNSASNFVKELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAARLFNSKL  265

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             S E+DSL + L  + IVY+D+Y+PLLD+I N Q YG++V DRGCCGTG +EV  LCN   
Sbjct  266   SKELDSLGHNLSDTRIVYIDVYSPLLDIIDNYQKYGYKVMDRGCCGTGKLEVAVLCNPLD  325

Query  308   GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              TC + ++YVFWDS+HPTE  Y  +V+ +L+KY+ R 
Sbjct  326   DTCSNASEYVFWDSYHPTEGVYRKIVNHVLEKYMDRL  362



>ref|XP_003545022.1| PREDICTED: GDSL esterase/lipase EXL3 [Glycine max]
Length=363

 Score =   424 bits (1091),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 197/343 (57%), Positives = 255/343 (74%), Gaps = 1/343 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVV-VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMP  1047
             +  L  R  A  KLPP    V  V+ FGDSIVD G NNN++T  +CN+PPYG+DF G  P
Sbjct  20    IFALWYRTMALAKLPPNASSVPAVLAFGDSIVDPGNNNNIKTLIKCNFPPYGKDFQGGNP  79

Query  1046  TGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATA  867
             TGRFCNGK PSD IAE+LG+KE LPAY DPNL+  D  TGV FASG  G+DPLT +I + 
Sbjct  80    TGRFCNGKIPSDLIAEQLGIKEYLPAYLDPNLKSSDLVTGVCFASGASGYDPLTPKITSV  139

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             + LSTQL+ F+EY GKLK +VGE++TNYI+ N+L++VVAG++D+ NTYF    R  +YDI
Sbjct  140   LSLSTQLDMFREYIGKLKGIVGESRTNYILSNSLYLVVAGSDDIANTYFVAHARILQYDI  199

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
              +Y DLM+  A++F++ELY+LGARR  + G PP GCVPSQRTLAGG +R C E+YN A++
Sbjct  200   PSYTDLMVNSASNFVKELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAAR  259

Query  506   IVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTF  327
             + NSKLS E+DSL + L  + IVY+D+Y PLLD+I+N Q YG++V DRGCCGTG +EV  
Sbjct  260   LFNSKLSKELDSLGHNLSDTRIVYIDVYTPLLDIIENYQKYGYKVMDRGCCGTGKLEVAV  319

Query  326   LCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             LCN    TC + ++YVFWDS+HPTE  Y  LV+ +L+KY+ R 
Sbjct  320   LCNPLDATCSNASEYVFWDSYHPTEGVYRKLVNYVLEKYIDRL  362



>ref|XP_006435221.1| hypothetical protein CICLE_v10003119mg [Citrus clementina]
 gb|ESR48461.1| hypothetical protein CICLE_v10003119mg [Citrus clementina]
Length=341

 Score =   423 bits (1087),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 191/340 (56%), Positives = 256/340 (75%), Gaps = 1/340 (0%)
 Frame = -1

Query  1214  LGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRF  1035
             +G   +A +KLP    +  +I FGDSIVD G NN+L+T ++C++PPYG+DF G + TGRF
Sbjct  1     MGNCIQALVKLPENETIPALIAFGDSIVDTGNNNDLRTISKCDFPPYGKDFQGGVATGRF  60

Query  1034  CNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLS  855
              NGK P+D IAEELG+KELLPAY    L   D  TGV FASGG G+DP+T+++ + + LS
Sbjct  61    SNGKVPADIIAEELGIKELLPAYVGQALSSRDLVTGVCFASGGSGYDPMTSKLVSVLSLS  120

Query  854   TQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYA  675
              Q+ YFK+Y  KLK +VGEN+TN+I+   LF+VVAG++D+ NTYF+L  R+ +YDI AY 
Sbjct  121   DQIEYFKDYIMKLKLLVGENKTNFILAKGLFLVVAGSDDIANTYFTLRARKLQYDIPAYT  180

Query  674   DLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNS  495
             DLM   A+DF+ ELY+LGARR  +FG PP GC+P+QRTLAGG +R C E +N+ASQ+ N 
Sbjct  181   DLMANSASDFLNELYELGARRVAVFGAPPIGCLPAQRTLAGGNARECAENFNQASQLFNK  240

Query  494   KLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNK  315
             KLSA++DS+ N LP S +V++D+YNP LDLIQNP+ +GFEV + GCCGTG +EV  LCN 
Sbjct  241   KLSAKLDSIKNSLPGSRMVFIDVYNPFLDLIQNPKKHGFEVVNEGCCGTGNLEVAVLCNA  300

Query  314   YTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +T  TC + + +VFWDS+HPTERAY +LV  ++ KYV +F
Sbjct  301   WTSTTCSNDSSHVFWDSYHPTERAYRVLVSLLVGKYVDKF  340



>ref|XP_011034987.1| PREDICTED: GDSL esterase/lipase EXL3-like [Populus euphratica]
Length=398

 Score =   425 bits (1092),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/344 (57%), Positives = 255/344 (74%), Gaps = 3/344 (1%)
 Frame = -1

Query  1220  LLLGRRCEAK--IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMP  1047
             L L   C  K  +KLPP V V  +++FGDSI D G NNN+QT  +CN+PPYG+DF G +P
Sbjct  54    LFLTVVCSVKSSVKLPPNVTVPALLLFGDSIADAGNNNNIQTLVKCNFPPYGKDFEGGVP  113

Query  1046  TGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATA  867
             TGRFCNGK PSD IA+ELG+K+ LPAY D  + P+D  TGV+FASGG GFDPLT ++ + 
Sbjct  114   TGRFCNGKVPSDIIAKELGIKDTLPAYLDSTVLPQDLVTGVTFASGGSGFDPLTPKLVSV  173

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             I LS QL Y KEY GKL+ M+GE +T +I++N+LF+VVAG++D+ NTYF++  R+ +YD+
Sbjct  174   ISLSDQLKYLKEYIGKLEAMIGEEKTKFILKNSLFLVVAGSDDIANTYFTIRARKSQYDV  233

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
              AY DLM   A+ F QELY+LGARR   F  PP GCVP+QRTLAGG  R C E  NEA++
Sbjct  234   PAYTDLMANSASSFAQELYELGARRIGFFSAPPVGCVPAQRTLAGGAERKCAENLNEAAK  293

Query  506   IVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTF  327
             + NSKLS ++DSL + LP    VY+D+YN LLDLIQNP+  GF+VAD+GCCGTG IEV+ 
Sbjct  294   LFNSKLSKKMDSLGSSLPNGRFVYIDVYNLLLDLIQNPEKQGFQVADKGCCGTGDIEVSI  353

Query  326   LCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             LCN+YT   C + + ++FWDS+HPTE AY  LV  +L +++ +F
Sbjct  354   LCNQYTQVMCTNVSDHIFWDSYHPTESAYKALVSPLLGEHLNKF  397



>ref|XP_006473698.1| PREDICTED: GDSL esterase/lipase EXL1-like [Citrus sinensis]
Length=722

 Score =   436 bits (1120),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 210/344 (61%), Positives = 260/344 (76%), Gaps = 3/344 (1%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
             +L L RR EA IKLP  V V  VIVFGDSIVD G NNNL+T A+CN+PPYG+DF G   T
Sbjct  379   VLDLFRRTEAVIKLPGNVTVSAVIVFGDSIVDTGNNNNLKTPAKCNFPPYGRDFEGGAAT  438

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI-ATA  867
             GRF NGK PSD +AEELGVKEL PAY DP L+PED  TGV+FASGGCG+DPLT ++ A A
Sbjct  439   GRFSNGKVPSDILAEELGVKELSPAYLDPTLKPEDLLTGVNFASGGCGYDPLTTRLSAAA  498

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             + LS QL  FKEY  KL+ +VGE   N I E + F+VV G+ND+ N YF   IRR +YDI
Sbjct  499   LSLSDQLQLFKEYIDKLRAIVGEEGKNRIFETSFFLVVVGSNDINNNYFGSRIRRLQYDI  558

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
             + Y DL++  A+ F++E+Y LGARR  +FG P  GC+PS RT+AGG  R C +EYNEA+Q
Sbjct  559   STYTDLLVGHASTFLKEIYGLGARRIGVFGAPTLGCLPSTRTVAGGIKRDCAKEYNEAAQ  618

Query  506   IVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTF  327
             + NSKLSAE+DSLNN LP   IVY+DIY+PLLD+IQNP  YGF++ D+GCCGTG IEV  
Sbjct  619   LFNSKLSAELDSLNN-LPDVRIVYIDIYSPLLDIIQNPNKYGFDIVDKGCCGTGTIEVII  677

Query  326   LCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             LCN+++  TC + + Y+FWDSFHPTE+AY ILV  +++KY+ RF
Sbjct  678   LCNQFSPYTCTNDSGYLFWDSFHPTEKAYKILVSNLVKKYINRF  721


 Score =   423 bits (1088),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/346 (57%), Positives = 256/346 (74%), Gaps = 1/346 (0%)
 Frame = -1

Query  1232  VFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGE  1053
             +F + +L    EA IKLP  V +  VIVFGDSIVD G NNNL+T A+CN+PPYG+DF G 
Sbjct  17    LFSVFVLVVSTEAVIKLPGNVTIPAVIVFGDSIVDAGNNNNLKTPAKCNFPPYGRDFMGG  76

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
             + TGRF NGK PSD I EELG+KELLPAY  PNLQPED  TGV+FASGGCG+DPLT ++A
Sbjct  77    VSTGRFSNGKVPSDLIVEELGIKELLPAYLQPNLQPEDLLTGVTFASGGCGYDPLTTELA  136

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
             +AIPLS QL  FKEY  K+K++VGE   N I++    +VVAG+ND+ NTYF+  +R+ +Y
Sbjct  137   SAIPLSDQLQLFKEYTEKVKQIVGEEGQNRIVKTAFVLVVAGSNDIDNTYFASRVRKLQY  196

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             DI+AY DL++  A+ F +ELY LG RR  +F  PP GC+PS RTL GGK+R C  +YNEA
Sbjct  197   DISAYTDLIVGLASTFFKELYGLGVRRMGVFSAPPLGCLPSSRTLGGGKTRDCANDYNEA  256

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             +Q+ N+KLSAE++SLN + P + ++ +DIYNPLL LIQNP  YGFEV ++GCCGTG +E 
Sbjct  257   AQMFNTKLSAELESLNIQFPDARLLLIDIYNPLLYLIQNPIKYGFEVVNKGCCGTGYLEA  316

Query  332   TFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +  CN+++  TC + + Y+FWD +HPTER Y ILV  ++ K    F
Sbjct  317   SIFCNQFSPNTCTNVSGYIFWDGYHPTERTYKILVSSLINKIANGF  362



>gb|KHN39410.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=336

 Score =   422 bits (1085),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 252/334 (75%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVV-VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A  KLPP    V  V+ FGDSIVD G NNN++T  +CN+PPYG+DF G  PTGRFCNGK 
Sbjct  2     ALAKLPPNASSVPAVLAFGDSIVDPGNNNNIKTLIKCNFPPYGKDFQGGNPTGRFCNGKI  61

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IAE+LG+KE LPAY DPNL+  D  TGV FASG  G+DPLT +I + + LSTQL+ 
Sbjct  62    PSDLIAEQLGIKEYLPAYLDPNLKSSDLVTGVCFASGASGYDPLTPKITSVLSLSTQLDM  121

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EY GKLK +VGE++TNYI+ N+L++VVAG++D+ NTYF    R  +YDI +Y DLM+ 
Sbjct  122   FREYIGKLKGIVGESRTNYILSNSLYLVVAGSDDIANTYFVAHARILQYDIPSYTDLMVN  181

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A++F++ELY+LGARR  + G PP GCVPSQRTLAGG +R C E+YN A+++ NSKLS E
Sbjct  182   SASNFVKELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAARLFNSKLSKE  241

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             +DSL + L  + IVY+D+Y PLLD+I+N Q YG++V DRGCCGTG +EV  LCN    TC
Sbjct  242   LDSLGHNLSDTRIVYIDVYTPLLDIIENYQKYGYKVMDRGCCGTGKLEVAVLCNPLDATC  301

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + ++YVFWDS+HPTE  Y  LV+ +L+KY+ R 
Sbjct  302   SNASEYVFWDSYHPTEGVYRKLVNYVLEKYIDRL  335



>gb|KHN12627.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=336

 Score =   421 bits (1083),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 194/334 (58%), Positives = 251/334 (75%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVV-VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A +KLPP    V  V+ FGDSIVD G NNN++T  +CN+PPYG+DF G  PTGRFCNGK 
Sbjct  2     ALVKLPPNASSVPAVLAFGDSIVDSGNNNNIKTLIKCNFPPYGKDFQGGNPTGRFCNGKI  61

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD I E+LG+KE LPAY DPNL+  D  TGV FASG  G+DPLT +I + I LSTQL+ 
Sbjct  62    PSDLIVEQLGIKEYLPAYLDPNLKSSDLVTGVGFASGASGYDPLTPKITSVISLSTQLDM  121

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EY GKLK +VGE++TNYI+ N+L++VVAG++D+ NTYF    R  +YDI +Y DLM+ 
Sbjct  122   FREYIGKLKGIVGESRTNYILANSLYLVVAGSDDIANTYFVAHARILQYDIPSYTDLMVN  181

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A++F++ELY+LGARR  + G PP GCVPSQRTLAGG +R C E+YN A+++ NSKLS E
Sbjct  182   SASNFVKELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAARLFNSKLSKE  241

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             +DSL + L  + IVY+D+Y PLLD+I N Q YG++V DRGCCGTG +EV  LCN    TC
Sbjct  242   LDSLGHNLSDTRIVYIDVYTPLLDIIDNYQKYGYKVMDRGCCGTGKLEVAVLCNPLDDTC  301

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + ++YVFWDS+HPTE  Y  +V+ +L+KY+ R 
Sbjct  302   SNASEYVFWDSYHPTEGVYRKIVNHVLEKYMDRL  335



>gb|KDO84924.1| hypothetical protein CISIN_1g042648mg [Citrus sinensis]
Length=356

 Score =   422 bits (1085),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/350 (56%), Positives = 261/350 (75%), Gaps = 4/350 (1%)
 Frame = -1

Query  1241  VSVVFPMLLLGRRC-EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             +SVV   LL    C +A +KLP    +  +I FGDSIVD G NN+L+T ++C++PPYG+D
Sbjct  8     LSVVGSCLLFS--CIQALVKLPENETIPALIAFGDSIVDTGNNNDLRTISKCDFPPYGKD  65

Query  1064  FAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLT  885
             F G + TGRF NGK P+D IAEELG+KELLPAY    L   D  TGV FASGG G+DP+T
Sbjct  66    FQGGVATGRFSNGKVPADIIAEELGIKELLPAYVGQALSSRDLVTGVCFASGGSGYDPMT  125

Query  884   AQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIR  705
             +++ + + LS Q+ YFK+Y  KLK +VGEN+TN+I+   LF+VVAG++D+ NTYF+L  R
Sbjct  126   SKLVSVLSLSDQIEYFKDYIMKLKLLVGENKTNFILAKGLFLVVAGSDDIANTYFTLRAR  185

Query  704   RYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEE  525
             + +YDI AY DLM   A+DF+ ELY+LGARR  +FG PP GC+P+QRTLAGG +R C E 
Sbjct  186   KLQYDIPAYTDLMANSASDFLNELYELGARRVAVFGAPPIGCLPAQRTLAGGNARECAEN  245

Query  524   YNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTG  345
             +N+ASQ+ N KLSA++DS+ N LP S +V++D+YNP LDLIQNP+ +GFEV + GCCGTG
Sbjct  246   FNQASQLFNKKLSAKLDSIKNSLPGSRMVFIDVYNPFLDLIQNPKKHGFEVVNEGCCGTG  305

Query  344   VIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              +EV  LCN +T  TC + + +VFWDS+HPTERAY +LV  ++ KYV +F
Sbjct  306   NLEVAVLCNAWTSTTCSNDSSHVFWDSYHPTERAYRVLVSLLVGKYVDKF  355



>gb|ACU19367.1| unknown [Glycine max]
Length=363

 Score =   422 bits (1085),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 195/340 (57%), Positives = 253/340 (74%), Gaps = 1/340 (0%)
 Frame = -1

Query  1214  LGRRCEAKIKLPPGVV-VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGR  1038
             L  R  A  KLPP    V  V+ FGDSIVD G NNN++T  +CN+PPYG+DF G  PTGR
Sbjct  23    LWYRTMALAKLPPNASSVPAVLAFGDSIVDPGNNNNIKTLIKCNFPPYGKDFQGRNPTGR  82

Query  1037  FCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPL  858
             FCNGK PSD IAE+LG+KE LP Y DPNL+  D  TGV FASG  G+DPLT +I + + L
Sbjct  83    FCNGKIPSDLIAEQLGIKEYLPVYLDPNLKSSDLVTGVCFASGASGYDPLTPKITSVLSL  142

Query  857   STQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAY  678
             STQL+ F+EY GKLK +VGE++TNYI+ N+L++VVAG++D+ NTYF    R  +YDI +Y
Sbjct  143   STQLDMFREYIGKLKGIVGESRTNYILSNSLYLVVAGSDDIANTYFVAHARILQYDIPSY  202

Query  677   ADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVN  498
              DLM+  A++F++ELY+LGARR  + G PP GCVPSQRTLAGG +R C E+YN A+++ N
Sbjct  203   TDLMVNSASNFVKELYNLGARRVAVLGAPPIGCVPSQRTLAGGLTRKCSEKYNYAARLFN  262

Query  497   SKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCN  318
             SKLS E+DSL + L  + IVY+D+Y PLLD+I+N Q +G++V DRGCCGTG +EV  LCN
Sbjct  263   SKLSKELDSLGHNLSDTRIVYIDVYTPLLDIIENYQKHGYKVMDRGCCGTGKLEVAVLCN  322

Query  317   KYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
                 TC + ++YVFWDS+HPTE  Y  LV+ +L+KY+ R 
Sbjct  323   PLDATCSNASEYVFWDSYHPTEGVYRKLVNYVLEKYIDRL  362



>ref|XP_009605224.1| PREDICTED: GDSL esterase/lipase At5g42170-like [Nicotiana tomentosiformis]
Length=382

 Score =   423 bits (1087),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 255/334 (76%), Gaps = 3/334 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +A  ++P    +  VIVFGDSIVD G NN L+T ++ NYPPYGQDF G  PTGRF NGK 
Sbjct  51    KAVTRIPYNESIPAVIVFGDSIVDTGNNNGLKTVSKVNYPPYGQDFMGGKPTGRFSNGKV  110

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P+D I EELG+KELLPAY DP LQP+D  TGV+FASGG G+DPLT+++A  I LS QL  
Sbjct  111   PADLIVEELGIKELLPAYLDPTLQPKDLITGVNFASGGAGYDPLTSELAKVISLSRQLEM  170

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KL+E+VGE++ N I+ N+LF++V GTND++NTYF+ P+R+  YD+++YADL++ 
Sbjct  171   FKEYILKLREIVGEDKKNEILANSLFILVTGTNDIINTYFNTPLRKTYYDVSSYADLLVN  230

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+Q+LY LGARR  +FGIPP GC+PSQRTL GG+ R CV+  N+A+Q+ NSKL+AE
Sbjct  231   SASSFVQDLYGLGARRIGVFGIPPIGCLPSQRTLRGGEERECVDYLNQAAQLFNSKLAAE  290

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             + SL N+ P S +VYVD+YN  LD+I NPQ YGF+++D+GCCGTG IEV  LC   T TC
Sbjct  291   LSSLGNEFPDSRMVYVDVYNLPLDVIYNPQKYGFKISDKGCCGTGKIEVAELC---TFTC  347

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
                + YVFWDSFH TE+AY  LVHQIL +++  F
Sbjct  348   SSDSDYVFWDSFHLTEKAYRQLVHQILAQHLSSF  381



>ref|XP_006473907.1| PREDICTED: GDSL esterase/lipase EXL3-like [Citrus sinensis]
Length=356

 Score =   422 bits (1084),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/350 (56%), Positives = 260/350 (74%), Gaps = 4/350 (1%)
 Frame = -1

Query  1241  VSVVFPMLLLGRRC-EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             +SVV   LL    C +A +KLP    +  +I FGDSIVD G NN+L+T ++C++PPYG+D
Sbjct  8     LSVVGSCLLFS--CIQALVKLPENETIPALIAFGDSIVDTGNNNDLRTISKCDFPPYGKD  65

Query  1064  FAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLT  885
             F G + TGRF NGK P+D IAEELG+KELLPAY    L   D  TGV FASGG G+DP+T
Sbjct  66    FQGGVATGRFSNGKVPADIIAEELGIKELLPAYVGQALSSRDLVTGVCFASGGSGYDPMT  125

Query  884   AQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIR  705
             +++ + + LS Q+ YFK+Y  KLK +VGEN+TN+I+   LF+VVAG++D+ NTYF+L  R
Sbjct  126   SKLVSVLSLSDQIEYFKDYIMKLKLLVGENKTNFILAKGLFLVVAGSDDIANTYFTLRAR  185

Query  704   RYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEE  525
             + +YDI AY DLM   A+DF+ ELY+LGARR  +FG PP GC+P+QRTLAGG +R C E 
Sbjct  186   KLQYDIPAYTDLMANSASDFLNELYELGARRVAVFGAPPIGCLPAQRTLAGGNARECAEN  245

Query  524   YNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTG  345
             +N+ASQ+ N KLSA++DS+ N LP S +V++D+YNP LDLIQNP+ +GFEV + GCCGTG
Sbjct  246   FNQASQLFNKKLSAKLDSIKNSLPGSRMVFIDVYNPFLDLIQNPKKHGFEVVNEGCCGTG  305

Query  344   VIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              +EV  LCN +T  TC + + +VFWDS+HPTERAY +LV  +  KYV +F
Sbjct  306   NLEVAVLCNAWTSTTCSNDSSHVFWDSYHPTERAYRVLVSLLFGKYVDKF  355



>gb|KHG24596.1| GDSL esterase/lipase EXL3 -like protein [Gossypium arboreum]
Length=363

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 199/347 (57%), Positives = 253/347 (73%), Gaps = 4/347 (1%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             +VF + +     +A IKLP    +  VIVFGDSIVD G NN+L T  RC++ PYGQDFAG
Sbjct  19    LVFALFI---SAKALIKLPINGTIPAVIVFGDSIVDAGNNNDLNTVIRCDFLPYGQDFAG  75

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
              +PTGRFCNGK PSD IAEELG+K+++PAY DP L+ +D  TGV+FASGG G+DPLT ++
Sbjct  76    GVPTGRFCNGKVPSDLIAEELGIKDIVPAYLDPTLKTQDLLTGVTFASGGTGYDPLTPKL  135

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
             A+ I L  QLNYFKEY GKLK + GE +TN+I+  ++F+VVAG++D+ NTYF L  R+ +
Sbjct  136   ASVISLGEQLNYFKEYIGKLKAIAGEEKTNFILAKSMFLVVAGSDDIANTYFVLRARKLQ  195

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
             YD+ AY DLM+  AA+F++ELY LGAR+  +F  PP GCVPSQRTL GG  R C E+YN 
Sbjct  196   YDVPAYTDLMVNSAAEFVKELYGLGARKIGVFSTPPIGCVPSQRTLGGGIERECAEDYNV  255

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+ + N KLS+ ++S    +P    VY+D+YNPLL LIQNPQ  GFEV D GCCGTG IE
Sbjct  256   AAILFNKKLSSVLNSFKTSIPDGRFVYIDVYNPLLGLIQNPQKNGFEVVDNGCCGTGNIE  315

Query  335   VTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             V  LCNK +  TC D +KY+FWDS+HPTE+AY  LV  ILQ  +  F
Sbjct  316   VAILCNKLSPSTCTDVSKYIFWDSYHPTEKAYRALVTLILQNIIGDF  362



>ref|XP_009605226.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=355

 Score =   421 bits (1082),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/345 (57%), Positives = 264/345 (77%), Gaps = 5/345 (1%)
 Frame = -1

Query  1244  MVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             ++ VVF   LL   CEAK++LP  VV++ V  FGDSIVDQG NNNL T A+CN+ PYG+D
Sbjct  15    LLCVVF---LLFSACEAKLQLPQDVVIKAVFAFGDSIVDQGNNNNLTTRAKCNFLPYGKD  71

Query  1064  FAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLT  885
             F G  PTGRF N KTP D I E+LG+KEL+PAYFDPNL+ ED K+GVSFASG  G+D LT
Sbjct  72    FMGGKPTGRFSNAKTPPDMIVEDLGIKELMPAYFDPNLEVEDLKSGVSFASGASGYDLLT  131

Query  884   AQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI-  708
             A  ATAIPLS QL  F++YK KL+ ++GE + N I++N+LFV+V G++D++NTYF+L   
Sbjct  132   AITATAIPLSAQLLLFQQYKLKLEGLIGEEEANSIVKNSLFVIVTGSDDLVNTYFTLKFP  191

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             R+++YDI++Y +LM+ GA++F+Q+LY+LGARR  +FGIPP GC+PSQR   GG +R CVE
Sbjct  192   RKWQYDIDSYTNLMVNGASNFVQDLYNLGARRIWVFGIPPIGCLPSQRQKNGGLARVCVE  251

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
             EYN+A+Q+ N+KL+A+IDSL+  LPQS +VY+++Y+PLLDLI NP  YGFE   R CC  
Sbjct  252   EYNQAAQMANTKLAAKIDSLSEILPQSELVYINVYDPLLDLIVNPDKYGFEEVKRCCCRP  311

Query  347   GVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQK  213
             G  +   LC+ +TGTC D  KY+FWD +H TE+ Y +L+ QI +K
Sbjct  312   GNNKF-LLCDNHTGTCEDDTKYLFWDGYHLTEKGYRVLLDQIFKK  355



>ref|XP_003589528.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59779.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=371

 Score =   421 bits (1081),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 251/342 (73%), Gaps = 0/342 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
              L++  +  A +KLPP   +  V VFGDSI+D G NNN+ T +RCNYPPYG+DF G +PT
Sbjct  29    FLVVFFKTNAVLKLPPNTNIPAVFVFGDSIMDTGNNNNMTTPSRCNYPPYGKDFKGGIPT  88

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRF NGK PSDF+ EELG+KE LPAY DPNLQP +  TGV+FASGG G+DPLTA++  AI
Sbjct  89    GRFSNGKVPSDFVVEELGIKEYLPAYLDPNLQPSELATGVNFASGGAGYDPLTAKLEVAI  148

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
              +S QL+ FK+Y  +LK + GE++ N+I+ N+LF+VV G+ND+ NTY+   +R+ +YD  
Sbjct  149   SMSGQLDLFKDYIVRLKGLFGEDRANFILANSLFLVVLGSNDISNTYYLSHLRQAQYDFP  208

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
              Y+DL++  A +F QE+Y LGARR  +F  PP GCVP QRT+AGG  R CV+EYN+A+  
Sbjct  209   TYSDLLVNSALNFYQEMYQLGARRIGVFNAPPMGCVPFQRTMAGGIIRTCVQEYNDAAVF  268

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
              N+KLS  ID+     P S IVY+D+Y+PLLD+I N Q YG+EV DRGCCGTG +EVT+L
Sbjct  269   FNNKLSIGIDTFKQNFPSSRIVYMDVYSPLLDIIVNNQKYGYEVGDRGCCGTGTLEVTYL  328

Query  323   CNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CN    TCP+   YVFWDSFHPTE  Y  LV  ILQKY+++F
Sbjct  329   CNHLQPTCPNDLDYVFWDSFHPTESVYRKLVAPILQKYMHQF  370



>ref|XP_002279335.1| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
Length=356

 Score =   419 bits (1077),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 247/334 (74%), Gaps = 3/334 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLP    +  VIVFGDSIVD G NNNL T A+ NYPPYG+DF+G +PTGRF NGK P
Sbjct  24    ALVKLPENGTIPAVIVFGDSIVDAGNNNNLVTVAKSNYPPYGRDFSGGIPTGRFSNGKIP  83

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD IAE LG+K+LLPAY DP LQP D  TGVSFASG  G+DPLT++I +   LS QL  F
Sbjct  84    SDIIAELLGIKKLLPAYLDPTLQPSDLLTGVSFASGASGYDPLTSKIPSVFSLSDQLEMF  143

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             KEY GKLK MVGE +TN I+  +LF+VV  +ND+ +TYF+  +R+ +YD  +YAD+++  
Sbjct  144   KEYIGKLKAMVGEERTNTILSKSLFLVVHSSNDITSTYFT--VRKEQYDFASYADILVTL  201

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F++ELY LGARR  +FG PP GC+PSQR+LAGG  R C E  NEA+++ N++LS+E+
Sbjct  202   ASSFLKELYGLGARRIAVFGAPPLGCLPSQRSLAGGIQRECAENLNEAAKLFNTQLSSEL  261

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TC  300
             DSLN   P +  VYVDIYNPLLD+IQNPQ  GFEVA++GCCGTG IE   LCN++   TC
Sbjct  262   DSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVANKGCCGTGTIESVLLCNRFNPFTC  321

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D  KYVFWDS+HPTE+ Y IL    + KYV  F
Sbjct  322   KDVTKYVFWDSYHPTEKVYKILSGGFIPKYVGSF  355



>ref|XP_008221397.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=359

 Score =   419 bits (1077),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/342 (57%), Positives = 250/342 (73%), Gaps = 2/342 (1%)
 Frame = -1

Query  1217  LLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGR  1038
             L+    +A  KLP  V + GV +FGDSIVD G NNNL T  + N+ PYG+DF G +PTGR
Sbjct  14    LILSTAQAIAKLPNNVTIPGVFMFGDSIVDTGNNNNLTTLVKSNFLPYGRDFMGGLPTGR  73

Query  1037  FCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPL  858
             F NGK PSD I E+LG+KELLPAY DP LQPED  TGV+FASGG GFDPLT+++   IPL
Sbjct  74    FGNGKVPSDLIVEDLGIKELLPAYLDPCLQPEDLPTGVNFASGGAGFDPLTSKLMLVIPL  133

Query  857   STQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAY  678
             S QL   KEY  KLK+ +GE + + II N+LFVV AG++D++NTY+  P R +KYDI AY
Sbjct  134   SEQLQLLKEYIEKLKKYIGEERASSIISNSLFVVAAGSDDIVNTYYHTPARFWKYDIYAY  193

Query  677   ADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVN  498
              DLM+  A+ F+Q+LY LGARR  +  +PP GC+P+QRTL GG  R CVE YNEA+++ N
Sbjct  194   TDLMLTEASAFVQKLYALGARRIGVISVPPVGCIPAQRTLGGGPERKCVEIYNEAAELFN  253

Query  497   SKLSAEIDSLNNKLPQSTI-VYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLC  321
              KLSAE+D LN+    +T+ V++D+Y P LD+I NPQ YGFEV +RGCCGTG+IEV   C
Sbjct  254   KKLSAELDCLNSDQFHATVAVFMDVYGPFLDIIHNPQKYGFEVVNRGCCGTGIIEVAEFC  313

Query  320   NKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             NK++  TC +   YVFWDS+HP+ERAY I+ HQ+L K +  F
Sbjct  314   NKWSPNTCENATSYVFWDSYHPSERAYRIITHQVLHKSIQAF  355



>ref|XP_008445321.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cucumis melo]
Length=374

 Score =   419 bits (1077),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 245/337 (73%), Gaps = 0/337 (0%)
 Frame = -1

Query  1208  RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             R     I +PPG  V  V VFGDSIVD G NNNL T A+CNYPPYG+DFA   PTGRF N
Sbjct  37    RAATKNIIIPPGYSVPAVFVFGDSIVDTGNNNNLITQAKCNYPPYGRDFADGRPTGRFSN  96

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             G+ PSD + + LG+K LLP Y DPNLQ ED  TGV+FASGG GFDPLT+++A AI L  Q
Sbjct  97    GRVPSDLVVDVLGIKPLLPPYADPNLQLEDLLTGVNFASGGAGFDPLTSKLAPAISLDAQ  156

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L  F+EY+ K++ +VGE +  +II+N+LF+VVAG+ND+ NT++    R+ +Y+I+ Y D 
Sbjct  157   LAMFREYRKKIEGLVGEEKAKFIIDNSLFLVVAGSNDIGNTFYLARFRQGQYNIDTYTDF  216

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             M Q A+ ++++LY  GARR   F  PP GC+PSQRTLAGG  RACV EYN+A+++ N KL
Sbjct  217   MNQHASAYVKDLYAAGARRIGFFATPPLGCLPSQRTLAGGIQRACVNEYNDAAKLFNGKL  276

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
                +  L + LP S +VYVDIYNPLLD+IQN   YGFEVADRGCCGTG IEVT LCNK  
Sbjct  277   QTTLSYLQSTLPDSRVVYVDIYNPLLDVIQNYAKYGFEVADRGCCGTGTIEVTLLCNKLV  336

Query  308   GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              TCPD  KYVFWDSFHP+E  Y +LV  I+Q+Y+  F
Sbjct  337   KTCPDTTKYVFWDSFHPSETTYNLLVSPIIQRYISSF  373



>emb|CBI19910.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   418 bits (1075),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 247/334 (74%), Gaps = 3/334 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLP    +  VIVFGDSIVD G NNNL T A+ NYPPYG+DF+G +PTGRF NGK P
Sbjct  27    ALVKLPENGTIPAVIVFGDSIVDAGNNNNLVTVAKSNYPPYGRDFSGGIPTGRFSNGKIP  86

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD IAE LG+K+LLPAY DP LQP D  TGVSFASG  G+DPLT++I +   LS QL  F
Sbjct  87    SDIIAELLGIKKLLPAYLDPTLQPSDLLTGVSFASGASGYDPLTSKIPSVFSLSDQLEMF  146

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             KEY GKLK MVGE +TN I+  +LF+VV  +ND+ +TYF+  +R+ +YD  +YAD+++  
Sbjct  147   KEYIGKLKAMVGEERTNTILSKSLFLVVHSSNDITSTYFT--VRKEQYDFASYADILVTL  204

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F++ELY LGARR  +FG PP GC+PSQR+LAGG  R C E  NEA+++ N++LS+E+
Sbjct  205   ASSFLKELYGLGARRIAVFGAPPLGCLPSQRSLAGGIQRECAENLNEAAKLFNTQLSSEL  264

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TC  300
             DSLN   P +  VYVDIYNPLLD+IQNPQ  GFEVA++GCCGTG IE   LCN++   TC
Sbjct  265   DSLNTNFPLAKFVYVDIYNPLLDIIQNPQKSGFEVANKGCCGTGTIESVLLCNRFNPFTC  324

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D  KYVFWDS+HPTE+ Y IL    + KYV  F
Sbjct  325   KDVTKYVFWDSYHPTEKVYKILSGGFIPKYVGSF  358



>ref|XP_003550432.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
 gb|KHN12628.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=377

 Score =   416 bits (1070),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 244/338 (72%), Gaps = 1/338 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             + +  ++LPP V V  V+VFGDSI+D G NNN L T ARCN+ PYGQDF G +PTGRFCN
Sbjct  40    KTKGAVELPPNVSVPAVLVFGDSIMDTGNNNNNLITSARCNFSPYGQDFMGGIPTGRFCN  99

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GK PSD + EELG+KE LPAY DPNLQ  +  TGV FASGG G+DPLT+Q ATAIPLS Q
Sbjct  100   GKVPSDILVEELGIKEFLPAYLDPNLQLSELATGVCFASGGSGYDPLTSQTATAIPLSGQ  159

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L+ FKEY  KLK  VGE++TN+I+ N LF VV G+ND+ NTYF   +R  +YD+  Y+D 
Sbjct  160   LDMFKEYIVKLKGHVGEDRTNFILANALFFVVLGSNDISNTYFLSHLRELQYDVPTYSDF  219

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             M+  A++F +E+Y LGARR  +   PP GCVP  RTL+GG +R CV++YN A  + N KL
Sbjct  220   MLNLASNFFKEIYQLGARRIAVLSAPPVGCVPFHRTLSGGIARKCVQKYNNAVVLFNDKL  279

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
               EI+SLN  LP S IVY+D+YNPLLD+I N Q YG++V DRGCCGTG +EV   CN   
Sbjct  280   LKEINSLNQNLPNSRIVYLDVYNPLLDIIVNHQKYGYKVGDRGCCGTGNLEVALTCNHLD  339

Query  308   GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
              TC +   YVFWD FHP+E  Y  LV  +LQKY+Y+FA
Sbjct  340   ATCSNVLDYVFWDGFHPSESVYKKLVPAVLQKYIYQFA  377



>ref|XP_003544388.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Glycine 
max]
Length=367

 Score =   416 bits (1069),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 245/338 (72%), Gaps = 1/338 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             + +  +KLPP + V  V+VFGDSI+D G NNN L T AR N+PPYGQDF G +PTGRFCN
Sbjct  30    KTKGAVKLPPNISVPAVLVFGDSIMDTGNNNNNLITSARSNFPPYGQDFKGGIPTGRFCN  89

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GK PSD + EELG+KE LPAY DPNL+  +  TGV FASGG G+DPLT+Q ATAIPLS Q
Sbjct  90    GKVPSDILVEELGIKEFLPAYLDPNLELNELPTGVCFASGGSGYDPLTSQTATAIPLSGQ  149

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L+ FKEY  KLK  VGE++TN+I+ N LF VV G+ND+ NTYF   +R  +YD+  Y+D 
Sbjct  150   LDMFKEYIVKLKGHVGEDRTNFILANGLFFVVLGSNDISNTYFLTHLRELQYDVPTYSDF  209

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             M+  A++F +E+Y LGARR  +   PP GCVP  RTL+GG +R CV++YN+A  + N KL
Sbjct  210   MLNSASNFFEEIYQLGARRIAVVSAPPVGCVPFHRTLSGGIARKCVQKYNDAVLLFNDKL  269

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             S +I+SLN KLP S IVY D+YNPLLD+  N Q YG++V DRGCCGTG +EV   CN   
Sbjct  270   SKKINSLNQKLPNSRIVYFDVYNPLLDVTVNHQKYGYKVGDRGCCGTGNLEVALTCNHLD  329

Query  308   GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
              TC +   YVFWD FHP+E  Y  LV  +LQKY++RFA
Sbjct  330   ATCSNVLDYVFWDGFHPSESVYKQLVPPLLQKYIHRFA  367



>ref|XP_010266339.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nelumbo nucifera]
Length=373

 Score =   416 bits (1070),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 193/344 (56%), Positives = 252/344 (73%), Gaps = 1/344 (0%)
 Frame = -1

Query  1226  PMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMP  1047
             P+L      +  + LP  V +  +IVFGDSIVD G NNNL T  +CN+PPYG+DF G +P
Sbjct  29    PLLFSFSFLDTLVALPHNVTIPALIVFGDSIVDTGNNNNLLTAVKCNFPPYGRDFMGGIP  88

Query  1046  TGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATA  867
             TGRF NG+ PSD + +E+G+KELLPAY DP+LQ ED  TGVSFASGG GFDPLTAQ ++ 
Sbjct  89    TGRFSNGRVPSDLLVQEIGIKELLPAYLDPDLQTEDLHTGVSFASGGAGFDPLTAQASSV  148

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             + L  QL  FKEY GKL E VGE +++ I+  +L+V+ AG++D+ NTYF    RR  YDI
Sbjct  149   LSLPKQLELFKEYIGKLNEAVGEERSSTIVSESLYVIGAGSDDIANTYFGATFRRLHYDI  208

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
              +Y DLM+Q A+ F+QELY+LG RR  +F  PP GCVPSQRT AGG  R C EEYN+ ++
Sbjct  209   PSYTDLMVQEASGFVQELYELGGRRIGVFSSPPIGCVPSQRTQAGGIYRECAEEYNQVAR  268

Query  506   IVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTF  327
             + N+KLS++++SL +KLP + ++Y+D+Y+PLLD+IQ PQ+YGFE   +GCCGTG IEVT 
Sbjct  269   LFNAKLSSQLNSLRHKLPGTRLLYIDVYSPLLDIIQRPQDYGFEEVSKGCCGTGKIEVTL  328

Query  326   LCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             LCN     TC D +KYVFWDSFHPT++AY  L   +L+KY+  F
Sbjct  329   LCNDLNPFTCADVSKYVFWDSFHPTQKAYKALFGPLLRKYLSFF  372



>ref|XP_002510573.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF52760.1| zinc finger protein, putative [Ricinus communis]
Length=707

 Score =   427 bits (1099),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 207/334 (62%), Positives = 256/334 (77%), Gaps = 5/334 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A IKLP  V V  +IVFGDSIVD G NNN++T  +CN+ PYG DF G +PTGRFCNGK P
Sbjct  13    ALIKLPENVAVPALIVFGDSIVDAGNNNNIKTLIKCNFRPYGLDFYGGIPTGRFCNGKIP  72

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD IA ELG+K++LP Y DP LQP+D  TGV+FASGGCG+DPLT ++ + I L+ QLN F
Sbjct  73    SDIIAGELGIKDILPGYLDPTLQPQDLITGVTFASGGCGYDPLTPKLVSVISLADQLNQF  132

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             KEY GK+K +VGE QTN+II N+LF+VVAG++D+ NTYF L  R+ +YD+ AY DLM   
Sbjct  133   KEYIGKVKAIVGEEQTNFIIANSLFLVVAGSDDIANTYFILGARKLQYDVPAYTDLMADS  192

Query  656   AADFIQ----ELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             A+ F Q    +LYDLGARR  +FG PP GCVPSQRT+AGG  R C E YNEA+ + NSKL
Sbjct  193   ASSFAQYLLLDLYDLGARRIGVFGAPPIGCVPSQRTIAGGIQRECAENYNEAAILFNSKL  252

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             S ++DSL + LP S IVYVD+YNPLL+LIQNP+ YGFEV ++GCCGTG +EV  LCNK T
Sbjct  253   SNKLDSLGSSLPNSRIVYVDVYNPLLNLIQNPKQYGFEVVNKGCCGTGALEVAILCNKVT  312

Query  308   G-TCPDHNKYVFWDSFHPTERAYGILVHQILQKY  210
               TC + + ++FWDS+HPTERAY IL+ Q+L KY
Sbjct  313   PVTCDNVSDHIFWDSYHPTERAYEILISQVLAKY  346


 Score =   407 bits (1045),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 186/338 (55%), Positives = 245/338 (72%), Gaps = 1/338 (0%)
 Frame = -1

Query  1208  RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             R   A  KLPP V +  ++VFGDSIVD G NN + T  RCN+ PYG DF G  PTGRFC+
Sbjct  369   RITTALTKLPPNVTIPAILVFGDSIVDTGNNNYVPTLLRCNFRPYGIDFKGGFPTGRFCD  428

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GK PSD IAEELG+K+ +PAY DP + PED+ TGV+FASGG G+DPLT  +  AI L  Q
Sbjct  429   GKVPSDLIAEELGIKDTVPAYLDPTVLPEDFLTGVTFASGGSGYDPLTPVLVKAISLDDQ  488

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L Y +EY GK+K +VGE +  ++I N+L++VVAG++D+ NTY++L  R+ +Y++N+Y+DL
Sbjct  489   LKYLREYIGKVKGLVGEERAQFVIANSLYLVVAGSDDIANTYYTLRARKLRYNVNSYSDL  548

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             M   A+ F+Q LY++GARR  I   PP GCVP+QRT+AGG  R C E  N+A+ + NSKL
Sbjct  549   MANSASTFVQNLYNMGARRIGILSAPPIGCVPAQRTVAGGIHRECAESQNQAAILFNSKL  608

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             S  + SLN KLP S IVY+D+YN  LD++QNPQ YGFEVA+RGCCGTG++E   LCN+ T
Sbjct  609   SQLLASLNIKLPNSKIVYIDVYNTFLDIVQNPQKYGFEVANRGCCGTGMLEAAILCNRAT  668

Query  308   G-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
                C + + YVFWDS+HPTE+AY +L  Q   + V +F
Sbjct  669   PIICANVSNYVFWDSYHPTEKAYRVLTSQFFSENVDKF  706



>ref|XP_010539839.1| PREDICTED: GDSL esterase/lipase EXL3-like [Tarenaya hassleriana]
Length=369

 Score =   416 bits (1068),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 190/335 (57%), Positives = 252/335 (75%), Gaps = 1/335 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +A +KLPP V V  +IVFGDSI+D G NN L+T  + ++PPYG DF   +PTGRFC+GK 
Sbjct  34    KALVKLPPNVTVPALIVFGDSIMDTGNNNVLKTVVKADFPPYGIDFQDGVPTGRFCDGKV  93

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P+D IAEELG+K ++PAY +P+L+PED  TGV FAS G G+DPLT++I + IPLS QL Y
Sbjct  94    PTDLIAEELGIKSIVPAYLNPSLKPEDLLTGVCFASSGSGYDPLTSKIVSVIPLSGQLRY  153

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EY  KLKE+VGE + ++I+EN+LF+VV+ +ND+  TYF+L  R+ +YD+ +Y  LM  
Sbjct  154   FEEYIEKLKELVGEERKDFILENSLFLVVSSSNDIATTYFTLHARQSEYDVVSYTSLMAD  213

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+DF+ +LY  GARR  +FG PP GC+PSQRTLAGG  R C +  NEA+++ N+KLSA 
Sbjct  214   LASDFVHKLYGYGARRIAVFGAPPLGCIPSQRTLAGGLVRGCDDNRNEAAKLFNAKLSAG  273

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-  303
             +DS++  L  + +VYVDIY  L  +IQNP+NYGFEVADRGCCGTG +EV  LCNK T + 
Sbjct  274   LDSISRTLAGARVVYVDIYTTLFRIIQNPRNYGFEVADRGCCGTGDLEVAVLCNKITSSV  333

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D + YVFWDSFHPTER Y +LV ++L +Y  +F
Sbjct  334   CSDVSAYVFWDSFHPTERVYRMLVSKLLDEYAQKF  368



>ref|XP_007225000.1| hypothetical protein PRUPE_ppa020405mg [Prunus persica]
 gb|EMJ26199.1| hypothetical protein PRUPE_ppa020405mg [Prunus persica]
Length=354

 Score =   414 bits (1065),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/342 (57%), Positives = 249/342 (73%), Gaps = 2/342 (1%)
 Frame = -1

Query  1217  LLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGR  1038
             L+    +A +KLP  V + GV +FGDSIVD G NNNL T  + N+ PYG+DF G +PTGR
Sbjct  7     LILSTAQAIVKLPNNVTIPGVFMFGDSIVDTGNNNNLTTLVKSNFLPYGRDFMGGLPTGR  66

Query  1037  FCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPL  858
             F NGK PSD I E+LG+KELLPAY DP LQ ED  TGV+FASGG GFDPLT+++   IPL
Sbjct  67    FGNGKVPSDLIVEDLGIKELLPAYLDPCLQAEDLPTGVNFASGGAGFDPLTSKLMLVIPL  126

Query  857   STQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAY  678
             S QL   KEY  KLK+ VGE + + II N+LFVV AG++D++NTY+  P R +KYDI AY
Sbjct  127   SEQLQLLKEYIEKLKKYVGEERASSIISNSLFVVAAGSDDIVNTYYHTPARFWKYDIYAY  186

Query  677   ADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVN  498
              DLM+  A+ F+Q+LY LGARR  +  +PP GC+P+QRTL GG  R CVE YNEA+++ N
Sbjct  187   TDLMLTEASAFVQKLYTLGARRIGVISVPPIGCIPAQRTLGGGPERKCVERYNEAAELFN  246

Query  497   SKLSAEIDSLNNKLPQSTI-VYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLC  321
              KLSAE+D LN+    +T+ V++D+Y P LD+I NP+ YGFEV +RGCCGTG+IEV   C
Sbjct  247   KKLSAELDCLNSHQFHATVAVFMDVYGPFLDIIHNPKKYGFEVINRGCCGTGIIEVAAFC  306

Query  320   NKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             N+ +  TC +   YVFWDS+HP+ERAY I+ HQ+L K +  F
Sbjct  307   NQCSPNTCKNATNYVFWDSYHPSERAYRIITHQVLHKSIQAF  348



>ref|XP_006601361.1| PREDICTED: GDSL esterase/lipase EXL1-like [Glycine max]
 gb|KHN12629.1| GDSL esterase/lipase EXL1 [Glycine soja]
Length=372

 Score =   415 bits (1066),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 200/337 (59%), Positives = 250/337 (74%), Gaps = 1/337 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             +  A +K+PP V V  V+VFGDSIVD G NNN L T ARCNYPPYG+DF G  PTGRF N
Sbjct  35    KTRAVVKIPPNVSVPAVLVFGDSIVDTGNNNNNLGTTARCNYPPYGKDFKGGKPTGRFSN  94

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GK PSDFIAEELG+KE +PAY DP+LQP +  TGV FASGG G+DP T+Q A+AIPLS Q
Sbjct  95    GKVPSDFIAEELGIKEYVPAYLDPHLQPGELATGVCFASGGAGYDPFTSQSASAIPLSGQ  154

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L+ FKEY GKL+ +VGE++  +I+ N+L+VVV G+ND+ NTYF   +R+ +YD  AYAD 
Sbjct  155   LDLFKEYIGKLRGVVGEDRAKFILGNSLYVVVFGSNDISNTYFLTRVRQLQYDFPAYADF  214

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             ++  A++F +ELY LGARR  +F  PP GC+PSQRTLAGG  R  V   N A QI NSKL
Sbjct  215   LLSSASNFFKELYGLGARRIAVFSAPPLGCLPSQRTLAGGLERKIVVNINNAVQIYNSKL  274

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             S E+DSLN+ L  S IVY+D+YNPL D+I N   YG++V D+GCCGTG IEV  LCN++T
Sbjct  275   SKELDSLNHNLQDSRIVYIDVYNPLFDIIVNYNKYGYKVGDKGCCGTGTIEVVLLCNRFT  334

Query  308   GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               CP+  +YVFWDSFHPTE  Y  L+  ++ KY+ +F
Sbjct  335   PLCPNDLEYVFWDSFHPTESVYKRLIASLIGKYLDKF  371



>ref|XP_006596537.1| PREDICTED: GDSL esterase/lipase EXL1-like [Glycine max]
Length=368

 Score =   414 bits (1065),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 199/337 (59%), Positives = 253/337 (75%), Gaps = 1/337 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             +  A +KLPP V V  V+VFGDSIVD G NNN L T ARCNYPPYG+DF G  PTGRF N
Sbjct  31    KTRAVVKLPPNVSVPAVLVFGDSIVDTGNNNNNLGTTARCNYPPYGKDFEGGKPTGRFSN  90

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GK PSDFIAEELG+KE +PAY DP+LQP +  TGV FASGG G+DPLT+Q A+AI LS Q
Sbjct  91    GKVPSDFIAEELGIKEYVPAYLDPHLQPGELATGVCFASGGAGYDPLTSQSASAISLSGQ  150

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L+ FKEY GKL+ +VGE++TN+I+ N+L+VVV G+ND+ NTYF   +R+ +YD   YAD 
Sbjct  151   LDLFKEYLGKLRGVVGEDRTNFILANSLYVVVFGSNDISNTYFLSRVRQLQYDFPTYADF  210

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             ++  A++F +ELY LGARR  +F  PP GC+PSQRTLAGG  R  V   N+A+++ N+KL
Sbjct  211   LLSSASNFFKELYGLGARRIAVFSAPPLGCLPSQRTLAGGLERKIVVNINDAAKLFNNKL  270

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             S E+DSLN+    S IVY+D+YNPL D+I N + YG++V D+GCCGTG IEV  LCN++T
Sbjct  271   SKELDSLNHNFQDSRIVYIDVYNPLFDIIINYKKYGYKVGDKGCCGTGTIEVVLLCNRFT  330

Query  308   GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               CP+  +YVFWDSFHPTE  Y  L+  +L KY+ +F
Sbjct  331   PLCPNDLEYVFWDSFHPTESVYRRLIASLLGKYLDKF  367



>ref|XP_004499293.1| PREDICTED: GDSL esterase/lipase EXL3-like, partial [Cicer arietinum]
Length=346

 Score =   414 bits (1063),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 248/336 (74%), Gaps = 1/336 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
             + +L  + +  IKLPP V +  +I FGDSIVD G NN+++T  +CN+PPYG+DF   +PT
Sbjct  10    LFVLCYKTKGLIKLPPNVTIPALIAFGDSIVDSGNNNHIKTLIKCNFPPYGKDFLENVPT  69

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRFCNGK PSD IAEELG+KE +PAY DP L+P D  TGVSFASG  G+DPLT+++ + I
Sbjct  70    GRFCNGKIPSDIIAEELGIKEYVPAYLDPYLKPNDLLTGVSFASGASGYDPLTSELMSVI  129

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
             PLSTQL+ FKEY  KLK +VGE+ TN+IIE +L+VVV G++D+ NTYF     R +YDI 
Sbjct  130   PLSTQLDLFKEYINKLKGIVGEDNTNFIIEKSLYVVVGGSDDIANTYFDAQ-ARLQYDIY  188

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
             AY DLM   A++F+QE+Y LG RR  +FG PP GC+PSQRT+ GG  R C E+ N  +++
Sbjct  189   AYTDLMSNSASNFLQEIYKLGGRRMFVFGAPPIGCLPSQRTVQGGILRTCAEKLNYVAKL  248

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
              N KLS  IDSLN+ LP+S + YVD+Y PLLD+I NPQ YG+++ D+GCCGTG+IE   L
Sbjct  249   FNLKLSNNIDSLNSNLPKSRVTYVDVYTPLLDIILNPQKYGYKIVDKGCCGTGLIEAAVL  308

Query  323   CNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQ  216
             CN +  TC + ++YVFWDS+HPTE  Y +L+  IL 
Sbjct  309   CNPFVNTCYNVSEYVFWDSYHPTEGVYNVLILLILD  344



>ref|XP_006390257.1| hypothetical protein EUTSA_v10018728mg [Eutrema salsugineum]
 gb|ESQ27543.1| hypothetical protein EUTSA_v10018728mg [Eutrema salsugineum]
Length=373

 Score =   414 bits (1065),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/351 (55%), Positives = 254/351 (72%), Gaps = 1/351 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L   + F +LL      A +KLP    +  +IVFGDSIVD G N+++ T ARC+YPPYG 
Sbjct  22    LYWCIFFLVLLFTSATNALVKLPENTTIPAIIVFGDSIVDAGNNDDMITEARCDYPPYGI  81

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G +PTGRF NGK P+D +AEELG+K  +PAY DPNL+PED  TGV+FASGG G+ PL
Sbjct  82    DFDGGVPTGRFSNGKVPTDMLAEELGIKPYIPAYRDPNLKPEDLLTGVTFASGGAGYVPL  141

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T QIA  IPLS QL YF+EY  +L  +VG+ +T +II+N+LFV++ G+ND+ N +F+ P 
Sbjct  142   TTQIAGGIPLSQQLKYFEEYLERLNGLVGDERTKFIIKNSLFVIICGSNDIANDFFTFPT  201

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
               ++YD+ ++  LM   A     +LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  202   VWHQYDVASFTALMADNARSIAMKLYGYGARRILMFGAPPIGCVPSQRTVAGGPTRDCVV  261

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              +N+AS++ N+KLSA ID L+  L  +T++Y+DIYNPLLDLI NP  YGF+VA+ GCCGT
Sbjct  262   RFNDASKLFNAKLSANIDGLSRTLLDTTLIYIDIYNPLLDLILNPHKYGFKVANLGCCGT  321

Query  347   GVIEVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G+IEVT LCN YT   CP  + YVFWDSFHPTE AY I+V ++L +Y+ RF
Sbjct  322   GLIEVTALCNNYTAAVCPVRSDYVFWDSFHPTETAYKIIVAKLLDRYLNRF  372



>ref|XP_002270500.1| PREDICTED: GDSL esterase/lipase EXL3 [Vitis vinifera]
Length=357

 Score =   414 bits (1064),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 194/335 (58%), Positives = 244/335 (73%), Gaps = 1/335 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +KLP       V+VFGDSIVD G NNNL T  +CN+PPYG+DF G  PTGRF NGK 
Sbjct  22    EALVKLPRNETFPAVLVFGDSIVDPGNNNNLSTVVKCNFPPYGRDFVGGFPTGRFSNGKI  81

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P DFIAEELG+K LLP Y  P+LQ  D  TGVSFAS G GFDPLT ++ + + L  QL  
Sbjct  82    PPDFIAEELGIKNLLPPYSSPSLQLGDLLTGVSFASSGSGFDPLTPKLVSVLSLRDQLGM  141

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKLK MVGE +TN I+  +LF+VVAG++D+ N+YF + +R+ +YD+ AY D M  
Sbjct  142   FKEYIGKLKVMVGEERTNTILSKSLFLVVAGSDDIANSYFVIGVRKRQYDVPAYTDFMAT  201

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              AA F++ELY LGARR  +   PP GC+PSQR+LAGGK R C E++NEA+++ N+KLS++
Sbjct  202   SAASFLKELYGLGARRIGVASAPPLGCLPSQRSLAGGKQRECAEDHNEAAKLFNTKLSSQ  261

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +DSLN   PQ+  VY+DIY P LDLIQNPQ  GFEV D+GCCGTG IE   LC+  +  T
Sbjct  262   LDSLNANSPQAKFVYIDIYKPFLDLIQNPQKSGFEVVDKGCCGTGRIEAAALCSLLSSFT  321

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D + YVFWDS+HPTERAY +++ +I+QK V  F
Sbjct  322   CEDASNYVFWDSYHPTERAYKVIIEKIIQKCVDGF  356



>gb|KHN39412.1| GDSL esterase/lipase EXL1 [Glycine soja]
Length=364

 Score =   414 bits (1064),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/337 (59%), Positives = 253/337 (75%), Gaps = 1/337 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             +  A +KLPP V V  V+VFGDSIVD G NNN L T ARCNYPPYG+DF G  PTGRF N
Sbjct  27    KTRAVVKLPPNVSVPAVLVFGDSIVDTGNNNNNLGTTARCNYPPYGKDFEGGKPTGRFSN  86

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GK PSDFIAEELG+KE +PAY DP+LQP +  TGV FASGG G+DPLT+Q A+AI LS Q
Sbjct  87    GKVPSDFIAEELGIKEYVPAYLDPHLQPGELATGVCFASGGAGYDPLTSQSASAISLSGQ  146

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L+ FKEY GKL+ +VGE++TN+I+ N+L+VVV G+ND+ NTYF   +R+ +YD   YAD 
Sbjct  147   LDLFKEYLGKLRGVVGEDRTNFILANSLYVVVFGSNDISNTYFLSRVRQLQYDFPTYADF  206

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             ++  A++F +ELY LGARR  +F  PP GC+PSQRTLAGG  R  V   N+A+++ N+KL
Sbjct  207   LLSSASNFFKELYGLGARRIAVFSAPPLGCLPSQRTLAGGLERKIVVNINDAAKLFNNKL  266

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             S E+DSLN+    S IVY+D+YNPL D+I N + YG++V D+GCCGTG IEV  LCN++T
Sbjct  267   SKELDSLNHNFQDSRIVYIDVYNPLFDIIINYKKYGYKVGDKGCCGTGTIEVVLLCNRFT  326

Query  308   GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               CP+  +YVFWDSFHPTE  Y  L+  +L KY+ +F
Sbjct  327   PLCPNDLEYVFWDSFHPTESVYRRLIASLLGKYLDKF  363



>ref|XP_010416497.1| PREDICTED: GDSL esterase/lipase EXL1-like [Camelina sativa]
Length=374

 Score =   414 bits (1064),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 199/351 (57%), Positives = 250/351 (71%), Gaps = 1/351 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L     F +LL      A +KLP    V  VIVFGDSIVD G N+++ T ARC+Y PYG 
Sbjct  23    LFWCTFFLVLLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGI  82

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G + TGRF NGK P D +AEELG+K  +PAY DPNL+PED  TGV+FASGG G+ PL
Sbjct  83    DFDGGVATGRFSNGKVPGDIVAEELGIKPNIPAYRDPNLKPEDLLTGVTFASGGAGYVPL  142

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T ++A  IPL  QL YF+EY+ +LK MVGE +T +II+N+LFVVV G+ND+ N +F+LP 
Sbjct  143   TTKLAGGIPLPLQLKYFEEYRARLKAMVGEERTQFIIKNSLFVVVCGSNDIANNFFALPP  202

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              +  Y + ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  203   VQLHYTVASFTALMANNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVA  262

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              +N+AS++ NSKLSA ID+L+  L   TI+ +DIY+PLLDLI NPQ YGF+V D+GCCGT
Sbjct  263   RFNDASKLFNSKLSANIDALSRTLQDPTIICIDIYSPLLDLILNPQQYGFKVGDKGCCGT  322

Query  347   GVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G+IEVT LCN YT   CP  + YVFWDSFHPTE+AY I+V ++  KY  RF
Sbjct  323   GLIEVTALCNNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  373



>ref|XP_008221398.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=386

 Score =   414 bits (1065),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 243/334 (73%), Gaps = 3/334 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCNGKTPS  1014
             +KLP  V V  VI FGDSIVD G NNN  +T ARCN+ PYG+D  G MPTGRF NGK PS
Sbjct  52    VKLPGNVSVPAVITFGDSIVDTGNNNNNFKTLARCNFLPYGKDLKGGMPTGRFSNGKVPS  111

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D + E  G+KELLPAY DP LQPED  TGV  A+GG G+DPLTAQ+A    LS QL  F+
Sbjct  112   DLLVEAFGIKELLPAYLDPTLQPEDLLTGVVIAAGGAGYDPLTAQLAGVASLSDQLKQFQ  171

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EY  KLK + GE +TN+I+ N L  VVAG+ND+ NTYF    R+ +YD+ +Y D M+  A
Sbjct  172   EYVEKLKGIAGEERTNFIVANCLIFVVAGSNDISNTYFLSGARKLEYDVPSYTDFMLNYA  231

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
             + F+++LY LGARR  +  +PP GCVPSQRT+ GG  R C ++ N+ASQ+ N KLSAE+D
Sbjct  232   SQFVKDLYGLGARRIGVLNVPPIGCVPSQRTVGGGMLRECDDKQNQASQLFNFKLSAEMD  291

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKY--TGTC  300
              LN  LP S +VY+DIYNPLLDLI NP  YGFEV ++GCCG+G+IEVT LCN++   GTC
Sbjct  292   GLNKNLPNSRVVYIDIYNPLLDLIINPTKYGFEVVNKGCCGSGIIEVTKLCNQFQPAGTC  351

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D +KYVFWDS+HPTE A+ I+V Q+L KY  RF
Sbjct  352   SDDSKYVFWDSYHPTESAFKIIVQQVLDKYANRF  385



>emb|CAN73607.1| hypothetical protein VITISV_035505 [Vitis vinifera]
Length=346

 Score =   413 bits (1061),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 246/334 (74%), Gaps = 14/334 (4%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +KLP    V  VIVFGDSIVD G NNNL T A+CN+PPYG+DF G +PTGRF NGK 
Sbjct  20    EALVKLPDNEKVPAVIVFGDSIVDPGNNNNLVTVAKCNFPPYGRDFIGGIPTGRFSNGKI  79

Query  1019  PSDFIA--EELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQL  846
             PSDFIA  EELG+K+LLPAY DP LQP D  TGVSFASG  G+DPLT +I +   LS QL
Sbjct  80    PSDFIATAEELGIKKLLPAYLDPTLQPSDLLTGVSFASGASGYDPLTPKIPSVFSLSDQL  139

Query  845   NYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLM  666
               FKEY GKLK MVGE +TN I+  +LF VV G+ND+ +TYF   IRR +YD  +YADL+
Sbjct  140   EMFKEYIGKLKGMVGEERTNTILSKSLFFVVQGSNDITSTYFB--IRRGQYDFASYADLL  197

Query  665   IQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLS  486
                      ELY LGARR  +F  PP GC+PSQRTLAGG  R CVE+YNEASQ+ N+KLS
Sbjct  198   ---------ELYGLGARRIGVFSAPPLGCLPSQRTLAGGIQRECVEKYNEASQLFNTKLS  248

Query  485   AEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG  306
             + +DSLN   P +  +YVDIYNPLLD+IQNPQ  GFEV ++GCCGTG+IEV+ LC++   
Sbjct  249   SGLDSLNTNFPLAKFLYVDIYNPLLDIIQNPQKSGFEVVNKGCCGTGLIEVSVLCDRLNP  308

Query  305   -TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
              TC D  KYVFWDS+HPTERAY  ++ +I+Q YV
Sbjct  309   FTCNDATKYVFWDSYHPTERAYKTIIGEIIQGYV  342



>ref|XP_010471731.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X1 [Camelina 
sativa]
 ref|XP_010471734.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X1 [Camelina 
sativa]
 ref|XP_010471737.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X1 [Camelina 
sativa]
Length=374

 Score =   414 bits (1063),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 250/351 (71%), Gaps = 1/351 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L     F +LL      A +KLP    V  VIVFGDSIVD G N+++ T ARC+Y PYG 
Sbjct  23    LFWCTFFLVLLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGI  82

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G + TGRF NGK P D +AEELG+K  +PAY DPNL+PED  TGV+FASGG G+ PL
Sbjct  83    DFDGGVATGRFSNGKVPGDIVAEELGIKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPL  142

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T ++A  IPL  QL YF++Y  KLK MVGE +T +II+N+LFVV+ G+ND+ N +F+LP 
Sbjct  143   TTKLAGGIPLPQQLKYFEQYIAKLKAMVGEERTQFIIKNSLFVVICGSNDIANDFFALPP  202

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              +  Y + ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  203   VQLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVA  262

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              +N+AS++ NSKLSA ID+L+  L   TI+Y+DIY+PLLDLI +PQ YGF+V D+GCCGT
Sbjct  263   RFNDASKLFNSKLSANIDALSTTLQDPTIIYIDIYSPLLDLILSPQQYGFKVGDKGCCGT  322

Query  347   GVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G+IEVT LCN YT   CP  + YVFWDSFHPTE+AY I+V ++  KY  RF
Sbjct  323   GLIEVTALCNNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  373



>ref|XP_003603778.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES74029.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=358

 Score =   412 bits (1060),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 250/334 (75%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A I+LPP V    V VFGDSI+D G NNN ++T+ARCN+ PYG+DF G +PTGRFCNGK 
Sbjct  24    ATIELPPNVSFPAVFVFGDSIMDTGNNNNNMKTYARCNFLPYGKDFNGGIPTGRFCNGKV  83

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD+I E LG+KE LPAY DPN+QP D  TGV FASGG G+DPLT++ A+AI LS Q+  
Sbjct  84    PSDYIVEALGIKEFLPAYLDPNIQPSDLVTGVCFASGGSGYDPLTSKSASAISLSGQIIL  143

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKLK +VGE + N+I+ N++F+VV G+ND+ NTYF   +R  +YD+ +Y DLM+ 
Sbjct  144   FKEYIGKLKGIVGEGRKNFILANSVFLVVQGSNDISNTYFLSHLRELQYDVPSYTDLMLA  203

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A++F++E+Y LGARR  +  IPP GCVP QRT+ GG  R C E+ N+A ++ N+KLS E
Sbjct  204   SASNFLKEIYQLGARRIGVLSIPPIGCVPFQRTVVGGIERKCAEKINDACKLFNTKLSKE  263

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             + SLN  LP + +VY+D+Y PLLD+I N QNYG++V D+GCCGTG +EV  LCN++   C
Sbjct  264   LSSLNRNLPNTRMVYLDVYYPLLDIILNYQNYGYKVVDKGCCGTGAVEVAVLCNQFATQC  323

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D   YVFWDSFHP+E  Y  L++ +L+KY+++F
Sbjct  324   EDVRDYVFWDSFHPSESVYSKLLNPLLRKYIHQF  357



>ref|XP_009757107.1| PREDICTED: uncharacterized protein LOC104210014 [Nicotiana sylvestris]
Length=717

 Score =   425 bits (1093),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 202/356 (57%), Positives = 268/356 (75%), Gaps = 12/356 (3%)
 Frame = -1

Query  1247  LMVSVVFPM----------LLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTF  1098
             L  S+VFP+          +LL   CEAK++LP GV ++ V  FGDSIVDQG NNNL T 
Sbjct  2     LFSSLVFPVNRMALLYCVVILLFSACEAKLQLPQGVNIKAVFAFGDSIVDQGNNNNLTTR  61

Query  1097  ARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSF  918
             A+CN+ PYG+DF G  PTGRF N KTP D I EELG+KEL+PAYFDPNL+ ED KTGVSF
Sbjct  62    AKCNFLPYGKDFMGGKPTGRFSNAKTPPDMIVEELGIKELMPAYFDPNLKVEDLKTGVSF  121

Query  917   ASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTND  738
             ASG  G+D LTA  ATAIPLS QL  F++YK KL+ ++GE + NYI++N+LF+VV G++D
Sbjct  122   ASGASGYDLLTAITATAIPLSAQLLLFQQYKLKLEGLIGEEEANYIVKNSLFLVVTGSDD  181

Query  737   VLNTYFSLPI-RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRT  561
             ++NTYF+L I R+++Y+I++Y +LM+ GA++F+Q+LY LGAR+  +FGIPP GC+PSQR 
Sbjct  182   LVNTYFTLKIPRKWQYNIDSYTNLMVNGASNFVQDLYTLGARKIWVFGIPPIGCLPSQRQ  241

Query  560   LAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYG  381
              +GG +R CVEEYN+A+Q+ N+KL+A+IDSL+  LPQS +V+++IY+PLLDLI NP  YG
Sbjct  242   KSGGLARVCVEEYNQAAQLANTKLAAKIDSLSEILPQSELVFINIYDPLLDLIDNPDKYG  301

Query  380   FEVADRGCCGTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQK  213
             FE   R CC  G  +   LCN +T TC D  KY+FWD +H TE+ Y +LV QI ++
Sbjct  302   FEEVKRCCCRPGKNKF-LLCNNHTKTCEDDTKYLFWDGYHLTEKGYRVLVDQIFKE  356


 Score =   424 bits (1089),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 255/334 (76%), Gaps = 3/334 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +A  ++P    +  VIVFGDSIVD G NN L+T ++ NYPPYGQDF G  PTGRF NGK 
Sbjct  386   KAVTRIPYNESIPAVIVFGDSIVDTGNNNGLKTVSKVNYPPYGQDFMGGKPTGRFSNGKV  445

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P+D I EELG+KELLPAY DP LQP D  TGV+FASGG G+DPLT+++A  I LS QL  
Sbjct  446   PADLIVEELGIKELLPAYLDPTLQPVDLITGVNFASGGAGYDPLTSELAKVISLSRQLEM  505

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KL+E+VGE++ N I+ N+LF++V GTND++NTYF+ P+R+  YD+++YADL+++
Sbjct  506   FKEYILKLREIVGEDRKNEILANSLFILVTGTNDIINTYFNTPLRKSYYDVSSYADLLVR  565

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+Q+LY LGARR  +FGIPP GC+PSQRTL GG+ R CV+  N+A+Q+ NSKL+AE
Sbjct  566   SASSFVQDLYGLGARRIGVFGIPPIGCLPSQRTLRGGEERECVDYLNQAAQLFNSKLAAE  625

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             + SL NK P S +VYVD+YN  LD+I NPQ YGF+++D+GCCGTG IEV  LC   T TC
Sbjct  626   LSSLGNKFPDSRMVYVDVYNLPLDVIYNPQKYGFKISDKGCCGTGKIEVAELC---TFTC  682

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
                + YVFWDSFH TE+AY  LVHQIL +++  F
Sbjct  683   SSDSDYVFWDSFHLTEKAYRQLVHQILAQHLSSF  716



>gb|ACU20672.1| unknown [Glycine max]
Length=372

 Score =   413 bits (1062),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 199/337 (59%), Positives = 250/337 (74%), Gaps = 1/337 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             +  A +K+PP V V  V+VFGDSIVD G NNN L T ARC+YPPYG+DF G  PTGRF N
Sbjct  35    KTRAVVKIPPNVSVPAVLVFGDSIVDTGNNNNNLGTTARCDYPPYGKDFKGGKPTGRFSN  94

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GK PSDFIAEELG+KE +PAY DP+LQP +  TGV FASGG G+DP T+Q A+AIPLS Q
Sbjct  95    GKVPSDFIAEELGIKEYVPAYLDPHLQPGELATGVCFASGGAGYDPFTSQSASAIPLSGQ  154

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             L+ FKEY GKL+ +VGE++  +I+ N+L+VVV G+ND+ NTYF   +R+ +YD  AYAD 
Sbjct  155   LDLFKEYIGKLRGVVGEDRAKFILGNSLYVVVFGSNDISNTYFLTRVRQLQYDFPAYADF  214

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             ++  A++F +ELY LGARR  +F  PP GC+PSQRTLAGG  R  V   N A QI NSKL
Sbjct  215   LLSSASNFFKELYGLGARRIAVFSAPPLGCLPSQRTLAGGLERKIVVNINNAVQIYNSKL  274

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT  309
             S E+DSLN+ L  S IVY+D+YNPL D+I N   YG++V D+GCCGTG IEV  LCN++T
Sbjct  275   SKELDSLNHNLQDSRIVYIDVYNPLFDIIVNYNKYGYKVGDKGCCGTGTIEVVLLCNRFT  334

Query  308   GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               CP+  +YVFWDSFHPTE  Y  L+  ++ KY+ +F
Sbjct  335   PLCPNDLEYVFWDSFHPTESVYKRLIASLIGKYLDKF  371



>emb|CDY70534.1| BnaAnng34060D [Brassica napus]
Length=374

 Score =   413 bits (1062),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 254/351 (72%), Gaps = 1/351 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L   + F +LL      A +KLP    V  +IVFGDSIVD G N++L T ARC+YPPYG 
Sbjct  23    LCFCISFLVLLFTTTTNALVKLPENTTVPAIIVFGDSIVDAGNNDDLITEARCDYPPYGI  82

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G +PTGRF NGK P+D +AEELG+K  +PAY DPNL+ ED  TGV+FASGG G+ PL
Sbjct  83    DFDGGVPTGRFSNGKVPTDILAEELGIKPTIPAYRDPNLRQEDLLTGVTFASGGAGYVPL  142

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T QIA  IPLS QL +F+EY  KL  MVG+ +T +II N+LFV++ G+ND+ N +FSLP 
Sbjct  143   TTQIAGGIPLSQQLKFFEEYIEKLNGMVGQERTTFIITNSLFVIICGSNDIANNFFSLPT  202

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              + +Y++ ++  LM   A  F + LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  203   TQLQYNVASFTALMADNARSFARTLYQYGARRILMFGAPPIGCVPSQRTVAGGPTRDCVV  262

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              +N+A ++ N+KLSA ID L+  L  +T++Y+DIY+PLLDLI NPQ YGF+V++ GCCGT
Sbjct  263   RFNDACKLFNAKLSANIDGLSRTLQDTTLIYIDIYDPLLDLILNPQQYGFKVSNLGCCGT  322

Query  347   GVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G+IEVT LCN YT   CP  + YVFWDSFHPTE AY  +V ++LQ+Y+ RF
Sbjct  323   GLIEVTALCNNYTAAVCPVRSDYVFWDSFHPTETAYRNIVAKLLQRYLNRF  373



>gb|KDP36891.1| hypothetical protein JCGZ_08182 [Jatropha curcas]
Length=359

 Score =   412 bits (1060),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 183/334 (55%), Positives = 257/334 (77%), Gaps = 3/334 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLPP V V  ++VFGDSIVD G NNN++T  +C++ PYG +F G  PTGRFC+GK P
Sbjct  27    ALVKLPPNVTVPALLVFGDSIVDSGNNNNIRTIVKCDFLPYGINFKGGTPTGRFCDGKIP  86

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD +AEELG+K+ +PAY DP ++ +D  TGV+FASG  G+DPLT+++ + + L  QL  F
Sbjct  87    SDILAEELGIKDTVPAYMDPEVKDQDLLTGVTFASGASGYDPLTSKLTSVMSLDDQLEQF  146

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             KEY  KLKE+VGE +TN+I+ N++F+VVAG++D+ NTY++L +R+ +YD+ AY DLM+  
Sbjct  147   KEYIEKLKEIVGEEKTNFILANSVFLVVAGSDDIANTYYTLRVRKLQYDVPAYTDLMLDY  206

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F+Q LYDLGARR  +F  PP GCVP+QRTLAGG  R C E++N+A+ + NSKLS ++
Sbjct  207   ASTFVQNLYDLGARRIAVFSAPPIGCVPAQRTLAGGSQRECAEDFNKAATLFNSKLSKKL  266

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TC  300
             DS N  +P + +VYVD+YNPLL++IQ+P  +GFEV ++GCCG+G +EV+ LCN+ T   C
Sbjct  267   DSFN--MPDAKVVYVDVYNPLLNIIQDPNQFGFEVVNKGCCGSGNLEVSVLCNRLTPFIC  324

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + + +VFWDS+HPTERAY +LV Q+L KY+ +F
Sbjct  325   SNTSDHVFWDSYHPTERAYRVLVSQLLVKYLDKF  358



>ref|XP_009336671.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103929236 
[Pyrus x bretschneideri]
Length=756

 Score =   426 bits (1095),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/336 (61%), Positives = 248/336 (74%), Gaps = 3/336 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNN-NLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A +KLP  V +  VIVFGDSIVD G NN N  TFARCN+ PYG+D  G MPTGRF NGK 
Sbjct  420   ATVKLPENVTIPAVIVFGDSIVDTGNNNENFGTFARCNFLPYGKDLKGGMPTGRFSNGKV  479

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDFI + LG+KELLPAY DP LQP D  TGV  A+GG G+DPLTA++A    LS Q+  
Sbjct  480   PSDFIVKALGIKELLPAYLDPTLQPNDLLTGVVIATGGAGYDPLTAKLAVVASLSDQMKQ  539

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK +VGE +TN+II+N+L  VVAG+ND+ NTYF   +RR +YD+ +Y D +++
Sbjct  540   FKEYIEKLKGIVGEKKTNFIIKNSLIFVVAGSNDISNTYFLSGLRRLEYDVPSYTDFILK  599

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+DF+++LY LGARR  +   PP GCVPSQRTL GG  R C E+ N+A Q+ NSKLS E
Sbjct  600   HASDFVKDLYGLGARRIGVLSTPPIGCVPSQRTLNGGIQRDCDEKQNQACQLFNSKLSVE  659

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKY--TG  306
             +D LN  LP S +VY+DIYNPLLD+I+NP  YGFEVA+ GCCGTG+IEVT LCN+    G
Sbjct  660   MDRLNKNLPNSRVVYIDIYNPLLDIIKNPAKYGFEVANIGCCGTGLIEVTKLCNQLQPAG  719

Query  305   TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              C   +KYVFWDS+HPTERAY I+V QIL  Y  RF
Sbjct  720   VCTHDSKYVFWDSYHPTERAYKIIVKQILDNYSSRF  755


 Score =   412 bits (1058),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/327 (61%), Positives = 242/327 (74%), Gaps = 8/327 (2%)
 Frame = -1

Query  1166  VEGVIVFGDSIVDQGMNN-NLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELG  990
             V  VIVFGDSIVD G NN N +TFARCN+ PYG+D  G MPTGR+ NGK P DFI E LG
Sbjct  44    VPAVIVFGDSIVDTGNNNENFRTFARCNFLPYGKDLKGGMPTGRYSNGKVPPDFIVEALG  103

Query  989   VKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKE  810
             +KELLPAY DP LQP D  TGV  A+GG G+DPLTA++A    LS QL  FKEY  KLK 
Sbjct  104   IKELLPAYLDPTLQPNDLLTGVVIAAGGAGYDPLTAKLAAVASLSDQLKQFKEYIEKLKG  163

Query  809   MVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQ---  639
             +VGE +TN+II+N+L +VVAG+ND+ NTYF   +R  +YD+ +Y D M++ A+DFI+   
Sbjct  164   IVGEEKTNFIIQNSLILVVAGSNDISNTYFLSGVRELEYDVPSYTDFMLKYASDFIKLXI  223

Query  638   --ELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLN  465
               +LY LGARR  +   PP GCVPSQRT+ GG  R C E+ N+ASQ+ NSKLS E+D LN
Sbjct  224   LXDLYGLGARRIGVLSAPPIGCVPSQRTVKGGIQRDCDEKQNQASQLFNSKLSMEMDHLN  283

Query  464   NKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKY--TGTCPDH  291
               LP S +VY+DIYNPLLDLI+NP  YGFEVA++GCCGTG IEVT LCN+    G C D 
Sbjct  284   KNLPNSRVVYIDIYNPLLDLIKNPAKYGFEVANKGCCGTGTIEVTKLCNQLQPAGVCIDD  343

Query  290   NKYVFWDSFHPTERAYGILVHQILQKY  210
             +KYVFWDS+HPT+RAY I+V QIL  Y
Sbjct  344   SKYVFWDSYHPTKRAYKIIVKQILDNY  370



>ref|XP_010428638.1| PREDICTED: GDSL esterase/lipase EXL1-like [Camelina sativa]
Length=374

 Score =   412 bits (1060),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 251/351 (72%), Gaps = 1/351 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L     F +LL      A +KLP    V  VIVFGDSIVD G N+++ T ARC+Y PYG 
Sbjct  23    LFWRTFFLVLLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGI  82

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G + TGRF NGK P D +AEELG+K  +PAY DPNL+PED  TGV+FASGG G+ PL
Sbjct  83    DFDGGVATGRFSNGKVPGDILAEELGIKPNIPAYRDPNLKPEDLLTGVTFASGGAGYVPL  142

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T ++A  I L  QL YF+EY  +LK MVGE +T +II+N+LFVVV G+ND+ N +F+LP 
Sbjct  143   TTKLAGGISLPQQLKYFEEYIARLKAMVGEERTQFIIKNSLFVVVCGSNDIANDFFALPP  202

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              +  Y ++++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  203   VQLHYTVDSFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVA  262

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
             ++N+AS++ NSKLSA ID+L+  L   TI+Y+DIY+PLLDLI +PQ YGF+V D+GCCGT
Sbjct  263   KFNDASKLFNSKLSANIDALSTTLQDPTIIYIDIYSPLLDLILSPQQYGFKVGDKGCCGT  322

Query  347   GVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G+IEVT LCN YT   CP  + YVFWDSFHPTE+AY I+V ++  KY  RF
Sbjct  323   GLIEVTALCNNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  373



>ref|XP_006302332.1| hypothetical protein CARUB_v10020390mg, partial [Capsella rubella]
 gb|EOA35230.1| hypothetical protein CARUB_v10020390mg, partial [Capsella rubella]
Length=408

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/351 (57%), Positives = 250/351 (71%), Gaps = 1/351 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L     F +LL      A +KLP   VV  VIVFGDSIVD G N+++ T ARC+YPPYG 
Sbjct  57    LFWCTCFLVLLFTTTTNALVKLPENTVVPAVIVFGDSIVDAGNNDDMITEARCDYPPYGI  116

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G + TGRF NGK P D +AEE G+K  +PAY DPNL+PED  TGV+FASGG G+ PL
Sbjct  117   DFDGGVATGRFSNGKVPGDIVAEEFGIKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPL  176

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T +IA  I L  QL YF+EY  KLK MVGE +T +II+N+LFVV++G+ND+ N +F+LP 
Sbjct  177   TTKIAGGISLPQQLKYFEEYIAKLKGMVGEERTKFIIKNSLFVVISGSNDIANDFFALPP  236

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              +  Y I ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  237   VQLHYTIASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVA  296

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              +N+ +++ N+KLSA ID L+  L   TI+Y+DIYNPLLDLI  PQ YGF+VA++GCCGT
Sbjct  297   RFNDGAKLFNTKLSANIDVLSRTLQAPTIIYIDIYNPLLDLILYPQQYGFKVANKGCCGT  356

Query  347   GVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G+IEVT LCN YT   CP  + YVFWDSFHPTE+AY I+V ++  KY+ RF
Sbjct  357   GLIEVTALCNNYTAAVCPRRSDYVFWDSFHPTEKAYRIIVAKLFDKYLDRF  407



>ref|XP_008242093.1| PREDICTED: GDSL esterase/lipase EXL3-like [Prunus mume]
Length=366

 Score =   412 bits (1058),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 251/346 (73%), Gaps = 1/346 (0%)
 Frame = -1

Query  1232  VFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGE  1053
             +F ++L      A + LP    +  VIVFGDSIVD G NNN++T  +CN+PPYG+DF G 
Sbjct  20    LFIIVLFLYHNAAAVTLPENETIPAVIVFGDSIVDPGNNNNIRTIVKCNFPPYGRDFTGR  79

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
              PTGRF NG+ PSD IAE +GVK +LPAY DP+L+ +D  TGVSFASGG G+DPLT Q+ 
Sbjct  80    KPTGRFSNGRVPSDLIAESVGVKNILPAYLDPSLKVQDLLTGVSFASGGTGYDPLTPQVV  139

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
             + + LS QL+ FK+Y  K+   VGE +T  I+  ++++V  G++D+ NTY+S P+RR +Y
Sbjct  140   SVLSLSDQLDLFKKYLSKINAAVGEARTATILSKSIYIVCLGSDDIANTYYSTPLRRPQY  199

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             DI AY DLMI+ A+ F QELYDLGARR  I  +P  GCVPSQRTL GG  R C +  N+A
Sbjct  200   DIPAYTDLMIKSASSFFQELYDLGARRIGILSLPAIGCVPSQRTLNGGIDRGCSDNANQA  259

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             + + NSKL+A+ID+ N +LP++ +VY+DIYN LL LIQ P  YG EV ++GCCGTG IEV
Sbjct  260   ASLFNSKLTAQIDAFNKRLPEARLVYLDIYNILLSLIQKPSQYGLEVVNKGCCGTGNIEV  319

Query  332   TFLCNKY-TGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             + LC +Y TGTC D +KY+FWDS+HPTE+AY +LV  +  K V++F
Sbjct  320   SILCTRYSTGTCKDPSKYLFWDSYHPTEKAYKVLVPLVFDKQVHKF  365



>ref|XP_007136104.1| hypothetical protein PHAVU_009G018100g [Phaseolus vulgaris]
 gb|ESW08098.1| hypothetical protein PHAVU_009G018100g [Phaseolus vulgaris]
Length=362

 Score =   411 bits (1057),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 254/346 (73%), Gaps = 4/346 (1%)
 Frame = -1

Query  1223  MLLLGRRC---EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNL-QTFARCNYPPYGQDFAG  1056
             ML+L   C   +  +KLPP   V  V+VFGDSI+D G NNN  QT A+CN+PPYG+DF G
Sbjct  16    MLILTMVCWKTKGAVKLPPNFRVPAVLVFGDSIMDTGNNNNNTQTLAKCNFPPYGRDFQG  75

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
              +PTGRF NGK PSD IAEELG+K+LLPAYFDPNLQP D  TGV FASGG G+DPLT+++
Sbjct  76    AIPTGRFGNGKVPSDLIAEELGIKDLLPAYFDPNLQPNDLLTGVCFASGGSGYDPLTSKM  135

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
             ATAI LS Q++ F+EY  KL+E+VGE++T +I+ N++ +VV G+ND+ NTYF    R  +
Sbjct  136   ATAISLSGQIDMFREYIRKLEELVGEDRTKFILANSIVLVVEGSNDISNTYFLSHAREVQ  195

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
             YDI  Y DLM+  AA F++E+Y LGARR  +F  PP GCVP QRT+ GG  + C E+YN+
Sbjct  196   YDIPTYTDLMVSSAASFLKEIYQLGARRIGVFSAPPIGCVPFQRTILGGIEKKCAEKYND  255

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+++ N KL+ E+ SLN  LP + +VY+D+Y+PLLD+I N QNYGF+V DRGCCGTG IE
Sbjct  256   AAKLFNDKLAKELASLNRNLPHARMVYLDVYSPLLDIIVNYQNYGFKVGDRGCCGTGKIE  315

Query  335   VTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
                 CN    TC +   YVFWDSFHP+E  Y  LV  IL+KY+Y+F
Sbjct  316   SAVFCNPLDTTCQNVGDYVFWDSFHPSENVYRKLVPPILKKYLYQF  361



>ref|XP_008350488.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=379

 Score =   412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 239/334 (72%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNN-NLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A +KLP  V +  VIVFGDSIVD G NN N  TFARCN+ PYG+D  G MPTGR+ NGK 
Sbjct  45    ATVKLPENVTIPAVIVFGDSIVDTGNNNKNFVTFARCNFLPYGKDLKGGMPTGRYSNGKV  104

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDFI E  G+KELLPAY DP LQP D  TGV  A+G  G+DPLTA++     LS Q   
Sbjct  105   PSDFIVEAFGIKELLPAYLDPTLQPNDLLTGVVXANGAXGYDPLTAKLGVVASLSDQXKQ  164

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK +VGE +TN+II+N+L  VVAG+ND+  TYF    RR +YD+ +Y D M++
Sbjct  165   FKEYIEKLKGIVGEEKTNFIIKNSLIFVVAGSNDISXTYFLTGARRLEYDVPSYTDFMLK  224

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+DF+++LY LG RR  +   PP GCVPSQRT+ GG  R C E  N+A Q+ NSKL+ E
Sbjct  225   HASDFVKDLYGLGVRRIGVLSAPPIGCVPSQRTVNGGIERDCDERQNQACQLFNSKLNVE  284

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             +D LN  LP S +VY+DIYNPLLD+I+NP  YGFEVA++GCCGTG+IEVT LCN+    C
Sbjct  285   MDRLNKXLPNSRVVYIDIYNPLLDIIKNPAKYGFEVANKGCCGTGLIEVTKLCNQLQXVC  344

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D + YVFWDS+HPTE AY I+V Q+L  Y  RF
Sbjct  345   TDDSNYVFWDSYHPTETAYKIIVKQMLNNYSSRF  378



>ref|XP_008387915.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=379

 Score =   411 bits (1057),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 239/334 (72%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNN-NLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A +KLP  V +  VIVFGDSIVD G NN N  TFARCN+ PYG+D  G MPTGR+ NGK 
Sbjct  45    ATVKLPENVTIPAVIVFGDSIVDTGNNNKNFVTFARCNFLPYGKDLKGGMPTGRYSNGKV  104

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDFI E  G+KELLPAY DP LQP D  TGV  A+G  G+DPLTA++     LS Q   
Sbjct  105   PSDFIVEAFGIKELLPAYLDPTLQPNDLLTGVVXANGAXGYDPLTAKLGVVASLSDQXKQ  164

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK +VGE +TN+II+N+L  VVAG+ND+  TYF    RR +YD+ +Y D M++
Sbjct  165   FKEYIEKLKGIVGEEKTNFIIKNSLIFVVAGSNDISXTYFLTGARRLEYDVPSYTDFMLK  224

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+DF+++LY LG RR  +   PP GCVPSQRT+ GG  R C E  N+A Q+ NSKL+ E
Sbjct  225   HASDFVKDLYGLGVRRIGVLSAPPIGCVPSQRTVNGGIERDCDERQNQACQLFNSKLNVE  284

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             +D LN  LP S +VY+DIYNPLLD+I+NP  YGFEVA++GCCGTG+IEVT LCN+    C
Sbjct  285   MDRLNKILPNSRVVYIDIYNPLLDIIKNPAKYGFEVANKGCCGTGLIEVTKLCNQLQQVC  344

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D + YVFWDS+HPTE AY I+V Q+L  Y  RF
Sbjct  345   TDDSNYVFWDSYHPTETAYKIIVKQMLDNYSSRF  378



>ref|XP_004142994.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161074.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform 1 [Cucumis 
sativus]
 gb|KGN62267.1| hypothetical protein Csa_2G346080 [Cucumis sativus]
Length=372

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 240/329 (73%), Gaps = 0/329 (0%)
 Frame = -1

Query  1184  LPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFI  1005
             +PPG  V  V +FGDSIVD G NNNL T A+CNYPPYG+DF    PTGRF NG+ PSD +
Sbjct  43    IPPGYSVPAVFIFGDSIVDTGNNNNLITQAKCNYPPYGRDFPDGRPTGRFSNGRVPSDLV  102

Query  1004  AEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYK  825
              + LG+K LLP Y DPNLQ ED  TGV+FASGG GFDPLT++ A AI L  QL  F+EY+
Sbjct  103   VDVLGIKPLLPPYADPNLQLEDLLTGVNFASGGAGFDPLTSKTAPAISLDAQLAMFREYR  162

Query  824   GKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADF  645
              K++ +VGE +  +II+N+LF+VVAG+ND+ NT++    R+ +Y+I+ Y D MIQ A+ +
Sbjct  163   KKIEGLVGEEKAKFIIDNSLFLVVAGSNDIGNTFYLARFRQGQYNIDTYTDFMIQHASAY  222

Query  644   IQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLN  465
             +++LY  GARR   F  PP GC+PSQRTLAGG  R CV EYN A+++ N KL   +  L 
Sbjct  223   VKDLYAAGARRIGFFATPPLGCLPSQRTLAGGIERGCVNEYNNAAKLFNGKLQTTLGYLQ  282

Query  464   NKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCPDHNK  285
               LP S +VYVDIYNPLLD+IQN   YGFEV D+GCCGTG IEVTFLCNK+  TCPD  K
Sbjct  283   TILPDSRVVYVDIYNPLLDVIQNYAKYGFEVVDKGCCGTGTIEVTFLCNKFVKTCPDTTK  342

Query  284   YVFWDSFHPTERAYGILVHQILQKYVYRF  198
             YVFWDSFHP+E  Y +LV  I+++Y+  F
Sbjct  343   YVFWDSFHPSEATYNLLVSPIIKRYISSF  371



>ref|XP_004238377.2| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum lycopersicum]
Length=393

 Score =   412 bits (1058),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 193/331 (58%), Positives = 245/331 (74%), Gaps = 3/331 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             I LPP   +  V VFGDSIVD G NN L+T A+ NYPPYG+DF G +PTGRF NGK PSD
Sbjct  65    ISLPPNKSIPAVFVFGDSIVDTGNNNGLKTIAKVNYPPYGKDFMGGIPTGRFSNGKVPSD  124

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
             F+ EELG+K+LLPAY DP LQ ED  TGV+FASGG G+DPLT+++A  I L  Q+  FKE
Sbjct  125   FLVEELGIKDLLPAYLDPTLQSEDLITGVNFASGGAGYDPLTSELAKVISLDGQVILFKE  184

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  KL E+VGE++ N I+ N+LF++V G ND+ NTYF +P+R+  YD+ +YADL++  A+
Sbjct  185   YIVKLTELVGEDRKNEILANSLFMLVTGANDITNTYFGMPLRKSYYDVPSYADLLVNFAS  244

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
              F+Q+LY LGARR  +FGIPP GC+PSQRTL GG+ R CV+  N+A+++ N+KL A   S
Sbjct  245   SFVQDLYGLGARRIGMFGIPPIGCLPSQRTLKGGEERQCVDNLNQAAKLFNNKLEAYSSS  304

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCPDH  291
               NKLP S +VYVD YN LLD+I NPQ YGF++ D+GCCGTG IEV  LC   T TC   
Sbjct  305   QGNKLPNSRLVYVDTYNVLLDVIDNPQRYGFKITDKGCCGTGKIEVAELC---TYTCSSD  361

Query  290   NKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               Y+FWDSFH TE+AY +LVHQIL +++  F
Sbjct  362   TDYIFWDSFHLTEKAYRLLVHQILVQHLNSF  392



>ref|XP_011083479.1| PREDICTED: uncharacterized protein LOC105166004 [Sesamum indicum]
Length=704

 Score =   422 bits (1084),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 196/380 (52%), Positives = 271/380 (71%), Gaps = 14/380 (4%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L+  ++FP+L+     EA   +P    +  VI+FGDS+VD G NN ++T  + NYPPYG+
Sbjct  4     LLFKLLFPVLVC--IAEAVTTMPQNSTIPAVIMFGDSVVDTGNNNYIETVVKVNYPPYGK  61

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G  PTGRFC+GK PSD I EELG+K+LLPAYFDP L  +D  TGV+FASGG G+DPL
Sbjct  62    DFIGGRPTGRFCDGKVPSDLIVEELGIKDLLPAYFDPTLHAQDLLTGVNFASGGAGYDPL  121

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T+ + + + LS QL  FK+Y  KL+ + G  +T  I++  LFVVVAG+ND+ NTYF  P+
Sbjct  122   TSHLVSVLSLSDQLRMFKDYTTKLELIAGHEKTMTILQEGLFVVVAGSNDITNTYFGTPL  181

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             R+  YD+++Y DL++  A++F+QELY LGARR  +FG+PP GC+PSQRTL GG  R C++
Sbjct  182   RKSHYDVSSYTDLLVAYASNFVQELYKLGARRIGVFGLPPLGCLPSQRTLKGGAERKCID  241

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              YN+ +++ N+KLSAE+DS+N + P++ +VY+DIYN  LDLI++PQ YGF+++D+GCCGT
Sbjct  242   IYNQVAELFNNKLSAEVDSINARYPEARVVYIDIYNLPLDLIRSPQKYGFKISDKGCCGT  301

Query  347   GVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA*TNCTSTNS  168
             G IEV FLC KY  TC D + YVFWDSFH TE+AY +LVHQIL+K +           N 
Sbjct  302   GTIEVAFLC-KY--TCSDVSDYVFWDSFHLTEKAYRLLVHQILKKSIREL-----RLANK  353

Query  167   LPQHWTRIYSS*EQLYVLVC  108
             +P  W +++      + L+C
Sbjct  354   MPFLWLKLF----HFFALLC  369


 Score =   415 bits (1067),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 187/333 (56%), Positives = 253/333 (76%), Gaps = 3/333 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A I LP  + +  +IVFGDSIVD G NN ++T A+ N+PPYG+DF G  PTGRF + K P
Sbjct  373   AVIHLPHNITIPALIVFGDSIVDTGNNNYIKTIAKANFPPYGKDFVGGKPTGRFSDAKVP  432

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD IAEELG+K LLPAY DP+LQP+D  TGV+FASG  GFDPLT+ +A+ + L+ QL  F
Sbjct  433   SDLIAEELGIKPLLPAYLDPSLQPQDLLTGVNFASGAAGFDPLTSDLASVLSLTDQLALF  492

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             K+Y  KLK++ GE +++ I++ +L ++VAG+ND+ NTYF  P+R+  YD+ +Y DL++  
Sbjct  493   KDYITKLKKIAGEERSSKILQESLVILVAGSNDITNTYFGTPLRQSHYDVPSYTDLLVSY  552

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F+Q+LY LGARR  +  +PP GC+PSQRTL GG +R CV+EYN+ +Q+ N KLSA +
Sbjct  553   ASSFVQDLYRLGARRIGLLRLPPIGCLPSQRTLRGGPARNCVDEYNQVAQLFNKKLSAAL  612

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCP  297
             +S+N + P++ +V +DIYN  LDLIQNPQ YGF++AD+GCCGTG +EV FLC KY   CP
Sbjct  613   NSINRQFPEARLVDIDIYNYFLDLIQNPQKYGFKIADKGCCGTGTVEVAFLC-KY--ACP  669

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             D + YVFWDSFHPTER Y ++VHQIL++Y+  F
Sbjct  670   DVSDYVFWDSFHPTERTYRLIVHQILEQYINSF  702



>ref|XP_009334750.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=362

 Score =   410 bits (1053),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 191/333 (57%), Positives = 247/333 (74%), Gaps = 2/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNN-NLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPS  1014
             +KLP    +  V +FGDSIVD G NN NL+T ARCN+PPYG++F G + TGR+ NGK PS
Sbjct  29    VKLPSNATIPAVFMFGDSIVDTGNNNVNLKTPARCNFPPYGREFEGGISTGRYSNGKVPS  88

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D I E+LG+KELLPAY DPNLQP D  TGVSFA G  G+DP+TAQI    PLS QL  F+
Sbjct  89    DLIVEKLGIKELLPAYLDPNLQPNDLLTGVSFAVGATGYDPMTAQIVAVTPLSDQLRQFE  148

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EY GKLK +VGE + N+I+ N+L  VVA +ND+ NTYF   +R+ +YD+ +Y DLM+  A
Sbjct  149   EYIGKLKGIVGEERANFILANSLCFVVASSNDIANTYFVAGVRKLEYDVPSYTDLMLNHA  208

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
             +DF + LY LGARR  +F  PP GC+PSQRTL GG  R C ++ N+A+ + NSKLSAE+D
Sbjct  209   SDFFKGLYALGARRIGVFSAPPIGCLPSQRTLGGGVERDCADKPNQAAMLFNSKLSAELD  268

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
              L N LP S ++YVDIYNPLLD+I NP NYGFEV+++GCCG+G +EV+ LCN++   TC 
Sbjct  269   DLKNNLPNSMLIYVDIYNPLLDMIINPTNYGFEVSNKGCCGSGKLEVSILCNRFDPETCT  328

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             D + Y+FWDS+HPTE AY I+V +++ KY+ R 
Sbjct  329   DDSHYLFWDSYHPTEGAYKIIVDELITKYLPRL  361



>emb|CDX85928.1| BnaC06g22060D [Brassica napus]
Length=374

 Score =   410 bits (1053),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 253/351 (72%), Gaps = 1/351 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L + + F +LL      A +KLP    V  +IVFGDSIVD G N++L T ARC+YPPYG 
Sbjct  23    LCLCISFLVLLFTTNTNALVKLPENTTVPAIIVFGDSIVDAGNNDDLITEARCDYPPYGI  82

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G +PTGRF NGK P+D +AEELG+K  +PAY DPNL+ ED  TGV+FASGG G+ PL
Sbjct  83    DFDGGVPTGRFSNGKVPTDILAEELGIKPTIPAYRDPNLRQEDLLTGVTFASGGAGYVPL  142

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T QIA  IPLS QL +F+EY  KL  MVG+ +T +II N+LFV++ G+ND+ N +FSLP 
Sbjct  143   TTQIAGGIPLSQQLKFFEEYIEKLNGMVGQERTTFIITNSLFVIICGSNDIANNFFSLPT  202

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              + +Y++ ++  LM   A  F + LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  203   AQLQYNVASFTALMADNARSFARTLYQYGARRILMFGAPPIGCVPSQRTVAGGPTRDCVV  262

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              +N+A ++ N+KLSA ID L+  L  +T++Y+DIY+PLLDLI  PQ YGF+V++ GCCGT
Sbjct  263   RFNDACKLFNAKLSANIDGLSRTLQDTTLIYIDIYDPLLDLILYPQQYGFKVSNLGCCGT  322

Query  347   GVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G IEVT LCN YT   CP  + YVFWDSFHPTE AY  +V ++LQ+Y+ RF
Sbjct  323   GFIEVTALCNNYTAAVCPVRSDYVFWDSFHPTETAYRNIVAKLLQRYLNRF  373



>gb|KFK42027.1| hypothetical protein AALP_AA2G202600 [Arabis alpina]
Length=367

 Score =   409 bits (1051),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 197/342 (58%), Positives = 249/342 (73%), Gaps = 3/342 (1%)
 Frame = -1

Query  1220  LLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTG  1041
             LL      A + +P  + V  VIVFGDSIVD G N+++ T ARCNYPPYG DF G +PTG
Sbjct  27    LLFMTTTNALVNIPDNISVPAVIVFGDSIVDAGNNDDMITEARCNYPPYGIDFDGGVPTG  86

Query  1040  RFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIP  861
             RF NGK P+D +AEELG+K  LPAY DPNL+ E+  TGV+FASGG G+ PLT +IA  I 
Sbjct  87    RFSNGKVPTDMLAEELGIKPTLPAYRDPNLKQEELLTGVTFASGGAGYVPLTTKIAGGIS  146

Query  860   LSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINA  681
             L  QL  F EY  +LK MVGE +T  IIEN+LFVV+ G+ND+ N +F+LP  ++KYD+ +
Sbjct  147   LPQQLKLFDEYLERLKGMVGEERTKIIIENSLFVVICGSNDIANNFFALP--QFKYDVAS  204

Query  680   YADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIV  501
             +  LM   A  F   LY  GARR ++FG PP GCVPSQRT+AGG  R CV  +N+A ++ 
Sbjct  205   FTALMADNARSFATTLYGYGARRILVFGAPPLGCVPSQRTVAGGPRRECVVRFNDACKLF  264

Query  500   NSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLC  321
             N+KLSA ID L+  L  ST++Y+DIY PLLDLI NPQ YGF+V+++GCCGTG+IEVT LC
Sbjct  265   NTKLSANIDGLSRTLHDSTLLYIDIYTPLLDLILNPQQYGFKVSNKGCCGTGLIEVTQLC  324

Query  320   NKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             N YT T CP  + YVFWDSFHPTERAY I+V ++L++Y+ RF
Sbjct  325   NNYTATVCPRRSDYVFWDSFHPTERAYRIIVAKLLERYLNRF  366



>ref|XP_004292937.1| PREDICTED: uncharacterized protein LOC101306013 [Fragaria vesca 
subsp. vesca]
Length=748

 Score =   422 bits (1085),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 264/355 (74%), Gaps = 4/355 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLG---RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPP  1077
             L++ V    ++LG   R  E ++++PPG  +  +I+FGDSI+D G NNNL++  +CN+PP
Sbjct  24    LLIFVCSLAMVLGHYPRITECRVQIPPGKTLPAIIIFGDSIMDTGNNNNLKSVIKCNFPP  83

Query  1076  YGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGF  897
             YGQ+F G++PTGRF NGK PSDFIA ELGVKE +P Y D +L PE+  TGV FASGG G+
Sbjct  84    YGQNFPGKVPTGRFGNGKVPSDFIAHELGVKEFVPPYADTSLTPEELSTGVCFASGGTGY  143

Query  896   DPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             DP T ++ + I LS QLN FKEY GKLK   GE +TN+I+ N+LF+VVAG++D+ NTYF+
Sbjct  144   DPQTPELVSVISLSDQLNSFKEYIGKLKANFGEERTNFILANSLFLVVAGSDDIANTYFT  203

Query  716   LPIRRYKYDINAYADLMIQGAADFIQ-ELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSR  540
             + IR+ +YD+ AY DLM+  A +F+Q +LY LGARR  +F  PP GCVPSQRTL GG  R
Sbjct  204   IGIRKAQYDVPAYTDLMVNSATNFLQVDLYALGARRFGVFSAPPIGCVPSQRTLGGGIQR  263

Query  539   ACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
              C EEYN+A+++ NSKLSA + SLN+KLP S +VY+D+Y P+LD+I  P  YG +VA++G
Sbjct  264   QCAEEYNDAAKLFNSKLSANMKSLNSKLPDSRMVYIDVYTPILDIILYPTKYGLKVANKG  323

Query  359   CCGTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             CCGTGV+EV  LC K + TC +   +VFWDS+HPTE+AY +L+  +LQKYV   +
Sbjct  324   CCGTGVLEVAILCTKLSPTCENPGDHVFWDSYHPTEQAYSVLIPPLLQKYVNHLS  378


 Score =   404 bits (1038),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 248/334 (74%), Gaps = 2/334 (1%)
 Frame = -1

Query  1193  KIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             K+KLP  V V  VI+FGDSIVD G NNN ++TFARCN+ PYG+DF G +PTGRF NGK P
Sbjct  414   KLKLPANVSVPAVIMFGDSIVDTGNNNNNMKTFARCNFLPYGKDFEGGLPTGRFSNGKVP  473

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             +D + E  G+KELLP Y D +L+P D  TGV+ A+GG G+DPLT++IA    LS QL  F
Sbjct  474   ADLLVEAFGIKELLPPYMDGSLEPNDLLTGVNLAAGGVGYDPLTSKIAAVESLSDQLEQF  533

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             KEY  KLK +VGE +TN+II N++  VV G+ND+ NTYF L  R+ ++D+ +Y D ++  
Sbjct  534   KEYIEKLKGIVGEKRTNFIISNSMIFVVIGSNDISNTYFLLGARKLQFDLPSYIDFILNH  593

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A++F +ELY LGARR  + G+P  GCVPSQRT+ GG  R C E+ N+A+++ NSKLSAE+
Sbjct  594   ASEFFKELYRLGARRIAVLGVPAIGCVPSQRTIGGGVGRDCDEKQNQAAELFNSKLSAEM  653

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTC  300
             + L + LP S   Y+D+YNPL D+I+NP  YGFEV ++GCCGTG++EVT LCNK++  TC
Sbjct  654   NHLRHTLPDSKFTYMDVYNPLQDIIKNPNKYGFEVVNKGCCGTGMLEVTILCNKWSPKTC  713

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + + YVFWDS+HPTERAY IL HQ+LQ  ++ F
Sbjct  714   SNASTYVFWDSYHPTERAYQILSHQVLQNTIHSF  747



>ref|XP_004499292.1| PREDICTED: GDSL esterase/lipase EXL1-like [Cicer arietinum]
Length=363

 Score =   409 bits (1050),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 246/333 (74%), Gaps = 0/333 (0%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNG  1026
             +  A +KLPP      V VFGDSI+D G NNN+ T +RCNYPPYG+DF G +PTGRF NG
Sbjct  28    KTNAALKLPPNTSFPAVFVFGDSIMDTGNNNNMTTPSRCNYPPYGKDFQGGIPTGRFGNG  87

Query  1025  KTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQL  846
             K PSDF+AEELG+KE LPAY DPNLQP +  TGV+FASGG G+DPLT+++  AI +S QL
Sbjct  88    KVPSDFVAEELGIKEYLPAYLDPNLQPSELATGVNFASGGAGYDPLTSKLEAAISMSGQL  147

Query  845   NYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLM  666
             + FK+Y  KLK +VGE++ N+I+ N+LF+VV G+ND+ NTYF   +R+ +YD   Y++L+
Sbjct  148   DLFKDYIVKLKRVVGEDKANFILANSLFLVVLGSNDISNTYFLSHLRQVEYDFPTYSNLL  207

Query  665   IQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLS  486
             +  A +F +++++LGARR  +F  PP GCVP QRT+AGG  R CV++YN+AS + N+ LS
Sbjct  208   VNSAINFYKDIHELGARRIGVFNAPPMGCVPFQRTMAGGIERNCVQQYNDASTLFNNMLS  267

Query  485   AEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG  306
               I S   + P S+IVY+D+Y PLLD+I N   YG++V DRGCCGTG IEVT+LC +   
Sbjct  268   LGIHSFKERFPSSSIVYLDVYTPLLDIIINHHKYGYKVGDRGCCGTGKIEVTYLCTQLEP  327

Query  305   TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             TCP+   YVFWDSFHPTE  Y  LV  ILQKY+
Sbjct  328   TCPNDLDYVFWDSFHPTESVYRKLVPPILQKYM  360



>ref|XP_010664850.1| PREDICTED: uncharacterized protein LOC100264374 [Vitis vinifera]
Length=713

 Score =   421 bits (1081),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/354 (56%), Positives = 258/354 (73%), Gaps = 7/354 (2%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +KLP    +  V+VFGDSIVD G NNNL T  +CN+PPYG+DF G  PTGRF NGK 
Sbjct  24    EALVKLPRNETIPAVLVFGDSIVDPGNNNNLITVVKCNFPPYGRDFMGGFPTGRFSNGKI  83

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P DFIAEELG+KELLP Y +P LQ  D  TGVSFAS G G+DP+T ++A+ + L  QL  
Sbjct  84    PPDFIAEELGIKELLPPYSNPALQLSDLLTGVSFASSGSGYDPMTPKLASVLSLRDQLEM  143

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK MVGE +TN I+  +LF+VVAG++D+ N+YF   +R+ +YD+ AY DLMI 
Sbjct  144   FKEYIRKLKMMVGEERTNTILSKSLFLVVAGSDDIANSYFVSGVRKIQYDVPAYTDLMIA  203

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F +ELY LGARR V+   PP GC+PSQR+LAGG  R C E++N+A+++ N+KLS++
Sbjct  204   SASSFFKELYGLGARRIVVGSAPPLGCLPSQRSLAGGILRECAEDHNDAAKLFNTKLSSQ  263

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +DSLN   PQ+  VY+DIYNP LDLIQNPQ  GFEV D+GCCGTG IEV  LCN ++  T
Sbjct  264   LDSLNANFPQAKFVYIDIYNPFLDLIQNPQKSGFEVVDKGCCGTGKIEVAVLCNPFSPFT  323

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA*TNCTSTNSLPQHWTRIY  141
             C D + YVFWDS+HPTE+AY +L+ +I+QKY +       TS++S+   +  ++
Sbjct  324   CEDASNYVFWDSYHPTEKAYKVLIGEIIQKYHFS------TSSSSIIVFFLSVF  371


 Score =   410 bits (1054),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 244/332 (73%), Gaps = 1/332 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +KLP    V  V+VFGDSIVD G NNNL T  + N+PPYG+D  G +PTGRF NGK 
Sbjct  378   EALVKLPRNETVPAVLVFGDSIVDPGNNNNLNTLVKSNFPPYGRDLMGGVPTGRFSNGKI  437

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDFIAE LG+KEL+P Y +  LQ  D  TGVSFAS G GFDP+T ++A+ + L  QL  
Sbjct  438   PSDFIAEALGIKELVPPYSNAALQLGDLLTGVSFASSGSGFDPMTPKLASVLSLRDQLEM  497

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK MVG  +TN I+  +LF+VVAG++D+ N+YF   +++++YD+ AY DLM+ 
Sbjct  498   FKEYIRKLKRMVGVERTNTILSKSLFLVVAGSDDIANSYFDSRVQKFQYDVPAYTDLMVT  557

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              AA F++ELY LGARR V+   PP GC+PSQR+LAGG  R C E +NEA+++ N KLS+ 
Sbjct  558   SAASFLKELYGLGARRTVVTSAPPLGCLPSQRSLAGGTQRECAEGHNEAAKLFNFKLSSR  617

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +DSLN   PQ+  VYVDIY PLLDLIQNPQ  GFEV D+GCCG+G IEV  LCN+ +  T
Sbjct  618   LDSLNANFPQAKFVYVDIYKPLLDLIQNPQKSGFEVVDKGCCGSGTIEVAVLCNQLSPFT  677

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             C D + YVFWDS+HPTERAY +++ +I+QK V
Sbjct  678   CEDASTYVFWDSYHPTERAYKVIIDEIIQKCV  709



>ref|XP_003589529.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES59780.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=358

 Score =   408 bits (1048),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 248/350 (71%), Gaps = 3/350 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L ++++F +     + +A +KLPP      V VFGDSI+D G NNN  T  +C +PPYG+
Sbjct  11    LFLTMLFAIF---SKTKAILKLPPNASFPAVFVFGDSIMDTGNNNNRPTPTQCKFPPYGK  67

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G +PTGRF NGK P+D I EELG+KE LPAY DPNLQP +  TGV+FASGG G+DPL
Sbjct  68    DFQGGIPTGRFSNGKVPADLIVEELGIKEYLPAYLDPNLQPSELVTGVNFASGGAGYDPL  127

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T++I  AI +S Q+  FKEY  KLK +VGE++TN+I+ N+++ V+ G+ND+ NTYF    
Sbjct  128   TSKIEAAISMSAQIELFKEYIVKLKGIVGEDRTNFILANSIYFVLVGSNDISNTYFLFHA  187

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             R+  YD  +Y+DL++  A +F +E+Y LGARR  +F +PP GCVP QRT+AGG +R CV+
Sbjct  188   RQVNYDFPSYSDLLVDSAYNFYKEMYQLGARRIGVFNVPPIGCVPFQRTVAGGITRKCVQ  247

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              YN+A    N KLS +IDS     P S IVY+D+YNP+LD+I N Q YGF+V DRGCCGT
Sbjct  248   HYNDAVVFFNKKLSMKIDSFKQNFPSSRIVYMDVYNPILDIIVNYQKYGFKVVDRGCCGT  307

Query  347   GVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G IEV FLCN    TC + + YVFWD+FHPTE  Y ILV   LQKY+Y F
Sbjct  308   GEIEVIFLCNHLEPTCVNDSDYVFWDAFHPTEAVYKILVALSLQKYMYNF  357



>emb|CBI19913.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   407 bits (1047),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 192/332 (58%), Positives = 241/332 (73%), Gaps = 1/332 (0%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             I LP       V+VFGDSIVD G NNNL T  +CN+PPYG+DF G  PTGRF NGK P D
Sbjct  14    IFLPRNETFPAVLVFGDSIVDPGNNNNLSTVVKCNFPPYGRDFVGGFPTGRFSNGKIPPD  73

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
             FIAEELG+K LLP Y  P+LQ  D  TGVSFAS G GFDPLT ++ + + L  QL  FKE
Sbjct  74    FIAEELGIKNLLPPYSSPSLQLGDLLTGVSFASSGSGFDPLTPKLVSVLSLRDQLGMFKE  133

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y GKLK MVGE +TN I+  +LF+VVAG++D+ N+YF + +R+ +YD+ AY D M   AA
Sbjct  134   YIGKLKVMVGEERTNTILSKSLFLVVAGSDDIANSYFVIGVRKRQYDVPAYTDFMATSAA  193

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
              F++ELY LGARR  +   PP GC+PSQR+LAGGK R C E++NEA+++ N+KLS+++DS
Sbjct  194   SFLKELYGLGARRIGVASAPPLGCLPSQRSLAGGKQRECAEDHNEAAKLFNTKLSSQLDS  253

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPD  294
             LN   PQ+  VY+DIY P LDLIQNPQ  GFEV D+GCCGTG IE   LC+  +  TC D
Sbjct  254   LNANSPQAKFVYIDIYKPFLDLIQNPQKSGFEVVDKGCCGTGRIEAAALCSLLSSFTCED  313

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + YVFWDS+HPTERAY +++ +I+QK V  F
Sbjct  314   ASNYVFWDSYHPTERAYKVIIEKIIQKCVDGF  345



>gb|KFK42028.1| hypothetical protein AALP_AA2G202700 [Arabis alpina]
Length=369

 Score =   408 bits (1048),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 249/348 (72%), Gaps = 2/348 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYG  1071
             L   V+F +L L     A +KLPP   +  +IVFGDSIVD G N++ + T ARCNYPPYG
Sbjct  17    LFWFVLFLVLFLNTNTNALVKLPPNKTIPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYG  76

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
              DF G +PTGRF NGK  +D IAEE G+K  +PAY DPNL+PED  TGV+FASGG G+ P
Sbjct  77    IDFDGGVPTGRFSNGKVSTDIIAEEYGIKPSIPAYRDPNLKPEDLLTGVTFASGGGGYVP  136

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
              TAQ++  I  S QL  F+EY  KLKEMVGE +T +IIEN+LF+VV G+ND+ NTYF LP
Sbjct  137   FTAQLSGGISYSQQLKLFEEYIEKLKEMVGEERTKFIIENSLFMVVFGSNDITNTYFGLP  196

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
               + KYD+ ++  LM   A  F Q+L++ GARR  +F  PP GCVPSQRT+AGG +R CV
Sbjct  197   SVQRKYDVGSFTTLMADNARSFAQKLHEYGARRIQVFSAPPLGCVPSQRTIAGGLTRTCV  256

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
               +N+A+++ N+KL A +DSL+  L    I+Y+DIY+ LLD+I NPQ YGF+V D+GCCG
Sbjct  257   ARFNDATKLYNAKLYANLDSLSRTLRDKAIIYIDIYDSLLDIILNPQEYGFKVVDKGCCG  316

Query  350   TGVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKY  210
             TG+IEV  LCNK+T   CP  + YVFWDSFHPTE+ Y ++V +  ++Y
Sbjct  317   TGLIEVAVLCNKFTAEVCPKRDDYVFWDSFHPTEKTYRVMVAKYFKRY  364



>ref|XP_008387913.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=362

 Score =   408 bits (1048),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 190/330 (58%), Positives = 246/330 (75%), Gaps = 2/330 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNN-NLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPS  1014
             +KLPP   +  V +FGDSIVD G NN NL+T ARCN+PPYG++F G + TGR+ NGK PS
Sbjct  29    VKLPPNATIPAVFMFGDSIVDTGNNNVNLKTPARCNFPPYGREFEGGISTGRYSNGKVPS  88

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D I E+LG+KELLPAY DPNLQP D  TGVSFA G  G+DP+TAQI    PL  QL  F+
Sbjct  89    DLIVEKLGIKELLPAYLDPNLQPNDLLTGVSFAVGATGYDPMTAQIVAVTPLFDQLRQFE  148

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EY GKLK +VGE + N+I+ N+L  VVA +ND+ NTYF   +R+ +YD+ +Y DLM+  A
Sbjct  149   EYIGKLKGIVGEERANFILANSLCFVVASSNDIANTYFVAGVRKLEYDVPSYTDLMLNQA  208

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
             +DF + LY LGARR  +F  PP GC+PSQRTL GG  R C ++ N+A+ + NSKLSAE+D
Sbjct  209   SDFFKGLYALGARRIGVFSAPPIGCLPSQRTLGGGVERDCADKPNQAAMLFNSKLSAELD  268

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
              L N LP S ++YVDIYNPLLD+I NP NYGFEV+++GCCG+G +EV+ LCN++   TC 
Sbjct  269   DLKNNLPNSMLIYVDIYNPLLDMIINPTNYGFEVSNKGCCGSGKLEVSILCNRFEPETCT  328

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             D + Y+FWDS+HPTE AY I+V +++ KY+
Sbjct  329   DDSHYLFWDSYHPTEGAYKIIVDELITKYL  358



>ref|XP_004499298.1| PREDICTED: GDSL esterase/lipase EXL1-like [Cicer arietinum]
Length=362

 Score =   407 bits (1047),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 193/347 (56%), Positives = 247/347 (71%), Gaps = 0/347 (0%)
 Frame = -1

Query  1238  SVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFA  1059
             +++  ++L   +  A I+LPP V +  V+VFGDSI+D G NN + T  R N+ PYG+DF 
Sbjct  15    TLICTIILFCLKTNAIIQLPPNVSIPAVLVFGDSIMDTGNNNYILTPGRSNFAPYGKDFQ  74

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G + TGRF NGK PSD I EELG+KE LP Y +PNL   +  TGV FASGG G+D LT+Q
Sbjct  75    GGIATGRFSNGKVPSDLIVEELGIKEYLPPYLNPNLTFNELTTGVCFASGGAGYDHLTSQ  134

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             +  AIPL+ QL+YFKEY  KL   VGEN+TN+I+ N++F +V G+ND+ NTYF   +R+ 
Sbjct  135   LEFAIPLTKQLDYFKEYIEKLNVYVGENRTNFILANSIFFLVMGSNDISNTYFLSHVRKL  194

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             KYD  +YADL++  A++F +E+Y+LGARR  IF  PP GCVP QRTL GGK R+CVE+YN
Sbjct  195   KYDFPSYADLLVNIASNFTKEIYELGARRIGIFNAPPIGCVPMQRTLDGGKERSCVEKYN  254

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
              A+ + N KL  EI SLN  L  S IVY D+Y PLLD+I N   YGF VADRGCCGTG +
Sbjct  255   NATTLFNDKLFKEIGSLNQNLSNSKIVYFDVYTPLLDIIVNNHKYGFTVADRGCCGTGKV  314

Query  338   EVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             EV FLCN++  TC +  +YVFWDSFHPTE  Y  LV  +LQKY+ +F
Sbjct  315   EVAFLCNRFEDTCSNDTEYVFWDSFHPTEATYKNLVASLLQKYITQF  361



>ref|XP_010471732.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X2 [Camelina 
sativa]
 ref|XP_010471735.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X2 [Camelina 
sativa]
 ref|XP_010471738.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X2 [Camelina 
sativa]
Length=373

 Score =   408 bits (1048),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 249/351 (71%), Gaps = 2/351 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L     F +LL      A +KLP    V  VIVFGDSIVD G N+++ T ARC+Y PYG 
Sbjct  23    LFWCTFFLVLLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGI  82

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G + TGRF NGK P D I EELG+K  +PAY DPNL+PED  TGV+FASGG G+ PL
Sbjct  83    DFDGGVATGRFSNGKVPGD-IVEELGIKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPL  141

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T ++A  IPL  QL YF++Y  KLK MVGE +T +II+N+LFVV+ G+ND+ N +F+LP 
Sbjct  142   TTKLAGGIPLPQQLKYFEQYIAKLKAMVGEERTQFIIKNSLFVVICGSNDIANDFFALPP  201

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              +  Y + ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  202   VQLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVA  261

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              +N+AS++ NSKLSA ID+L+  L   TI+Y+DIY+PLLDLI +PQ YGF+V D+GCCGT
Sbjct  262   RFNDASKLFNSKLSANIDALSTTLQDPTIIYIDIYSPLLDLILSPQQYGFKVGDKGCCGT  321

Query  347   GVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G+IEVT LCN YT   CP  + YVFWDSFHPTE+AY I+V ++  KY  RF
Sbjct  322   GLIEVTALCNNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  372



>ref|XP_007160641.1| hypothetical protein PHAVU_001G004500g [Phaseolus vulgaris]
 gb|ESW32635.1| hypothetical protein PHAVU_001G004500g [Phaseolus vulgaris]
Length=374

 Score =   408 bits (1048),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 192/338 (57%), Positives = 245/338 (72%), Gaps = 1/338 (0%)
 Frame = -1

Query  1208  RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNN-NLQTFARCNYPPYGQDFAGEMPTGRFC  1032
              +  A +KLPP V V  V VFGDSI+D G NN NL T ARCNYPPYG+DF G +PTGRF 
Sbjct  36    EKTRAVVKLPPNVSVPAVFVFGDSIMDTGNNNKNLATTARCNYPPYGKDFKGGIPTGRFS  95

Query  1031  NGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLST  852
             NGK PSDFI EELG+KE LPAY D NL+P +  TGV FASGG G+DPLTAQ +  I LS 
Sbjct  96    NGKVPSDFIVEELGIKEFLPAYLDSNLEPGELVTGVCFASGGAGYDPLTAQTSLTISLSG  155

Query  851   QLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYAD  672
             QL+ F+EY GKL+ +VGE++  +I+ N+L++VV G+ND+ NTYF   +R+ +YD  AYAD
Sbjct  156   QLDLFREYIGKLEGIVGEDKAKFILGNSLYIVVLGSNDISNTYFLTRVRQLQYDFPAYAD  215

Query  671   LMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSK  492
              M+  A+ F++E+Y  GARR  +F +PP G +PSQRT+AGG  R  V + N+A QI N+K
Sbjct  216   FMLSSASTFLKEIYGKGARRIAVFSVPPLGYLPSQRTIAGGIQRDVVVKINDAVQIFNTK  275

Query  491   LSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKY  312
             LS ++DSL +  P S +VY+D+YNPLLD+I N Q YG++V D+GCCGTG IEV  LCN  
Sbjct  276   LSKKLDSLQHNFPDSRMVYIDVYNPLLDIIVNYQRYGYKVGDKGCCGTGTIEVVLLCNHL  335

Query  311   TGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             T  CP+   YVFWDSFHPTE  Y  L+  I+ KY+ +F
Sbjct  336   TPLCPNDLDYVFWDSFHPTESVYKKLIAPIIGKYINKF  373



>ref|NP_974149.1| GDSL esterase/lipase EXL1 [Arabidopsis thaliana]
 gb|AAO42232.1| putative family II extracellular lipase 1 (EXL1) [Arabidopsis 
thaliana]
 gb|AAO50559.1| putative family II extracellular lipase 1 (EXL1) [Arabidopsis 
thaliana]
 gb|AEE35769.1| GDSL esterase/lipase EXL1 [Arabidopsis thaliana]
Length=374

 Score =   408 bits (1048),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 195/353 (55%), Positives = 256/353 (73%), Gaps = 3/353 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLG--RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPY  1074
             ++   +F ++LL       A +K+P    V  VIVFGDSIVD G N+++ T ARC+Y PY
Sbjct  21    ILFWCIFVLVLLSTTSTTNALVKIPKNTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPY  80

Query  1073  GQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFD  894
             G DF G + TGRF NGK P D +AEELG+K  +PAY +PNL+PE+  TGV+FASGG G+ 
Sbjct  81    GIDFDGGVATGRFSNGKVPGDIVAEELGIKPNIPAYRNPNLKPEELLTGVTFASGGAGYV  140

Query  893   PLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSL  714
             PLT +IA  IPL  QL YF+EY  KLK+MVGE +T +II+N+LFVV+ G+ND+ N +F+L
Sbjct  141   PLTTKIAGGIPLPQQLIYFEEYIEKLKQMVGEKRTKFIIKNSLFVVICGSNDIANDFFTL  200

Query  713   PIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRAC  534
             P  R  Y + ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R C
Sbjct  201   PPVRLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDC  260

Query  533   VEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCC  354
             V  +N+A+++ N+KLSA ID L+  L   TI+Y+DIY+PLLDLI NP  YGF+VA++GCC
Sbjct  261   VARFNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSPLLDLILNPHQYGFKVANKGCC  320

Query  353   GTGVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             GTG+IEVT LCN YT + CP  + YVFWDSFHPTE+AY I+V ++L +Y+ RF
Sbjct  321   GTGLIEVTALCNNYTASVCPIRSDYVFWDSFHPTEKAYRIIVAKLLDRYLNRF  373



>ref|XP_010266839.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nelumbo nucifera]
Length=688

 Score =   419 bits (1076),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 192/335 (57%), Positives = 249/335 (74%), Gaps = 1/335 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +A++ LP    V  +IVFGDSIVD G NNNL T  +CN+ PYG+DF G +PTGRF NGK 
Sbjct  353   DARLTLPYNATVPALIVFGDSIVDSGNNNNLATLVKCNFSPYGKDFMGGIPTGRFSNGKI  412

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA+ LG+K+LLPAY DPNL+ ED  TGV+FASGG GFDPLT ++A  + LS QL  
Sbjct  413   PSDLIADSLGIKQLLPAYLDPNLRTEDLLTGVTFASGGTGFDPLTPKVAAVLSLSKQLEL  472

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY G+L   VGE ++  II  ++++V AG++D+ NTYF+ P R+  YD+ +Y DLM+Q
Sbjct  473   FKEYVGRLNLAVGEERSATIISESMYIVCAGSDDLANTYFTTPFRKLSYDVPSYTDLMLQ  532

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+QELY LGARR  +  IPP GCVPSQRTL GGK R+C E YNEA+++ N+KLS+E
Sbjct  533   SASSFVQELYGLGARRIGLISIPPIGCVPSQRTLGGGKDRSCAENYNEAAKLFNTKLSSE  592

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             ++SL  +LPQS +VY+D+Y  +LD+IQ PQNYGFEV ++GCCGTG IEV  LCN     T
Sbjct  593   LNSLKQQLPQSRLVYIDVYYRILDIIQRPQNYGFEVINKGCCGTGKIEVAVLCNDLDPLT  652

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D + YVFWDS+HPTE+AY  +V  +L K++  F
Sbjct  653   CLDVSNYVFWDSYHPTEKAYRSVVEPVLSKHINEF  687


 Score =   374 bits (961),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 180/323 (56%), Positives = 229/323 (71%), Gaps = 16/323 (5%)
 Frame = -1

Query  1133  VDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPN  954
             +D G NN + + A+CN+ PYG+DF G +PTGRF NGK PSDF+AE  GVKELLP Y DP+
Sbjct  1     MDTGNNNYIVSLAKCNFSPYGRDFVGGIPTGRFSNGKVPSDFLAEGFGVKELLPPYLDPD  60

Query  953   LQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIE  774
             LQ +D  TGV+FASGG G+DPLT+QI TAI LS QL  FKEY GKLKE VGE +T  I+ 
Sbjct  61    LQTQDLITGVNFASGGAGYDPLTSQIETAISLSKQLKLFKEYIGKLKEAVGEERTATILS  120

Query  773   NTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQ---------------  639
              +++++  G+NDV   YF  P RR  YD++A+ DL++Q A+ F+Q               
Sbjct  121   ESIYIMCVGSNDVTINYFFAPFRRPNYDVSAFTDLLLQFASTFLQVFLANFYSSSFFLLF  180

Query  638   ELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNK  459
             ELY LGARR  +F IPP GCVPSQRTLAGGK + CV+  N+A ++ N+KLS+E+ SL NK
Sbjct  181   ELYGLGARRIGVFNIPPIGCVPSQRTLAGGKHKDCVDNLNQAXEMFNAKLSSELISLTNK  240

Query  458   LPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKY  282
             L  ST+VY+D+Y+ LLD+IQ PQ+YGFE   +GCCGTG IE T LCN  +  TC + +KY
Sbjct  241   LSHSTLVYIDVYSSLLDIIQRPQDYGFEEISKGCCGTGKIEATILCNDLSPFTCKNASKY  300

Query  281   VFWDSFHPTERAYGILVHQILQK  213
             +FWDSFHPTE  Y I +  IL K
Sbjct  301   LFWDSFHPTEAGYKIYISWILNK  323



>ref|XP_009106246.1| PREDICTED: GDSL esterase/lipase EXL2 [Brassica rapa]
Length=363

 Score =   407 bits (1045),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 258/347 (74%), Gaps = 2/347 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQT-FARCNYPPYG  1071
             L + V+F +LL      A +KLP    +  +IVFGDSIVD G N+++ T  ARCNYPPYG
Sbjct  11    LFMCVLFMVLLSETITNALVKLPANKTIPAIIVFGDSIVDAGNNDDITTTLARCNYPPYG  70

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
              DF G +PTGRF NGK P+DFIAEELG+K  +PAY DP L+PED  TGV+FASGG G+ P
Sbjct  71    IDFDGGIPTGRFSNGKVPTDFIAEELGIKPSVPAYRDPTLKPEDLLTGVTFASGGAGYVP  130

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
             LT+Q++  I LS QL  F+EY  KL EMVGE +T +I++N+LF+V+ G+ND+ NTYF+LP
Sbjct  131   LTSQLSGGISLSQQLKLFEEYIEKLNEMVGEERTKFIMQNSLFMVICGSNDIANTYFALP  190

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
               + +Y+++++  LM   A  F Q+L++ GARR  +FG+PP GCVPSQRT+AGG +R+CV
Sbjct  191   SVQRQYNVDSFTTLMADKAQSFAQKLHEYGARRIQVFGVPPLGCVPSQRTVAGGPTRSCV  250

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
               +N+A+++ N+KLSA +DSL+  L ++T++Y+DIY  LLD+I +PQ YGF+V DRGCCG
Sbjct  251   GRFNDATKLYNAKLSANLDSLSRNLRENTLIYIDIYGSLLDIILDPQQYGFQVVDRGCCG  310

Query  350   TGVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQK  213
             TG+IEV  LCN +T   CP+ + +VFWDSFHPTE+ Y I+  +  ++
Sbjct  311   TGLIEVAVLCNNFTADICPNRHDHVFWDSFHPTEKTYKIMTAKYFER  357



>emb|CDX73210.1| BnaC06g36580D [Brassica napus]
Length=369

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 258/347 (74%), Gaps = 2/347 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQT-FARCNYPPYG  1071
             L + V+F +LL      A +KLP    +  +IVFGDSIVD G N+++ T  ARCNYPPYG
Sbjct  17    LCMCVLFMVLLSETITNALVKLPANKTIPAIIVFGDSIVDAGNNDDITTTLARCNYPPYG  76

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
              DF G +PTGRF NGK P+DFIAEELG+K ++PAY DP L+PED  TGV+FASGG G+ P
Sbjct  77    IDFDGGIPTGRFSNGKVPTDFIAEELGIKPIVPAYRDPTLKPEDLLTGVTFASGGAGYVP  136

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
              T+Q++  I LS QL  F+EY  KL EMVGE +T +II+N+LF+V+ G+ND+ NTYF+L 
Sbjct  137   FTSQLSGGISLSQQLKLFEEYIEKLNEMVGEERTKFIIQNSLFMVICGSNDIANTYFALA  196

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
               + +Y+++++  LM   A  F Q+L++ GARR  +FG+PP GCVPSQRT+AGG +R+CV
Sbjct  197   SVQRQYNVDSFTTLMADKAQSFAQKLHEYGARRIQVFGVPPLGCVPSQRTVAGGPTRSCV  256

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
               +N+A+++ N+KLSA +DSL+  L ++T++Y+DIY+ LL++I +PQ YGF+V DRGCCG
Sbjct  257   GRFNDATKLYNAKLSANLDSLSRNLRENTLIYIDIYDSLLEIILDPQQYGFQVVDRGCCG  316

Query  350   TGVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQK  213
             TG+IEV  LCN YT   CP+ + YVFWDSFHPTE+ Y I+  +  ++
Sbjct  317   TGLIEVAVLCNNYTADICPNRHDYVFWDSFHPTEKTYKIMTGKYFER  363



>gb|EYU38779.1| hypothetical protein MIMGU_mgv1a026265mg [Erythranthe guttata]
Length=350

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 248/347 (71%), Gaps = 7/347 (2%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             VV   L+     EA IKLP  + +  VIVFGDS+VD G NNN++T  + N+PPYG+DF G
Sbjct  11    VVLSFLVRFYVLEAAIKLPKNISIPAVIVFGDSVVDTGNNNNIETIVKVNFPPYGKDFMG  70

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
               PTGRF +GK PSD IAEELG+KELLPAYFDP LQ ED  TGV+FASGG GFDP+T+ +
Sbjct  71    GKPTGRFSDGKVPSDLIAEELGIKELLPAYFDPALQAEDLLTGVNFASGGAGFDPITSNL  130

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
             A+ + LS QL  FK+Y  KL+ ++G  +T+ I+  +L+++VAG+ND++NTYF  P R+  
Sbjct  131   ASVLSLSDQLEMFKDYIKKLEAIIGHEKTSKILSESLYILVAGSNDIINTYFGTPFRKST  190

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
             YD+++Y DL++  A+ F+QELY LGARR  +FG+PP GC+PSQRTL GG  R C++ YNE
Sbjct  191   YDVSSYNDLLVGYASTFVQELYGLGARRIGVFGLPPLGCLPSQRTLKGGAERKCIDIYNE  250

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
              SQI N+KL  EI+S+N +   + + Y+DIY   LDLI NP  Y    ADRGCCGTG++E
Sbjct  251   VSQIFNNKLYDEIESINGRYSMARVTYMDIYTLPLDLIHNPHKY----ADRGCCGTGMVE  306

Query  335   VTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             V+FLC      CPD   YVFWDS H TE+AY ILV +IL +YV  F 
Sbjct  307   VSFLCKN---ACPDVEDYVFWDSVHQTEKAYRILVRRILDEYVNYFT  350



>gb|KHN09072.1| GDSL esterase/lipase [Glycine soja]
Length=357

 Score =   405 bits (1041),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 252/355 (71%), Gaps = 5/355 (1%)
 Frame = -1

Query  1244  MVSVVFPMLLLG----RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPP  1077
             + SVVF   +L        EA +KL     +  +I+FGDSIVD G NNNL T  +CN+PP
Sbjct  3     LWSVVFVCCVLCYSFCHSAEAIVKLGGNETIPALILFGDSIVDTGTNNNLITLLKCNFPP  62

Query  1076  YGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGF  897
             YG+DF G +PTGRF NGK P+DFIAEELG+ E +  Y  P+LQP D   GV+FASGG G+
Sbjct  63    YGRDFQGGIPTGRFSNGKVPADFIAEELGISEYITPYKSPSLQPGDLLKGVNFASGGSGY  122

Query  896   DPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             D LTAQI +  PLS QL  FKEY GKLK   GE +TN+I+  +L +VV+ +ND+ NTYF+
Sbjct  123   DSLTAQIVSVTPLSEQLEQFKEYIGKLKGNFGEAKTNFILSKSLVLVVSSSNDIANTYFA  182

Query  716   LPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRA  537
               +R+  YD++ Y D+++Q A+ F++ELY LGARR  +FG PP GC+P  RTL GG  R 
Sbjct  183   SGVRKVTYDVSGYTDMLVQEASSFVKELYGLGARRIGVFGAPPLGCLPFVRTLFGGLERV  242

Query  536   CVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGC  357
             C EE N AS++ NSKLS+E+ +LN  LPQ+ +VY+ IY+ LL++IQNP NYGF+VADRGC
Sbjct  243   CTEEINMASKLFNSKLSSELHNLNQSLPQAKVVYIRIYDSLLNIIQNPINYGFDVADRGC  302

Query  356   CGTGVIEVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             CGTG +E  FLCN     TC D +KYVFWDS+HPT++ Y ILV +IL KY+  F+
Sbjct  303   CGTGTVEAAFLCNPLDPTTCVDDSKYVFWDSYHPTQKTYQILVGEILNKYIISFS  357



>ref|XP_009106244.1| PREDICTED: GDSL esterase/lipase EXL1 isoform X1 [Brassica rapa]
Length=364

 Score =   405 bits (1042),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 192/345 (56%), Positives = 249/345 (72%), Gaps = 1/345 (0%)
 Frame = -1

Query  1232  VFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGE  1053
             +F +LL      A +KLP  + +  VIVFGDSIVD G N+++ T ARC+YP YG DF G 
Sbjct  18    LFLVLLFTTTTNALVKLPENITIPAVIVFGDSIVDAGNNDDMITEARCDYPHYGIDFDGG  77

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
             + TGRF NGK P+D +AEELG+K  +PAY DPNL+PED  TGV+FASGG G+ P T QIA
Sbjct  78    VATGRFSNGKVPTDILAEELGLKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPFTTQIA  137

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
               IPLS QL YF+EY  KL  MVGE +T +I++N++FVV+ G+ND+ N +F LP  R +Y
Sbjct  138   GGIPLSQQLKYFEEYIEKLNGMVGEERTKFILKNSMFVVICGSNDIANDFFGLPTVRLQY  197

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
              ++++  LM   A  F + LY  GARR ++FG PP GCVPSQRT+AGG +R CV  +N+A
Sbjct  198   TVDSFTALMADNARSFAKSLYGYGARRILMFGAPPIGCVPSQRTVAGGPTRDCVVRFNDA  257

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             S++ N+KLS  ID L+  L  S ++YVDIY+PLLDLI NP  YGF+V++ GCCGTG+IEV
Sbjct  258   SKLFNAKLSGNIDVLSRTLLDSKLIYVDIYSPLLDLILNPGQYGFKVSNLGCCGTGLIEV  317

Query  332   TFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYR  201
             T LCN YT   CP  + YVFWDSFHPTE AY I+V ++L +Y+ R
Sbjct  318   TALCNNYTSAVCPIRSDYVFWDSFHPTETAYRIIVAKLLDRYLSR  362



>ref|XP_010105283.1| GDSL esterase/lipase EXL3 [Morus notabilis]
 gb|EXC04218.1| GDSL esterase/lipase EXL3 [Morus notabilis]
Length=356

 Score =   405 bits (1041),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 192/344 (56%), Positives = 245/344 (71%), Gaps = 1/344 (0%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMP  1047
             +LL+    EA++KLP    V  VIVFGDSIVD G NNN + + AR N+PPYG+DF G +P
Sbjct  13    LLLIFTEIEARVKLPGNATVPAVIVFGDSIVDTGNNNNNVLSLARSNFPPYGRDFKGGVP  72

Query  1046  TGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATA  867
             TGR+ NGK PSD + EELG+KELLP Y DPNL+PED  TGV FA GG G+D  T+++A+ 
Sbjct  73    TGRYSNGKVPSDLLVEELGIKELLPPYADPNLKPEDLLTGVCFAVGGVGYDDFTSKLASV  132

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
               LS QL  FKEY  KLK +VG  +TN+II N++  VV  +ND+ NTYFS   R  +YDI
Sbjct  133   PLLSDQLEKFKEYIKKLKGIVGVERTNFIIANSIHFVVLSSNDIANTYFSTKTRSLQYDI  192

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
             ++Y DLM+  A+ F QELY LG RR  + G PP GCVPSQRT+ GG  R C E+ NEA++
Sbjct  193   SSYTDLMVNHASKFFQELYGLGVRRLGVLGAPPIGCVPSQRTIGGGLERNCFEQENEAAK  252

Query  506   IVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTF  327
             + NSKLSAE+D+LN   P + +VY+DIY PLL+LIQNP   GF++ ++GCCGTG+IE   
Sbjct  253   LFNSKLSAELDNLNKDRPDARLVYIDIYYPLLNLIQNPTKNGFKIVNKGCCGTGLIEAAL  312

Query  326   LCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
              CN    TC D + YVFWD++HPTERAY ++V QI+ KYV  F 
Sbjct  313   TCNALDTTCKDDSIYVFWDAYHPTERAYKLIVSQIISKYVNEFV  356



>ref|XP_008393902.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=377

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 249/347 (72%), Gaps = 1/347 (0%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             ++  ++L   R  A ++LP    +  VIVFGDSIVD G NNN+ T  +CN+PPYG+DF G
Sbjct  30    IMITIVLFLYRNVAAVELPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFVG  89

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
             + PTGRF NG+ PSD+IAE +GVK++LPAY D NL+ +D  TGVSFASGG G+DPLT +I
Sbjct  90    KRPTGRFSNGRVPSDWIAESVGVKKILPAYLDSNLKIQDLLTGVSFASGGSGYDPLTPKI  149

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
                  LS QL+ FK+Y  K+   VG+ +T  I+  ++++V  G+ND+ NTY S P+RR  
Sbjct  150   VVNKSLSDQLDLFKKYISKINAAVGKERTTTIVSKSIYIVCTGSNDIANTYLSTPLRRSH  209

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
             YDI AY DLM++ A+ F QELY LGARR  +  +P  GCVPSQRTL+GG  R C E  N+
Sbjct  210   YDIPAYTDLMVKSASSFFQELYGLGARRIGVVSLPAIGCVPSQRTLSGGIDRGCSETANQ  269

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+ + NSKLSA+ID+ N +LP++ +VY+DIYN LL LIQNP  YGFEV +RGCCGTG +E
Sbjct  270   AASLFNSKLSAQIDAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNVE  329

Query  335   VTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             V+ LC +Y+ GTC D +KY+FWDS+HP+E+ Y ++   +    V++F
Sbjct  330   VSILCTRYSPGTCNDSSKYIFWDSYHPSEKGYEVITSLVFDSQVHKF  376



>emb|CDX87652.1| BnaA07g32210D [Brassica napus]
Length=363

 Score =   404 bits (1038),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 257/347 (74%), Gaps = 2/347 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQT-FARCNYPPYG  1071
             L + V+F +LL      A +KLP    +  +IVFGDSIVD G N+++ T  ARCNYPPYG
Sbjct  11    LFMCVLFMVLLSETITNALVKLPANKTIPAIIVFGDSIVDAGNNDDITTTLARCNYPPYG  70

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
              DF G +PTGRF NGK P+DFIAE LG+K  +PAY DP L+PED  TGV+FASGG G+ P
Sbjct  71    IDFDGGIPTGRFSNGKVPTDFIAEGLGIKPSVPAYRDPTLKPEDLLTGVTFASGGAGYVP  130

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
             LT+Q++  I LS QL  F+EY  KL EMVGE +T +I++N+LF+V+ G+ND+ NTYF+LP
Sbjct  131   LTSQLSGGISLSQQLKLFEEYIEKLNEMVGEERTKFIMQNSLFMVICGSNDIANTYFALP  190

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
               + +Y+++++  LM   A  F Q+L++ GARR  +FG+PP GCVPSQRT+AGG +R+CV
Sbjct  191   SVQRQYNVDSFTTLMADKAQSFAQKLHEYGARRIQVFGVPPLGCVPSQRTVAGGPTRSCV  250

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
               +N+A+++ N+KLSA +DSL+  L ++T++Y+DIY  LLD+I +PQ YGF+V DRGCCG
Sbjct  251   GRFNDATKLYNAKLSANLDSLSRNLRENTLIYIDIYGSLLDIILDPQQYGFQVVDRGCCG  310

Query  350   TGVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQK  213
             TG+IEV  LCN +T   CP+ + +VFWDSFHPTE+ Y I+  +  ++
Sbjct  311   TGLIEVAVLCNNFTADICPNRHDHVFWDSFHPTEKTYKIMTAKYFER  357



>ref|NP_565120.1| GDSL esterase/lipase EXL1 [Arabidopsis thaliana]
 sp|Q94CH8.1|EXL1_ARATH RecName: Full=GDSL esterase/lipase EXL1; AltName: Full=Family 
II extracellular lipase 1; Short=Family II lipase EXL1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK30016.1| family II lipase EXL1 [Arabidopsis thaliana]
 gb|AEE35768.1| GDSL esterase/lipase EXL1 [Arabidopsis thaliana]
Length=375

 Score =   404 bits (1039),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/354 (55%), Positives = 256/354 (72%), Gaps = 4/354 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLG--RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPY  1074
             ++   +F ++LL       A +K+P    V  VIVFGDSIVD G N+++ T ARC+Y PY
Sbjct  21    ILFWCIFVLVLLSTTSTTNALVKIPKNTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPY  80

Query  1073  GQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFD  894
             G DF G + TGRF NGK P D +AEELG+K  +PAY +PNL+PE+  TGV+FASGG G+ 
Sbjct  81    GIDFDGGVATGRFSNGKVPGDIVAEELGIKPNIPAYRNPNLKPEELLTGVTFASGGAGYV  140

Query  893   PLTAQIATA-IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             PLT +IA   IPL  QL YF+EY  KLK+MVGE +T +II+N+LFVV+ G+ND+ N +F+
Sbjct  141   PLTTKIAVGGIPLPQQLIYFEEYIEKLKQMVGEKRTKFIIKNSLFVVICGSNDIANDFFT  200

Query  716   LPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRA  537
             LP  R  Y + ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R 
Sbjct  201   LPPVRLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRD  260

Query  536   CVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGC  357
             CV  +N+A+++ N+KLSA ID L+  L   TI+Y+DIY+PLLDLI NP  YGF+VA++GC
Sbjct  261   CVARFNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSPLLDLILNPHQYGFKVANKGC  320

Query  356   CGTGVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CGTG+IEVT LCN YT + CP  + YVFWDSFHPTE+AY I+V ++L +Y+ RF
Sbjct  321   CGTGLIEVTALCNNYTASVCPIRSDYVFWDSFHPTEKAYRIIVAKLLDRYLNRF  374



>ref|XP_010536419.1| PREDICTED: GDSL esterase/lipase At1g20120-like [Tarenaya hassleriana]
Length=722

 Score =   416 bits (1068),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/333 (58%), Positives = 250/333 (75%), Gaps = 4/333 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +AK++LPP V V  +IVFGDSIVD G NN  +T ++CN+PPYG DF G +PTGRF NG+ 
Sbjct  27    KAKVRLPPNVTVPAIIVFGDSIVDAGNNNKFKTPSKCNFPPYGIDFDGGVPTGRFSNGRV  86

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD +AEE+G+K+ +PAY DP L PED  TGV+FASGG G+ PLT  +A A  L+ QL +
Sbjct  87    PSDLLAEEIGIKKNVPAYLDPKLTPEDLLTGVTFASGGAGYIPLTNSLAVATSLTDQLKH  146

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EY  K+KE+VGE + N+I+ N+L++V+  +ND+ NTY   PI +YKYD++ Y  LM  
Sbjct  147   FEEYLEKVKELVGEERKNFILANSLYMVLTASNDIANTY---PILQYKYDVDTYTALMAD  203

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+  +++LY  GARR ++ G PP GCVPSQRT+AGG SR CVE  N+A+++ NSKLSA 
Sbjct  204   SASSILEKLYGYGARRILVLGAPPIGCVPSQRTVAGGPSRECVERLNDAAKLFNSKLSAT  263

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-  303
             +DSL   LP   +VY DIY PLLD+I N QNYGF+V DRGCCGTG IEVT  CNKYT T 
Sbjct  264   VDSLARTLPGGNLVYADIYTPLLDIIVNFQNYGFKVGDRGCCGTGYIEVTATCNKYTSTV  323

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVY  204
             CP+ +++VFWDSFHPTER Y +LV +++ KYVY
Sbjct  324   CPNRDEFVFWDSFHPTERGYRVLVSKLVGKYVY  356


 Score =   330 bits (847),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 222/322 (69%), Gaps = 1/322 (0%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              ++VFGDSI+D G NN++ T  +CN+ PYG +F   + TGRF +GK PSD +AE LG+KE
Sbjct  399   ALLVFGDSIIDTGNNNDIMTVVKCNFRPYGINFPNGVATGRFSDGKVPSDILAELLGIKE  458

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
              LPAY DP L+PED  TGV F SGG GFDPLT  + + I ++ QLNYF+EYK +LK M+G
Sbjct  459   TLPAYLDPKLKPEDLLTGVVFGSGGSGFDPLTPVLLSVISMTNQLNYFQEYKERLKGMLG  518

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLG  621
             E + N  I  +LF VVAG++D++NTY+    RR++Y++  Y   +   A  F  +L+  G
Sbjct  519   EEKANARIAESLFFVVAGSDDIVNTYYGFQTRRFQYNLGDYTSFLADSATSFALQLHQYG  578

Query  620   ARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTI  441
             AR   I  +PP GC+PS RT+ G   R C +  N A+Q+ NSKLS ++D+L+  LP++ +
Sbjct  579   ARYIAIASLPPIGCLPSVRTIRGKFGRDCSKLLNFAAQLFNSKLSTKVDALSKTLPETKL  638

Query  440   VYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWDSF  264
             VY+D+Y P++ +++ P+ Y FEVAD+GCCGTG +E   LCN +T   C + + Y+FWDS+
Sbjct  639   VYIDVYTPMIQMVKFPEKYDFEVADKGCCGTGTVETVVLCNHFTSYVCRNVSAYLFWDSY  698

Query  263   HPTERAYGILVHQILQKYVYRF  198
             HPTERAY IL  +++ KY  RF
Sbjct  699   HPTERAYRILTKELIDKYFTRF  720



>ref|XP_006301398.1| hypothetical protein CARUB_v10021812mg [Capsella rubella]
 gb|EOA34296.1| hypothetical protein CARUB_v10021812mg [Capsella rubella]
Length=368

 Score =   404 bits (1037),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 256/351 (73%), Gaps = 4/351 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRC--EAKIKLPPG-VVVEGVIVFGDSIVDQGMNNNLQT-FARCNYP  1080
             L   V+F ++LL +     A +KL P   ++  +IVFGDSIVD G N++++T  ARCNYP
Sbjct  18    LFWFVLFFLVLLCKTTTTNALVKLSPNETIIPAIIVFGDSIVDAGNNDDIKTTLARCNYP  77

Query  1079  PYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCG  900
             PYG DF G +PTGRF NGK  +DFIAE  G+K  +PAY +PNL+PED  TGV+FASGG G
Sbjct  78    PYGIDFYGSIPTGRFSNGKVATDFIAENFGIKPTVPAYRNPNLKPEDLLTGVTFASGGAG  137

Query  899   FDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYF  720
             + PLT Q++  I L  QL  F+EY  KLK+MVGE +TN+II+N+L +V+ G+ND+ NTYF
Sbjct  138   YVPLTTQLSGGIALPQQLELFEEYIDKLKKMVGEERTNFIIKNSLVMVICGSNDITNTYF  197

Query  719   SLPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSR  540
              LP  ++KYD++++  LM   A  F Q+L++ GARR  +FG+PP GCVPSQRTLAGG +R
Sbjct  198   GLPSVQHKYDVSSFTTLMADNARSFAQKLHEYGARRIQVFGVPPLGCVPSQRTLAGGPTR  257

Query  539   ACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
              CV  +N+A+++ N+KL+A +DSL+  L + TI YVDIY  LLD+I +PQ YGF+V DRG
Sbjct  258   NCVVRFNDATKLYNTKLAANLDSLSTTLGEKTITYVDIYGSLLDIILDPQQYGFKVVDRG  317

Query  359   CCGTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             CCGTG+IEV  LCN     CP+ ++YVFWDSFHPTE+ Y I+  +  ++Y+
Sbjct  318   CCGTGLIEVAVLCNLAADVCPNRDEYVFWDSFHPTEKTYKIMATKYFERYI  368



>ref|XP_009363463.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=368

 Score =   403 bits (1035),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 243/334 (73%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLP    +  VIVFGDS+VD G NNN+ T  +CN+PPYG+DF G+ PTGRF NG+ P
Sbjct  34    AAVKLPNNEKIPAVIVFGDSVVDSGNNNNISTVVKCNFPPYGRDFVGQRPTGRFSNGRVP  93

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD IAE +GVK++LPAY DPNL+  D  TGV+FASGG G+DPLT +I + + LS Q++ F
Sbjct  94    SDLIAESVGVKKILPAYLDPNLKIHDLLTGVAFASGGSGYDPLTPKIVSVLSLSDQIDMF  153

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             K Y  K+   VG+     I+  ++++V  G+ND+ NTYFS P+RR +YDI+AY DLM++ 
Sbjct  154   KTYINKITASVGKESAAIIVSKSIYIVCTGSNDIANTYFSTPLRRPRYDISAYTDLMVES  213

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F QELY LGARR  +  +PP GC+PSQRTL GG+ R C E  N+A+ + NSKL +EI
Sbjct  214   ASSFFQELYGLGARRIGVVSLPPIGCLPSQRTLRGGRDRGCSETVNQAASLFNSKLLSEI  273

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTC  300
             ++ N +LP++ +VY+D+YN LL LI+NP  YGFEV D+GCCGTG IEV+ LC +Y+ GTC
Sbjct  274   NAFNTRLPEARLVYLDVYNTLLSLIRNPAQYGFEVMDQGCCGTGNIEVSILCTRYSPGTC  333

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D + Y+FWDS+HP+E+ Y ++   +    V++F
Sbjct  334   NDASNYIFWDSYHPSEKGYEVITPMVFDSQVHKF  367



>ref|XP_004499299.1| PREDICTED: GDSL esterase/lipase EXL1-like [Cicer arietinum]
Length=362

 Score =   403 bits (1035),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 248/347 (71%), Gaps = 0/347 (0%)
 Frame = -1

Query  1238  SVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFA  1059
             +++F ++L   +  A I+LPP V +  V+VFGDSI+D G NN + T +R N+ PYG+DF 
Sbjct  15    TLIFTIILFCFKTNAIIQLPPNVSIPAVLVFGDSIMDTGNNNYITTLSRSNFAPYGKDFP  74

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G + TGRF NGK PSDFI EELG+KE LP Y +PNL+P++  TGV FASGG G+D +T+Q
Sbjct  75    GGIATGRFSNGKVPSDFIVEELGIKEYLPPYLNPNLKPDELITGVCFASGGAGYDHITSQ  134

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             +  AI LS QL+ FKEY  KL   VGEN+TN+I+ N++F +V G+ND+ NTYF    R+ 
Sbjct  135   LLFAISLSKQLDLFKEYIEKLNVYVGENRTNFILANSIFFLVMGSNDISNTYFLTHARQL  194

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             KYD  +YADL++  A++F +E+Y+LGARR  IF + P GCVP  RTLAGGK R+CVE+YN
Sbjct  195   KYDFPSYADLLVTLASNFTKEIYELGARRIGIFSVAPIGCVPLHRTLAGGKERSCVEKYN  254

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
              A+ + N KL  EI SLN  L  S IVY D+Y PLLD+I N Q YGF VAD+GCCG G +
Sbjct  255   NATTLFNDKLFKEIGSLNQNLSNSKIVYFDVYTPLLDIIVNNQKYGFTVADQGCCGRGKL  314

Query  338   EVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             EV  LCN++  TC +  +YVFWDSFHPTE  Y   V  +LQKY+ +F
Sbjct  315   EVGILCNRFGRTCSNDTEYVFWDSFHPTEAIYKGFVAPLLQKYITQF  361



>ref|XP_010033517.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
 gb|KCW53199.1| hypothetical protein EUGRSUZ_J02472 [Eucalyptus grandis]
Length=367

 Score =   403 bits (1035),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 192/350 (55%), Positives = 246/350 (70%), Gaps = 3/350 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGR-RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYG  1071
             L   +   + L+ R R  + ++  P   +   IVFGDSI+D G NNN+QT  +CN+PPYG
Sbjct  14    LHAVIFVSLALVARGRLASSVRHKPRPRMPAFIVFGDSIIDPGNNNNIQTIVKCNFPPYG  73

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
             +DF G  P+GRF NGK P D   E  G+K+ LPAY DP+L+ ED  TGVSFASG  G+DP
Sbjct  74    RDFMGGKPSGRFSNGKIPPDLFVEAFGLKQYLPAYLDPSLKLEDLLTGVSFASGATGYDP  133

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
             LT QIA+A+ LS QLN FKEY  K+K   GE + +YI++N+L++VV G++D+ NTY+S P
Sbjct  134   LTPQIASALSLSDQLNLFKEYVNKIKSGAGEEKASYIVKNSLYMVVCGSDDIANTYYSTP  193

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
              RR +YDI AY DLM+  A+ FIQELY LGAR+  I  IPP GCVP+QRTL GG  RAC 
Sbjct  194   FRRGEYDIPAYTDLMLNSASSFIQELYGLGARKISILSIPPIGCVPAQRTLDGGLERACN  253

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
                N+A+ + NSKL +EI+SL  KLP S +VY+DIY+ LL +IQNP +YGFEVA+RGCCG
Sbjct  254   APANQAATLFNSKLISEIESLKQKLPGSKLVYLDIYHKLLSVIQNPSHYGFEVANRGCCG  313

Query  350   TGVIEVTFLCNKYTG--TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             TG IEV+ LCN+     TC D +KYVFWDS+HPTE  Y IL   ++  Y 
Sbjct  314   TGNIEVSILCNRLDDLETCQDDSKYVFWDSYHPTENTYKILTDHVIDNYA  363



>ref|XP_010428639.1| PREDICTED: GDSL esterase/lipase EXL2-like [Camelina sativa]
Length=366

 Score =   402 bits (1034),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 187/349 (54%), Positives = 254/349 (73%), Gaps = 2/349 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRC-EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQT-FARCNYPPY  1074
             L   V+F ++LLG+    A +KL     +  +IVFGDSIVD G N++++T  ARCNYPPY
Sbjct  18    LFWCVLFFLVLLGKTTTNALVKLSSNETIPAIIVFGDSIVDAGNNDDIKTTLARCNYPPY  77

Query  1073  GQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFD  894
             G DF G +PTGRF NGK  +DFIAE  G+K  +PAY +PNL+PED  TGV+FASGG G+ 
Sbjct  78    GIDFDGGVPTGRFSNGKVATDFIAENFGIKPTIPAYRNPNLKPEDLLTGVTFASGGAGYV  137

Query  893   PLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSL  714
             P T Q++  I L  QL  F+EY  KLK+MVGE +TN+II+N+L +V+ G+ND+ NTYF L
Sbjct  138   PFTTQLSGGIALPQQLELFEEYIEKLKKMVGEERTNFIIQNSLIMVICGSNDITNTYFGL  197

Query  713   PIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRAC  534
             P  ++KYD++++  LM   A  F  +L++ GARR  +FG+PP GCVPSQRTLAGG +R C
Sbjct  198   PSVQHKYDVSSFTTLMADNARSFALKLHEYGARRIQVFGVPPLGCVPSQRTLAGGPTRNC  257

Query  533   VEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCC  354
             V  +N+A+++ N+KL+A +DSL+  L + TI+YVDIY  LLD+I +PQ YGF+V DRGCC
Sbjct  258   VVRFNDATKLYNAKLAANLDSLSRSLGEKTIIYVDIYGSLLDIILDPQQYGFKVVDRGCC  317

Query  353   GTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             GTG+IEV  LCN     CP+ ++YVFWDSFHPTE+ Y I+  +  ++Y+
Sbjct  318   GTGLIEVAVLCNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYFERYI  366



>ref|XP_009379345.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=374

 Score =   402 bits (1034),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 247/347 (71%), Gaps = 1/347 (0%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             +   ++L   R  A + LP    +  VIVFGDSIVD G NNN+ T  +CN+PPYG+DF G
Sbjct  27    ITITIVLFLYRNAAAVDLPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFVG  86

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
             + PTGRF NG+ PSD IAE +GVK++LPAY D NL+ +D  TGVSFASGG G+DPLT +I
Sbjct  87    KRPTGRFSNGRVPSDLIAESVGVKKILPAYLDSNLKIQDLVTGVSFASGGSGYDPLTPKI  146

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
              + + LS QL+ FK+Y  K+   VG+ +T  I+  ++++V  G+ND+ NTY S P+RR  
Sbjct  147   VSVLSLSDQLDLFKKYIIKINAAVGKERTATIVSKSIYIVCTGSNDIANTYLSTPLRRPH  206

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
             YDI AY DLM++ A+ F QELY LGARR  +  +P  GCVPSQRTL+GG  R C E  N+
Sbjct  207   YDIPAYTDLMVKSASSFFQELYGLGARRIGVVSLPAIGCVPSQRTLSGGIDRGCSETANQ  266

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+ + NSKLSA+ID+ N +LP++ +VY+DIYN LL LIQNP  YGFEV +RGCCGTG +E
Sbjct  267   AASLFNSKLSAQIDAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNVE  326

Query  335   VTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             V+ LC +Y+ GTC D +KY+FWDS+HP+E+ Y ++        V++F
Sbjct  327   VSILCTRYSPGTCNDSSKYIFWDSYHPSEKGYEVITPLAFDSQVHKF  373



>ref|XP_009363464.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=367

 Score =   402 bits (1033),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 180/348 (52%), Positives = 252/348 (72%), Gaps = 3/348 (1%)
 Frame = -1

Query  1232  VFPML--LLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFA  1059
             +FP++  L      A +KLP    V  VIVFGDS+VD G NNN+ T  +CN+PPYG+DFA
Sbjct  19    IFPIVIVLFFYNNAAAVKLPNNEKVPAVIVFGDSVVDPGNNNNISTIVKCNFPPYGRDFA  78

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G+ PTGRF NG+ PSD IAE +GVK++LPAY DPNL+  D  TGVSFASGG G+DPLT +
Sbjct  79    GQRPTGRFSNGRVPSDMIAESVGVKKILPAYLDPNLKIHDLLTGVSFASGGSGYDPLTPK  138

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             I + + LS Q++ FK Y  K+   VG+     I+  ++++V  G++D+ +TY+  P+RR 
Sbjct  139   IVSVLSLSDQIDMFKNYISKITVAVGKEGAATIVSKSIYIVCTGSDDIAHTYYFTPLRRP  198

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             +YDI+AY DLM++ A+ F QELY+LGARR  +  +PP GC+PSQRTL GG+ R C E  N
Sbjct  199   RYDISAYTDLMVESASSFFQELYELGARRIGVVNLPPIGCLPSQRTLGGGRERGCSETTN  258

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             +A+ + NSKL  +ID+ N +LP++ +VY+DIYN +L LIQNP  +GFEV D+GCCGTG+I
Sbjct  259   QAASLFNSKLLPKIDAFNTRLPEARLVYLDIYNTVLSLIQNPTQFGFEVMDQGCCGTGII  318

Query  338   EVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             EV+ LC +Y+ GTC D +KY+FWDS+HP+E+ Y +++  +    V++F
Sbjct  319   EVSILCTRYSPGTCNDSSKYIFWDSYHPSEKGYEVIIPLVFDSQVHKF  366



>gb|KHN45939.1| GDSL esterase/lipase [Glycine soja]
Length=357

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/336 (56%), Positives = 242/336 (72%), Gaps = 1/336 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA +KL     +  +I+FGDSIVD G NNNL T  +CN+PPYG+DF G +PTGRF NGK 
Sbjct  22    EAIVKLRGNETIPALILFGDSIVDTGSNNNLITGLKCNFPPYGRDFEGGIPTGRFSNGKV  81

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P+DF+AEELG+KE +  Y  P LQP D   GV+FASGG G+DPLTAQ+ + IPLS QL  
Sbjct  82    PADFVAEELGIKEYIAPYTSPALQPGDLLRGVNFASGGTGYDPLTAQLVSVIPLSEQLEQ  141

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKLK   GE +TN+I+  +L +VV+ +ND+ NTYF+  +R+  YD+  Y D+++Q
Sbjct  142   FKEYIGKLKGNFGEAKTNFILSKSLVLVVSSSNDIANTYFATGVRKLNYDVPNYTDMLVQ  201

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F++ELY LGARR  +FG PP GC+P  R L GG  R C EE N AS++ NSKLS+E
Sbjct  202   QASSFVKELYGLGARRIGVFGAPPLGCLPFVRALFGGLRRLCSEEINMASKLFNSKLSSE  261

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GT  303
             +  LN  LPQ+ +VY+ IY+ LL++IQNP  YGFEVAD+GCCGTG +E  FLCN     T
Sbjct  262   LHKLNQSLPQAKVVYIHIYDSLLNIIQNPTKYGFEVADKGCCGTGTVEAAFLCNMLDPTT  321

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             C D +KYVFWDS+HPT++ Y ILV +IL KY   F+
Sbjct  322   CSDDSKYVFWDSYHPTQKTYQILVGEILNKYTSNFS  357



>ref|XP_008363081.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=377

 Score =   402 bits (1033),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 248/347 (71%), Gaps = 1/347 (0%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             ++  ++L   R  A ++LP    +  VIVFGDSIVD G NNN+ T  +CN+PPYG+DF G
Sbjct  30    IMITIVLFLYRNVAAVELPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFVG  89

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
             + PTGRF NG+ PSD+IAE +GVK++LPAY D NL+ +D  TGVSFASGG G+DPLT +I
Sbjct  90    KRPTGRFSNGRVPSDWIAESVGVKKILPAYLDSNLKIQDLLTGVSFASGGSGYDPLTPKI  149

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
              + + LS QL+ FK+Y  K+   VG+ +T  I+   +++V   +ND+ NTY S P+RR  
Sbjct  150   VSVLSLSDQLDLFKKYISKINAXVGKERTXTIVSKXIYIVCTXSNDIXNTYLSTPLRRXH  209

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
             YDI AY DLM++ A+ F QELY LGARR  +  +P  GCVPSQRTL+GG  R C E  N+
Sbjct  210   YDIPAYTDLMVKSASSFFQELYGLGARRIGVVSLPAIGCVPSQRTLSGGLDRGCSETANQ  269

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+ + NSKLSA+ID+ N +LP++ +VY+DIYN LL LIQNP  YGFEV +RGCCGTG  E
Sbjct  270   AASLFNSKLSAQIDAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNFE  329

Query  335   VTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             V+ LC +Y+ GTC D +KY+FWDS+HP+E+ Y ++   +    V++F
Sbjct  330   VSILCTRYSPGTCNDSSKYIFWDSYHPSEKGYEVITSLVFDSQVHKF  376



>ref|XP_009379346.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=366

 Score =   401 bits (1030),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 243/334 (73%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLP    +  +IVFGDSIVD G N+N+ T  +CN+PPYG+DF G+ PTGRF NG+ P
Sbjct  32    AAVKLPNNEKIPALIVFGDSIVDPGNNDNIGTIVKCNFPPYGRDFIGKRPTGRFSNGRVP  91

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD IAE +GVK +LPAY DPN++ ED  TGVSFASGG G+DPLT QI + + LS QL+ F
Sbjct  92    SDLIAESVGVKNILPAYLDPNVKIEDLLTGVSFASGGSGYDPLTPQIVSVLSLSDQLDLF  151

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             K+Y  K+   VGE     I+  +++++  G++D+ NTY S P+RR  YDI AY DLMI  
Sbjct  152   KDYIRKITAAVGEESAATIVSKSIYILCIGSDDIANTYLSTPVRRPYYDIPAYTDLMINS  211

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F+QELY LGARR  +  +P  GCVPSQRTL GG +R C E  N+A+++ NSKLSA+I
Sbjct  212   ASSFLQELYGLGARRIGVINLPAIGCVPSQRTLGGGINRDCSETANQAARLFNSKLSAKI  271

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTC  300
             D+ N +LPQ+ +VY+DIY  LL LIQNP  YGFEVA++GCCGTG IEV+ LC +Y+ GTC
Sbjct  272   DAFNKRLPQARVVYLDIYYTLLSLIQNPTQYGFEVANKGCCGTGNIEVSVLCTRYSPGTC  331

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D +KY+FWDS+HPTE+ Y ILV  +    + +F
Sbjct  332   NDSSKYIFWDSYHPTEKTYEILVPLVFDTQIRKF  365



>ref|XP_006302445.1| hypothetical protein CARUB_v10020529mg [Capsella rubella]
 gb|EOA35343.1| hypothetical protein CARUB_v10020529mg [Capsella rubella]
Length=362

 Score =   399 bits (1026),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 247/334 (74%), Gaps = 2/334 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLPP ++V  +I FGDSIVD GMNN ++T  +C++ PYG +F G   TGRFC+G+ P
Sbjct  29    AAVKLPPKLIVPALIAFGDSIVDTGMNNFVKTVVKCDFRPYGINFQGGAATGRFCDGRVP  88

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             +D +AEELG+K  +PAYFDP L+ +D  TGVSFASGG G+DP+T ++ + + L  QLNYF
Sbjct  89    ADLLAEELGIKSTVPAYFDPTLKSKDLLTGVSFASGGSGYDPITPKLVSVLSLEDQLNYF  148

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             +EY  K+K +VGE + ++II N+LF+VVAG++D+ NTY++L  R  +YD++AY  LM   
Sbjct  149   EEYIEKVKNIVGEEKKDFIIANSLFLVVAGSDDIANTYYTLRARP-QYDVDAYTTLMSDS  207

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A DF+ +LY  G RR  +FG PP GCVPSQRTL GG  R C E YN A+++ NSKLS ++
Sbjct  208   ATDFVTKLYGYGVRRLAVFGAPPIGCVPSQRTLGGGIMRDCAESYNVAAKLFNSKLSPKL  267

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-C  300
             D L+  LP    VY++IY+PL D+IQNP NYGFEVA++GCCGTG IEV  LCNK T + C
Sbjct  268   DMLHKTLPGIRPVYINIYDPLFDIIQNPANYGFEVANKGCCGTGAIEVAVLCNKITSSVC  327

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             PD + +VFWDS+HPTE+ Y +LV  ++ K+V +F
Sbjct  328   PDVSSHVFWDSYHPTEKTYKVLVSLLINKFVNQF  361



>ref|XP_010266840.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nelumbo nucifera]
Length=371

 Score =   400 bits (1027),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 249/352 (71%), Gaps = 3/352 (1%)
 Frame = -1

Query  1244  MVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             M  ++   L L    +A + LPP V +  V VFGDS+VD G NNNL +  +CN PPYG+D
Sbjct  19    MFLILSTSLFLSHLIQAALVLPPNVTIPAVYVFGDSVVDTGNNNNLVSVMKCNSPPYGRD  78

Query  1064  FAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLT  885
             F G   TGR  NG+ PSD  A  LG+KELLP Y DPNLQ +D  TGV+FASG  G+DPLT
Sbjct  79    FMGGKATGRCSNGRVPSDMFASILGIKELLPPYLDPNLQDQDLLTGVNFASGASGYDPLT  138

Query  884   AQIATAIPLSTQLNYFKEYKGKLKEMV-GENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             +++A+   ++ QL  FKEY  KLK    GE +   I   +L++V  G++D+ NTYF+ P 
Sbjct  139   SKLASVYSITDQLGMFKEYIEKLKAAAAGEERAKSITTQSLYIVCLGSDDISNTYFNSPF  198

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             RR  YD+ AY DLM+Q A+ F+QELY LGA+R  +    P GC P QRT+AGG +R C  
Sbjct  199   RRMDYDVPAYTDLMLQSASSFLQELYGLGAKRIGVLSAAPIGCAPYQRTVAGGPNRDCAA  258

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              YN+A+Q+ N KLS+EIDSLN KLPQ+ IVYVDIY PLLDLIQ+P++YGFE + +GCCGT
Sbjct  259   PYNQAAQLFNQKLSSEIDSLNQKLPQARIVYVDIYYPLLDLIQHPRSYGFEESSKGCCGT  318

Query  347   GVIEVTF-LCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G +EVT  LCN+ T  TC D +KYVFWDSFHPT++AY IL++ +LQKYV+RF
Sbjct  319   GNLEVTTALCNELTPFTCTDVSKYVFWDSFHPTQKAYEILLNPLLQKYVHRF  370



>ref|XP_007224778.1| hypothetical protein PRUPE_ppa023913mg, partial [Prunus persica]
 gb|EMJ25977.1| hypothetical protein PRUPE_ppa023913mg, partial [Prunus persica]
Length=313

 Score =   397 bits (1021),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 237/311 (76%), Gaps = 2/311 (1%)
 Frame = -1

Query  1172  VVVEGVIVFGDSIVDQGMNN-NLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEE  996
             V +  V +FGDSIVD G NN NL+T ARCN+PPYG+DF G +PTGR+ NGK PSDFIAEE
Sbjct  3     VTIPAVFMFGDSIVDTGNNNDNLKTPARCNFPPYGRDFQGGIPTGRYSNGKVPSDFIAEE  62

Query  995   LGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKL  816
             LG+KELLPAY DPNL   D  TGVSFA G  G+DP+TA++     LS QL  F+EY G+L
Sbjct  63    LGIKELLPAYLDPNLAQNDLLTGVSFAVGATGYDPMTAKVVAVTQLSDQLLQFEEYIGRL  122

Query  815   KEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQE  636
             K +VGE++ N I+ N+LF VVA +ND+ NTYF   IR+ +YD+ +Y DLM+  A+DF++ 
Sbjct  123   KGIVGEDRANSILANSLFFVVASSNDLANTYFVTGIRKLEYDVPSYTDLMLNHASDFLKG  182

Query  635   LYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKL  456
             LY LGARR  +F  PP GC+PSQRTL GG  R CVE+ N+A+ + NSKLSAE+D+LN  L
Sbjct  183   LYALGARRIGVFSAPPIGCLPSQRTLGGGILRDCVEKPNQAAMLFNSKLSAELDNLNKNL  242

Query  455   PQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCPDHNKYV  279
             P S +VYVDIYNPLLDLI NP NYGFE+AD+GCCG+G +EV+ LCN++   TC D + YV
Sbjct  243   PNSNLVYVDIYNPLLDLIINPTNYGFEIADKGCCGSGKLEVSILCNEFEPETCTDDSNYV  302

Query  278   FWDSFHPTERA  246
             FWDS+HPTE A
Sbjct  303   FWDSYHPTEAA  313



>ref|XP_006596538.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
 gb|KHN39413.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=362

 Score =   399 bits (1026),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 187/340 (55%), Positives = 243/340 (71%), Gaps = 4/340 (1%)
 Frame = -1

Query  1214  LGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQT-FARCNYPPYGQDFAGEMPTGR  1038
             +  + +  +KLP  V V  V VFGDS+VD G NNN  T FAR N+PPYG+DF G +PTGR
Sbjct  25    VSSKTKGLVKLPADVSVPAVFVFGDSVVDTGNNNNRTTSFARSNFPPYGRDFQGGIPTGR  84

Query  1037  FCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPL  858
             F NGK PSD I EELG+KELLPAY  PNLQ  D  TGV FASGG G+DPLT+ + +++PL
Sbjct  85    FSNGKVPSDLIVEELGIKELLPAYLKPNLQSSDLITGVCFASGGSGYDPLTSILESSMPL  144

Query  857   STQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAY  678
             + Q++  KEY GKLKE+VGEN+  +I+ N+LFVVVAG++D+ NTY +   R   YD+ AY
Sbjct  145   TGQVDLLKEYIGKLKELVGENRAKFILANSLFVVVAGSSDISNTYRT---RSLLYDLPAY  201

Query  677   ADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVN  498
              DL++  A++F+ E+ +LGARR  +F  PP GC+P QRT+ GG  R C E  N  +Q+ N
Sbjct  202   TDLLVNSASNFLTEINELGARRIAVFSAPPIGCLPFQRTVGGGIERRCAERPNNLAQLFN  261

Query  497   SKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCN  318
             +KLS E+DSLN   P S  V++++Y+PLLD+I N Q YG+ V D GCCGTG IEV  LCN
Sbjct  262   TKLSKEVDSLNRNFPNSRNVFINVYDPLLDIITNYQKYGYRVGDTGCCGTGRIEVAILCN  321

Query  317   KYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              +  +CP+   YVFWDSFHPTE  Y  L++ ILQKY+Y+F
Sbjct  322   SFDSSCPNVQDYVFWDSFHPTESVYKRLINPILQKYLYQF  361



>gb|KDP23987.1| hypothetical protein JCGZ_25375 [Jatropha curcas]
Length=330

 Score =   398 bits (1023),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 240/323 (74%), Gaps = 2/323 (1%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              VIVFGDSIVD G NN ++T  +CN+PPYG+DF G  PTGRF NG  PSD  A+ LG+K+
Sbjct  7     AVIVFGDSIVDPGNNNYVKTIIKCNFPPYGRDFIGRKPTGRFSNGFIPSDIAAQILGIKK  66

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
             L+PAY DPN+QPED  TGVSFASGG G+DP T++IA+ + LS QL+ F+ Y  KLK +VG
Sbjct  67    LVPAYLDPNVQPEDLLTGVSFASGGSGYDPQTSKIASVLSLSDQLDLFRGYLSKLKSIVG  126

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLG  621
             E  T+ I+   LF+V  G++D+ NTYF+LP RRY+YDIN+Y DLM+  A+ F +ELY++G
Sbjct  127   EEGTSTILSKGLFIVCIGSDDIANTYFALPFRRYQYDINSYTDLMVSSASTFYKELYEVG  186

Query  620   ARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTI  441
             ARR  +  +PP GCVPSQRTL GG  R C E  NEA+++ NSK+S+ IDSLN +LP   +
Sbjct  187   ARRIGVLNLPPIGCVPSQRTLGGGIVRECSESANEAAKLFNSKISSAIDSLNTELPDVRL  246

Query  440   VYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCN--KYTGTCPDHNKYVFWDS  267
             V +DIYNPLL +I+NP  YGFE A +GCCGTG IEV+ LCN  +   TC D +KY+FWDS
Sbjct  247   VNIDIYNPLLSIIKNPSQYGFEEATKGCCGTGNIEVSILCNPLEDKHTCEDASKYIFWDS  306

Query  266   FHPTERAYGILVHQILQKYVYRF  198
             +HP+E+ Y IL   IL + +Y+F
Sbjct  307   YHPSEKTYQILTPMILNECLYKF  329



>ref|XP_010034703.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
 gb|KCW53196.1| hypothetical protein EUGRSUZ_J02470 [Eucalyptus grandis]
Length=367

 Score =   399 bits (1026),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/350 (55%), Positives = 244/350 (70%), Gaps = 3/350 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGR-RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYG  1071
             L   ++  + L+ R R  +  +  P   +   I FGDSI+D G NNN+QT  +CN+PPYG
Sbjct  14    LYAVILVSLALVARGRLASSARPRPWPPLPAFIAFGDSIIDPGNNNNIQTIVKCNFPPYG  73

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
             +DF G  P+GRF NGK P D   E  G+K+ LPAY DP+L+ ED  TGVSFASG  G+DP
Sbjct  74    RDFMGGKPSGRFSNGKIPPDLFVEAFGIKQYLPAYLDPSLKLEDLLTGVSFASGATGYDP  133

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
             LT QIA+A+ LS QLN FKEY  K+K   GE + +YII+N+L+ VV G++D+ NTY+S P
Sbjct  134   LTPQIASALSLSDQLNLFKEYVNKIKSGAGEEKASYIIKNSLYTVVCGSDDIANTYYSTP  193

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
              RR +YDI AY DLM+  A+ FIQELY LGAR+  I  IPP GCVP+QRTL GG  RAC 
Sbjct  194   FRRGEYDIPAYTDLMLNSASSFIQELYGLGARKIGILSIPPIGCVPAQRTLDGGLERACN  253

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
                N+A+ + NSKL +EI+SL  KLP S +VY+DIY+ LL +IQNP +YGFEVA+RGCCG
Sbjct  254   APANQAATLFNSKLISEIESLKQKLPGSKLVYLDIYHKLLSVIQNPSHYGFEVANRGCCG  313

Query  350   TGVIEVTFLCNKYTG--TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             TG IEV+ LCN+     TC D +KYVFWDS+HPTE  Y IL   ++  Y 
Sbjct  314   TGNIEVSILCNRLDDLETCQDDSKYVFWDSYHPTENTYKILTDHVIDNYA  363



>ref|XP_010314650.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X2 [Solanum 
lycopersicum]
Length=325

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 190/345 (55%), Positives = 247/345 (72%), Gaps = 24/345 (7%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKL-PPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMP  1047
             M+ L   CE K +L      ++ V  FGDSIVDQG NNN+ T  +CN+PPYG+DF     
Sbjct  1     MMFLFLLCEGKTQLLSKNSTIKAVFAFGDSIVDQGNNNNITTIVKCNFPPYGKDFVDGKA  60

Query  1046  TGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATA  867
             TGRF N KTP+D I                     D KTGVSFASG CG+DP TA I + 
Sbjct  61    TGRFTNAKTPADLI---------------------DLKTGVSFASGACGYDPQTASIVSV  99

Query  866   IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDI  687
             IPLSTQLNYF+EY GKLK +VGE + N I+ N+L++VVAG+ND+ NTY+++  R+ +YDI
Sbjct  100   IPLSTQLNYFEEYIGKLKGLVGEKEANKILNNSLYLVVAGSNDLANTYYTIGFRQKQYDI  159

Query  686   NAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQ  507
             ++Y D M+  A  FIQELY LGAR+  +FGIPP GC+P QRTL+GG SR CVEE+N+A+Q
Sbjct  160   DSYTDFMVDKAEHFIQELYKLGARKIGVFGIPPIGCLPFQRTLSGGLSRVCVEEHNQAAQ  219

Query  506   IVNSKLSAEID-SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVT  330
             + N+K+S  I+ SL+NKLPQS +V++DIY+P+LDLI NP+ +GFEV D+GCCGTG IEV 
Sbjct  220   LANTKISLAINGSLSNKLPQSKLVFIDIYDPMLDLILNPKKHGFEVVDKGCCGTGNIEVV  279

Query  329   FLCNKY-TGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              LCN+Y + TC D  KY+F+DS+HPTER Y ILV Q+++KY+  F
Sbjct  280   ILCNRYMSSTCEDDTKYLFFDSYHPTERGYRILVDQMIKKYINSF  324



>gb|KCW53198.1| hypothetical protein EUGRSUZ_J02472 [Eucalyptus grandis]
Length=368

 Score =   398 bits (1023),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 246/351 (70%), Gaps = 4/351 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGR-RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYG  1071
             L   +   + L+ R R  + ++  P   +   IVFGDSI+D G NNN+QT  +CN+PPYG
Sbjct  14    LHAVIFVSLALVARGRLASSVRHKPRPRMPAFIVFGDSIIDPGNNNNIQTIVKCNFPPYG  73

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
             +DF G  P+GRF NGK P D   E  G+K+ LPAY DP+L+ ED  TGVSFASG  G+DP
Sbjct  74    RDFMGGKPSGRFSNGKIPPDLFVEAFGLKQYLPAYLDPSLKLEDLLTGVSFASGATGYDP  133

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
             LT QIA+A+ LS QLN FKEY  K+K   GE + +YI++N+L++VV G++D+ NTY+S P
Sbjct  134   LTPQIASALSLSDQLNLFKEYVNKIKSGAGEEKASYIVKNSLYMVVCGSDDIANTYYSTP  193

Query  710   IRRYKYDINAYADLMIQGAADFI-QELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRAC  534
              RR +YDI AY DLM+  A+ FI QELY LGAR+  I  IPP GCVP+QRTL GG  RAC
Sbjct  194   FRRGEYDIPAYTDLMLNSASSFIQQELYGLGARKISILSIPPIGCVPAQRTLDGGLERAC  253

Query  533   VEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCC  354
                 N+A+ + NSKL +EI+SL  KLP S +VY+DIY+ LL +IQNP +YGFEVA+RGCC
Sbjct  254   NAPANQAATLFNSKLISEIESLKQKLPGSKLVYLDIYHKLLSVIQNPSHYGFEVANRGCC  313

Query  353   GTGVIEVTFLCNKYTG--TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             GTG IEV+ LCN+     TC D +KYVFWDS+HPTE  Y IL   ++  Y 
Sbjct  314   GTGNIEVSILCNRLDDLETCQDDSKYVFWDSYHPTENTYKILTDHVIDNYA  364



>gb|KDP23988.1| hypothetical protein JCGZ_25376 [Jatropha curcas]
Length=359

 Score =   397 bits (1021),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/328 (57%), Positives = 237/328 (72%), Gaps = 2/328 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A I LP    +  V VFGDSIVD G NN ++T A+CN+PPYG+DF G  PTGRF NG+ P
Sbjct  25    ATITLPNNEKIPAVFVFGDSIVDTGNNNYIKTTAKCNFPPYGRDFMGGKPTGRFSNGRVP  84

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SDFIAE  GVK+LLPAY DPNL+ ED  TGV FASGG G+DP+T ++  A  LS Q+  F
Sbjct  85    SDFIAEAFGVKKLLPAYLDPNLKLEDLLTGVVFASGGNGYDPITNKLPPAFSLSDQVEQF  144

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             KEY  K+K  VGE +T  II  ++F++  GTND+LNTY+S P+R+  YDIN+Y D +++ 
Sbjct  145   KEYTRKIKSAVGEEKTATIISKSVFLICTGTNDILNTYYSTPLRQLHYDINSYTDFLVRS  204

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F QELY LG RR  I G+P AGCVPSQRT+ GG  R C +  N+A+ + NSKLS+ I
Sbjct  205   ASSFFQELYGLGVRRIGILGVPAAGCVPSQRTVRGGIERKCADFANQAAILFNSKLSSAI  264

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG--T  303
              SLN  L  + ++Y+DIY PLL LIQNP  YGFEVA +GCCGTG IEVT+LCN++    T
Sbjct  265   YSLNTTLSDANLIYLDIYYPLLSLIQNPAKYGFEVATKGCCGTGKIEVTYLCNRFDDPLT  324

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQIL  219
             C D  KY+FWDS+HPTE+AY  L++ I+
Sbjct  325   CKDDTKYIFWDSYHPTEKAYQTLINMII  352



>ref|XP_010416498.1| PREDICTED: GDSL esterase/lipase EXL2 [Camelina sativa]
Length=366

 Score =   397 bits (1021),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 250/344 (73%), Gaps = 1/344 (0%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQT-FARCNYPPYGQDFA  1059
             + F +LL      A +KLP    +  +IVFGDSIVD G N++++T  ARCNYPPYG DF 
Sbjct  23    LFFLVLLCKTTTNALVKLPSNETIPAIIVFGDSIVDAGNNDDIKTTLARCNYPPYGIDFD  82

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G +PTGRF NGK  +DFIAE  G+K  +PAY +PNL+PED  TGV+FASGG G+ P T Q
Sbjct  83    GGVPTGRFSNGKVATDFIAENFGIKPTIPAYRNPNLKPEDLLTGVTFASGGAGYVPFTTQ  142

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             ++  I L  Q   F+EY  KLK++VGE +TN+II+N+L +V+ G+ND+ NTYF LP  ++
Sbjct  143   LSGGIALPQQQELFEEYIEKLKKLVGEERTNFIIQNSLIMVICGSNDITNTYFGLPSVQH  202

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             KYD++++  LM   A  F  +L++ GARR  +FG+PP GCVPSQRTLAGG +R CV  +N
Sbjct  203   KYDVSSFTTLMADNARSFALKLHEYGARRIQVFGVPPLGCVPSQRTLAGGPTRDCVVRFN  262

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             +A+++ N+KL+A +DSL+  L + TI+YVDIY  LLD+I +PQ YGF+V DRGCCGTG+I
Sbjct  263   DATKLYNAKLAANLDSLSRTLGEKTIIYVDIYGSLLDIILDPQQYGFKVVDRGCCGTGLI  322

Query  338   EVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             EV  LCN     CP+ ++YVFWDSFHPTE+ Y I+  + +++Y+
Sbjct  323   EVAVLCNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYVERYI  366



>gb|AES59784.2| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=402

 Score =   399 bits (1025),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 190/355 (54%), Positives = 250/355 (70%), Gaps = 4/355 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRC---EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPP  1077
             L+ +++  ++L    C   +A +KL P V +  V VFGDSI D G NN  +T ARC++ P
Sbjct  48    LIYTILLHLILFLVVCFETKAIVKLQPNVSIPAVFVFGDSITDTGNNNFKKTIARCDFAP  107

Query  1076  YGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGF  897
             YG+DF G + TGRF NGK PSD I EELG+KE LP Y DP LQP +  TGV FASGG G+
Sbjct  108   YGKDFPGGIATGRFSNGKVPSDLIVEELGIKEFLPPYLDPKLQPSELTTGVCFASGGAGY  167

Query  896   DPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             D LT+++ TAI LS+QL+ FKEY GKL  +VGEN+T +II N++F V  G+ND+ NTYF 
Sbjct  168   DDLTSKLLTAISLSSQLDSFKEYIGKLNALVGENRTKFIIANSVFFVEFGSNDISNTYFI  227

Query  716   LPIRRYKY-DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSR  540
               +R+ KY + ++YAD ++  A++F +E+Y LGARR  IF +PP GCVP QRTLAGG  R
Sbjct  228   SRVRQIKYPEFSSYADFLVSLASNFTKEIYKLGARRIGIFNVPPLGCVPMQRTLAGGFER  287

Query  539   ACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
              CVE+ + A+ + N KLS EIDSL   L  S IVY+D+Y+P+ D+I N Q YGF  ADRG
Sbjct  288   KCVEKISNATMLYNDKLSKEIDSLKQNLSNSRIVYLDVYSPIQDVIANEQKYGFLNADRG  347

Query  359   CCGTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
             CCGTG +EV FLCN+   TC + ++YVFWDSFHPTE  Y  ++  +LQKY+ +F 
Sbjct  348   CCGTGRVEVAFLCNRLAHTCSNDSEYVFWDSFHPTEAMYKRIIVPLLQKYMNQFV  402



>ref|NP_177718.1| GDSL esterase/lipase EXL3 [Arabidopsis thaliana]
 sp|Q94CH6.1|EXL3_ARATH RecName: Full=GDSL esterase/lipase EXL3; AltName: Full=Family 
II extracellular lipase 3; Short=Family II lipase EXL3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK30018.1| family II lipase EXL3 [Arabidopsis thaliana]
 gb|AEE35772.1| GDSL esterase/lipase EXL3 [Arabidopsis thaliana]
Length=364

 Score =   397 bits (1019),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 249/332 (75%), Gaps = 2/332 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             +KLPP +++  VI FGDSIVD GMNNN++T  +C++ PYG +F   + TGRFC+G+ P+D
Sbjct  33    VKLPPKLIIPAVIAFGDSIVDTGMNNNVKTVVKCDFLPYGINFQSGVATGRFCDGRVPAD  92

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +AEELG+K ++PAY DPNL+ +D  TGVSFASGG G+DP+T ++   I L  QL+YF+E
Sbjct  93    LLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKLVAVISLEDQLSYFEE  152

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE + ++I+ N+LF++VAG++D+ NTY++L  R  +YD+++Y  LM   A+
Sbjct  153   YIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYYTLRARP-EYDVDSYTTLMSDSAS  211

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             +F+ +LY  G RR  +FG PP GCVPSQRTL GG  R C + YNEA+++ NSKLS ++DS
Sbjct  212   EFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNEAAKLFNSKLSPKLDS  271

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             L   LP    +Y++IY+PL D+IQNP NYGFEV+++GCCGTG IEV  LCNK T + CPD
Sbjct  272   LRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVSNKGCCGTGAIEVAVLCNKITSSVCPD  331

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + +VFWDS+HPTE+ Y +LV  ++ K+V +F
Sbjct  332   VSTHVFWDSYHPTEKTYKVLVSLLINKFVNQF  363



>ref|XP_008354621.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
 ref|XP_008363080.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=366

 Score =   397 bits (1019),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 240/334 (72%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLP    +  +IVFGDSIVD G NNN+ T  +CN+PPYG+DF G+ PTGRF NG+ P
Sbjct  32    AAVKLPNNEKIPALIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFIGKXPTGRFSNGRVP  91

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD IAE +GVK +LPAY DPNL+ ED  TGVSFASGG G+DPLT QI + + LS QL+ F
Sbjct  92    SDLIAESVGVKNILPAYLDPNLKIEDLLTGVSFASGGSGYDPLTPQIVSVLSLSDQLDLF  151

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             K Y  K+    GE +   I+  ++++V  G++D+ NTY S P+RR  YDI AY DLMI  
Sbjct  152   KNYIRKITAAAGEERAATIVSKSIYIVCIGSDDIANTYLSTPVRRPYYDIPAYTDLMINS  211

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F+QELY LGARR  +  +P  GCVPSQRT+ GG +R C E  N+A+++ NSKLSA I
Sbjct  212   ASSFLQELYGLGARRIGVINLPAIGCVPSQRTVGGGINRDCSETANQAARLFNSKLSAXI  271

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTC  300
             D+ N +LP++ +VY+DIY  LL LIQNP  YGFEVA++GCCGTG IEV+ LC +Y+ GTC
Sbjct  272   DAFNKRLPEARVVYLDIYYTLLSLIQNPTXYGFEVANKGCCGTGNIEVSVLCTRYSPGTC  331

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D +KY+FWDS+HPTE+ Y  LV  +    + +F
Sbjct  332   NDSSKYIFWDSYHPTEKXYEXLVPLVFDTQIRKF  365



>ref|XP_008357124.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=380

 Score =   397 bits (1019),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/334 (57%), Positives = 242/334 (72%), Gaps = 0/334 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             E  +KLPP   V  VIVFGDSI+D G NN+L++  RCN+PPYG DF   MP+GRF NGK 
Sbjct  44    EGLVKLPPNQTVPAVIVFGDSIMDTGNNNDLESLVRCNFPPYGLDFQQHMPSGRFGNGKV  103

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA ELG++E LPAY D NL+P+D  TGV FASGG GFDP+T QI + I +  QL  
Sbjct  104   PSDLIASELGIREYLPAYLDXNLRPQDLPTGVVFASGGTGFDPMTPQIXSVISMDDQLKM  163

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK +VGE +T +I+   L +VV+G++D+ NTYF + IR+ +Y + AY DLM+ 
Sbjct  164   FKEYIAKLKGVVGEERTEFILSKALVLVVSGSDDIANTYFGIRIRQAQYSVPAYTDLMVN  223

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F++ELY LG RR  +F  PP GCVPSQRTL GG  R C EE+N+A+++ N KLS+ 
Sbjct  224   SASSFVKELYKLGVRRIGVFSAPPIGCVPSQRTLGGGILRGCAEEHNDAAKLFNIKLSSS  283

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             ++SL++ L  S IVYVD+YNPLLD+I NP  YGF+V D+GCCGTG IEV  LCNKY  TC
Sbjct  284   LNSLSSALSGSKIVYVDVYNPLLDIILNPAKYGFKVVDQGCCGTGEIEVAVLCNKYDSTC  343

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + + YVFWDS+HPTE  Y IL+  ++ KY+  F
Sbjct  344   ENRSDYVFWDSYHPTEGTYNILIPSLINKYINNF  377



>ref|XP_010320440.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g14820-like 
[Solanum lycopersicum]
Length=368

 Score =   396 bits (1017),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 249/347 (72%), Gaps = 11/347 (3%)
 Frame = -1

Query  1238  SVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFA  1059
             S+ + +LLL    +A + +P    ++ VIVFGDSIVD G NN L T  + NYPPYG+DF 
Sbjct  26    SICYAVLLLCN-VQADMNVPHNKSIQAVIVFGDSIVDTGNNNGLTTIGKVNYPPYGKDFM  84

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G  PTGRFCNGK P D I EELG+KELLPAY DP LQ ED  TGV+FASGG G+DPLT++
Sbjct  85    GGKPTGRFCNGKVPPDLIVEELGIKELLPAYLDPTLQAEDLITGVNFASGGAGYDPLTSE  144

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             IA  I LS QL  FKEY  K ++       N I+ N+L+++V G+ND+ NTYFS  +R+ 
Sbjct  145   IANVISLSGQLKMFKEYIVKXRK-------NEILANSLYILVVGSNDITNTYFSTHLRKS  197

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
              YDI++YAD ++   + F+++LY++GARR  +FGIPP GC+PSQRTL GG+ R CV+  N
Sbjct  198   YYDISSYADFLLNYGSSFVKDLYEIGARRIGVFGIPPIGCLPSQRTLKGGEERQCVDYLN  257

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             +A+ + NSKL+A++ SL NKLP S +VYVDIYN  LD+I NPQ YGF++AD+GCCGTG I
Sbjct  258   QAALLFNSKLAADLSSLGNKLPNSRLVYVDIYNLPLDVINNPQKYGFKIADKGCCGTGQI  317

Query  338   EVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             EV  LC      C   + YVFWDSFH TE+AY +LVH+IL +++  F
Sbjct  318   EVAELCRF---ACSSDSDYVFWDSFHLTEKAYRLLVHKILVQHLSSF  361



>ref|XP_009104692.1| PREDICTED: GDSL esterase/lipase EXL3-like [Brassica rapa]
Length=362

 Score =   395 bits (1016),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 246/332 (74%), Gaps = 2/332 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             IKLPP + +  +I FGDSIVD G NNN++T  +C++ PYG +F G +PTGRFC+G+ P+D
Sbjct  31    IKLPPNLKIPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQGGVPTGRFCDGRVPAD  90

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +AEE+G+K ++PAY DPNL P+D  TGVSFASGG G+DP+T ++  AI L  QL YF+E
Sbjct  91    LLAEEVGIKSVVPAYLDPNLTPKDLLTGVSFASGGSGYDPITPKLVAAISLQKQLEYFEE  150

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE + N+I+ N+LF++VAG++D+ NTY+ L  R + YD+++Y  LM   A+
Sbjct  151   YIEKVKNLVGEERKNFILANSLFLLVAGSDDIANTYYDLHARPH-YDVDSYTTLMANSAS  209

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             DF+ +LY  G RR  +FG PP GC+PSQRTL GG  R C E YN+A+++ NSK+S ++D 
Sbjct  210   DFVNKLYGYGVRRIAVFGAPPLGCIPSQRTLGGGLLRECAEYYNDAAKLFNSKISTKLDY  269

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             L   LP S  VY++IY+PL D+IQNP  YGF V+++GCCGTG IEV  LCNK T + CPD
Sbjct  270   LRKTLPDSKPVYINIYDPLYDIIQNPTKYGFGVSNKGCCGTGAIEVAVLCNKITSSVCPD  329

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + +VFWDS+HPTE+ Y +LV  ++ K+V +F
Sbjct  330   VSSHVFWDSYHPTEKTYKVLVSLLVDKFVNQF  361



>ref|XP_006425399.1| hypothetical protein CICLE_v10025900mg [Citrus clementina]
 ref|XP_006466996.1| PREDICTED: GDSL esterase/lipase EXL3-like [Citrus sinensis]
 gb|ESR38639.1| hypothetical protein CICLE_v10025900mg [Citrus clementina]
Length=369

 Score =   395 bits (1015),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 234/320 (73%), Gaps = 2/320 (1%)
 Frame = -1

Query  1166  VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGV  987
             V  V VFGDSI D G NNN++T  +CN+PPYG+DF G++ TGRF NG  PSD IA+E G+
Sbjct  44    VPAVFVFGDSIADPGNNNNIKTIIKCNFPPYGRDFKGKIATGRFSNGVIPSDLIAQEFGI  103

Query  986   KELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEM  807
             KELLPAY DPNL+P+D  TGVSFASGG G+DPLT+++A+A+ +S QL+ FK+    +K  
Sbjct  104   KELLPAYLDPNLKPQDLVTGVSFASGGAGYDPLTSKVASALSMSDQLDLFKKALETIKAT  163

Query  806   VGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYD  627
              GE  T  I+   LF+VV+G++D+ NTY S P RR +YDIN+Y DL    A  F+QELY 
Sbjct  164   AGEEATANILSKGLFMVVSGSDDIANTYLSTPFRRGQYDINSYTDLTASSALSFLQELYG  223

Query  626   LGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQS  447
             +GARR  +  +PP GCVP QRTL GG +R C +  N+A+QI NSKL + +DSL+ + P S
Sbjct  224   VGARRIGVLSLPPIGCVPVQRTLNGGIARGCSDFANQAAQIYNSKLQSVVDSLSKEFPDS  283

Query  446   TIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKY--TGTCPDHNKYVFW  273
               VY DIYNPL  LIQNP  YGFEVAD+GCCGTG +EV+ LCN+     TCPD +KY+FW
Sbjct  284   RFVYFDIYNPLNSLIQNPPQYGFEVADKGCCGTGNLEVSILCNRLEDAATCPDASKYIFW  343

Query  272   DSFHPTERAYGILVHQILQK  213
             DS+HPTE+AY IL  +IL +
Sbjct  344   DSYHPTEKAYKILTPKILNQ  363



>ref|XP_009334746.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=370

 Score =   395 bits (1015),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 244/334 (73%), Gaps = 0/334 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             E  +KLP       VIVFGDSI+D G NN+L++  +CN+ PYG+DF    PTGRF NGK 
Sbjct  35    EGLVKLPSNQTFPAVIVFGDSIMDTGNNNHLKSLVKCNFSPYGRDFQQHKPTGRFGNGKV  94

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA +LG++E LPAY DPNL+P+D   GV FASGG G+DP+T QI + I +  QL  
Sbjct  95    PSDIIASQLGIQEYLPAYLDPNLRPQDLPAGVVFASGGTGYDPMTPQIVSVISMDDQLKM  154

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK +VGE +T +I+ N L +VVAG++D+ NTYF++ IR+ +Y + AY DLM+ 
Sbjct  155   FKEYIVKLKGVVGEERTQFILSNALVLVVAGSDDIANTYFTIRIRKAQYSVPAYTDLMVN  214

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F++ELY LGARR  +F  PP GCVPSQRTL GG  R C EEYN+A+++ N KLS+ 
Sbjct  215   SASSFVKELYKLGARRIGVFSAPPIGCVPSQRTLGGGILRMCAEEYNDAAKLFNIKLSSS  274

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             +++L++ LP S IVYVDIYNPLLD+I NP   GF+V ++GCCGTG IEV  LCNK+  TC
Sbjct  275   LNTLSSALPHSKIVYVDIYNPLLDIILNPAKSGFKVVEKGCCGTGNIEVAVLCNKFDSTC  334

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + + YVFWDS+HPTER Y I+V  +LQ+Y+  F
Sbjct  335   ENPSDYVFWDSYHPTERTYNIIVPSLLQRYMKDF  368



>ref|XP_010033516.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
Length=367

 Score =   395 bits (1015),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 244/350 (70%), Gaps = 3/350 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGR-RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYG  1071
             L   ++  + L+ R R  +  +  P   +   I FGDSI+D G NNN+QT  +CN+PPYG
Sbjct  14    LYAVILVSLALVARGRLASSARPRPRPPLLAYIAFGDSIIDPGNNNNIQTIVKCNFPPYG  73

Query  1070  QDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDP  891
             +DF G  P+GRF NGK P D   E  GVK+ LPAY DP+L+ ED  TGVSFASG  G+DP
Sbjct  74    RDFMGGKPSGRFSNGKIPPDLFVEAFGVKQYLPAYLDPSLKLEDLLTGVSFASGATGYDP  133

Query  890   LTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP  711
             LT QIA+A+ LS QLN FKEY  K+K   GE +   I++N++++VV G++D+ NTY+S P
Sbjct  134   LTPQIASALSLSDQLNLFKEYVNKIKSGAGEEKAADIVKNSVYMVVCGSDDIANTYYSTP  193

Query  710   IRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
              RR +YDI AY DLM+  A+ FIQELY LGAR+  I  +PP GCVP+QRTL GG  RAC 
Sbjct  194   FRRGEYDIPAYTDLMLNSASSFIQELYGLGARKIGILSLPPIGCVPAQRTLDGGLERACN  253

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
                N+A+ + NSKLS+E++SL  KLP S +VY+DIY+ LL +IQNP +YGFEVADRGCCG
Sbjct  254   APANQAATLFNSKLSSELESLKQKLPGSKLVYMDIYHKLLSVIQNPSHYGFEVADRGCCG  313

Query  350   TGVIEVTFLCNKYTG--TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             TG IEV+ LCN+     TC D +KYVFWD +HPTE AY IL   ++  Y 
Sbjct  314   TGNIEVSILCNRLDDLETCQDDSKYVFWDGYHPTENAYKILSDHVIDNYA  363



>dbj|BAC41809.1| putative family II lipase EXL3 [Arabidopsis thaliana]
Length=364

 Score =   395 bits (1014),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 249/332 (75%), Gaps = 2/332 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             +KLPP +++  VI FGDSIVD G+NNN++T  +C++ PYG +F   + TGRFC+G+ P+D
Sbjct  33    VKLPPKLIIPAVIAFGDSIVDTGINNNVKTVVKCDFLPYGINFQSGVATGRFCDGRVPAD  92

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +AEELG+K ++PAY DPNL+ +D  TGVSFASGG G+DP+T ++   I L  QL+YF+E
Sbjct  93    LLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKLVAVISLEDQLSYFEE  152

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE + ++I+ N+LF++VAG++D+ NTY++L  R  +YD+++Y  LM   A+
Sbjct  153   YIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYYTLRARP-EYDVDSYTTLMSDSAS  211

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             +F+ +LY  G RR  +FG PP GCVPSQRTL GG  R C + YNEA+++ NSKLS ++DS
Sbjct  212   EFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNEAAKLFNSKLSPKLDS  271

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             L   LP    +Y++IY+PL D+IQNP NYGFEV+++GCCGTG IEV  LCNK T + CPD
Sbjct  272   LRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVSNKGCCGTGAIEVAVLCNKITSSVCPD  331

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + +VFWDS+HPTE+ Y +LV  ++ K+V +F
Sbjct  332   VSTHVFWDSYHPTEKTYKVLVSLLINKFVNQF  363



>emb|CDX85929.1| BnaC06g22050D [Brassica napus]
Length=362

 Score =   394 bits (1013),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 246/332 (74%), Gaps = 2/332 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             IKLPP + +  +I FGDSIVD G NNN++T  +C++ PYG +F G +PTGRFC+G+ P+D
Sbjct  31    IKLPPNLKIPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQGGVPTGRFCDGRVPAD  90

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +AEE+G+K ++PAY DPNL P+D  TGVSFASGG G+DP+T ++  AI L  QL YF+E
Sbjct  91    LLAEEVGIKSVVPAYLDPNLTPKDLLTGVSFASGGSGYDPITPKLVAAISLQKQLEYFEE  150

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE + N+I+ N+LF++VAG++D+ NTY+ L  R + YD+++Y  LM   A+
Sbjct  151   YIEKVKNLVGEERKNFILANSLFLLVAGSDDIANTYYDLHARPH-YDVDSYTTLMANSAS  209

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             DF+ +LY  G RR  +FG PP GC+PSQRTL GG  R C E YN+A+++ NSK+S ++D 
Sbjct  210   DFVNKLYGYGVRRIAVFGAPPLGCIPSQRTLGGGLLRECAEYYNDAAKLFNSKISTKLDY  269

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             L   LP S  VY++IY+PL D+IQNP  YGF V+++GCCGTG IEV  LCNK T + CPD
Sbjct  270   LLKTLPDSKPVYINIYDPLYDIIQNPTKYGFGVSNKGCCGTGAIEVAVLCNKITSSVCPD  329

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + +VFWDS+HPTE+ Y +LV  ++ K+V +F
Sbjct  330   VSSHVFWDSYHPTEKTYKVLVSLLIDKFVNQF  361



>ref|NP_001077829.1| GDSL esterase/lipase EXL2 [Arabidopsis thaliana]
 gb|ABE65777.1| family II extracellular lipase 2 [Arabidopsis thaliana]
 gb|AEE35771.1| GDSL esterase/lipase EXL2 [Arabidopsis thaliana]
Length=366

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 246/345 (71%), Gaps = 2/345 (1%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFA  1059
             V F +LL      A +K PP      +IVFGDSIVD G N++ + T ARCNYPPYG DF 
Sbjct  22    VFFLVLLCKTSTNALVKQPPNETTPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDFD  81

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G +PTGRFCNGK  +DFIA + G+K  +PAY +PNL+PED  TGV+FASGG G+ P T Q
Sbjct  82    GGIPTGRFCNGKVATDFIAGKFGIKPSIPAYRNPNLKPEDLLTGVTFASGGAGYVPFTTQ  141

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             ++  I LS QL  F+EY  K+K+MVGE +T  II+N+LF+V+ G+ND+ NTYF LP  + 
Sbjct  142   LSGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSNDITNTYFGLPSVQQ  201

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             +YD+ ++  LM   A  F Q+L++ GARR  +FG PP GCVPSQRTLAGG +R CV  +N
Sbjct  202   QYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRFN  261

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             +A+++ N KL+A + SL+  L   TI+YVDIY+ LLD+I +P+ YGF+V D+GCCGTG+I
Sbjct  262   DATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGFKVVDKGCCGTGLI  321

Query  338   EVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             EV  LCN +    CP+ ++YVFWDSFHPTE+ Y I+  +  ++YV
Sbjct  322   EVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYFERYV  366



>gb|ABK28470.1| unknown [Arabidopsis thaliana]
Length=367

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 246/345 (71%), Gaps = 2/345 (1%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFA  1059
             V F +LL      A +K PP      +IVFGDSIVD G N++ + T ARCNYPPYG DF 
Sbjct  22    VFFLVLLCKTSTNALVKQPPNETTPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDFD  81

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G +PTGRFCNGK  +DFIA + G+K  +PAY +PNL+PED  TGV+FASGG G+ P T Q
Sbjct  82    GGIPTGRFCNGKVATDFIAGKFGIKPSIPAYRNPNLKPEDLLTGVTFASGGAGYVPFTTQ  141

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             ++  I LS QL  F+EY  K+K+MVGE +T  II+N+LF+V+ G+ND+ NTYF LP  + 
Sbjct  142   LSGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSNDITNTYFGLPSVQQ  201

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             +YD+ ++  LM   A  F Q+L++ GARR  +FG PP GCVPSQRTLAGG +R CV  +N
Sbjct  202   QYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRFN  261

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             +A+++ N KL+A + SL+  L   TI+YVDIY+ LLD+I +P+ YGF+V D+GCCGTG+I
Sbjct  262   DATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGFKVVDKGCCGTGLI  321

Query  338   EVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             EV  LCN +    CP+ ++YVFWDSFHPTE+ Y I+  +  ++YV
Sbjct  322   EVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYFERYV  366



>ref|XP_009336660.1| PREDICTED: GDSL esterase/lipase EXL1-like [Pyrus x bretschneideri]
Length=359

 Score =   393 bits (1009),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 246/350 (70%), Gaps = 6/350 (2%)
 Frame = -1

Query  1244  MVSVVFPML----LLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPP  1077
             M S+ F +L    L+    +A +KLP  V +  V +FGDSIVD G NNNL T  + N+PP
Sbjct  1     MTSLFFFLLGSLDLIFSTAQATVKLPKNVTIPAVFMFGDSIVDTGNNNNLVTIIKSNFPP  60

Query  1076  YGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGF  897
             YG+DF G + TGRF NGK PSD + EELG+K+LLPAY DPNLQ +D+ TGV+FASG  GF
Sbjct  61    YGRDFMGGVATGRFGNGKVPSDIVVEELGIKKLLPAYLDPNLQEKDFATGVNFASGASGF  120

Query  896   DPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             DPLT+++ + IPLS QL   KEYK KLK  VG  +   I+  +L  VV G++D++NTYF 
Sbjct  121   DPLTSEMMSVIPLSEQLLLLKEYKEKLKNYVGGKRAKSIVSKSLHFVVTGSDDLVNTYFH  180

Query  716   LPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRA  537
              P R  +Y+I+AY D M+  A+ F++ELY LGARR VI G+PP GC+PS RT+ GG  R 
Sbjct  181   TPARSLQYNIDAYIDFMVAEASAFVRELYALGARRIVISGLPPVGCLPSMRTVDGGSERN  240

Query  536   CVEEYNEASQIVNSKLSAEIDSLNNKLPQS-TIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
             CV  YN+A+++ NSKLS E+D LN +L  +  +V +D+Y P +D+I  PQ YGF+V D+G
Sbjct  241   CVARYNQAAELFNSKLSVEVDRLNKQLFHAKVVVLMDVYGPFMDIILKPQKYGFKVEDKG  300

Query  359   CCGTGVIEVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQK  213
             CCGTG IEV  LCN+ +  TC +  +YVFWDS+HPTER Y + V ++LQK
Sbjct  301   CCGTGRIEVVRLCNRLSPNTCNNTREYVFWDSYHPTERVYKLFVPKLLQK  350



>ref|XP_006601360.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
 gb|KHN12630.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=372

 Score =   393 bits (1010),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 185/352 (53%), Positives = 249/352 (71%), Gaps = 5/352 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLG-RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQT-FARCNYPPY  1074
             L++ +   +LL+  +  +  +KLP  V V  V VFGDS+VD G NNN  T FAR N+PPY
Sbjct  23    LVLRLTLIILLVSCKTIKGLVKLPADVSVPAVFVFGDSVVDTGNNNNRTTSFARSNFPPY  82

Query  1073  GQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFD  894
             G+DF G +PTGRF NGK PSD I EELG+KELLPAY  PNLQ  D  TGV FASGG G+D
Sbjct  83    GRDFQGGIPTGRFSNGKVPSDLIVEELGIKELLPAYLKPNLQSSDLITGVCFASGGSGYD  142

Query  893   PLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSL  714
             PLT+ + +++PL+ Q++  KEY GKLK +VGE++  +I+ N+LF+VVAG++D+ NTY + 
Sbjct  143   PLTSILESSMPLTGQVDLLKEYIGKLKGLVGEDRAKFILANSLFIVVAGSSDISNTYRT-  201

Query  713   PIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRAC  534
               R   YD+ AY DL++  A++F+ E+ +LGARR  +F  PP GC+P QRT+ GG  + C
Sbjct  202   --RSLLYDLPAYTDLLVNSASNFLTEINELGARRIAVFSAPPIGCLPFQRTVGGGLEKRC  259

Query  533   VEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCC  354
              E  N  +Q+ N+KLS E+DSLN   P S  V++++Y+PLLD+I N Q YG++V D GCC
Sbjct  260   AERPNNLAQLFNTKLSKELDSLNRNFPNSRNVFINVYDPLLDIITNHQKYGYKVGDTGCC  319

Query  353   GTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             GTG IEV  LCN++  +CP+   YVFWDSFHPTE  Y  L+  ILQKY+ +F
Sbjct  320   GTGRIEVAILCNRFDSSCPNVQDYVFWDSFHPTESVYKRLISPILQKYLDQF  371



>emb|CDX68113.1| BnaA07g21530D [Brassica napus]
Length=362

 Score =   393 bits (1009),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 245/332 (74%), Gaps = 2/332 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             IKLPP + +  +I FGDSIVD G NNN++T  +C++ PYG +F G +PTGRFC+G+ P+D
Sbjct  31    IKLPPNLKIPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQGGVPTGRFCDGRVPAD  90

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +AEE+G+K ++PAY DPNL P+D  TGVSFASGG G+DP+T ++  AI L  QL YF+E
Sbjct  91    LLAEEVGIKSVVPAYLDPNLTPKDLLTGVSFASGGSGYDPITPKLVAAISLQKQLEYFEE  150

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE + N+I+ N+LF++VAG++D+ NTY+ L  R + YD+++Y  LM   A+
Sbjct  151   YIEKVKNLVGEERKNFILANSLFLLVAGSDDIANTYYDLHARPH-YDVDSYTTLMANSAS  209

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             DF+ +L+  G RR  +FG PP GC+PSQRTL GG  R C E YN+A+++ NSK+S ++D 
Sbjct  210   DFVNKLHGYGVRRIAVFGAPPLGCIPSQRTLGGGLLRECAEYYNDAAKLFNSKISTKLDY  269

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             L   LP S  VY++IY+PL D+IQNP  YGF V+++GCCGTG IEV  LCNK T + CPD
Sbjct  270   LRKTLPDSKPVYINIYDPLYDIIQNPTKYGFGVSNKGCCGTGAIEVAVLCNKITSSVCPD  329

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
                +VFWDS+HPTE+ Y +LV  ++ K+V +F
Sbjct  330   VFSHVFWDSYHPTEKTYKVLVSLLVDKFVNQF  361



>ref|XP_008387914.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=370

 Score =   392 bits (1008),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 243/334 (73%), Gaps = 0/334 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             E  + LP       VIVFGDSI+D G NN+L++  +CN+ PYG+DF    PTGRF NGK 
Sbjct  35    EGLVMLPSNQTFPAVIVFGDSIMDTGNNNHLKSLVKCNFSPYGRDFQQHKPTGRFGNGKV  94

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA +LG++E LPAY DPNL+P+D   GV FASGG G+DP+T QI + I +  QL  
Sbjct  95    PSDIIASQLGIQEYLPAYLDPNLRPQDLPAGVVFASGGTGYDPMTPQIVSVISMDDQLKM  154

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK +VGE +T +I+ N L +VVAG++D+ NTYF++ IR+ +Y + AY DLM+ 
Sbjct  155   FKEYIVKLKGVVGEERTQFILSNALVLVVAGSDDIANTYFTIRIRKAQYSVPAYTDLMVN  214

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F++ELY LGARR  +F  PP GCVPSQRTL GG  R C EEYN+A+++ N KLS+ 
Sbjct  215   SASSFVKELYKLGARRIGLFSAPPIGCVPSQRTLGGGILRMCAEEYNDAAKLFNIKLSSS  274

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTC  300
             ++SL++ LP S IVYVDIYNPLLD+I NP   GF+V ++GCCGTG IEV  LCNK+  TC
Sbjct  275   LNSLSSALPHSKIVYVDIYNPLLDIILNPAKSGFKVVEKGCCGTGNIEVAVLCNKFDSTC  334

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + + YVFWDS+HPTER Y +L+  +LQ+Y+  F
Sbjct  335   ENPSDYVFWDSYHPTERTYNVLIPPLLQRYIKDF  368



>ref|XP_003589533.1| GDSL esterase/lipase [Medicago truncatula]
Length=517

 Score =   397 bits (1021),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 248/351 (71%), Gaps = 4/351 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRC---EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPP  1077
             L+ +++  ++L    C   +A +KL P V +  V VFGDSI D G NN  +T ARC++ P
Sbjct  48    LIYTILLHLILFLVVCFETKAIVKLQPNVSIPAVFVFGDSITDTGNNNFKKTIARCDFAP  107

Query  1076  YGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGF  897
             YG+DF G + TGRF NGK PSD I EELG+KE LP Y DP LQP +  TGV FASGG G+
Sbjct  108   YGKDFPGGIATGRFSNGKVPSDLIVEELGIKEFLPPYLDPKLQPSELTTGVCFASGGAGY  167

Query  896   DPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             D LT+++ TAI LS+QL+ FKEY GKL  +VGEN+T +II N++F V  G+ND+ NTYF 
Sbjct  168   DDLTSKLLTAISLSSQLDSFKEYIGKLNALVGENRTKFIIANSVFFVEFGSNDISNTYFI  227

Query  716   LPIRRYKY-DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSR  540
               +R+ KY + ++YAD ++  A++F +E+Y LGARR  IF +PP GCVP QRTLAGG  R
Sbjct  228   SRVRQIKYPEFSSYADFLVSLASNFTKEIYKLGARRIGIFNVPPLGCVPMQRTLAGGFER  287

Query  539   ACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
              CVE+ + A+ + N KLS EIDSL   L  S IVY+D+Y+P+ D+I N Q YGF  ADRG
Sbjct  288   KCVEKISNATMLYNDKLSKEIDSLKQNLSNSRIVYLDVYSPIQDVIANEQKYGFLNADRG  347

Query  359   CCGTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             CCGTG +EV FLCN+   TC + ++YVFWDSFHPTE  Y  ++  +LQKY+
Sbjct  348   CCGTGRVEVAFLCNRLAHTCSNDSEYVFWDSFHPTEAMYKRIIVPLLQKYM  398



>gb|KHN39411.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=314

 Score =   390 bits (1002),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 225/308 (73%), Gaps = 0/308 (0%)
 Frame = -1

Query  1118  NNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPED  939
             NNNL T AR N+PPYGQDF G +PTGRFCNGK PSD + EELG+KE LPAY DPNL+  +
Sbjct  7     NNNLITSARSNFPPYGQDFKGGIPTGRFCNGKVPSDILVEELGIKEFLPAYLDPNLELNE  66

Query  938   YKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFV  759
               TGV FASGG G+DPLT+Q ATAIPLS QL+ FKEY  KLK  VGE++TN+I+ N LF 
Sbjct  67    LPTGVCFASGGSGYDPLTSQTATAIPLSGQLDMFKEYIVKLKGHVGEDRTNFILANALFF  126

Query  758   VVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGC  579
             VV G+ND+ NTYF   +R  +YD+  Y+D M+  A++F +E+Y LGARR  +   PP GC
Sbjct  127   VVLGSNDISNTYFLTHLRELQYDVPTYSDFMLNSASNFFEEIYQLGARRIAVVSAPPVGC  186

Query  578   VPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQ  399
             VP  RTL+GG +R CV++YN+A  + N KLS +I+SLN KLP S IVY D+YNPLLD+  
Sbjct  187   VPFHRTLSGGIARKCVQKYNDAVLLFNDKLSKKINSLNQKLPNSRIVYFDVYNPLLDVTV  246

Query  398   NPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQIL  219
             N Q YG++V DRGCCGTG +EV   CN    TC +   YVFWD FHP+E  Y  LV  +L
Sbjct  247   NHQKYGYKVGDRGCCGTGNLEVALTCNHLDATCSNVLDYVFWDGFHPSESVYKQLVPPLL  306

Query  218   QKYVYRFA  195
             QKY++RFA
Sbjct  307   QKYIHRFA  314



>ref|XP_010428640.1| PREDICTED: GDSL esterase/lipase EXL3-like [Camelina sativa]
Length=363

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 244/331 (74%), Gaps = 2/331 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLPP +++  VI FGDSIVD GMNN ++T  +C++ PYG +F G + TGRFC+G+ P
Sbjct  30    AAVKLPPNLIIPAVIAFGDSIVDTGMNNYVKTIVKCDFQPYGINFQGGVATGRFCDGRVP  89

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
              D IAEELG+K  +PAYFD  L  +D  TGVSFASGG G+DP+T ++ T I L  QL YF
Sbjct  90    VDLIAEELGIKSTVPAYFDSKLNSKDLLTGVSFASGGSGYDPITPKLVTVISLEEQLTYF  149

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             +EY  K+K +VGE + ++II N+LF+VVAG++D+ NTY++L  R + YD+++Y  LM   
Sbjct  150   EEYIEKVKNIVGEERKDFIIANSLFLVVAGSDDIANTYYTLRARPH-YDVDSYTTLMSDS  208

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+DF+ +LY  G RR  +F  PP GCVPSQRTL GG  R C + YN+A+++ NSKLS ++
Sbjct  209   ASDFVTKLYGYGVRRLAVFSAPPIGCVPSQRTLGGGILRDCADTYNQAAKLFNSKLSPKL  268

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-C  300
             D L+  LP    +YV+IY+PLLD+IQNP  YGF+VA++GCCGTGVIEV+ LCNK T + C
Sbjct  269   DMLHKTLPGIKPMYVNIYDPLLDIIQNPAKYGFKVANKGCCGTGVIEVSVLCNKITSSVC  328

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             PD + +VFWDS+HPTE  Y +LV  ++ K++
Sbjct  329   PDVSNHVFWDSYHPTEHTYKVLVSLLINKFI  359



>ref|XP_010471733.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X3 [Camelina 
sativa]
 ref|XP_010471736.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X3 [Camelina 
sativa]
 ref|XP_010471739.1| PREDICTED: GDSL esterase/lipase EXL1-like isoform X3 [Camelina 
sativa]
Length=360

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 241/351 (69%), Gaps = 15/351 (4%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             L     F +LL      A +KLP    V  VIVFGDSIVD G N+++ T ARC+Y PYG 
Sbjct  23    LFWCTFFLVLLFTTTTHALVKLPENTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGI  82

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G + TGRF NGK P D +AEELG+K  +PAY DPNL+PED  TGV+FASGG G+ PL
Sbjct  83    DFDGGVATGRFSNGKVPGDIVAEELGIKPSIPAYRDPNLKPEDLLTGVTFASGGAGYVPL  142

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T ++A              Y  KLK MVGE +T +II+N+LFVV+ G+ND+ N +F+LP 
Sbjct  143   TTKLA--------------YIAKLKAMVGEERTQFIIKNSLFVVICGSNDIANDFFALPP  188

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
              +  Y + ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R CV 
Sbjct  189   VQLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVA  248

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
              +N+AS++ NSKLSA ID+L+  L   TI+Y+DIY+PLLDLI +PQ YGF+V D+GCCGT
Sbjct  249   RFNDASKLFNSKLSANIDALSTTLQDPTIIYIDIYSPLLDLILSPQQYGFKVGDKGCCGT  308

Query  347   GVIEVTFLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G+IEVT LCN YT   CP  + YVFWDSFHPTE+AY I+V ++  KY  RF
Sbjct  309   GLIEVTALCNNYTAAVCPIRSDYVFWDSFHPTEKAYRIIVAKLFDKYFDRF  359



>ref|XP_007160642.1| hypothetical protein PHAVU_001G004600g [Phaseolus vulgaris]
 gb|ESW32636.1| hypothetical protein PHAVU_001G004600g [Phaseolus vulgaris]
Length=370

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/350 (54%), Positives = 243/350 (69%), Gaps = 4/350 (1%)
 Frame = -1

Query  1244  MVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQT-FARCNYPPYGQ  1068
             M+  +  +L +  + E  +KLPP V V  V VFGDS+VD G NNN  T FAR N+PPYG+
Sbjct  23    MLRFILLLLFVCCKTEGLLKLPPNVSVPAVFVFGDSVVDTGNNNNRTTSFARSNFPPYGR  82

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G +PTGRF NGK PSD I EELG+KE LP Y  PNLQP D  TGV FASGG G+DPL
Sbjct  83    DFQGGIPTGRFSNGKVPSDLIVEELGIKEFLPPYLKPNLQPSDLVTGVCFASGGSGYDPL  142

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T+ I  +IP+S QL+ FKEY GKLK +VGE +  +I+ N+LF+VVAG++D+ NTY +   
Sbjct  143   TSVIEGSIPVSGQLDLFKEYIGKLKGVVGEERAKFILANSLFIVVAGSSDISNTYRT---  199

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             R   YD+ +Y+DL++  A+ F+ EL +LGARR  +F  PP GC+P QRT+ GG  + C +
Sbjct  200   RSLLYDLPSYSDLLLNSASKFLTELNELGARRIAVFSAPPIGCLPFQRTVGGGIEKKCAQ  259

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
               N  +Q+ N+KLS  + SLN   P S  V+++IY+PLLD+I N Q YG++V D GCCGT
Sbjct  260   RPNNLAQLFNTKLSNLLHSLNRNFPNSRNVFINIYDPLLDIILNYQKYGYKVGDTGCCGT  319

Query  347   GVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G IEV  LCN    TC + + YVFWDSFHPTE  Y  L+  ILQKY+Y+F
Sbjct  320   GRIEVAILCNSLDSTCSNVHDYVFWDSFHPTESVYKRLIAPILQKYLYQF  369



>ref|XP_009106247.1| PREDICTED: GDSL esterase/lipase EXL3 [Brassica rapa]
 emb|CDX87651.1| BnaA07g32220D [Brassica napus]
Length=362

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 244/333 (73%), Gaps = 2/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             IKLPP +    +I FGDSIVD G NNN++T  +C++ PYG +F G +PTGRFC+G+ P D
Sbjct  31    IKLPPNLTFPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQGGVPTGRFCDGRVPPD  90

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              IAEELG+K ++PAY DP+L+ ED  TGVSFASGG G+DPLT ++   I L  QL YF+E
Sbjct  91    LIAEELGIKSVVPAYLDPSLKTEDLLTGVSFASGGSGYDPLTPKLVAVISLEDQLKYFEE  150

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE +  +I+ N+LF++VAG++D+ NTY+ L  R + YD+++Y  LM+  A+
Sbjct  151   YIEKVKNIVGEERKGFILANSLFLLVAGSDDIANTYYVLRARPH-YDVDSYTTLMVNSAS  209

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             DF+ +LY  G RR  +FG PP GCVPSQRTL GG  R C E YNEA+++ NSK+S ++D 
Sbjct  210   DFVNKLYGYGVRRIAVFGAPPLGCVPSQRTLGGGLLRECAENYNEAAKLFNSKISPKLDL  269

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             +   LP    VY++IY+PLLD+IQ+P  YGF V+++GCCGTGVIEV  LCNK T + CPD
Sbjct  270   MQKTLPGIKPVYINIYDPLLDIIQSPAKYGFGVSNKGCCGTGVIEVAVLCNKITSSVCPD  329

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRFA  195
              + +VFWDS+HPTE+ Y +L+  ++ K+V +F 
Sbjct  330   VSSHVFWDSYHPTEKTYKVLISLLISKFVDQFV  362



>emb|CDX73211.1| BnaC06g36590D [Brassica napus]
Length=362

 Score =   391 bits (1004),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 244/332 (73%), Gaps = 2/332 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             IKLPP +    +I FGDSIVD G NNN++T  +C++ PYG +F G +PTGRFC+G+ P D
Sbjct  31    IKLPPNLTFPALIAFGDSIVDTGNNNNVKTVVKCDFQPYGINFQGGVPTGRFCDGRVPPD  90

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              IAEELG+K ++PAY DPNL+ ED  TGVSFASGG G+DPLT ++   I L  QL YF+E
Sbjct  91    LIAEELGIKSVVPAYLDPNLKTEDLLTGVSFASGGSGYDPLTPKLVAVISLEDQLKYFEE  150

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE +  +I+ N+LF++VAG++D+ NTY+ L  R + YD+++Y  LM+  A+
Sbjct  151   YIEKVKNIVGEERKGFILANSLFLLVAGSDDIANTYYVLRARPH-YDVDSYTTLMVNSAS  209

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             DF+ +LY  G RR  +FG PP GCVPSQRT+ GG  R C E YNEA+++ NSK+S ++D 
Sbjct  210   DFVNKLYGYGVRRIAVFGAPPLGCVPSQRTVGGGLLRECAEYYNEAAKLFNSKISTKLDL  269

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             ++  LP     Y++IY+PLLD+IQ+P  YGF V+++GCCGTGVIEV  LCNK T + CPD
Sbjct  270   MHKTLPGIKPAYINIYDPLLDIIQSPAKYGFGVSNKGCCGTGVIEVAVLCNKITSSVCPD  329

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + +VFWDS+HPTE+ Y +LV  ++ K+V +F
Sbjct  330   VSSHVFWDSYHPTEKTYKVLVSLLISKFVNQF  361



>ref|XP_006390254.1| hypothetical protein EUTSA_v10018754mg [Eutrema salsugineum]
 gb|ESQ27540.1| hypothetical protein EUTSA_v10018754mg [Eutrema salsugineum]
Length=362

 Score =   390 bits (1001),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 174/332 (52%), Positives = 244/332 (73%), Gaps = 2/332 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             +KLPP + +  +I FGDSIVD G NNN++T  +C++ PYG +F G +PTGRFC+G+TP+D
Sbjct  31    VKLPPNLKIPALIAFGDSIVDTGNNNNVKTVVKCDFHPYGINFQGGVPTGRFCDGRTPAD  90

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +AEE+G+K ++PAY DPNL+PED  TGVSFASGG G+DP+T ++   I L  QL YF+E
Sbjct  91    LLAEEVGIKSVVPAYLDPNLKPEDLLTGVSFASGGSGYDPITPKLVAVISLQQQLKYFEE  150

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+  +VGE +  +I+ N++ ++VAG++D+ NTY+ L  R  +YD+++Y  LM   A+
Sbjct  151   YIEKVNHLVGEERKRFILANSIILLVAGSDDIANTYYDLHARP-QYDVDSYTTLMANSAS  209

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             DF+ +LY  G RR  +FG PP GCVPSQRT+ GG  R C E YN+A+++ NSKLS ++D 
Sbjct  210   DFVTKLYGYGVRRIAVFGAPPLGCVPSQRTVGGGLLRECAEYYNDAAKLFNSKLSVKLDL  269

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
                 LP    VY++IY+PLLD+IQNP  YGFEV+++GCCGTGVIEV  LCNK T + CPD
Sbjct  270   FRKTLPGIKPVYINIYDPLLDIIQNPAKYGFEVSNKGCCGTGVIEVAVLCNKITSSVCPD  329

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              + +VFWDS+HPTE+ Y +LV  ++ K + +F
Sbjct  330   VSSHVFWDSYHPTEKTYKVLVSLLINKAINQF  361



>ref|XP_007136106.1| hypothetical protein PHAVU_009G018300g [Phaseolus vulgaris]
 gb|ESW08100.1| hypothetical protein PHAVU_009G018300g [Phaseolus vulgaris]
Length=356

 Score =   389 bits (999),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 238/335 (71%), Gaps = 1/335 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA + L     +  +I+FGDSI+D G NN+L T  +CN+PPYG+DF G  PTGRF NGK 
Sbjct  21    EAIVTLRGNETIPALILFGDSIMDTGTNNDLITAFKCNFPPYGRDFHGAQPTGRFSNGKV  80

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD +AE+LG+ E + AY   +LQP+D   G++FASGG G+DP TA++A+  PLS QL  
Sbjct  81    PSDLVAEQLGINEYVAAYTSSSLQPDDLLKGINFASGGTGYDPFTARLASVRPLSEQLEQ  140

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY GKLKE  GE +TN+I+  +L +VV+ +ND+ NTYF+  IR+  +D+  Y D+++Q
Sbjct  141   FKEYIGKLKENFGEEKTNFILSKSLVLVVSSSNDIANTYFASGIRKLDHDVPRYTDMLVQ  200

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F++ELY LG +R  +FG PP GC+P  RTL GG  R C EE N AS++ NSKLSAE
Sbjct  201   LASSFVKELYSLGVKRIGVFGAPPLGCLPFMRTLFGGVERECTEEINMASKLFNSKLSAE  260

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKY-TGT  303
             + +LN   PQ+ IVY+ IY+PLL++IQNP  YG EV DRGCCGTG +E   LCN     T
Sbjct  261   LHNLNQNWPQAKIVYIQIYDPLLNIIQNPIKYGLEVVDRGCCGTGSVEAGILCNPLDLQT  320

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D +KYVFWDS+HPTE+ Y ILV +IL KY+  F
Sbjct  321   CTDDSKYVFWDSYHPTEKTYQILVAEILNKYINSF  355



>dbj|BAJ53101.1| JHL20J20.8 [Jatropha curcas]
Length=668

 Score =   399 bits (1026),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 248/324 (77%), Gaps = 3/324 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLPP V V  ++VFGDSIVD G NNN++T  +C++ PYG +F G  PTGRFC+GK P
Sbjct  34    ALVKLPPNVTVPALLVFGDSIVDSGNNNNIRTIVKCDFLPYGINFKGGTPTGRFCDGKIP  93

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD +AEELG+K+ +PAY DP ++ +D  TGV+FASG  G+DPLT+++ + + L  QL  F
Sbjct  94    SDILAEELGIKDTVPAYMDPEVKDQDLLTGVTFASGASGYDPLTSKLTSVMSLDDQLEQF  153

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             KEY  KLKE+VGE +TN+I+ N++F+VVAG++D+ NTY++L +R+ +YD+ AY DLM+  
Sbjct  154   KEYIEKLKEIVGEEKTNFILANSVFLVVAGSDDIANTYYTLRVRKLQYDVPAYTDLMLDY  213

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F+Q LYDLGARR  +F  PP GCVP+QRTLAGG  R C E++N+A+ + NSKLS ++
Sbjct  214   ASTFVQNLYDLGARRIAVFSAPPIGCVPAQRTLAGGSQRECAEDFNKAATLFNSKLSKKL  273

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TC  300
             DS N  +P + +VYVD+YNPLL++IQ+P  +GFEV ++GCCG+G +EV+ LCN+ T   C
Sbjct  274   DSFN--MPDAKVVYVDVYNPLLNIIQDPNQFGFEVVNKGCCGSGNLEVSVLCNRLTPFIC  331

Query  299   PDHNKYVFWDSFHPTERAYGILVH  228
              + + +VFWDS+HPTERAY +L  
Sbjct  332   SNTSDHVFWDSYHPTERAYRVLAK  355


 Score =   320 bits (819),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 211/325 (65%), Gaps = 14/325 (4%)
 Frame = -1

Query  1169  VVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELG  990
              +  V+ FGDSI+D G NNNL T+++CN+PPYG+DF G + TGRF NGK  SD +A+ LG
Sbjct  358   TISAVVAFGDSILDTGNNNNLMTYSKCNFPPYGKDFPGGIATGRFSNGKVFSDLVADGLG  417

Query  989   VKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKE  810
             VK +LPAY DPNLQ +D  TGV+FASGG G DP+TA+  + + ++ QLN FK Y  +LK 
Sbjct  418   VKAILPAYLDPNLQDQDLPTGVNFASGGSGLDPMTARAQSVLSMTDQLNLFKGYISRLKR  477

Query  809   MVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELY  630
              VGE++T   I  TL ++ +G ND     F       +YDI +Y   ++  A++F+++LY
Sbjct  478   FVGEDKTYETISTTLCLISSGNND-----FGFSYMARQYDIFSYTSQLVSWASNFVKDLY  532

Query  629   DLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQ  450
             +LGARR    G  P GC+P  R    G   AC E+ N  +Q+ NSKLS+E++ LN  L  
Sbjct  533   ELGARRIGFMGTLPFGCLPIVRAYRAGLLGACAEDINGVAQMFNSKLSSELNLLNRSLAN  592

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCPDHNKYVFWD  270
             +T+ Y+D+Y+PLL L+QNPQ  GF V + GC GTG +           TC D + YVFWD
Sbjct  593   ATVFYIDVYSPLLALVQNPQQSGFVVTNNGCFGTGGMYF---------TCSDISDYVFWD  643

Query  269   SFHPTERAYGILVHQILQKYVYRFA  195
             S HPTE+AY I+V QILQKY   F+
Sbjct  644   SVHPTEKAYRIIVSQILQKYANYFS  668



>ref|XP_008344249.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase EXL3-like 
[Malus domestica]
Length=344

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/343 (52%), Positives = 243/343 (71%), Gaps = 4/343 (1%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPT  1044
              +L+  R  A ++L     +  VIVFGDSIVD G NNN+ T  +CN+PPYG+DF  + PT
Sbjct  4     FILVLVRNAAAVELXNNEXIPAVIVFGDSIVDPGNNNNIGTIVKCNFPPYGRDFVRKRPT  63

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRF NG+ PSD I   +GVK++LPAY D NL+ +D  TGVSFASGG G+DPLT +I + +
Sbjct  64    GRFSNGRVPSDXI---VGVKKILPAYLDSNLKIQDLLTGVSFASGGSGYDPLTPKIVSVL  120

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
              LS QL+ FK+Y  K+  +VG+ +T  I+   +++V  G+ND+ NTY S P+RR  YDI 
Sbjct  121   SLSDQLDLFKKYISKINAVVGKERTATIVSKIIYIVCTGSNDIPNTYLSTPLRRSHYDIP  180

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
             AY DLM++ A+ F QELY LGARR  +  +P  GCVPSQRTL+GG  R C E  N+A+ +
Sbjct  181   AYTDLMVKSASSFFQELYGLGARRIGVVSLPAIGCVPSQRTLSGGLDRGCSETANQAASL  240

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
              NSKLSA+ID+ N +LP++ +VY+DIYN LL LIQNP  YGFEV +RGCCGTG  EV+ L
Sbjct  241   FNSKLSAQIDAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNFEVSIL  300

Query  323   CNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C +Y+ GTC D +KY+FWDS+HP+E+ Y ++   +    V++F
Sbjct  301   CTRYSPGTCNDSSKYIFWDSYHPSEKGYEVITSLVFDSQVHKF  343



>ref|XP_002887618.1| T4O12.12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63877.1| T4O12.12 [Arabidopsis lyrata subsp. lyrata]
Length=673

 Score =   398 bits (1023),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 249/332 (75%), Gaps = 2/332 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A +KLPP   +  +IVFGDSIVD G N++ + T ARCNYPPYG DF G +PTGRF NGK 
Sbjct  342   ALVKLPPNETIPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDFDGGIPTGRFSNGKV  401

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
              +DFIAE+ G+K  +PAY +PNL+P+D  TGV+FASGG G+ P T Q++  I LS QL  
Sbjct  402   ATDFIAEKFGIKPTIPAYRNPNLKPDDLLTGVTFASGGAGYVPFTTQLSGGIALSQQLKL  461

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F++Y  KLKEMVGE +T +II+N+LF+V+ G+ND+ NTYF+LP  +++YD+ ++  LM  
Sbjct  462   FEQYIEKLKEMVGEERTTFIIKNSLFMVICGSNDITNTYFALPSVQHQYDVASFTTLMAD  521

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A  F Q+L++ GARR  +FG PP GCVPSQRTLAGG +R CV  +N+A+++ N+KL+A 
Sbjct  522   NARSFAQKLHEYGARRIQVFGAPPLGCVPSQRTLAGGPTRNCVVRFNDATKLYNAKLAAN  581

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             ++SL+  L + TI+YVDIY+ L D+I +PQ YGF+V DRGCCGTG+IEVT LCN +    
Sbjct  582   LESLSRTLGEKTIIYVDIYDSLFDIILDPQQYGFKVVDRGCCGTGLIEVTVLCNNFAADV  641

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             C + ++YVFWDSFHPTE+ Y I+  + +++YV
Sbjct  642   CQNRDEYVFWDSFHPTEKTYRIMATKYIERYV  673


 Score =   367 bits (941),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 224/309 (72%), Gaps = 0/309 (0%)
 Frame = -1

Query  1229  FPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEM  1050
             F +LL      A +K+P    V  VIVFGDSIVD G N+++ T ARC+Y PYG DF G +
Sbjct  29    FLVLLFTTTTNALVKIPKNTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPYGIDFDGGV  88

Query  1049  PTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIAT  870
              TGRF NGK P D +AEELG+K  +PAY DPNL+PED  TGV+FASGG G+ PLT +IA 
Sbjct  89    ATGRFSNGKVPGDIVAEELGIKPNIPAYRDPNLKPEDLLTGVTFASGGAGYVPLTTKIAG  148

Query  869   AIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYD  690
              IPL  QL YF+EY  KLK MVGE +T +II+N+LFVV+ G+ND++N +F+LP  +  Y 
Sbjct  149   GIPLPQQLKYFEEYIKKLKGMVGEERTKFIIKNSLFVVICGSNDIVNNFFALPPVQLHYT  208

Query  689   INAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEAS  510
             + ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R CV  +N+AS
Sbjct  209   VASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDAS  268

Query  509   QIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVT  330
             ++ N+KLSA ID L+  L   TI+Y+DIY+PLLDLI NP  YGF+VA++GCCGTG+IEVT
Sbjct  269   KLFNTKLSANIDVLSRTLRDPTIIYIDIYSPLLDLILNPHQYGFKVANKGCCGTGLIEVT  328

Query  329   FLCNKYTGT  303
              LCN YT +
Sbjct  329   ALCNNYTAS  337



>ref|XP_010471741.1| PREDICTED: GDSL esterase/lipase EXL3-like [Camelina sativa]
Length=358

 Score =   387 bits (994),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 243/334 (73%), Gaps = 2/334 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KL P +++  VI FGDSIVD GMNN ++T  +C++ PYG +F G + TGRFC+G+ P
Sbjct  25    AAVKLQPNLIIPAVIAFGDSIVDTGMNNYVKTVVKCDFQPYGINFQGGVATGRFCDGRVP  84

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
              D +AEELG+K  +PAYFD  L P+D  TGVSFASGG G+DP+T ++ T I L  QL YF
Sbjct  85    VDLLAEELGIKLNVPAYFDSKLNPKDLLTGVSFASGGSGYDPITPKLVTVISLEEQLTYF  144

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             +EY  K+K +VGE + ++II N+LF+VVAG++D+ NTY++L  R  +YD+++Y  LM   
Sbjct  145   EEYIEKVKNIVGEKRKDFIIANSLFLVVAGSDDIANTYYTLRARP-QYDVDSYTTLMSDS  203

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F+ +LY  G RR  +F  PP GCVPSQRTL GG  R C + YNEA+++ NSKLS ++
Sbjct  204   ASAFVTKLYGYGVRRLAVFSAPPIGCVPSQRTLGGGILRDCADTYNEAAKLFNSKLSPKL  263

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-C  300
             D L   LP    +Y++IY+PLLD+IQNP NYGF+VA++GCCGTG IEV  LCNK T + C
Sbjct  264   DMLRKTLPGIKPIYINIYDPLLDIIQNPANYGFKVANKGCCGTGAIEVAVLCNKITSSVC  323

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             PD + +VFWDS+HPTE  Y +LV  ++ K++ +F
Sbjct  324   PDVSSHVFWDSYHPTEHTYKVLVSLLINKFIDQF  357



>ref|XP_008344250.1| PREDICTED: GDSL esterase/lipase EXL3-like [Malus domestica]
Length=377

 Score =   387 bits (995),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 238/334 (71%), Gaps = 1/334 (0%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A ++LP    +  VIVFGDSIVD G NNN+ T  +CN+ PYG+DF G+ PTGRF NG+ P
Sbjct  43    AAVELPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFSPYGRDFVGKRPTGRFSNGRVP  102

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD + E +GVK++LP Y D NL+ +D  TGVSFASGG G+DPLT +I + + LS QL+ F
Sbjct  103   SDLVVESVGVKKILPTYLDSNLKIQDLLTGVSFASGGSGYDPLTPKIVSILSLSDQLDLF  162

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             K+Y  K+   VG+ +T  I+  ++++V   +ND+ NTY S P+RR  YDI AY DLM++ 
Sbjct  163   KKYISKINAAVGKERTATIVSKSIYIVCTRSNDIANTYLSTPLRRPHYDIPAYTDLMVKS  222

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F QELY LGARR  +  +P  GCV SQRTL+GG  + C E  N+A+ + NSKLSA+I
Sbjct  223   ASSFFQELYGLGARRIGVVSLPAIGCVLSQRTLSGGIDKGCSETANQAASLFNSKLSAQI  282

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTC  300
             D+ N +LP++ +VY+DIYN LL LIQNP  YGFEV +RGCCGTG  EV+ LC +Y+ GTC
Sbjct  283   DAFNKRLPETRLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNFEVSILCTRYSPGTC  342

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              D +KY+FWDS+HP+E+ Y ++   +    V++F
Sbjct  343   NDSSKYIFWDSYHPSEKGYEVITSLVFDSQVHKF  376



>ref|NP_565121.1| GDSL esterase/lipase EXL2 [Arabidopsis thaliana]
 sp|Q94CH7.1|EXL2_ARATH RecName: Full=GDSL esterase/lipase EXL2; AltName: Full=Family 
II extracellular lipase 2; Short=Family II lipase EXL2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK30017.1| family II lipase EXL2 [Arabidopsis thaliana]
 gb|AEE35770.1| GDSL esterase/lipase EXL2 [Arabidopsis thaliana]
Length=379

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 247/358 (69%), Gaps = 15/358 (4%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFA  1059
             V F +LL      A +K PP      +IVFGDSIVD G N++ + T ARCNYPPYG DF 
Sbjct  22    VFFLVLLCKTSTNALVKQPPNETTPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDFD  81

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G +PTGRFCNGK  +DFIA + G+K  +PAY +PNL+PED  TGV+FASGG G+ P T Q
Sbjct  82    GGIPTGRFCNGKVATDFIAGKFGIKPSIPAYRNPNLKPEDLLTGVTFASGGAGYVPFTTQ  141

Query  878   IAT-------------AIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTND  738
             ++T              I LS QL  F+EY  K+K+MVGE +T  II+N+LF+V+ G+ND
Sbjct  142   LSTYLFIYKPLLFLKGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSND  201

Query  737   VLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTL  558
             + NTYF LP  + +YD+ ++  LM   A  F Q+L++ GARR  +FG PP GCVPSQRTL
Sbjct  202   ITNTYFGLPSVQQQYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTL  261

Query  557   AGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGF  378
             AGG +R CV  +N+A+++ N KL+A + SL+  L   TI+YVDIY+ LLD+I +P+ YGF
Sbjct  262   AGGPTRNCVVRFNDATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGF  321

Query  377   EVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             +V D+GCCGTG+IEV  LCN +    CP+ ++YVFWDSFHPTE+ Y I+  +  ++YV
Sbjct  322   KVVDKGCCGTGLIEVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYFERYV  379



>ref|XP_010416499.1| PREDICTED: GDSL esterase/lipase EXL3 [Camelina sativa]
Length=363

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 242/334 (72%), Gaps = 2/334 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A +KLPP +++  VI FGDSIVD GMNN ++T  +C++ PYG +F G + TGRFC+G+ P
Sbjct  30    AAVKLPPNLIIPAVIAFGDSIVDTGMNNYVKTVVKCDFQPYGINFQGGVATGRFCDGRVP  89

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
              D +AEE G+K  +PAYFD  L  +D  TGVSFASGG G+DP+T ++ T I L  QL YF
Sbjct  90    VDLLAEEFGIKLNVPAYFDSKLNSKDLLTGVSFASGGSGYDPITPKLVTVISLEEQLTYF  149

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             +EY  K+K +VGE + ++II N+LF+VVAG++D+ NTY++L  R  +YD+++Y  LM   
Sbjct  150   EEYIEKVKNIVGEERKDFIIANSLFLVVAGSDDIANTYYTLRARP-QYDVDSYTTLMSDS  208

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ F+ +LY  G RR  +F  PP GCVPSQRTL GG  R C + YNEA+++ NSKLS ++
Sbjct  209   ASAFVAKLYGYGVRRLAVFSAPPIGCVPSQRTLGGGILRDCADTYNEAAKLFNSKLSPKL  268

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-C  300
             D L   LP    +Y++IY+PLLD+IQNP NYGF+VA++GCCGTG IEV  LCNK T + C
Sbjct  269   DMLRKTLPGIKPIYINIYDPLLDIIQNPANYGFKVANKGCCGTGAIEVAVLCNKITSSVC  328

Query  299   PDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             PD + +VFWDS+HPTE  Y +LV  ++ K++ +F
Sbjct  329   PDVSSHVFWDSYHPTEHTYKVLVSLLINKFIDQF  362



>ref|XP_010920107.1| PREDICTED: GDSL esterase/lipase EXL3 [Elaeis guineensis]
Length=358

 Score =   385 bits (989),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 234/321 (73%), Gaps = 1/321 (0%)
 Frame = -1

Query  1166  VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGV  987
             +  VIVFGDSIVD G NN+L+T  +CN+PPYGQDF     TGRF NG+ PSD IA +LGV
Sbjct  34    IPAVIVFGDSIVDPGNNNDLETLIKCNFPPYGQDFINHQATGRFSNGRIPSDLIASKLGV  93

Query  986   KELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEM  807
             KEL+P Y   +L+PED  TGVSFASG  G+DPLT  I   IP++ +L  F EYK +LK +
Sbjct  94    KELVPPYIGYDLKPEDILTGVSFASGATGYDPLTPAILNVIPMTDELKLFGEYKERLKAI  153

Query  806   VGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYD  627
              GE +   I+ N+L++V +GT+D+ NTY++ P R  +YDI +Y DL+I+GA+ F++EL  
Sbjct  154   AGEERAASIVSNSLYIVCSGTDDIANTYYTTPFRILEYDIRSYVDLLIRGASSFLEELIH  213

Query  626   LGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQS  447
             +GA++ V  G+PP GCVPSQRTL GG  R C  + N+A+Q+ NSK+  EID+LN +    
Sbjct  214   MGAQKIVFVGLPPIGCVPSQRTLGGGIQRNCEPKRNQAAQLFNSKIQKEIDTLNKEHKGI  273

Query  446   TIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKYVFWD  270
              + YVDIY+ L+DLI +P  YGFEV++RGCCGTG IEVT LCNK T + CPD  KYVFWD
Sbjct  274   MVAYVDIYSMLIDLIFHPSKYGFEVSNRGCCGTGEIEVTLLCNKVTASVCPDVTKYVFWD  333

Query  269   SFHPTERAYGILVHQILQKYV  207
             S+HPTERAY I+V +I Q+ +
Sbjct  334   SYHPTERAYKIMVEKIYQETI  354



>gb|EYU38777.1| hypothetical protein MIMGU_mgv1a009038mg [Erythranthe guttata]
Length=355

 Score =   384 bits (986),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 179/351 (51%), Positives = 247/351 (70%), Gaps = 5/351 (1%)
 Frame = -1

Query  1244  MVSVVFPMLLLG-RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             + +V  P+L L      A + L        + +FGDSI D G NN ++T A+ N+PPYG+
Sbjct  7     LFTVFLPILFLSCNITRAVVNLHKNATFPALFIFGDSIFDTGNNNYIKTIAKANFPPYGK  66

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             DF G +PTGRF +GK PSD  AEELG+K +LP + DP+LQ +D  TGVSFAS   G+DPL
Sbjct  67    DFIGGIPTGRFSDGKIPSDLSAEELGIKTILPPFLDPSLQDQDLLTGVSFASASTGYDPL  126

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             TA++++ +  S QL  FKEY  KL ++ G+ +++ I+  +LF+V  G ND L TYF   +
Sbjct  127   TARLSSVLSFSDQLELFKEYISKLNKIAGDEKSSAILRESLFLVDGGNNDFLITYFGTLL  186

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             R+++YD+ +Y DL++  A+ F+QELY LGAR+  +FG+PP GCVP  RTL GG  R C +
Sbjct  187   RKFQYDVPSYIDLLVSHASTFVQELYGLGARKIGVFGLPPIGCVPVSRTLRGGLKRKCAK  246

Query  527   EYNEASQIVNSKLSAEIDSLNN-KLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
             EYNEA+Q+ N+KLSAEI SL + +L ++ IVY DIYNP LD+I+NPQ YGFE+ D+GCCG
Sbjct  247   EYNEAAQLFNNKLSAEIASLKSAQLSEAIIVYADIYNPTLDIIRNPQKYGFEIVDKGCCG  306

Query  350   TGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             TG +E++FLC KY   C D + YVFWDS HPTE+ Y I+VH+I ++Y+  F
Sbjct  307   TGTVELSFLC-KY--ACSDVSDYVFWDSVHPTEKTYRIIVHRIFEEYISYF  354



>ref|XP_002887619.1| T4O12.13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63878.1| T4O12.13 [Arabidopsis lyrata subsp. lyrata]
Length=688

 Score =   395 bits (1014),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 247/339 (73%), Gaps = 2/339 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             +KLPP +VV  +  FGDSIVD GMNNN++T  +C++ PYG DF G + TGRFC+G+ P+D
Sbjct  31    VKLPPKLVVPALFAFGDSIVDTGMNNNVKTVVKCDFHPYGIDFQGGVATGRFCDGRVPAD  90

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +AEELG+K ++PAY DPNL+ +D  TGVSFASGG G+DP+T ++   I L  QL YF+E
Sbjct  91    LLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKLVAVISLEEQLTYFEE  150

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE + ++I+ N+LF++VAG++D+ NTY+++  R  +YDI++Y  LM   A+
Sbjct  151   YIEKVKNIVGEERKDFIVANSLFLLVAGSDDIANTYYTIRARP-EYDIDSYTTLMSDSAS  209

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             +F+ +LY  G RR  +FG PP GCVPSQRTL GG  R C E YNEA+++ NSKLS ++DS
Sbjct  210   EFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGIMRDCAETYNEAAKLFNSKLSPKLDS  269

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             L   LP    +Y++IY+PL D+IQNP NYGFEVA++GCCGTG IEV  LCNK T + CPD
Sbjct  270   LRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVANKGCCGTGAIEVAVLCNKITSSVCPD  329

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRFA*TNCTS  177
              + +VFWDS+HPTE+ Y + +  +L  +   F  TN  +
Sbjct  330   VSTHVFWDSYHPTEKTYKVKITLVLALFSIYFLSTNAAN  368


 Score =   221 bits (562),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/320 (38%), Positives = 176/320 (55%), Gaps = 16/320 (5%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              ++ FGDSI+D G NN L T  + N  PYG+ F   MPTGRF NG+  SD +AE LG+K+
Sbjct  373   ALLAFGDSILDTGNNNFLLTLMKGNIWPYGRSFNMRMPTGRFGNGRVFSDIVAEGLGIKK  432

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
             +LPAY    + P D +TGV FASGG G DP+T+++   +    Q+N FK Y  KLK   G
Sbjct  433   ILPAYRKLFVSPSDLRTGVCFASGGAGVDPVTSKLLRVLTPRDQVNDFKGYIRKLKATAG  492

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK-YDINAYADLMIQGAADFIQELYDL  624
              ++   I+ N + +V  G ND+  +YF  P   ++    N Y   +      F++ELYD 
Sbjct  493   PSKAKEIVANAVILVSQGNNDIGISYFGTPSATFRGLTPNRYTTKLAGWNKQFMKELYDQ  552

Query  623   GARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNK--LPQ  450
             GAR+  + G+ P GC+P  R   GG    C    N  ++  N KL +   S   +     
Sbjct  553   GARKFAVMGVIPLGCLPMSRIFLGGFVIWCNFFANRVAEDYNGKLRSGTKSWGRESGFSG  612

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG--TGVIEVTFLCNKYTGTCPDHNKYVF  276
             +  VYVD++N L+D+I+N + YGF     GCC   T ++            CP+ +KYVF
Sbjct  613   AKFVYVDMFNTLMDVIKNHRRYGFSNEKNGCCCMITAIVP-----------CPNPDKYVF  661

Query  275   WDSFHPTERAYGILVHQILQ  216
             +D  HP+E+AY  +  +++Q
Sbjct  662   YDFVHPSEKAYKTISKKLVQ  681



>ref|XP_007156185.1| hypothetical protein PHAVU_003G265500g [Phaseolus vulgaris]
 gb|ESW28179.1| hypothetical protein PHAVU_003G265500g [Phaseolus vulgaris]
Length=374

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 236/335 (70%), Gaps = 2/335 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFA-GEMPTGRFCNGKT  1020
             + + LP    V  VIVFGDSIVD G NN + T  +CN+PPYG+DFA G  P+GRF NG  
Sbjct  39    SALSLPNNATVPAVIVFGDSIVDTGNNNYISTLVKCNFPPYGRDFAEGNHPSGRFSNGLV  98

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA + GVK+ LP Y DPNLQ +D  TGVSFASGG G+DPLTA++ + + L+ QL+ 
Sbjct  99    PSDIIAAKFGVKKFLPPYLDPNLQVQDLLTGVSFASGGAGYDPLTAELVSVMSLTDQLDM  158

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  K+ + VG N+T  I+  ++++V  G++D+ NTY   P RR +YDI++Y DLM  
Sbjct  159   FKEYIKKINDAVGGNRTTLIVSKSIYIVCIGSDDIANTYIQSPFRRVEYDISSYTDLMAS  218

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A++F++ LY++G RR  +FG+P  GCVPSQRT+AGG  RACVE  NEA+ + NSKLS++
Sbjct  219   EASNFLETLYEIGGRRIGVFGVPAIGCVPSQRTMAGGLDRACVESSNEAAMLFNSKLSSQ  278

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GT  303
             ID+L  KLP + IVY+D YN LL +I +P  YGFE A +GCCGTG IE + LCN+Y   T
Sbjct  279   IDALGKKLPDARIVYLDCYNGLLSMIGDPAKYGFEEAMKGCCGTGNIEASILCNRYAINT  338

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C + + Y+FWDS+HPTE AY IL   +L   +  F
Sbjct  339   CSNSSDYLFWDSYHPTEHAYNILSSIVLDNKINNF  373



>ref|XP_010026063.1| PREDICTED: GDSL esterase/lipase At5g42170-like [Eucalyptus grandis]
Length=360

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 239/332 (72%), Gaps = 1/332 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +AK+ +P    +  V +FGDSIVD G NNNL T  + N+PPYG+DF G  PTGRF NGK 
Sbjct  24    QAKVVVPKNATISAVFMFGDSIVDTGNNNNLITLVKSNFPPYGRDFMGGKPTGRFSNGKI  83

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P DF  E+LG+KELLPA+ DPNLQ +D   GV+FAS G GFDPLT+++ +AIP+S QL  
Sbjct  84    PPDFFVEQLGIKELLPAFLDPNLQLQDLIGGVNFASAGAGFDPLTSELVSAIPMSKQLQL  143

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
               EYK KLK  +GE + + I+ N L++V AG++D++NTYF  P R + Y + +Y +L+++
Sbjct  144   LDEYKMKLKCFIGEERVDSIVANGLYIVSAGSDDIVNTYFHTPTRIFDYSVFSYTELLVR  203

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+QEL+  GARR  +F + P GC+PS RTLAGG  R C E YN+  Q++NSKLS+E
Sbjct  204   LASSFLQELHAKGARRIGVFSLTPLGCIPSMRTLAGGIKRRCAENYNQMVQLLNSKLSSE  263

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +  LN   P + +V +DIY  +LD++++P+ YGFE++DRGCCG+G+IE  FLCN++   T
Sbjct  264   LHRLNEAFPHARMVLIDIYGLVLDIVKSPRKYGFEISDRGCCGSGLIETGFLCNQWDFLT  323

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             C + ++YVFWDS+HPTE  Y ++V + L+K +
Sbjct  324   CSNVSEYVFWDSYHPTENVYKVMVQEKLRKLL  355



>ref|XP_009385168.1| PREDICTED: GDSL esterase/lipase EXL3-like [Musa acuminata subsp. 
malaccensis]
Length=360

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 227/320 (71%), Gaps = 1/320 (0%)
 Frame = -1

Query  1166  VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGV  987
             V  V+VFGDSIVD G NN L T ARCN+PPYG+DF G   TGRF NGK PSD +A +LGV
Sbjct  35    VPAVVVFGDSIVDPGNNNMLPTIARCNFPPYGKDFPGGKATGRFSNGKNPSDILASQLGV  94

Query  986   KELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEM  807
             KE +PAY   +L  ++  TG+SFASGGCG+DPLT+Q+  A+ L  QLN FKEYK KLK +
Sbjct  95    KEYVPAYLGTHLDAQELLTGISFASGGCGYDPLTSQLLVALSLRHQLNLFKEYKEKLKRV  154

Query  806   VGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYD  627
              GE +   II N+L+ VV GTND+  TYF LP RR ++DI +Y   ++Q A+ F+QELY 
Sbjct  155   AGEGRAADIIANSLYAVVTGTNDIATTYFLLPFRRAEFDIPSYITFLVQSASSFLQELYR  214

Query  626   LGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQS  447
              GARR  I G PP GC+PSQRTLAGG  R CV  YNEA+ + NS+LS E+  L++ L  +
Sbjct  215   SGARRIAIMGAPPIGCMPSQRTLAGGIERECVTLYNEAATMFNSQLSKEVQRLDSTLLGA  274

Query  446   TIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKYVFWD  270
              IVY+DIY PLLD+I  P  YGF+ + RGCCGTG  EV   CN  T T C + ++YVFWD
Sbjct  275   KIVYIDIYTPLLDMILRPFAYGFKESTRGCCGTGYYEVIITCNSITATSCANASEYVFWD  334

Query  269   SFHPTERAYGILVHQILQKY  210
             SFH TERA  +L+ QILQ+Y
Sbjct  335   SFHTTERAAEMLITQILQQY  354



>ref|XP_009379344.1| PREDICTED: GDSL esterase/lipase EXL3-like [Pyrus x bretschneideri]
Length=374

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 241/347 (69%), Gaps = 4/347 (1%)
 Frame = -1

Query  1235  VVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG  1056
             V   ++L   R  A ++LP    +  VIVFGDSIVD G NNN+ T  +CN+P    DF G
Sbjct  30    VPIAIVLFLYRNAAAVELPNNEKIPAVIVFGDSIVDPGNNNNIGTIVKCNFP---SDFVG  86

Query  1055  EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQI  876
             + PTGRF NG+ PSD IAE +GVK++LPAY D NL+ +D  TGVSFASGG G+DPLT +I
Sbjct  87    KRPTGRFSNGRVPSDLIAESVGVKKILPAYLDSNLKIQDLVTGVSFASGGSGYDPLTPKI  146

Query  875   ATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK  696
              + + LS QL+ FK Y  K+   VG+ +T  I+  ++++V  G+ND+ NTY S P+RR  
Sbjct  147   VSVLSLSDQLDLFKIYISKINAAVGKERTATIVSKSIYIVCTGSNDIANTYLSTPLRRSH  206

Query  695   YDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNE  516
             YDI AY DLM++ A+ F QEL  LGARR  +  +P  GCVPS RTL+GG  R C E  N+
Sbjct  207   YDIPAYTDLMVKSASSFFQELCGLGARRIGVVSLPAIGCVPSLRTLSGGIDRGCSETANQ  266

Query  515   ASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIE  336
             A+ + NSKLSA+ID+ N +LP++ +VY+DIYN LL LIQNP  YGFEV +RGCCGTG +E
Sbjct  267   AASLFNSKLSAQIDAFNRRLPEARLVYLDIYNTLLSLIQNPTQYGFEVINRGCCGTGNVE  326

Query  335   VTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             V+ LC +Y+ GTC D +KY+FWDS+HP+E+ Y ++        V++F
Sbjct  327   VSILCTRYSPGTCNDSSKYIFWDSYHPSEKGYEVITPLAFDSQVHKF  373



>ref|XP_003527436.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
Length=365

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 236/333 (71%), Gaps = 2/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKTPS  1014
             + LP    V  VIVFGDSIVD G NN + T A+ N+ PYG+DF G   PTGRF NG TPS
Sbjct  32    VSLPNNESVPAVIVFGDSIVDTGNNNYINTIAKVNFLPYGKDFGGGNQPTGRFSNGLTPS  91

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D IA +LGVK+LLP Y DP LQP+D  TGVSFASGG G+DPLT++IA+ + LS QL+ F+
Sbjct  92    DIIAAKLGVKKLLPPYLDPKLQPQDLLTGVSFASGGSGYDPLTSKIASVLSLSDQLDKFR  151

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EYK K+KE VG N+T  II  +++++  G+ND+ NTY   P RR +YDI +Y D MI+ A
Sbjct  152   EYKNKIKETVGGNRTTTIISKSIYILCTGSNDIANTYSLSPFRRLQYDIQSYIDFMIKQA  211

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
              +F++ELY LGARR  + G+P  GCVP QRT+ GG  R C +  N A+ + N+KLS++ID
Sbjct  212   TNFLKELYGLGARRIGVIGLPVLGCVPFQRTIQGGIHRECSDFENHAATLFNNKLSSQID  271

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
             +L  + P++  VY++IYNPLL++IQN   YGFEV D+GCCGTG  EV FLCN+ T   C 
Sbjct  272   ALKKQFPETKFVYLEIYNPLLNMIQNATKYGFEVTDKGCCGTGDFEVGFLCNRLTPHICS  331

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             + + Y+FWDSFHPTE  Y +L  Q+L K +  F
Sbjct  332   NTSSYIFWDSFHPTEEGYKVLCSQVLDKNIKDF  364



>ref|XP_004240848.2| PREDICTED: uncharacterized protein LOC101249647 [Solanum lycopersicum]
Length=982

 Score =   402 bits (1032),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 244/345 (71%), Gaps = 1/345 (0%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQ  1068
             ++  ++   L++    +  +KLP  VVV  V  FGDSIVDQG NN + T  +CN+PPYG+
Sbjct  631   VVTHLILISLIMPSSYKIIVKLPEKVVVPAVYAFGDSIVDQGNNNYIATTIKCNFPPYGK  690

Query  1067  DFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             D    +PTGRF N KTP D IAEELG+K L+PAY DPNL+ ED KTGVSFASGGCG+DPL
Sbjct  691   DLRDGIPTGRFSNAKTPPDLIAEELGIKGLIPAYLDPNLKDEDLKTGVSFASGGCGYDPL  750

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T    + + LS QL  F+EY  KLK +VG+ +T +I+ N+ ++VVAG+ND LN Y+    
Sbjct  751   TGSAFSILHLSDQLTLFQEYIEKLKRLVGKQETTHILNNSFYMVVAGSNDFLNNYYVTGF  810

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGG-KSRACV  531
             R+++YDIN+Y D ++  A++F+QELY+LGARR  I G+PP GCVP QRTL GG  SR CV
Sbjct  811   RKHQYDINSYIDHIVSWASNFVQELYELGARRIGIMGLPPLGCVPFQRTLQGGIISRVCV  870

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
             +EYN+ +Q+ N+K +     L+  LPQS +V++DIYN + D I N   YGFE  D+GCCG
Sbjct  871   DEYNQDAQLANTKFAVAFGLLSKSLPQSKLVFIDIYNLVTDFIVNNTKYGFEEVDKGCCG  930

Query  350   TGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQ  216
             TG IEV+ LCNKY+  C D  KY+FWDSFHPTE+ Y +L+  I +
Sbjct  931   TGTIEVSTLCNKYSAICEDDTKYLFWDSFHPTEKGYKVLIDHIFK  975



>ref|XP_009400370.1| PREDICTED: GDSL esterase/lipase At1g20120-like [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 231/318 (73%), Gaps = 1/318 (0%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              +IVFGDS+VD G NN + T  +CN+PPYG+DF     TGRF NGK PSD IA  LG+K+
Sbjct  33    ALIVFGDSVVDPGNNNAIVTTVKCNFPPYGKDFIDHKATGRFSNGKIPSDMIASRLGIKQ  92

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
             L+PAY    L  ED  TGVSFASGG G+DPLT+++  AIP+S QLN FKEY  KL+E+ G
Sbjct  93    LVPAYLGTELDAEDLLTGVSFASGGSGYDPLTSELVQAIPMSEQLNMFKEYMKKLEEIAG  152

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLG  621
             E +   II  +L++V+ GT+D+ NTYF+ P RR +YD+ +Y   +++ A  F+QELY+LG
Sbjct  153   ERKARDIISRSLYLVITGTDDLANTYFTTPFRRVEYDLPSYIKFVVETATSFVQELYNLG  212

Query  620   ARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTI  441
             ARR  + GI P GC+PSQRTLAGG  R C + YN+A+ I NS+LS E+  LN+ LP S I
Sbjct  213   ARRISVSGISPIGCLPSQRTLAGGIERECADLYNQAAVIYNSELSKELQRLNHSLPGSRI  272

Query  440   VYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWDSF  264
             +++D+Y  LLDL+Q P+ YGF+   RGCCGTG+ EVT  CN +T   C D +KY+FWD++
Sbjct  273   LFIDMYTSLLDLMQRPEAYGFKETARGCCGTGIYEVTLTCNSFTAPPCEDVSKYLFWDTY  332

Query  263   HPTERAYGILVHQILQKY  210
             HPTERAY I++ +IL++Y
Sbjct  333   HPTERAYNIIIKKILRQY  350



>ref|XP_008440851.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cucumis melo]
Length=369

 Score =   382 bits (981),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 176/331 (53%), Positives = 231/331 (70%), Gaps = 2/331 (1%)
 Frame = -1

Query  1184  LPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFI  1005
             LP    V  +IVFGDSIVD G NN+L+T  +CN+PPYG+DF G MPTGRF NGK P+DF+
Sbjct  38    LPDNEEVSAIIVFGDSIVDPGNNNHLKTLIKCNFPPYGRDFNGGMPTGRFTNGKIPTDFV  97

Query  1004  AEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYK  825
             AEE GVKEL+PAY DP+L  +D  TGVSFASG  G+DPLT++I + + LS QL  FK+Y 
Sbjct  98    AEEFGVKELVPAYLDPHLTTQDLLTGVSFASGASGYDPLTSKITSVLSLSDQLELFKDYI  157

Query  824   GKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADF  645
              K+K  VGE +   I+  ++ +V  G++D+ NTYF  P RR  YD+ +Y DLM+Q A+ F
Sbjct  158   KKIKAAVGEEKATAILSKSVIIVCTGSDDIANTYFITPFRRLHYDVASYTDLMLQSASSF  217

Query  644   IQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLN  465
               +LY LGARR  +  +P  GCVPSQRTL GG +R C E  N A+ + NSKLS+ I SL 
Sbjct  218   FHQLYALGARRIGVLSLPAIGCVPSQRTLFGGVARGCSEAANSAALLFNSKLSSLITSLG  277

Query  464   NKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG--TCPDH  291
             N+   +  VY+D+Y P L LIQNP  YGFE A +GCCGTG IEV+ LCN  +   +CP+ 
Sbjct  278   NEYSDAKFVYLDVYTPFLALIQNPSEYGFEEATKGCCGTGAIEVSVLCNPLSSKLSCPNP  337

Query  290   NKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +KY+FWDS+HPT  AY +L  +I++  + +F
Sbjct  338   DKYIFWDSYHPTGNAYQVLTSRIIKDSLPKF  368



>ref|XP_007046630.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX90787.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=394

 Score =   382 bits (982),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/338 (55%), Positives = 236/338 (70%), Gaps = 5/338 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA + LP    V  V+VFGDSIVD G NNNL T A+ N+PPYG+DF G  PTGRF NGK 
Sbjct  57    EAALVLPNNETVPAVLVFGDSIVDPGNNNNLNTIAKSNFPPYGRDFEGG-PTGRFSNGKV  115

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IAEE GVKEL+PAY DP+LQ ED  TGVSFASG  G+DP+ A+I+  +  S QL+ 
Sbjct  116   PSDLIAEEFGVKELVPAYLDPSLQLEDLLTGVSFASGAAGYDPIAAKISNVLSTSDQLDL  175

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F++YK K+K  VGE +   II   +++VV G+NDV N YF  PIRR  YD N+Y D  + 
Sbjct  176   FEQYKTKIKSAVGEERAATIISKAIYIVVFGSNDVANIYFGTPIRRTHYDFNSYTDFTVS  235

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+QELY LGARR  + G+PP GCVPSQRTL GG +R C +  N+ + + N+KLS  
Sbjct  236   YASKFLQELYGLGARRIGVLGLPPIGCVPSQRTLGGGPNRDCYKGENQLASLYNAKLSGM  295

Query  479   IDSLNNK--LPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-  309
             IDSL     LP + ++++DIY PLL LIQN   YGFEV ++GCCGTG+IE + LCN  + 
Sbjct  296   IDSLRTSLNLPGTKLIFLDIYYPLLSLIQNAAKYGFEVTNKGCCGTGLIEASILCNPLSI  355

Query  308   -GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               +CPD +KYVFWD +HP+++AY ILV  IL  ++  F
Sbjct  356   PKSCPDASKYVFWDGYHPSDKAYKILVPIILNMHLNEF  393



>ref|XP_007046631.1| Serine transhydroxymethyltransferase 1 isoform 2 [Theobroma cacao]
 gb|EOX90788.1| Serine transhydroxymethyltransferase 1 isoform 2 [Theobroma cacao]
Length=391

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/338 (55%), Positives = 236/338 (70%), Gaps = 5/338 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EA + LP    V  V+VFGDSIVD G NNNL T A+ N+PPYG+DF G  PTGRF NGK 
Sbjct  54    EAALVLPNNETVPAVLVFGDSIVDPGNNNNLNTIAKSNFPPYGRDFEGG-PTGRFSNGKV  112

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IAEE GVKEL+PAY DP+LQ ED  TGVSFASG  G+DP+ A+I+  +  S QL+ 
Sbjct  113   PSDLIAEEFGVKELVPAYLDPSLQLEDLLTGVSFASGAAGYDPIAAKISNVLSTSDQLDL  172

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F++YK K+K  VGE +   II   +++VV G+NDV N YF  PIRR  YD N+Y D  + 
Sbjct  173   FEQYKTKIKSAVGEERAATIISKAIYIVVFGSNDVANIYFGTPIRRTHYDFNSYTDFTVS  232

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+QELY LGARR  + G+PP GCVPSQRTL GG +R C +  N+ + + N+KLS  
Sbjct  233   YASKFLQELYGLGARRIGVLGLPPIGCVPSQRTLGGGPNRDCYKGENQLASLYNAKLSGM  292

Query  479   IDSLNNK--LPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-  309
             IDSL     LP + ++++DIY PLL LIQN   YGFEV ++GCCGTG+IE + LCN  + 
Sbjct  293   IDSLRTSLNLPGTKLIFLDIYYPLLSLIQNAAKYGFEVTNKGCCGTGLIEASILCNPLSI  352

Query  308   -GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               +CPD +KYVFWD +HP+++AY ILV  IL  ++  F
Sbjct  353   PKSCPDASKYVFWDGYHPSDKAYKILVPIILNMHLNEF  390



>ref|NP_001242335.1| uncharacterized protein LOC100810354 [Glycine max]
 gb|ACU19734.1| unknown [Glycine max]
Length=366

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 237/346 (68%), Gaps = 2/346 (1%)
 Frame = -1

Query  1229  FPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-E  1053
             F  +++ ++  + + LP    V  VIVFGDSIVD G NN + T  +CN+ PYG+DFAG  
Sbjct  20    FSTVIISQQHVSAVSLPNNETVPAVIVFGDSIVDSGNNNYINTILKCNFQPYGRDFAGGN  79

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
              PTGRF NG TPS  IA + GVK++LPAY DP LQP+D  TGVSFASGG G+DPLT++  
Sbjct  80    QPTGRFSNGLTPSGIIAAKFGVKKILPAYLDPKLQPQDLLTGVSFASGGSGYDPLTSKTV  139

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
             + + LS QL+ F EYK K+K  VGEN+   II  +++V+  G+NDV NTY   P+RR  Y
Sbjct  140   SVLSLSDQLDKFSEYKNKIKGTVGENRMATIISKSIYVLCTGSNDVANTYSLSPVRRAHY  199

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             D+  Y DLM   A +F+QELY LGARR  + G+P  GCVPSQRT+ GG  R+C +  N+A
Sbjct  200   DVPEYTDLMASQATNFLQELYGLGARRIGVIGLPVLGCVPSQRTIQGGILRSCSDFENQA  259

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             + + NSKLS++ D+LN   P++  VY+DIYNPLL++IQNP  YGF+V + GCCGTG+IE 
Sbjct  260   AMLFNSKLSSQTDALNKNFPEARFVYLDIYNPLLNMIQNPSTYGFKVTNEGCCGTGIIEA  319

Query  332   TFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
               LCN +T   C +   Y+FWDSFHPTE AY +L   +L   +  F
Sbjct  320   GILCNPFTLQICSNTANYIFWDSFHPTEEAYNVLCSLVLDNKIKDF  365



>gb|KHN41131.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=362

 Score =   380 bits (977),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 240/335 (72%), Gaps = 5/335 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKT  1020
             + + LP    +  VIVFGDSIVD G NN + T A+CN+ PYG+DF G   PTGRF NG T
Sbjct  30    SSVSLPNYESIPAVIVFGDSIVDTGNNNYINTIAKCNFLPYGRDFGGGNQPTGRFSNGLT  89

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA + GVKELLP Y DP LQP+D  TGVSFASG  G+DPLT++IA+A+ LS QL+ 
Sbjct  90    PSDIIAAKFGVKELLPPYLDPKLQPQDLLTGVSFASGASGYDPLTSKIASALSLSDQLDT  149

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EYK K+ E+VGEN+T  II  +++++  G+ND+ NTYF   +R  +YDI AY DLM  
Sbjct  150   FREYKNKIMEIVGENRTATIISKSIYILCTGSNDITNTYF---VRGGEYDIQAYTDLMAS  206

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A +F+QELY LGARR  + G+P  GCVPSQRTL GG  RAC +  NEA+ + NSKLS++
Sbjct  207   QATNFLQELYGLGARRIGVVGLPVLGCVPSQRTLHGGIFRACSDFENEAAVLFNSKLSSQ  266

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GT  303
             +D+L  +  ++  VY+D+YNP+L+LIQNP  YGFEV D+GCCGTG +EV  LCN +T   
Sbjct  267   MDALKKQFQEARFVYLDLYNPVLNLIQNPAKYGFEVMDQGCCGTGKLEVGPLCNHFTLLI  326

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C + + Y+FWDSFHPTE AY ++  Q+L   +  F
Sbjct  327   CSNTSNYIFWDSFHPTEAAYNVVCTQVLDHKIKDF  361



>ref|XP_003527440.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
Length=362

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 240/335 (72%), Gaps = 5/335 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKT  1020
             + + LP    +  VIVFGDSIVD G NN + T A+CN+ PYG+DF G   PTGRF NG T
Sbjct  30    SSVSLPNYESIPAVIVFGDSIVDTGNNNYITTIAKCNFLPYGRDFGGGNQPTGRFSNGLT  89

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA + GVKELLP Y DP LQP+D  TGVSFASG  G+DPLT++IA+A+ LS QL+ 
Sbjct  90    PSDIIAAKFGVKELLPPYLDPKLQPQDLLTGVSFASGASGYDPLTSKIASALSLSDQLDT  149

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EYK K+ E+VGEN+T  II  +++++  G+ND+ NTYF   +R  +YDI AY DLM  
Sbjct  150   FREYKNKIMEIVGENRTATIISKSIYILCTGSNDITNTYF---VRGGEYDIQAYTDLMAS  206

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A +F+QELY LGARR  + G+P  GCVPSQRTL GG  RAC +  NEA+ + NSKLS++
Sbjct  207   QATNFLQELYGLGARRIGVVGLPVLGCVPSQRTLHGGIFRACSDFENEAAVLFNSKLSSQ  266

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GT  303
             +D+L  +  ++  VY+D+YNP+L+LIQNP  YGFEV D+GCCGTG +EV  LCN +T   
Sbjct  267   MDALKKQFQEARFVYLDLYNPVLNLIQNPAKYGFEVMDQGCCGTGKLEVGPLCNHFTLLI  326

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C + + Y+FWDSFHPTE AY ++  Q+L   +  F
Sbjct  327   CSNTSNYIFWDSFHPTEAAYNVVCTQVLDHKIKDF  361



>ref|XP_010920106.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=388

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/322 (55%), Positives = 236/322 (73%), Gaps = 2/322 (1%)
 Frame = -1

Query  1169  VVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELG  990
             +V  VIVFGDSIVD G NN ++T  +CN+PPYG DF G  PTGRF NGK P+DFIA +LG
Sbjct  64    LVPAVIVFGDSIVDPGNNNAIKTVVKCNFPPYGVDFIGHKPTGRFSNGKIPTDFIASKLG  123

Query  989   VKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKE  810
             VKELLPAY    L PED  TGVSFASGG GFDPLT+++A+ + ++ QL  F+EYK K++ 
Sbjct  124   VKELLPAYLGTTLGPEDLLTGVSFASGGTGFDPLTSRVASVLSMAEQLELFQEYKEKVRA  183

Query  809   MVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELY  630
             + G  + + I+   L++V AG++D+ NTYF+ P RR  YDI++Y++L++  A++F+QEL 
Sbjct  184   IAGAKRADEILSKALYLVCAGSDDIANTYFTTPFRRTHYDISSYSNLLLHSASNFLQELI  243

Query  629   DLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQ  450
              LGAR+  + GIPP GCVPSQRTL+GG  R C   +N+ +++ NS L+ EI  L +K  +
Sbjct  244   HLGARKIGVAGIPPIGCVPSQRTLSGGILRHCAPGHNQMAELFNSGLTKEIRRLGDK-HR  302

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKYVFW  273
               +VY+DIY  LLD+IQ P NYGFEV+ +GCCGTG +EV+ LCN  T T C D ++YVFW
Sbjct  303   VKVVYIDIYTILLDMIQRPNNYGFEVSTKGCCGTGDLEVSVLCNGLTSTICTDVSQYVFW  362

Query  272   DSFHPTERAYGILVHQILQKYV  207
             DS+HPTERAY +LV  + Q Y+
Sbjct  363   DSYHPTERAYKVLVDWLYQNYI  384



>ref|XP_010680078.1| PREDICTED: uncharacterized protein LOC104895310 [Beta vulgaris 
subsp. vulgaris]
Length=786

 Score =   394 bits (1012),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/328 (57%), Positives = 236/328 (72%), Gaps = 1/328 (0%)
 Frame = -1

Query  1187  KLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDF  1008
             ++   V V  ++VFGDSIVD G NN + T  + N+PPYG+DF G +PTGR+ NGK PSD 
Sbjct  44    EIKKNVKVSALLVFGDSIVDPGNNNYIATIGKANFPPYGRDFPGGVPTGRYSNGKVPSDL  103

Query  1007  IAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEY  828
             IAEELG+KE +P Y DP LQ  D  +GVSFASG  G+DP +A++A  + L  QL  FK Y
Sbjct  104   IAEELGIKEFIPPYLDPKLQISDLISGVSFASGAAGYDPDSAKLANVLSLDDQLKLFKGY  163

Query  827   KGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAAD  648
               KLK  VGEN+T+ II  ++++V AG+ND+ NTYF+LP  R  Y+I+AY  LM++ A+ 
Sbjct  164   IKKLKATVGENKTSSIISQSVYLVCAGSNDITNTYFALPFARLHYNISAYTGLMVKRAST  223

Query  647   FIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSL  468
             F+QELY LGARR  +   PP GC+PSQRTL GG SRAC  + N+AS + NSKL  E+ SL
Sbjct  224   FVQELYALGARRIAVVSAPPCGCLPSQRTLHGGLSRACATKENQASILFNSKLINELTSL  283

Query  467   NNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCPDH  291
             N KL  S I Y+DIYNPLL+LI NP   GF+V +RGCCGTG +EV+FLC K   GTC D 
Sbjct  284   NQKLAHSRIAYLDIYNPLLELITNPSQSGFKVNNRGCCGTGNLEVSFLCTKLDPGTCKDA  343

Query  290   NKYVFWDSFHPTERAYGILVHQILQKYV  207
             +KY+FWDSFHPTE AY  +VH++LQK V
Sbjct  344   SKYIFWDSFHPTEAAYKFIVHKVLQKSV  371


 Score =   391 bits (1004),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/355 (54%), Positives = 246/355 (69%), Gaps = 5/355 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRR----CEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYP  1080
             +M+ VV+ M++          A I L     V  +IVFGDSIVD G NN + T AR N+P
Sbjct  431   VMIIVVYYMVIASYLNIFYGHAIINLGEKAKVPALIVFGDSIVDPGNNNYIVTIARVNFP  490

Query  1079  PYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCG  900
             PYG+DF G +PTGRF NGK PSD IAEELG+KE +P Y DP LQ  D  +GV+FASG  G
Sbjct  491   PYGRDFPGGVPTGRFSNGKVPSDLIAEELGIKEFVPPYLDPKLQISDLLSGVNFASGAAG  550

Query  899   FDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYF  720
             +DP +A+    + L  QL  F+ Y  KL+  VGEN T+ II  +L++V AG+ND+ NTYF
Sbjct  551   YDPNSARSQNVLSLEDQLKLFRGYTDKLRAAVGENTTSSIISQSLYLVCAGSNDITNTYF  610

Query  719   SLPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSR  540
              LP R   Y+I+ Y  LM+Q A+ F+QELY LGAR+  +   PP GC+P+QRTL GG SR
Sbjct  611   GLPTRSLHYNISTYTTLMVQWASSFLQELYGLGARKIGVISGPPCGCLPAQRTLHGGPSR  670

Query  539   ACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
             AC E+ N+AS + NSKLS E+ SLN KL QS IVY+DIY+P+++LI NP   GFEVA++G
Sbjct  671   ACFEKENQASMLFNSKLSTELISLNQKLAQSRIVYLDIYSPIIELITNPSQQGFEVANKG  730

Query  359   CCGTGVIEVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CCGTG IEV+  C ++  GTC D +KYVFWDSFHPTE+AY  +V +++QK +  F
Sbjct  731   CCGTGNIEVSIFCTRFDPGTCKDASKYVFWDSFHPTEKAYKFIVQRVIQKSIGDF  785



>ref|XP_007157889.1| hypothetical protein PHAVU_002G106300g [Phaseolus vulgaris]
 gb|ESW29883.1| hypothetical protein PHAVU_002G106300g [Phaseolus vulgaris]
Length=363

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 236/333 (71%), Gaps = 2/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKTPS  1014
             + LP    V  VIVFGDSIVD G NN + T  +CN+ PYG+DF G   P+GRF NG TPS
Sbjct  30    VSLPNNETVPAVIVFGDSIVDTGNNNYITTIFKCNFQPYGKDFGGGNQPSGRFSNGITPS  89

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D IA + GVK++LP Y DP LQP+D  TGVSFASGG G+DPLT++ A+ + L+ QL  F+
Sbjct  90    DIIASKFGVKKILPPYLDPKLQPQDLLTGVSFASGGSGYDPLTSKSASVLSLADQLEKFR  149

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EYK K++++VGE++T+ I+  +++++  G+ND+ NTY   PIRR  YDI++Y DLM   A
Sbjct  150   EYKSKIEKIVGEDRTSTIMSKSIYILCTGSNDIANTYSLSPIRRAHYDISSYTDLMTSEA  209

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
              +F+QELY LG RR  + G+P  GCVPSQRT+ GG  R C    N+A+ + N+KLS++ID
Sbjct  210   TNFLQELYGLGGRRIGVIGLPALGCVPSQRTIRGGLQRNCSYSENQAAMLFNTKLSSQID  269

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
             +LN K  ++ +VY+DIYNPLL++IQNP  YGFEVA++GCCGTG IE   LCN +T   C 
Sbjct  270   ALNKKNSEARLVYLDIYNPLLNMIQNPATYGFEVANKGCCGTGNIEAGILCNSFTLHICS  329

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +   Y+FWDSFHPT+ AY +L  Q+    +  F
Sbjct  330   NTKSYIFWDSFHPTQEAYNVLCSQVFDNKIKDF  362



>ref|XP_008807138.1| PREDICTED: GDSL esterase/lipase EXL3 [Phoenix dactylifera]
Length=361

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 176/322 (55%), Positives = 233/322 (72%), Gaps = 1/322 (0%)
 Frame = -1

Query  1169  VVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELG  990
             +V  VIVFGDSIVD G NN ++T  +CN+PPYG DF G  PTGRFCNGK P+DFIA +LG
Sbjct  36    LVPAVIVFGDSIVDPGNNNAIKTIVKCNFPPYGVDFIGHKPTGRFCNGKIPTDFIASKLG  95

Query  989   VKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKE  810
             VKELLPAY    L PED  TGVSFASGG GFDPLT+++ + I ++ QL  FK+Y  K++ 
Sbjct  96    VKELLPAYLGTALGPEDLLTGVSFASGGTGFDPLTSKVVSVISMTEQLELFKDYMEKVRA  155

Query  809   MVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELY  630
             + G  +   I+  +L+VV AG++DV NTYF+ P RR  YDI++Y +L++  A++F+QEL 
Sbjct  156   IAGAKRAEDILSRSLYVVCAGSDDVANTYFTTPFRRTNYDISSYVNLLLHSASNFLQELI  215

Query  629   DLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQ  450
              LGAR+  +  IPP GCVPSQRTL+GG  R C   +N+ +++ NS L+ EI  LN K   
Sbjct  216   HLGARKIGVTSIPPIGCVPSQRTLSGGILRNCAPGHNQMAELFNSGLAKEIRRLNTKHRG  275

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKYVFW  273
               +VY+DIY+ LLD+I+ P NYGFEV+ +GCCGTG +EV+ LCN  T T C D ++YVFW
Sbjct  276   VKVVYIDIYSILLDMIERPNNYGFEVSTKGCCGTGDLEVSVLCNGLTSTICTDVSEYVFW  335

Query  272   DSFHPTERAYGILVHQILQKYV  207
             DS+HPTE+AY ILV  + + Y+
Sbjct  336   DSYHPTEKAYEILVDWLYKNYI  357



>ref|XP_010026062.1| PREDICTED: GDSL esterase/lipase At5g42170-like [Eucalyptus grandis]
 gb|KCW58231.1| hypothetical protein EUGRSUZ_H00933 [Eucalyptus grandis]
Length=343

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 168/332 (51%), Positives = 235/332 (71%), Gaps = 1/332 (0%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +A +  P    +  V +FGDSI+D G NNNL T  + N+ PYG+DF G  PTGRF NGK 
Sbjct  7     QAAVVAPENATISAVFMFGDSILDTGNNNNLFTLVKSNFLPYGRDFMGGKPTGRFSNGKI  66

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD +A++LG+KELLPA+ DPNL+ +D   GV+FAS G GF+PLT+++ + IP+S QL  
Sbjct  67    PSDILAQQLGIKELLPAFLDPNLRLQDLIGGVNFASAGAGFNPLTSELVSVIPMSRQLQL  126

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F EYK KLK  +GE + + +I N L+VV AG+ND+ NTYF    R + Y +++Y +L+ +
Sbjct  127   FDEYKMKLKSFIGEERADSVIANGLYVVSAGSNDIANTYFHTLTRLFDYSVSSYTELLAR  186

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+QEL+  GARR  +F + P GC PS RTLAGG  R C E+YN+ +Q++N+KL+ E
Sbjct  187   LASSFLQELHTKGARRIGLFSLAPLGCTPSMRTLAGGIERRCAEDYNQMAQLLNAKLTLE  246

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GT  303
             +  LN   P++ +  +DIY PLLD+++NP+ YGFE++DRGCCG G+IE  F+CN++   T
Sbjct  247   LHRLNGAFPRARMALIDIYGPLLDIMKNPRKYGFEISDRGCCGLGLIEAAFMCNQWNLLT  306

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             C + + YVFWDSFHPTE  Y ILVH +L K +
Sbjct  307   CSNVSGYVFWDSFHPTENVYNILVHGLLGKVL  338



>ref|XP_010679879.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   380 bits (976),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 233/335 (70%), Gaps = 2/335 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
              AKI  P    V  +IVFGDSIVD G NN L T  + N+ PYG+DF G +PTGR+ NGK 
Sbjct  40    HAKIN-PEEKQVPALIVFGDSIVDPGNNNYLATIGKANFLPYGRDFPGGIPTGRYSNGKV  98

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDF AEELG+KEL+P Y DP+LQ  D  TGVSFASG  G+DP +A++   + L  QL  
Sbjct  99    PSDFFAEELGIKELVPPYLDPDLQISDLLTGVSFASGVSGYDPSSAKLENVLSLEDQLKL  158

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FK Y  KL+  VGE+ T+ II  +L++V  G+ND+ N++F  PI R +YDI+ Y DLM+ 
Sbjct  159   FKGYINKLETTVGESTTSTIISQSLYLVCTGSNDITNSFFGSPITRLQYDISTYTDLMVN  218

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+QELY LGARR  +   PP GC+PSQR L GG  RAC EE N+AS + N+KLS +
Sbjct  219   WASSFVQELYALGARRIGVINAPPCGCLPSQRLLHGGLLRACAEEENKASILFNNKLSFQ  278

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GT  303
             + SLN KL +S IVY+DIY P L+LI NP   GFEV DRGCCGTG IEV+ LC K   GT
Sbjct  279   LASLNQKLAKSRIVYLDIYKPFLNLINNPSQSGFEVVDRGCCGTGNIEVSVLCTKLDPGT  338

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C D + Y+FWDSFHPTE  Y ++VH++LQK +  F
Sbjct  339   CQDASNYIFWDSFHPTETTYRLIVHEVLQKSLGDF  373



>ref|XP_004287786.1| PREDICTED: GDSL esterase/lipase EXL3-like [Fragaria vesca subsp. 
vesca]
Length=361

 Score =   379 bits (974),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 234/348 (67%), Gaps = 4/348 (1%)
 Frame = -1

Query  1229  FPMLLLG---RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFA  1059
             FP++++        A + LP  V +  VIV+GDSIVD G NN + T  +CN+ PYG D+ 
Sbjct  13    FPVIIVTFIIYHSAAALTLPKNVTIPAVIVWGDSIVDPGNNNVVNTIVKCNFEPYGMDYN  72

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G  PTGRF NG+ PSD IAEELG+K++LPAY DPNLQ ED  TGVSFASGG G+DPLT +
Sbjct  73    GGEPTGRFSNGRVPSDLIAEELGIKKILPAYLDPNLQTEDLLTGVSFASGGSGYDPLTPK  132

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             I   + LS Q+  FKEYK K+   VG  + N I+   + +V  G++D+ NTY S P R  
Sbjct  133   IVNVLSLSDQIELFKEYKSKIDAAVGVARRNIIVSKGIHIVCIGSDDIANTYLSTPFRSP  192

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
              YDI AY DL+   A+ F Q LY  GAR+  + GIP  GCVPSQRTL+G   R C  + N
Sbjct  193   HYDIPAYTDLLASSASKFFQALYGQGARKIGVVGIPAIGCVPSQRTLSGDIKRGCSAKAN  252

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             +A+ + N+KL A ++SLN KLPQ+  VY DIYNP + LIQNP  YGFEV ++GCCGTG I
Sbjct  253   KAASLFNTKLIALLESLNKKLPQAKFVYFDIYNPSVSLIQNPSKYGFEVVNKGCCGTGNI  312

Query  338   EVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             EV+ LC +++ GTC D +KY+FWDS+HPTE+AY  LV     K + + 
Sbjct  313   EVSILCTRFSLGTCSDPSKYIFWDSYHPTEKAYETLVPMAFDKEIQKL  360



>ref|XP_010934102.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=359

 Score =   379 bits (973),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/318 (56%), Positives = 225/318 (71%), Gaps = 2/318 (1%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              +IVFGDSIVD G NN + T  RCN+PPYG+DF     TGRF NGK PSD IA  +G+K+
Sbjct  38    ALIVFGDSIVDPGNNNEILTTVRCNFPPYGKDFVEHKATGRFSNGKIPSDIIASLIGIKQ  97

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
              +PAY    L  +D  TGVSFASGG G+DPLTA++  A+ L  QLN FK+YK KLK + G
Sbjct  98    YVPAYLGTRLDDQDLLTGVSFASGGGGYDPLTAELVQALTLDEQLNLFKDYKKKLKAIAG  157

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLG  621
             E + + II  +L++V  G +D+ NTYF+ P RR  YD+++Y   ++Q A+ F Q+LY LG
Sbjct  158   EKRASTIISRSLYIVATGNDDLANTYFTSPFRR-NYDLSSYIKFVVQSASSFFQKLYHLG  216

Query  620   ARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTI  441
             ARR  I G+PP GC+PSQR+LAGG  R CV  YN+A+Q +NS+L  EI  LN  LP S I
Sbjct  217   ARRIGITGLPPVGCLPSQRSLAGGIERECVPLYNQAAQTLNSELQMEIQRLNRTLPGSRI  276

Query  440   VYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWDSF  264
             VY+DIY PLLD+IQ P  YGFE   RGCCGTG+ EVT  CN YT   C D +KY+FWD +
Sbjct  277   VYIDIYTPLLDMIQRPYVYGFEEVKRGCCGTGIFEVTLTCNSYTAPACGDVSKYLFWDVY  336

Query  263   HPTERAYGILVHQILQKY  210
             HPTERAY IL+ Q+LQ+Y
Sbjct  337   HPTERAYTILMTQVLQRY  354



>gb|KFK42029.1| hypothetical protein AALP_AA2G202800 [Arabis alpina]
Length=363

 Score =   379 bits (973),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 237/332 (71%), Gaps = 2/332 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             +KLPPG  V  V+ FGDSIVD G NNN++T  +C++ PYG +F G + TGRFC+G+ P D
Sbjct  32    VKLPPGFTVPAVMAFGDSIVDTGNNNNVKTVVKCDFQPYGINFEGGVATGRFCDGRVPVD  91

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              IAEELGVK ++PAY D NL+PED  TGVSFASGG G+DP+T ++   I L  QL YF+E
Sbjct  92    LIAEELGVKSIVPAYLDSNLKPEDLLTGVSFASGGSGYDPITPKLLAVISLEQQLKYFEE  151

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE + ++I+ N+L ++VAG++D+ NTY++L  R + YD+++Y  LM   A+
Sbjct  152   YIEKVKNLVGEERKDFILANSLILLVAGSDDLANTYYTLHARPH-YDVDSYTTLMADYAS  210

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             DF+ +LY  G RR  +F  PP GCVPSQRTL GG  R C E+YN+AS++ NSKLS ++D 
Sbjct  211   DFVTKLYGYGVRRVAVFSAPPIGCVPSQRTLGGGLLRDCAEDYNDASKLFNSKLSKKLDL  270

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             L   L     +Y+DIYNPL D+IQ P  YGF VA++GCCGTG +EV  LCNK T + C D
Sbjct  271   LRQTLLGIKSIYIDIYNPLSDIIQYPAKYGFGVANKGCCGTGALEVAVLCNKVTSSVCSD  330

Query  293   HNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
                +VFWDS+HPTE+ Y  +V  ++ KYV +F
Sbjct  331   VFSHVFWDSYHPTEKTYKAIVKPLMVKYVNQF  362



>ref|XP_004134848.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cucumis sativus]
 gb|KGN48939.1| hypothetical protein Csa_6G507140 [Cucumis sativus]
Length=362

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/331 (53%), Positives = 228/331 (69%), Gaps = 2/331 (1%)
 Frame = -1

Query  1184  LPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFI  1005
             LP    V  +IVFGDSIVD G NN L+T  +CN+PPYG+DF G +PTGRF NGK P+DF+
Sbjct  31    LPENEEVSAIIVFGDSIVDPGNNNYLKTLVKCNFPPYGRDFNGGIPTGRFSNGKIPTDFV  90

Query  1004  AEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYK  825
             AEE GVKEL+PAY DP+L  +D  TGVSFASG  G+DPLT++I + + LS QL  FK+Y 
Sbjct  91    AEEFGVKELVPAYLDPHLTTQDLLTGVSFASGASGYDPLTSKITSVLSLSDQLELFKDYI  150

Query  824   GKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADF  645
              K+K  VGE +   I+  ++ +V  G++D+ NTYF  P RR+ YD+ +Y DLM+Q  + F
Sbjct  151   KKIKAAVGEEKATAILSKSVIIVCTGSDDIANTYFITPFRRFHYDVASYTDLMLQSGSSF  210

Query  644   IQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLN  465
               +LY LGARR  +  +P  GCVPSQRTL GG +R C E  N  + + NSKLS+ IDSL 
Sbjct  211   FHQLYALGARRIGVLSLPAIGCVPSQRTLFGGAARGCSEAANSMAVLFNSKLSSLIDSLG  270

Query  464   NKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG--TCPDH  291
             N+   +  VY+D+Y P L LIQNP  YGFE A +GCCGTG IEV+ LCN  +   +CP  
Sbjct  271   NEYSDAKFVYLDVYTPFLALIQNPAEYGFEEATKGCCGTGSIEVSVLCNPLSSKLSCPSP  330

Query  290   NKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +KY+FWDS+HPT  AY  L  +IL+  + +F
Sbjct  331   DKYIFWDSYHPTGNAYKALTSRILKDSIPKF  361



>gb|EYU38772.1| hypothetical protein MIMGU_mgv1a008997mg [Erythranthe guttata]
Length=356

 Score =   378 bits (971),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/331 (53%), Positives = 234/331 (71%), Gaps = 4/331 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             I LP    +  V+ FGDSIVD G NN + T A+CN+ PYG++F    PTGRF +GK PSD
Sbjct  23    IDLPENATIPAVLFFGDSIVDTGNNNYITTVAKCNFRPYGKNFIEGKPTGRFSDGKVPSD  82

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
               A+ELG+K LLP Y DP+LQ +D  TGV+FASG  G+DPLT+  A+   LS QL  FKE
Sbjct  83    LFAKELGIKPLLPPYLDPSLQDQDLLTGVNFASGASGYDPLTSDPASVFSLSDQLEMFKE  142

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  KLK++ GE +++ I+  ++  V  G+ND+LNTYF  P RR++YD+ +Y DL++  A+
Sbjct  143   YIAKLKKIAGEEKSSAILRESIIAVATGSNDILNTYFLTP-RRFQYDVPSYTDLLVSYAS  201

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
              F+QELY LGARR  +F +PP GC PSQ TL GG  R CV++YNE +++ N+KLSA I S
Sbjct  202   SFVQELYRLGARRIGVFSMPPIGCAPSQITLKGGLDRKCVDKYNEIAKLFNNKLSAAITS  261

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCPDH  291
             LN +   + IVY D YNP LD+I NPQ YGF++ADRGCCGTG++EV+ +C      C + 
Sbjct  262   LNTRFTDARIVYFDAYNPTLDIILNPQKYGFKIADRGCCGTGLVEVSLVCRY---ACSNV  318

Query  290   NKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             N YVFWDSFHP+E+ Y ILV +IL++Y+  F
Sbjct  319   NDYVFWDSFHPSEKTYTILVRRILEQYISYF  349



>ref|XP_008807139.1| PREDICTED: GDSL esterase/lipase EXL3-like [Phoenix dactylifera]
Length=358

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 174/318 (55%), Positives = 228/318 (72%), Gaps = 1/318 (0%)
 Frame = -1

Query  1166  VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGV  987
             V  VIVFGDSIVD G NN L T  RCN+PPYGQDF    PTGRF NG+ PSD IA +LGV
Sbjct  34    VPAVIVFGDSIVDPGNNNVLPTLVRCNFPPYGQDFVRHQPTGRFSNGRIPSDLIASKLGV  93

Query  986   KELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEM  807
             KEL+P YF  +L+PED  TGVSFASG  G+DPLT  +   + ++ +L  FK+YK +LK +
Sbjct  94    KELVPPYFGYDLKPEDILTGVSFASGATGYDPLTPTLLNVLSMTEELKLFKKYKERLKAI  153

Query  806   VGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYD  627
              GE +   I+  +L+VV +GT+D+ NTYF+ P RR +YDI +Y +LMI+GA+ F++EL  
Sbjct  154   AGEERATSIVAKSLYVVCSGTDDIANTYFTTPFRRLQYDIPSYVNLMIRGASSFLEELLQ  213

Query  626   LGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQS  447
             +GAR+    G+PP GCVPSQRTL GG  R C    N+A+Q+ NSK+  E D L+ +    
Sbjct  214   MGARKIAFVGLPPIGCVPSQRTLGGGIERNCEPMRNQAAQLFNSKIQKEADRLSREHKGV  273

Query  446   TIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKYVFWD  270
              IVY+DIY+ L+DLI +P  +GFE++DRGCCGTG IEVT LCN+ T + CP+   YVFWD
Sbjct  274   QIVYIDIYSMLIDLIFHPSKFGFEISDRGCCGTGEIEVTVLCNRVTASVCPNVTAYVFWD  333

Query  269   SFHPTERAYGILVHQILQ  216
             S+HPTERAY I++ +I +
Sbjct  334   SYHPTERAYKIMIDKIFK  351



>ref|XP_004158854.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cucumis sativus]
Length=362

 Score =   378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/331 (53%), Positives = 228/331 (69%), Gaps = 2/331 (1%)
 Frame = -1

Query  1184  LPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFI  1005
             LP    V  +IVFGDSIVD G NN L+T  +CN+PPYG+DF G +PTGRF NGK P+DF+
Sbjct  31    LPENEEVSAIIVFGDSIVDPGNNNYLKTLVKCNFPPYGRDFNGGIPTGRFSNGKIPTDFV  90

Query  1004  AEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYK  825
             AEE GVKEL+PAY DP+L  +D  TGVSFASG  G+DPLT++I + + LS QL  FK+Y 
Sbjct  91    AEEFGVKELVPAYLDPHLTTQDLLTGVSFASGASGYDPLTSKITSVLSLSDQLELFKDYI  150

Query  824   GKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADF  645
              K+K  VGE +   I+  ++ +V  G++D+ NTYF  P RR+ YD+ +Y DLM+Q  + F
Sbjct  151   KKIKAAVGEEKATAILSKSVIIVCTGSDDIANTYFITPFRRFHYDVASYTDLMLQSGSIF  210

Query  644   IQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLN  465
               +LY LGARR  +  +P  GCVPSQRTL GG +R C E  N  + + NSKLS+ IDSL 
Sbjct  211   FHQLYALGARRIGVLSLPAIGCVPSQRTLFGGAARGCSEAANSMAVLFNSKLSSLIDSLG  270

Query  464   NKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG--TCPDH  291
             N+   +  VY+D+Y P L LIQNP  YGFE A +GCCGTG IEV+ LCN  +   +CP  
Sbjct  271   NEYSDAKFVYLDVYTPFLALIQNPAEYGFEEATKGCCGTGSIEVSVLCNPLSSKLSCPSP  330

Query  290   NKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +KY+FWDS+HPT  AY  L  +IL+  + +F
Sbjct  331   DKYIFWDSYHPTGNAYKALTSRILKDSIPKF  361



>ref|XP_003612218.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES95176.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=366

 Score =   377 bits (968),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 178/343 (52%), Positives = 233/343 (68%), Gaps = 2/343 (1%)
 Frame = -1

Query  1220  LLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDF-AGEMPT  1044
             + +   C   + LP    +  +IVFGDSIVD G NN + T+ +CN+ PYG+DF +G  PT
Sbjct  23    IFISLHCGNAVNLPNNETIPALIVFGDSIVDSGNNNYIGTYVKCNFLPYGRDFGSGNQPT  82

Query  1043  GRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAI  864
             GRF NG  PSD IA + GVK+LLP Y DPNLQ ED  TGVSFASGG G+DPLT+Q+A  +
Sbjct  83    GRFSNGLVPSDIIASKFGVKKLLPPYLDPNLQLEDLLTGVSFASGGAGYDPLTSQLALVL  142

Query  863   PLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDIN  684
              LS QLN FKEYK K+KE VGE +   II  +++++  G +D+ NTY   P R+ +YDI 
Sbjct  143   SLSDQLNMFKEYKNKIKEAVGEMRMEMIISKSVYIICIGADDIANTYSQTPFRKPQYDIP  202

Query  683   AYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQI  504
             AY +L+I  A DFIQELY LGARR  + G+P  GCVPSQRT+ GG  R C    NEA+ +
Sbjct  203   AYTNLLISYALDFIQELYGLGARRIGVIGMPYIGCVPSQRTIGGGMYRHCSGLENEAAIV  262

Query  503   VNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFL  324
              NSKL +++D+  NK P++ +VY+DIYNP + +IQNP  YGFEV D GCCGTG +E   L
Sbjct  263   FNSKLVSQMDAFENKFPEAKLVYLDIYNPFMHMIQNPDKYGFEVVDEGCCGTGEMEAGIL  322

Query  323   CNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             CN Y+   C + + Y+FWDS+HPT+ AY +L   +L   +  F
Sbjct  323   CNSYSLNLCSNPSSYIFWDSYHPTQEAYNLLCSMVLDDKIKDF  365



>gb|KHN41128.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=367

 Score =   377 bits (967),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 181/335 (54%), Positives = 235/335 (70%), Gaps = 4/335 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKTPS  1014
             + LP    V  VIVFGDSIVD G NN + T A+ N+ PYG+DF G   PTGRF NG TPS
Sbjct  32    VSLPNNESVPAVIVFGDSIVDTGNNNYINTIAKVNFLPYGKDFGGGNQPTGRFSNGLTPS  91

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIAT--AIPLSTQLNY  840
             D IA +LGVK+LLP Y DP LQP+D  TGVSFASGG G+DPLT++IA    + LS QL+ 
Sbjct  92    DIIAAKLGVKKLLPPYLDPKLQPQDLLTGVSFASGGSGYDPLTSKIAVNNLLSLSDQLDK  151

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EYK K+KE VG N+T  II  +++++  G+ND+ NTY   P RR +YDI +Y D MI+
Sbjct  152   FREYKNKIKETVGGNRTTTIISKSIYILCTGSNDIANTYSLSPFRRLQYDIQSYIDFMIK  211

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A +F++ELY LGARR  + G+P  GCVP QRT+ GG  R C +  N A+ + N+KLS++
Sbjct  212   QATNFLKELYGLGARRIGVIGLPVLGCVPFQRTIQGGIHRECSDFENHAATLFNNKLSSQ  271

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GT  303
             ID+L  + P++  VY++IYNPLL++IQN   YGFEV D+GCCGTG  EV FLCN+ T   
Sbjct  272   IDALKKQFPETKFVYLEIYNPLLNMIQNATKYGFEVTDKGCCGTGDFEVGFLCNRLTPHI  331

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C + + Y+FWDSFHPTE  Y +L  Q+L K +  F
Sbjct  332   CSNTSSYIFWDSFHPTEEGYKVLCSQVLDKNIKDF  366



>ref|XP_010266977.1| PREDICTED: GDSL esterase/lipase At3g14820-like [Nelumbo nucifera]
Length=660

 Score =   387 bits (993),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 241/348 (69%), Gaps = 14/348 (4%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             EAKI LP  V V  +I+FGDSIVD G NN+L T  +CN+PPYG+DF G  PTGRF NG+ 
Sbjct  22    EAKIILPKNVTVPALIMFGDSIVDTGNNNHLATLFKCNFPPYGKDFLGGEPTGRFSNGRI  81

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD +AEELG+KE LPAY DPNLQ E+  TGV FAS G G+DPLT+Q+ + + LS QL  
Sbjct  82    PSDILAEELGIKEFLPAYLDPNLQTEELLTGVCFASSGTGYDPLTSQVTSVLSLSDQLKL  141

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEY  KLK +VGE +T  II  +L+VV AG+ND L TYF  P+RR KYD+ AY D MIQ
Sbjct  142   FKEYIEKLKTLVGEERTATIISQSLYVVCAGSNDFLITYFLTPLRRAKYDVPAYTDFMIQ  201

Query  659   GAADF----IQELYDLGARRAVIFGIPPAGCVPSQRTL------AGGKSRACVEEYNEAS  510
              A+ F    IQELYDLGARR  +  +P  GCVP  R+L        G    C+E+ NEA+
Sbjct  202   SASTFLQVSIQELYDLGARRIAVLSVPSVGCVPYARSLLGGIGGGRGGDGGCIEDVNEAA  261

Query  509   QIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVT  330
             Q+ N+KLS+++D LNNK P++ +VY+D+Y PLL L + P++YGFE   +GCCGTG IEV 
Sbjct  262   QLFNAKLSSQMDWLNNKFPEARMVYIDVYFPLLHLNRRPRDYGFEEVSKGCCGTGKIEVA  321

Query  329   FLCNKYTG-TCPDHNKYVFWDSFHPTERAYGIL---VHQILQKYVYRF  198
              LCN     TC D +KYV+WDS HPTE+AY I+   V    Q  +Y+F
Sbjct  322   ELCNDLNPFTCTDVSKYVYWDSVHPTEKAYQIIFASVEMQAQSLIYKF  369


 Score =   312 bits (800),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 194/270 (72%), Gaps = 2/270 (1%)
 Frame = -1

Query  1184  LPP--GVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             +PP   + V  V VFGDSIVD G NN L +  +CN+PPYG+DF G   TGR  NG+ PSD
Sbjct  387   VPPQKNITVPAVYVFGDSIVDTGNNNYLFSVVKCNFPPYGRDFMGGRATGRCSNGRLPSD  446

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +A +LG+KE LPAY DPNLQPED  TG+SFAS   G+DPLTA++++ + LS QL  FKE
Sbjct  447   LLARKLGIKETLPAYLDPNLQPEDLVTGISFASSSTGYDPLTAKVSSVLSLSDQLKLFKE  506

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             YK K+K +VGE ++  II ++L+VV AG+ND L TYF+ P+RR KYD+ AY DLM++ A+
Sbjct  507   YKDKVKTLVGEERSATIISHSLYVVCAGSNDFLITYFTTPLRRKKYDVPAYTDLMLRSAS  566

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
              F+Q+LY LGARR  +F IP  GCVP+ R + GG    CV+  N+A +I N+KL +++DS
Sbjct  567   SFLQKLYGLGARRIAVFSIPAVGCVPTARFIFGGGQGGCVKSVNQAGEIFNAKLYSKLDS  626

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYG  381
             LNNK PQ+ + Y+D+Y P L L Q P +YG
Sbjct  627   LNNKFPQARMAYIDVYFPFLRLNQKPHDYG  656



>ref|XP_007223323.1| hypothetical protein PRUPE_ppa009528mg [Prunus persica]
 gb|EMJ24522.1| hypothetical protein PRUPE_ppa009528mg [Prunus persica]
Length=288

 Score =   373 bits (957),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/287 (61%), Positives = 213/287 (74%), Gaps = 2/287 (1%)
 Frame = -1

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
             MPTGR+ NGK PSD I E LG+KELLPAY DP LQP+D  TGV  A+GG G+DPLTAQ+A
Sbjct  1     MPTGRYSNGKVPSDLIVEALGIKELLPAYLDPTLQPKDLLTGVVIAAGGAGYDPLTAQVA  60

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
                 LS QL  FKEY  KLK + GE + N+II N+L  VVAGTND+ NTYF   +R+ +Y
Sbjct  61    GVASLSDQLKQFKEYIKKLKAIAGEERANFIISNSLIFVVAGTNDISNTYFLTGLRKLEY  120

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             D+ +Y DLM+  A+ F+++LY LG RR  +   PP GCVPSQRT+AGG  R C E+ N+A
Sbjct  121   DVPSYTDLMLNYASVFVKDLYGLGVRRIGVLNTPPIGCVPSQRTVAGGVLRECDEKQNQA  180

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             SQ+ NSKLSAE+D LN  LP S +VY+DIYNPLLDLI NP  YGFEV ++GCCGTG+IEV
Sbjct  181   SQLFNSKLSAEVDDLNKNLPNSRVVYIDIYNPLLDLINNPSKYGFEVVNKGCCGTGIIEV  240

Query  332   TFLCNKY--TGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             T LCN+    GTC D +KYVFWDS+HPTERAY I+V  IL KY+  F
Sbjct  241   TKLCNQIQPAGTCSDDSKYVFWDSYHPTERAYKIIVQHILDKYINFF  287



>ref|XP_010029654.1| PREDICTED: GDSL esterase/lipase EXL3-like [Eucalyptus grandis]
 gb|KCW56604.1| hypothetical protein EUGRSUZ_I02326 [Eucalyptus grandis]
Length=372

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/352 (50%), Positives = 239/352 (68%), Gaps = 5/352 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRC---EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPP  1077
             L+++ ++ ++L+   C    A +  P    V  V  FGDSIVD G NN L T A+C++PP
Sbjct  17    LLLAAIWAVVLVSPHCGAAAASVVPPCNATVPAVFAFGDSIVDPGNNNGLATVAKCDFPP  76

Query  1076  YGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGF  897
             YG+D    +P GRF NG+ PSD +AE+LGVK+ LPAY DPNL+ +D  TGVSFASG  G+
Sbjct  77    YGRDLDPGVPIGRFSNGRVPSDMLAEKLGVKKFLPAYLDPNLELQDLLTGVSFASGANGY  136

Query  896   DPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             DPL+A++A  + LS QL+ + EY   ++  VGE + + I   ++++V  G ND+ NTYF+
Sbjct  137   DPLSAKLALVLSLSDQLDLYSEYMETVRSAVGEERASAIASESVYMVCTGANDITNTYFA  196

Query  716   LPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRA  537
              P+RR+KYD+ +Y DL++  A  F++ELY LGARR  +  +PP GC+PSQRTL GG  R 
Sbjct  197   TPLRRFKYDVPSYTDLLVNSALSFLRELYGLGARRIGVLSLPPVGCLPSQRTLHGGPKRG  256

Query  536   CVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGC  357
             C    NEA+ + NSKL AEIDSL  +LP + +VY+DIY PLL ++Q P  +GFEV+ +GC
Sbjct  257   CFNSANEAAVLFNSKLYAEIDSLRKELPGARLVYMDIYYPLLAIMQGPAQFGFEVSTKGC  316

Query  356   CGTGVIEVTFLCNKYTG--TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             CGTG IEV++LC++      C D  KYVFWDSFHPTE  Y +L  QI  KY 
Sbjct  317   CGTGNIEVSYLCSRLDNPVMCDDDTKYVFWDSFHPTEATYRMLTDQIYSKYA  368



>ref|XP_006574669.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
Length=365

 Score =   375 bits (964),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/333 (53%), Positives = 232/333 (70%), Gaps = 2/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKTPS  1014
             + LP    V  VIVFGDSIVD G N+ + T  +CN+ PYG+DF G   PTGRF NG  PS
Sbjct  32    VSLPNNETVPAVIVFGDSIVDTGNNDYITTLVKCNFQPYGRDFGGGNQPTGRFSNGLVPS  91

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D IA + GVK+ LP Y DPNLQ +D  TGVSFASGG GFDPLTA++   + LS QL+ F+
Sbjct  92    DIIAAKFGVKKFLPPYLDPNLQLQDLLTGVSFASGGAGFDPLTAELVNVMSLSDQLDMFR  151

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EY  K+ E VG N+T  I+  ++++V  G++D+ NTY  LP R  +YDI +Y DLM   A
Sbjct  152   EYTRKINEAVGRNRTAMIVSKSIYIVCVGSDDIANTYSQLPFRSAEYDIPSYTDLMASEA  211

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
             ++F+Q+LY LGARR  +FG+P  GCVPSQRTL G  +RAC++  N+A+ + NSKLS ++ 
Sbjct  212   SNFLQKLYGLGARRIGVFGLPVIGCVPSQRTLGGSLNRACLDSSNQAAMLFNSKLSTQMV  271

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
              L  K   S +VY+D YN LL+++QNP  YGFEV DRGCCGTG IEV+ LCN+Y+  TC 
Sbjct  272   VLGKKFSDSRLVYLDSYNGLLNMLQNPAKYGFEVTDRGCCGTGNIEVSLLCNRYSIDTCS  331

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             + + Y+FWDS+HPT++AY +L   +L   +  F
Sbjct  332   NSSNYIFWDSYHPTQKAYNVLSSLVLDNKIKDF  364



>ref|XP_003612217.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES95175.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=367

 Score =   375 bits (964),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 236/345 (68%), Gaps = 3/345 (1%)
 Frame = -1

Query  1223  MLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNL-QTFARCNYPPYGQDFAG-EM  1050
             ++L+       + LP    V   I FGDSIVD G NN +  T  +CN+PPYG+DF G   
Sbjct  22    IILVSLHYGNAVNLPNNETVPAFIAFGDSIVDSGNNNYIINTVFKCNFPPYGKDFGGGNQ  81

Query  1049  PTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIAT  870
             PTGRF NG  PSD IA + GVK+LLPAY DPNLQ +D  TGVSFASGG G+DPLT++ A+
Sbjct  82    PTGRFSNGLVPSDIIASKFGVKKLLPAYLDPNLQLQDLLTGVSFASGGAGYDPLTSKSAS  141

Query  869   AIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYD  690
              I LS QLN FKEYK K+KE VGE +   II  +++++  G+ND+ NTY   P RR KYD
Sbjct  142   VISLSDQLNMFKEYKNKIKEAVGEMRMEMIISKSVYIICIGSNDIANTYAQTPYRRVKYD  201

Query  689   INAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEAS  510
             I +Y DL+   A++F+QELY LGARR  + G+P  GCVPSQRT+ GG  R C +  N+A+
Sbjct  202   IRSYTDLLASYASNFLQELYGLGARRIGVIGMPNIGCVPSQRTIGGGIERGCSDFENQAA  261

Query  509   QIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVT  330
             ++ NSKL +++D+  NK P++ +VY+DIY  L  L+QNP  YGFEVAD+GCCGTG IEV+
Sbjct  262   RLFNSKLVSKMDAFENKFPEAKLVYLDIYTSLSQLVQNPAKYGFEVADKGCCGTGNIEVS  321

Query  329   FLCNKYTGT-CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
              LCN Y+   C + + Y+FWDS+HPT+ AY +L   +    +  F
Sbjct  322   ILCNHYSSNICSNPSSYIFWDSYHPTQEAYNLLCAMVFDDKIKDF  366



>gb|KHN00457.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=365

 Score =   375 bits (963),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 232/333 (70%), Gaps = 2/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKTPS  1014
             + LP    V  V+VFGDSIVD G N+ + T  +CN+ PYG+DF G   PTGRF NG  PS
Sbjct  32    VSLPNNETVPAVVVFGDSIVDTGNNDYITTLVKCNFQPYGRDFGGGNQPTGRFSNGLVPS  91

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D IA + GVK+ LP Y DPNLQ +D  TGVSFASGG GFDPLTA++   + LS QL+ F+
Sbjct  92    DIIAAKFGVKKFLPPYLDPNLQLQDLLTGVSFASGGAGFDPLTAELVNVMSLSDQLDMFR  151

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EY  K+ E VG N+T  I+  ++++V  G++D+ NTY  LP R  +YDI +Y DLM   A
Sbjct  152   EYTRKINEAVGRNRTAMIVSKSIYIVCVGSDDIANTYSQLPFRSAEYDIPSYTDLMASEA  211

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
             ++F+Q+LY LGARR  +FG+P  GCVPSQRTL G  +RAC++  N+A+ + NSKLS ++ 
Sbjct  212   SNFLQKLYGLGARRIGVFGLPVIGCVPSQRTLGGSLNRACLDSSNQAAMLFNSKLSTQMV  271

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
              L  K   S +VY+D YN LL+++QNP  YGFEV DRGCCGTG IEV+ LCN+Y+  TC 
Sbjct  272   VLGKKFSDSRLVYLDSYNGLLNMLQNPAKYGFEVTDRGCCGTGNIEVSLLCNRYSIDTCS  331

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             + + Y+FWDS+HPT++AY +L   +L   +  F
Sbjct  332   NSSNYIFWDSYHPTQKAYNVLSSLVLDNKIKDF  364



>ref|XP_004512156.1| PREDICTED: GDSL esterase/lipase EXL3-like [Cicer arietinum]
Length=361

 Score =   374 bits (960),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 242/351 (69%), Gaps = 2/351 (1%)
 Frame = -1

Query  1244  MVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             ++  +  +L++       + LP    V  +IVFGDS+VD G NN + T  +CN+ PYG+D
Sbjct  10    LICYLATILIISLHYGDALNLPNNETVPALIVFGDSVVDSGNNNYINTIVKCNFEPYGRD  69

Query  1064  FAG-EMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             F G   PTGRF NG  PSD IA + GVK++LPAY DPNLQ +D  TGVSFASGG G+DPL
Sbjct  70    FGGGNQPTGRFSNGLVPSDIIASKFGVKKILPAYLDPNLQLQDLLTGVSFASGGAGYDPL  129

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T+++A+ I LS QLN FKEYK K+K+ VGE +   II  ++++V  G++D+ NTY   P 
Sbjct  130   TSKLASVISLSEQLNMFKEYKNKIKKAVGEKRMEMIITKSVYIVCIGSDDIANTYAQSPF  189

Query  707   RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVE  528
             R  +YDI +Y DL+   A++F+QELY LG RR  + G+P  GCVPSQRT+ GG  R C +
Sbjct  190   RSAEYDIPSYTDLLASYASNFLQELYGLGGRRIGVIGMPNIGCVPSQRTIRGGIQRGCSD  249

Query  527   EYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGT  348
               N+A+ + NSKL ++I++  ++  ++ +VY+DIYNPL+D+ QNP  YGFEV+DRGCCGT
Sbjct  250   LENQAATLFNSKLVSQIEAFQHQFLEAKLVYLDIYNPLMDITQNPTKYGFEVSDRGCCGT  309

Query  347   GVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             G IEV+ LCN Y+  TC + + YVFWDS+HPT+ AY +L   ++   +  F
Sbjct  310   GNIEVSVLCNHYSSDTCSNPSSYVFWDSYHPTQEAYNVLCSMVIDDKIKDF  360



>emb|CDX87653.1| BnaA07g32200D [Brassica napus]
Length=306

 Score =   371 bits (952),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/302 (58%), Positives = 223/302 (74%), Gaps = 1/302 (0%)
 Frame = -1

Query  1103  TFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGV  924
             T ARC+YPPYG DF G + TGRF NGK P+D +AEELG+K  +PAY DPNL+PED  TGV
Sbjct  3     TEARCDYPPYGIDFDGGVATGRFSNGKVPTDILAEELGLKPSIPAYRDPNLKPEDLLTGV  62

Query  923   SFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGT  744
             +FASGG G+ P T QIA  IPLS QL YF+EY  KL  MVGE +T +I++N++FVV+ G+
Sbjct  63    TFASGGAGYVPFTTQIAGGIPLSQQLKYFEEYIEKLNGMVGEERTKFILKNSMFVVICGS  122

Query  743   NDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQR  564
             ND+ N +F LP  R +Y ++++  LM   A  F + LY  GARR ++FG PP GCVPSQR
Sbjct  123   NDIANDFFGLPTVRLQYTVDSFTALMADNARSFAKSLYGYGARRILMFGAPPIGCVPSQR  182

Query  563   TLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNY  384
             T+AGG +R CV  +N+AS++ N+KLS  ID L+  L  S ++YVDIY+PLLDLI NP  Y
Sbjct  183   TVAGGPTRDCVVRFNDASKLFNAKLSGNIDVLSRTLLDSKLIYVDIYSPLLDLILNPGQY  242

Query  383   GFEVADRGCCGTGVIEVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             GF+V++ GCCGTG+IEVT LCN YT   CP  + YVFWDSFHPTE AY I+V ++L +Y+
Sbjct  243   GFKVSNLGCCGTGLIEVTALCNNYTSAVCPIRSDYVFWDSFHPTETAYRIIVAKLLDRYL  302

Query  206   YR  201
              R
Sbjct  303   SR  304



>ref|XP_007132710.1| hypothetical protein PHAVU_011G118200g [Phaseolus vulgaris]
 gb|ESW04704.1| hypothetical protein PHAVU_011G118200g [Phaseolus vulgaris]
Length=357

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 234/333 (70%), Gaps = 3/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKTPS  1014
             + LP    V  VIVFGDSIVD G NN ++T   C++ PYG+DF G   PTGRF NG  PS
Sbjct  25    VSLPNNESVPAVIVFGDSIVDTGNNNYIKTIVNCDFQPYGKDFGGGNQPTGRFSNGLIPS  84

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             DF A +  VK+LLP Y DPNL+ ED  TGVSFA+GG G+DPLT+ IA    LS QL+ F+
Sbjct  85    DFFAAKFEVKKLLPPYLDPNLKREDLLTGVSFATGGSGYDPLTSTIALVPSLSDQLDKFR  144

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EYK K+++M+GEN T  +I  +++++  G+ND+ NT+F+LP RR +Y+I+ Y D +   A
Sbjct  145   EYKKKIQDMIGENTTT-MISKSIYILCTGSNDITNTFFTLPFRRLQYNISTYTDFLTSEA  203

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
             + F+QELY LGARR  I G+   GCVP QRT  GG  RAC +  N+A+ + N+KLS++ID
Sbjct  204   SQFLQELYGLGARRIGITGLTNIGCVPFQRTFKGGIKRACSDLENQAAMLFNNKLSSQID  263

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
             +L   LP + +VY+DIYNPLLD+IQNP  YGFEV ++GCCGTG  EV FLCN +T   C 
Sbjct  264   ALGKLLPDARLVYLDIYNPLLDMIQNPTKYGFEVTNKGCCGTGKFEVGFLCNPFTLELCS  323

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             + + Y+FWDSFHPTE AY IL  Q++ K +  F
Sbjct  324   NRSNYIFWDSFHPTENAYNILCSQVIDKNINGF  356



>ref|XP_003527438.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
 gb|KHN41129.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=362

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 234/335 (70%), Gaps = 5/335 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAG-EMPTGRFCNGKT  1020
             + + LP    +  VIVFGDSIVD G NN + T A+CN+ PYG+DF G   PTGRF NG  
Sbjct  30    SSVSLPNYESIPAVIVFGDSIVDTGNNNYINTIAKCNFLPYGRDFGGGNQPTGRFSNGLV  89

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD IA + GVKELLP Y DP LQP+D  TGVSFASG  G+DPLT++IA    LS QL+ 
Sbjct  90    PSDIIAAKFGVKELLPPYLDPKLQPQDLLTGVSFASGANGYDPLTSKIALVWSLSDQLDM  149

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EYK K+ E+VGEN+T  II   ++++  G+ND+ NTY     RR +YDI AY DLM  
Sbjct  150   FREYKNKIMEIVGENRTATIISKGIYILCTGSNDITNTYV---FRRVEYDIQAYTDLMAS  206

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A +F+QELY LGARR  + G+P  GCVPSQRT+ GG SRAC +  N+A+ + NSKLS++
Sbjct  207   QATNFLQELYGLGARRIGVVGLPVLGCVPSQRTIDGGISRACSDFENQAAVLFNSKLSSQ  266

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GT  303
             +D+L  +  ++ +VY+D+YNPLL LIQNP  YGFEV D+GCCGTG +EV+ +CN +    
Sbjct  267   MDALKKQFQEARLVYLDLYNPLLHLIQNPAKYGFEVIDKGCCGTGNLEVSLMCNHFVLHI  326

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C + + Y+FWDSFHPT+ AY ++   +L   +  F
Sbjct  327   CSNTSNYIFWDSFHPTQAAYNVVCSLVLDHKIKDF  361



>gb|AAF79814.1|AC007396_7 T4O12.12 [Arabidopsis thaliana]
Length=687

 Score =   383 bits (983),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 242/345 (70%), Gaps = 15/345 (4%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNN-LQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             A +K PP      +IVFGDSIVD G N++ + T ARCNYPPYG DF G +PTGRFCNGK 
Sbjct  343   ALVKQPPNETTPAIIVFGDSIVDAGNNDDIMTTLARCNYPPYGIDFDGGIPTGRFCNGKV  402

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIAT----------  870
              +DFIA + G+K  +PAY +PNL+PED  TGV+FASGG G+ P T Q++T          
Sbjct  403   ATDFIAGKFGIKPSIPAYRNPNLKPEDLLTGVTFASGGAGYVPFTTQLSTYLFIYKPLLF  462

Query  869   ---AIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
                 I LS QL  F+EY  K+K+MVGE +T  II+N+LF+V+ G+ND+ NTYF LP  + 
Sbjct  463   LKGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSNDITNTYFGLPSVQQ  522

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             +YD+ ++  LM   A  F Q+L++ GARR  +FG PP GCVPSQRTLAGG +R CV  +N
Sbjct  523   QYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRFN  582

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             +A+++ N KL+A + SL+  L   TI+YVDIY+ LLD+I +P+ YGF+V D+GCCGTG+I
Sbjct  583   DATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGFKVVDKGCCGTGLI  642

Query  338   EVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             EV  LCN +    CP+ ++YVFWDSFHPTE+ Y I+  +  ++YV
Sbjct  643   EVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMATKYFERYV  687


 Score =   357 bits (917),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/318 (55%), Positives = 228/318 (72%), Gaps = 3/318 (1%)
 Frame = -1

Query  1247  LMVSVVFPMLLLG--RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPY  1074
             ++   +F ++LL       A +K+P    V  VIVFGDSIVD G N+++ T ARC+Y PY
Sbjct  21    ILFWCIFVLVLLSTTSTTNALVKIPKNTTVPAVIVFGDSIVDAGNNDDMITEARCDYAPY  80

Query  1073  GQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFD  894
             G DF G + TGRF NGK P D +AEELG+K  +PAY +PNL+PE+  TGV+FASGG G+ 
Sbjct  81    GIDFDGGVATGRFSNGKVPGDIVAEELGIKPNIPAYRNPNLKPEELLTGVTFASGGAGYV  140

Query  893   PLTAQIATA-IPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             PLT +IA   IPL  QL YF+EY  KLK+MVGE +T +II+N+LFVV+ G+ND+ N +F+
Sbjct  141   PLTTKIAVGGIPLPQQLIYFEEYIEKLKQMVGEKRTKFIIKNSLFVVICGSNDIANDFFT  200

Query  716   LPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRA  537
             LP  R  Y + ++  LM   A  F Q LY  GARR ++FG PP GCVPSQRT+AGG +R 
Sbjct  201   LPPVRLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRD  260

Query  536   CVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGC  357
             CV  +N+A+++ N+KLSA ID L+  L   TI+Y+DIY+PLLDLI NP  YGF+VA++GC
Sbjct  261   CVARFNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSPLLDLILNPHQYGFKVANKGC  320

Query  356   CGTGVIEVTFLCNKYTGT  303
             CGTG+IEVT LCN YT +
Sbjct  321   CGTGLIEVTALCNNYTAS  338



>ref|NP_199032.2| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FHW9.2|GDL90_ARATH RecName: Full=GDSL esterase/lipase At5g42170; AltName: Full=Extracellular 
lipase At5g42170; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AED94775.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=369

 Score =   372 bits (955),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/335 (50%), Positives = 240/335 (72%), Gaps = 4/335 (1%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +  IKLPP V + G+I FGDSIVD G NN+L+T  +CN+PPYG+DF G++ TGRF +G+ 
Sbjct  37    KGTIKLPPNVTIPGIITFGDSIVDSGNNNHLRTALKCNFPPYGKDFPGKIATGRFSDGRV  96

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSD +AE LG+ E +PAY +P L+ ED   GV+FASGG G+DPLTA++   + LS QL  
Sbjct  97    PSDIVAERLGIAETIPAYLNPKLKNEDLLKGVNFASGGSGYDPLTAKLVKVVSLSDQLKN  156

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EYK KLK +VGE + N++++N+L++VVA +ND+ +TY +   R  KY+  +YAD +  
Sbjct  157   FQEYKNKLKVIVGEEKANFLVKNSLYLVVASSNDIAHTYTA---RSIKYNKTSYADYLAD  213

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              A+ F+  LY LGARR  +F   P GCVP+ RTL G   R C E+ NE ++  N+K+S  
Sbjct  214   SASKFVSALYGLGARRIGVFSAVPVGCVPAARTLRGKLKRRCSEKLNEVARNFNAKISPT  273

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +++L  +LP S +V +D+ + L D+I+NP+NYGFEV++RGCCGTG++EV FLCNK    T
Sbjct  274   LEALGKELPDSRVVLIDVCDTLNDMIENPKNYGFEVSNRGCCGTGLVEVLFLCNKINPFT  333

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             C + + Y+FWDS+HPTE+AY I+V ++L  Y+ + 
Sbjct  334   CKNSSSYIFWDSYHPTEKAYQIIVDKLLGNYITKL  368



>gb|AAF79815.1|AC007396_8 T4O12.13 [Arabidopsis thaliana]
Length=730

 Score =   384 bits (985),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 239/317 (75%), Gaps = 2/317 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSD  1011
             +KLPP +++  VI FGDSIVD GMNNN++T  +C++ PYG +F   + TGRFC+G+ P+D
Sbjct  82    VKLPPKLIIPAVIAFGDSIVDTGMNNNVKTVVKCDFLPYGINFQSGVATGRFCDGRVPAD  141

Query  1010  FIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKE  831
              +AEELG+K ++PAY DPNL+ +D  TGVSFASGG G+DP+T ++   I L  QL+YF+E
Sbjct  142   LLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKLVAVISLEDQLSYFEE  201

Query  830   YKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAA  651
             Y  K+K +VGE + ++I+ N+LF++VAG++D+ NTY++L  R  +YD+++Y  LM   A+
Sbjct  202   YIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYYTLRARP-EYDVDSYTTLMSDSAS  260

Query  650   DFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDS  471
             +F+ +LY  G RR  +FG PP GCVPSQRTL GG  R C + YNEA+++ NSKLS ++DS
Sbjct  261   EFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNEAAKLFNSKLSPKLDS  320

Query  470   LNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPD  294
             L   LP    +Y++IY+PL D+IQNP NYGFEV+++GCCGTG IEV  LCNK T + CPD
Sbjct  321   LRKTLPGIKPIYINIYDPLFDIIQNPANYGFEVSNKGCCGTGAIEVAVLCNKITSSVCPD  380

Query  293   HNKYVFWDSFHPTERAY  243
              + +VFWDS+HPTE+ Y
Sbjct  381   VSTHVFWDSYHPTEKTY  397


 Score =   219 bits (557),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/320 (38%), Positives = 176/320 (55%), Gaps = 16/320 (5%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              ++ FGDSI+D G NN L TF + N  PYG+ F+    TGRF NG+  SD +AE LG+K+
Sbjct  415   ALLAFGDSILDTGNNNFLLTFMKGNIWPYGRSFSMRRATGRFGNGRVFSDIVAEGLGIKK  474

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
             +LPAY      P D +TGV FASGG G DP+T+++   +    Q+N FK Y  KLK   G
Sbjct  475   ILPAYRKLFNSPSDLRTGVCFASGGAGVDPVTSKLLRVLTPKDQVNDFKGYIRKLKATAG  534

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYK-YDINAYADLMIQGAADFIQELYDL  624
              ++ + I+ N + +V  G ND+  +YF  P   ++    N Y   +      F++ELYD 
Sbjct  535   PSRASSIVSNAVILVSQGNNDIGISYFGTPTAAFRGLTPNRYTTKLAGWNKQFMKELYDQ  594

Query  623   GARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNK--LPQ  450
             GAR+  + G+ P GC+P  R   GG    C    N  ++  N KL +   S   +     
Sbjct  595   GARKFAVMGVIPLGCLPMTRIFLGGFVITCNFFANRVAEQYNGKLRSGTKSWGREAGFRG  654

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG--TGVIEVTFLCNKYTGTCPDHNKYVF  276
             +  VYVD+YN L+D+I+N + YGF     GCC   T +I            CP+ +KYVF
Sbjct  655   AKFVYVDMYNTLMDVIKNYRRYGFSNEKNGCCCMITAIIP-----------CPNPDKYVF  703

Query  275   WDSFHPTERAYGILVHQILQ  216
             +D  HP+E+AY  +  +++Q
Sbjct  704   YDFVHPSEKAYRTISKKLVQ  723



>ref|XP_004289076.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At3g14820-like 
[Fragaria vesca subsp. vesca]
Length=367

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/335 (52%), Positives = 232/335 (69%), Gaps = 4/335 (1%)
 Frame = -1

Query  1205  RCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNG  1026
             R  A + LP       V  FGDS +D G N+ + +  + N+PPYG+DF G MPTGRF NG
Sbjct  28    RNVAAVTLPTNGTTPAVFAFGDSTLDTGNNDYIISGLKSNFPPYGRDFMGGMPTGRFSNG  87

Query  1025  KTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA---TAIPLS  855
             + PSD IAE  GVK++LPAY DPNLQ +D  TGV FAS G G+DPLTA+ A   + + LS
Sbjct  88    RVPSDLIAEVFGVKKILPAYLDPNLQLQDLLTGVCFASAGSGYDPLTAEFAELQSVLSLS  147

Query  854   TQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYA  675
              QL+ FKEYK K+   VG  +T  ++  +LF++  G+ND+  +YF+ P+R   YDI AY 
Sbjct  148   DQLDLFKEYKSKINTAVGNEKTATLLSKSLFIIWMGSNDLAFSYFATPLRSAHYDIPAYT  207

Query  674   DLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNS  495
             D +++ A+ F Q+LY LGAR   +  +PP GCVP+Q TL GG  RAC E  N+A+ + NS
Sbjct  208   DFLLEFASTFFQKLYALGARVIGVASMPPIGCVPAQITLGGGIERACSEAENQAAMLYNS  267

Query  494   KLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNK  315
             KLSA +DSLN +LP++ ++Y+DIYNP L +IQ+P  YGFEV D+GCCGTG++E   LCNK
Sbjct  268   KLSALVDSLNKRLPEALVIYIDIYNPFLSIIQDPAQYGFEVVDKGCCGTGIVEFGLLCNK  327

Query  314   YT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQK  213
             +T GTC D +KY+FWD FHPTE A  IL  +IL++
Sbjct  328   HTPGTCNDASKYMFWDGFHPTETACRILTSEILKQ  362



>ref|XP_009106245.1| PREDICTED: GDSL esterase/lipase EXL1 isoform X2 [Brassica rapa]
Length=306

 Score =   368 bits (944),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/302 (57%), Positives = 222/302 (74%), Gaps = 1/302 (0%)
 Frame = -1

Query  1103  TFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGV  924
             T ARC+YP YG DF G + TGRF NGK P+D +AEELG+K  +PAY DPNL+PED  TGV
Sbjct  3     TEARCDYPHYGIDFDGGVATGRFSNGKVPTDILAEELGLKPSIPAYRDPNLKPEDLLTGV  62

Query  923   SFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGT  744
             +FASGG G+ P T QIA  IPLS QL YF+EY  KL  MVGE +T +I++N++FVV+ G+
Sbjct  63    TFASGGAGYVPFTTQIAGGIPLSQQLKYFEEYIEKLNGMVGEERTKFILKNSMFVVICGS  122

Query  743   NDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQR  564
             ND+ N +F LP  R +Y ++++  LM   A  F + LY  GARR ++FG PP GCVPSQR
Sbjct  123   NDIANDFFGLPTVRLQYTVDSFTALMADNARSFAKSLYGYGARRILMFGAPPIGCVPSQR  182

Query  563   TLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNY  384
             T+AGG +R CV  +N+AS++ N+KLS  ID L+  L  S ++YVDIY+PLLDLI NP  Y
Sbjct  183   TVAGGPTRDCVVRFNDASKLFNAKLSGNIDVLSRTLLDSKLIYVDIYSPLLDLILNPGQY  242

Query  383   GFEVADRGCCGTGVIEVTFLCNKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             GF+V++ GCCGTG+IEVT LCN YT   CP  + YVFWDSFHPTE AY I+V ++L +Y+
Sbjct  243   GFKVSNLGCCGTGLIEVTALCNNYTSAVCPIRSDYVFWDSFHPTETAYRIIVAKLLDRYL  302

Query  206   YR  201
              R
Sbjct  303   SR  304



>ref|XP_008806618.1| PREDICTED: GDSL esterase/lipase EXL3-like [Phoenix dactylifera]
Length=337

 Score =   369 bits (946),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 174/318 (55%), Positives = 221/318 (69%), Gaps = 1/318 (0%)
 Frame = -1

Query  1166  VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGV  987
             V  V  FGDS+VD G NN L T A+CN+PPYG+DF G   TGRF NGK P+D  A  LGV
Sbjct  16    VPAVFAFGDSVVDSGNNNMLLTTAKCNFPPYGRDFIGHRATGRFSNGKIPTDLFASYLGV  75

Query  986   KELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEM  807
             KELLPAY DP+++  D  TGVSFASGG G+D LTA+I     L  QL  FKEYK KL+ +
Sbjct  76    KELLPAYLDPDIKEHDLLTGVSFASGGAGYDNLTAEIPLVFSLWDQLEMFKEYKRKLEAI  135

Query  806   VGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYD  627
              GE +   I+  +  ++ +GTND++ TYF+  IR   YD+ +Y + M+Q A+ F++ELY 
Sbjct  136   AGEMRAANIVAESQCIIFSGTNDLMTTYFTTSIRALSYDLPSYINFMLQAASSFVEELYS  195

Query  626   LGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQS  447
             LGAR+  + G+PP GCVP+QRTL GG +R CV+ YN+AS   NS+LS  ++ L    P +
Sbjct  196   LGARKIAVIGVPPIGCVPAQRTLKGGITRDCVDTYNQASIKFNSELSMRLERLATYHPGA  255

Query  446   TIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWD  270
              I+Y+DIYNPLL+LI +P +YGFE A +GCCGTG IE T LCN  T  TCPD  KY+FWD
Sbjct  256   RIMYIDIYNPLLELILHPSDYGFEEATKGCCGTGKIEATILCNDLTPFTCPDATKYLFWD  315

Query  269   SFHPTERAYGILVHQILQ  216
              FHPTER Y ILV +I Q
Sbjct  316   GFHPTERGYEILVTKITQ  333



>ref|XP_003571815.1| PREDICTED: GDSL esterase/lipase EXL3-like [Brachypodium distachyon]
Length=367

 Score =   369 bits (947),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 238/351 (68%), Gaps = 8/351 (2%)
 Frame = -1

Query  1244  MVSVVFPMLLLGRRCEAKIKLPPGVVVE---GVIVFGDSIVDQGMNNNLQTFARCNYPPY  1074
             +++++  ++LL   C A    PP         +I+FGDSIVD G NN L T  RC++ PY
Sbjct  16    IIALITALMLLSHCCIAS-PAPPSKQTRPPPALILFGDSIVDPGNNNALTTTVRCDFAPY  74

Query  1073  GQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFD  894
             GQDF G   TGRF NGK   D +A  +G+K+ +PAY    L   D  TGVSFASGGCGFD
Sbjct  75    GQDFPGHNATGRFSNGKIVGDILATRMGLKQYVPAYLGTELSDFDLLTGVSFASGGCGFD  134

Query  893   PLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSL  714
             PLTA+I + + L  QL+ FKEYKGK++ + GE +   I+  ++F+VV+GT+D+ NTYF+ 
Sbjct  135   PLTAEIVSVLTLDDQLDLFKEYKGKIRAIAGEQRAAEIVSTSMFLVVSGTDDLANTYFTT  194

Query  713   PIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRAC  534
             P+RR  YD+ +Y + +++ A+DFIQ+LY +GARR  I G PP GCVPSQRT AGG  RAC
Sbjct  195   PLRR-DYDLESYIEFIVKCASDFIQKLYGMGARRVSIAGAPPIGCVPSQRTNAGGDDRAC  253

Query  533   VEEYNEASQIVNSKLSAEIDSLNNK--LPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
             V  YN+A+ + N+ L  EI  LN    LP S + Y+D+Y PLLD+IQ P  YGFEV++RG
Sbjct  254   VSLYNQAAVLYNAALEKEIKRLNGSALLPGSVLKYIDLYTPLLDMIQRPAAYGFEVSNRG  313

Query  359   CCGTGVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKY  210
             CCGTG+ EVT  CN YT   C D  K++FWD+FH TER Y +L+ QI+ +Y
Sbjct  314   CCGTGLFEVTLTCNSYTAHACRDPTKFLFWDTFHLTERGYDLLMAQIINRY  364



>gb|KCW58232.1| hypothetical protein EUGRSUZ_H00934 [Eucalyptus grandis]
Length=334

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 232/332 (70%), Gaps = 10/332 (3%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             +AK+ +P    +  V +FGDSIVD G NNNL T  + N+PPYG+DF G  PTGRF NGK 
Sbjct  7     QAKVVVPKNATISAVFMFGDSIVDTGNNNNLITLVKSNFPPYGRDFMGGKPTGRFSNGKI  66

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P DF  E+LG+KELLPA+ DPNLQ +D   GV+FAS G GFDPLT+++ +AIP+S QL  
Sbjct  67    PPDFFVEQLGIKELLPAFLDPNLQLQDLIGGVNFASAGAGFDPLTSELVSAIPMSKQLQL  126

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
               EYK KLK  +GE + + I+ N L++V AG++D++NTYF  P R + Y + +Y +L+  
Sbjct  127   LDEYKMKLKCFIGEERVDSIVANGLYIVSAGSDDIVNTYFHTPTRIFDYSVFSYTELL--  184

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
                    EL+  GARR  +F + P GC+PS RTLAGG  R C E YN+  Q++NSKLS+E
Sbjct  185   -------ELHAKGARRIGVFSLTPLGCIPSMRTLAGGIKRRCAENYNQMVQLLNSKLSSE  237

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             +  LN   P + +V +DIY  +LD++++P+ YGFE++DRGCCG+G+IE  FLCN++   T
Sbjct  238   LHRLNEAFPHARMVLIDIYGLVLDIVKSPRKYGFEISDRGCCGSGLIETGFLCNQWDFLT  297

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             C + ++YVFWDS+HPTE  Y ++V + L+K +
Sbjct  298   CSNVSEYVFWDSYHPTENVYKVMVQEKLRKLL  329



>ref|XP_010933356.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=358

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/322 (53%), Positives = 226/322 (70%), Gaps = 1/322 (0%)
 Frame = -1

Query  1169  VVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELG  990
             +V  VIVFGDSIVD G NN L+T  +CN+PPYGQDF    PTGRF NGK PSDFIA  +G
Sbjct  33    MVPAVIVFGDSIVDTGNNNVLETIVKCNFPPYGQDFINHQPTGRFSNGKVPSDFIASAMG  92

Query  989   VKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKE  810
             VKEL+P Y   +LQ ED  TGV+FASG  G+DPLT+ I   I ++ QL  F+EYK ++K 
Sbjct  93    VKELVPPYIGYDLQSEDILTGVTFASGATGYDPLTSTIVNVISMTDQLQLFEEYKERMKA  152

Query  809   MVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELY  630
             + GE +T  I+ N+L+VV  GT+D+ NTYF+ P+R+  YDI +Y +L+I GA+ F+++L 
Sbjct  153   IAGEERTATILSNSLYVVCCGTDDIANTYFTTPLRKPHYDIPSYVNLLITGASTFLEKLV  212

Query  629   DLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQ  450
              +GA++     +PP GC+PSQRTL GG  R C    N+A+Q+ NSK+   ID +  +   
Sbjct  213   GMGAQKIGFVSLPPIGCIPSQRTLGGGILRDCEPTRNQAAQLFNSKIKKRIDKIAGQHKG  272

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFW  273
               I+Y+DIY+ LLDL+  P  YGFEV+ +GCCGTG +E + LCNK +  TC D  KYVFW
Sbjct  273   IKIIYIDIYSILLDLMLRPSKYGFEVSTKGCCGTGELEASVLCNKVSASTCSDITKYVFW  332

Query  272   DSFHPTERAYGILVHQILQKYV  207
             DS+HPTERAY I+V +I Q Y+
Sbjct  333   DSYHPTERAYKIIVDKIYQDYI  354



>ref|XP_004983037.1| PREDICTED: GDSL esterase/lipase EXL3-like [Setaria italica]
Length=364

 Score =   367 bits (941),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/320 (54%), Positives = 224/320 (70%), Gaps = 4/320 (1%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              + VFGDSIVD G NN L T  RCN+PPYGQDF G   TGRF NG+ PSD +A  LG+KE
Sbjct  44    ALFVFGDSIVDTGNNNALTTLIRCNFPPYGQDFPGHNATGRFSNGRVPSDILASRLGIKE  103

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
              +PAY    L   D  TGVSFASGGCGFDPLTA++ + + +  QL+ FKEYK KL+ + G
Sbjct  104   YVPAYLGTELSDFDLLTGVSFASGGCGFDPLTAELVSVLTMDNQLDLFKEYKAKLERVAG  163

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLG  621
               +   I+  +L++VV GT+D+ NTYF+ P RR  YD+ +Y D +++ A+DFI++L+  G
Sbjct  164   ARRAGEIVSTSLYMVVTGTDDLANTYFTTPFRR-DYDLESYIDFVVRCASDFIRKLHGEG  222

Query  620   ARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNN--KLPQS  447
             ARR  I G PP GCVPSQRT AGG  R CV  YN+AS ++N+ L  EI  LN   +LP S
Sbjct  223   ARRINIAGAPPIGCVPSQRTNAGGLERDCVSLYNQASVVLNAALEKEIKRLNGSAELPGS  282

Query  446   TIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWD  270
              + Y+D+Y PLLD+IQ P  YGF+V +RGCCGTGV EVT  CN+YT   C D +K++FWD
Sbjct  283   VLKYIDLYTPLLDMIQRPGAYGFDVTNRGCCGTGVFEVTLTCNRYTAHACRDPSKFLFWD  342

Query  269   SFHPTERAYGILVHQILQKY  210
             ++H TER Y +L+ QI+ +Y
Sbjct  343   TYHLTERGYDLLMAQIINRY  362



>ref|XP_009786861.1| PREDICTED: GDSL esterase/lipase EXL3-like isoform X2 [Nicotiana 
sylvestris]
Length=299

 Score =   364 bits (935),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/271 (63%), Positives = 213/271 (79%), Gaps = 1/271 (0%)
 Frame = -1

Query  1202  CEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGK  1023
             CEAK++LP  V+ + V  FGDSIVDQG NN ++T  +CN+ PYG+DF G MPTGRF NGK
Sbjct  28    CEAKVQLPQNVIFKAVFAFGDSIVDQGNNNYIKTLVKCNFQPYGKDFMGGMPTGRFSNGK  87

Query  1022  TPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLN  843
             TP D IA ELG+K+L+PAY DPNL+ ED K+GVSFASGGCG+DPLTA +   IPLS QL 
Sbjct  88    TPPDLIAVELGIKKLIPAYLDPNLKTEDIKSGVSFASGGCGYDPLTATLVAVIPLSRQLT  147

Query  842   YFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMI  663
              F EY GKLK +VGE + NYI++N+LF+VVAGT+D+ NTYF+  I R K DIN+Y DLM+
Sbjct  148   QFIEYTGKLKVLVGEEEANYILKNSLFMVVAGTDDLANTYFTAGI-RLKQDINSYTDLMV  206

Query  662   QGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSA  483
               A+ F+ ELY LGAR+  I GIPP GC+PSQRTLAGG +R C +EYN+A+Q+ N+K S 
Sbjct  207   AEASKFLNELYKLGARKFWILGIPPIGCLPSQRTLAGGHNRMCSQEYNQAAQLANTKFSI  266

Query  482   EIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQ  390
              I+SL+ KLPQS +V++DIYNPLLDLI NP+
Sbjct  267   AINSLSKKLPQSKLVFIDIYNPLLDLIFNPE  297



>emb|CDP07367.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   367 bits (941),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 230/333 (69%), Gaps = 10/333 (3%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTP  1017
             A  +LP    +  VI FGDSIVD G NNNL T A+ NYPPYGQDF G  PTGRF NGK P
Sbjct  44    ANPELPYNSSIPAVIFFGDSIVDTGNNNNLVTIAKANYPPYGQDFMGGRPTGRFSNGKVP  103

Query  1016  SDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYF  837
             SD IAEELG+KE LPAY DPNLQ ED +TGV+FASGG G+DPLT+++A+ + L+ QL  F
Sbjct  104   SDLIAEELGIKEALPAYLDPNLQTEDLRTGVNFASGGAGYDPLTSELASVLSLTDQLELF  163

Query  836   KEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQG  657
             +EY  KL E+ GE+  N I+ N LF VV G+ND+ NTYF L  ++  YD+ +Y DLM+  
Sbjct  164   REYLTKLHEIFGEDNKNKILSNGLFAVVIGSNDITNTYFGLGGQKSHYDVPSYTDLMLNS  223

Query  656   AADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEI  477
             A+ FIQELY +GA +  +FG+PP GC+PSQRTL GG  R C ++YN+ +Q+ NSKL AEI
Sbjct  224   ASSFIQELYKVGALKIAVFGLPPIGCMPSQRTLRGGVLRQCADDYNQMAQLFNSKLRAEI  283

Query  476   DSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCP  297
             +SL+++ P++ +VYVDIYN  LDLI  PQ YG  +         +    FLC     TC 
Sbjct  284   NSLDSRYPKARMVYVDIYNRPLDLINKPQKYGMLLP-------SLSTFAFLCQY---TCS  333

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +   YVFWDSFH TERAY ++V Q L++ +  F
Sbjct  334   NVLDYVFWDSFHLTERAYRVVVQQFLKQNLISF  366



>ref|XP_009398920.1| PREDICTED: GDSL esterase/lipase EXL3-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score =   367 bits (941),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 228/324 (70%), Gaps = 4/324 (1%)
 Frame = -1

Query  1169  VVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELG  990
             +V  VIVFGDSIVD G NN ++T  + N+PPYG+DF G  PTGRFCNGK P+DFIA  +G
Sbjct  37    LVPAVIVFGDSIVDPGNNNVMRTIVKSNFPPYGKDFIGHSPTGRFCNGKIPTDFIASTVG  96

Query  989   VKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKE  810
             VKELLPAY    L PED  TGVSFAS G GFDPLT  + + + L  QL  FKEYK K++ 
Sbjct  97    VKELLPAYLGTTLGPEDLLTGVSFASSGSGFDPLTPTLTSVLSLPDQLELFKEYKKKVRG  156

Query  809   MVGENQTNYIIENTLFVVVAGTNDVLNTYFSLP--IRRYKYDINAYADLMIQGAADFIQE  636
             + G+ + N II  +L+VV AG++D+ N YF LP  +R++ YD ++YA  ++  A+ F+++
Sbjct  157   IAGKKRANSIISASLYVVCAGSDDIANNYF-LPASLRQHSYDFSSYAKFLVHKASGFVED  215

Query  635   LYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKL  456
             L +LGAR   + GIPP GCVPSQRTL GG  R+C   +N+ +Q+ NS L  E+  L  K 
Sbjct  216   LVNLGARSVAVVGIPPIGCVPSQRTLGGGIMRSCASGHNQVAQLYNSGLKEEMQRLKTKH  275

Query  455   PQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYV  279
               + +VYVDIY  LL++I +P  YGFEV+ +GCCGTG +EV+ LCN  T  TC D +KYV
Sbjct  276   QGTKLVYVDIYTILLNMILHPNAYGFEVSAKGCCGTGDLEVSVLCNGLTTVTCADASKYV  335

Query  278   FWDSFHPTERAYGILVHQILQKYV  207
             FWDSFHPTERAY ILV  +L+ Y+
Sbjct  336   FWDSFHPTERAYEILVDWVLKTYL  359



>ref|XP_010320539.1| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum lycopersicum]
Length=605

 Score =   375 bits (962),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 176/276 (64%), Positives = 219/276 (79%), Gaps = 1/276 (0%)
 Frame = -1

Query  1208  RRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCN  1029
             R CE K++LP  VVV+ V  FGDSIVDQG NN + T A+CN+PPYG+DF G +PTGRFCN
Sbjct  5     RSCEGKVQLPNNVVVKAVFAFGDSIVDQGNNNYIPTIAKCNFPPYGKDFNGGIPTGRFCN  64

Query  1028  GKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQ  849
             GKTP D I EELG+KE +PAY D NL+ ED KTGVSFASGGCG+DP T+ +A AIPLSTQ
Sbjct  65    GKTPPDLIVEELGIKEYIPAYLDSNLRNEDLKTGVSFASGGCGYDPRTSTLALAIPLSTQ  124

Query  848   LNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADL  669
             LN FKEY GKL+ +VGE + NYI++N+LF+VVAG++D+ NTYF+L + R K +I++Y DL
Sbjct  125   LNQFKEYIGKLEGLVGEEEANYILKNSLFLVVAGSDDLANTYFTLEV-RLKQNIDSYTDL  183

Query  668   MIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKL  489
             M+  A +F QELY+LGAR+  IFGIPP GC+PSQRTLAGG +R C +EYNEA+Q+ N+K 
Sbjct  184   MVSKATEFFQELYNLGARKIGIFGIPPIGCLPSQRTLAGGPNRVCAKEYNEAAQLANTKF  243

Query  488   SAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYG  381
             S  IDSL+ KL QS +V +DIYNP LD+I NPQ Y 
Sbjct  244   SIAIDSLSKKLAQSKLVLIDIYNPFLDIIVNPQKYA  279


 Score =   347 bits (889),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 166/327 (51%), Positives = 231/327 (71%), Gaps = 4/327 (1%)
 Frame = -1

Query  1196  AKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDF-AGEMPTGRFCNGKT  1020
             AK++L   + +  +  FGDSIVDQG NNNL T A+CN+ PYG+DF  G  PTGRF N +T
Sbjct  279   AKLQLRKDINITALFAFGDSIVDQGNNNNLITHAKCNFLPYGKDFMGGNNPTGRFSNART  338

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P+D + E+ G+K+L+PAY D NL+ ED KTGVSFASG  GFD LT  +A+A+PLS QL  
Sbjct  339   PADMLVEDFGIKKLMPAYLDSNLKVEDLKTGVSFASGASGFDLLTPVVASALPLSVQLAL  398

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI-RRYKYDINAYADLMI  663
             F++Y  K+   +GE  T  I++ +L++VVAG++D+ NTYF L   R+ +Y++++Y +LM+
Sbjct  399   FQQYIWKMNGFIGEEATKNIVKKSLYIVVAGSDDLCNTYFMLKFPRKIQYNVDSYTNLMV  458

Query  662   QGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSA  483
              GA++FI +LY++GARR  IFG+PP GC+PSQ    GG S+ CV EYN+A++I N+KLS 
Sbjct  459   DGASNFINDLYNMGARRIWIFGLPPIGCLPSQILRGGGPSKICVNEYNQAARIANTKLSN  518

Query  482   EIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT  303
             +I SLN KLPQ  ++Y++IY+PLLD+I     YGFE A   CC  G  E   LC+  T  
Sbjct  519   KIHSLNKKLPQIELLYINIYDPLLDIIAKHNKYGFEDALSACC-QGRNEY-LLCDNVTKI  576

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQI  222
             C +   Y+FWDS+H TE+ Y +L+ QI
Sbjct  577   CENDANYLFWDSYHLTEKGYRVLLDQI  603



>gb|KHN35532.1| GDSL esterase/lipase EXL3 [Glycine soja]
Length=334

 Score =   365 bits (938),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 229/333 (69%), Gaps = 2/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFA-GEMPTGRFCNGKTPS  1014
             + LP    V  V+VFGDSIVD G NN + T  +CN+PPYG+DF  G  PTGRF NG  PS
Sbjct  1     MSLPNNETVPAVMVFGDSIVDPGNNNYITTLVKCNFPPYGRDFGEGNQPTGRFSNGLVPS  60

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D IA +LGVK+LLPAY DPNLQ +D  TGVSFASGG G+DPLTA++   + LS QL+ FK
Sbjct  61    DIIAAKLGVKKLLPAYLDPNLQLQDLLTGVSFASGGAGYDPLTAELVNVMSLSDQLDMFK  120

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EY  K+ E VG N+T  I+  ++++V  G++D+ NTY+  P R  +YDI +Y D M   A
Sbjct  121   EYIKKINEAVGRNRTTMIVSKSIYIVCVGSDDIANTYYQSPFRSAEYDIPSYTDFMASEA  180

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
             + F+QELY LGARR  +FG+   GCVPSQRTL GG +RAC++  N+A+ + NSKL++++ 
Sbjct  181   SKFLQELYGLGARRIGVFGLSVIGCVPSQRTLGGGLNRACLDSSNQAAMLFNSKLNSQMV  240

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
              L  K   S +VY+D YN  L+++QNP  +GFEV  +GCCGTG IEV+ LCN+Y+  TC 
Sbjct  241   VLGKKFSDSRLVYLDSYNGFLNMLQNPAKFGFEVIKKGCCGTGDIEVSILCNRYSINTCS  300

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +   Y+FWDS+HPT+ AY  L   +    +  F
Sbjct  301   NTTHYLFWDSYHPTQEAYLALSSLVFDNKIKDF  333



>ref|XP_003548834.1| PREDICTED: GDSL esterase/lipase EXL3-like [Glycine max]
Length=366

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/333 (52%), Positives = 228/333 (68%), Gaps = 2/333 (1%)
 Frame = -1

Query  1190  IKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFA-GEMPTGRFCNGKTPS  1014
             + LP    V  V+VFGDSIVD G NN + T  +CN+PPYG+DF  G  PTGRF NG  PS
Sbjct  33    MSLPNNETVPAVMVFGDSIVDPGNNNYITTLVKCNFPPYGRDFGEGNQPTGRFSNGLVPS  92

Query  1013  DFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFK  834
             D IA +LGVK+LLPAY DPNLQ +D  TGVSFASGG G+DPLTA++   + LS QL+ FK
Sbjct  93    DIIAAKLGVKKLLPAYLDPNLQLQDLLTGVSFASGGAGYDPLTAELVNVMSLSDQLDMFK  152

Query  833   EYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGA  654
             EY  K+ E VG N+T  I+  ++++V  G++D+ NTY+  P R  +YDI +Y D M   A
Sbjct  153   EYIKKINEAVGRNRTTMIVSKSIYIVCVGSDDIANTYYQSPFRSAEYDIPSYTDFMASEA  212

Query  653   ADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEID  474
             + F+QELY LGARR  +FG+   GCVPSQRTL GG +RAC++  N+A+ + NSKL++++ 
Sbjct  213   SKFLQELYGLGARRIGVFGLSVIGCVPSQRTLGGGLNRACLDSSNQAAMLFNSKLNSQMV  272

Query  473   SLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCP  297
              L  K   S +VY+D YN  L ++QNP  +GFEV  +GCCGTG IEV+ LCN+Y+  TC 
Sbjct  273   VLGKKFSDSRLVYLDSYNGFLSMLQNPAKFGFEVIKKGCCGTGDIEVSILCNRYSINTCS  332

Query  296   DHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             +   Y+FWDS+HPT+ AY  L   +    +  F
Sbjct  333   NTTHYLFWDSYHPTQEAYLALSSLVFDNKIKDF  365



>ref|XP_006342070.1| PREDICTED: GDSL esterase/lipase EXL3-like [Solanum tuberosum]
Length=343

 Score =   364 bits (934),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 241/343 (70%), Gaps = 6/343 (2%)
 Frame = -1

Query  1244  MVSVVFPMLLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQD  1065
             ++  VF ML +   CEAK++L   + +  +  FGDSIVDQG NNNL T A+CN+ PYG+D
Sbjct  3     LLCAVFIMLFIS--CEAKLQLRKDINITALFAFGDSIVDQGNNNNLITHAKCNFLPYGKD  60

Query  1064  F-AGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPL  888
             F  G  PTGRF N +TP+D + E+ G+K+L+PAY D NL+ ED KTGVSFASG  GFD L
Sbjct  61    FMGGNKPTGRFSNARTPADMLVEDFGIKKLMPAYLDSNLKVEDLKTGVSFASGASGFDLL  120

Query  887   TAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPI  708
             T  +A+A+PLS QL  F++Y  K+   +GE  T  I++ +L++VVAG++D+ NTYF L  
Sbjct  121   TPIVASALPLSVQLALFQQYIWKMNGFIGEEATKNIVKKSLYIVVAGSDDLCNTYFMLKF  180

Query  707   -RRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACV  531
              R+ +Y++++Y +LM+ GA++FI +LY++G RR  IFG+PP GC+PSQ    GG S+ CV
Sbjct  181   PRKIQYNVDSYTNLMVDGASNFINDLYNMGGRRIWIFGLPPIGCLPSQILRGGGPSKICV  240

Query  530   EEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCG  351
             +EYN+A+QI N+KLS +I SLN KLPQ  ++Y++IY+PLLD+I N   YGFE A   CC 
Sbjct  241   DEYNQAAQIANTKLSNKIYSLNKKLPQIELLYINIYDPLLDIIVNHDKYGFEDALSACCQ  300

Query  350   TGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQI  222
              G   V  LC+  T  C +   Y+FWDS+H TER Y +L+ QI
Sbjct  301   GG--NVYLLCDNITRICENDANYLFWDSYHLTERGYRVLLDQI  341



>ref|XP_010935130.1| PREDICTED: GDSL esterase/lipase EXL3-like [Elaeis guineensis]
Length=364

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/321 (53%), Positives = 224/321 (70%), Gaps = 1/321 (0%)
 Frame = -1

Query  1166  VEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGV  987
             V  V  FGDSIVD G NN + T A+CN+PPYG+DF G   TGRF NGK P+DFIA  LGV
Sbjct  44    VPAVFAFGDSIVDPGNNNMVLTPAKCNFPPYGRDFIGHTATGRFSNGKIPTDFIASLLGV  103

Query  986   KELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEM  807
             KELLPAY DP ++ +D  TGVSFASGG GFD LTA+I +   L  QL  FKEYK KL+ +
Sbjct  104   KELLPAYLDPEIKEQDLLTGVSFASGGAGFDNLTAEIPSVFSLWDQLEMFKEYKRKLEAI  163

Query  806   VGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYD  627
              GE +   I+  +L  + AG+ND++ TYF+  +R   YD+ +Y + ++Q  + F++ELY+
Sbjct  164   AGEERAANIVMESLCTIFAGSNDLMTTYFTTSVRALNYDLPSYINFLLQAVSSFLEELYN  223

Query  626   LGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQS  447
             LGAR+  + G+PP GCVP+QRTL GG +R CV+ YN+AS   N +LS E++ L    P +
Sbjct  224   LGARKIGVVGVPPIGCVPAQRTLKGGIARDCVDTYNQASIKFNGELSMELERLATYHPGA  283

Query  446   TIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWD  270
              I+Y+D+YNPLL+LI +P +YGFE   +GCCGTG IE T LCN  +  TCPD  KY+FWD
Sbjct  284   NIIYIDVYNPLLELILHPSHYGFEETTKGCCGTGEIEATILCNDLSPFTCPDATKYLFWD  343

Query  269   SFHPTERAYGILVHQILQKYV  207
              FHPTE+ Y IL+  + + Y+
Sbjct  344   GFHPTEKGYEILLQFLHKSYI  364



>ref|NP_001150849.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG40651.1| anther-specific proline-rich protein APG precursor [Zea mays]
Length=365

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 224/321 (70%), Gaps = 5/321 (2%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              + VFGDSIVD G NN L T  RCN+PPYGQDF G   TGRF NG+ PSD +A  LG+KE
Sbjct  44    ALFVFGDSIVDPGNNNALTTTVRCNFPPYGQDFPGHNATGRFSNGRVPSDIVASRLGIKE  103

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMV-  804
              LPAY    L   D  TGVSFASGGCGFDPLTA++ + + +  QL+ FKEYK KL+ +  
Sbjct  104   HLPAYLGTELSDFDLLTGVSFASGGCGFDPLTAELVSVLTMDNQLDLFKEYKEKLERVAS  163

Query  803   GENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDL  624
             G ++   I+  +L++VV GT+D+ NTYF+ P RR  YD+ +Y + ++Q A+DFI++LY L
Sbjct  164   GAHRAADIVSRSLYMVVTGTDDLANTYFTTPFRR-DYDLESYIEFVVQCASDFIKKLYGL  222

Query  623   GARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLN--NKLPQ  450
             GARR  I G PP GCVPSQRT AGG  R CV  YN+A+ + N+ L  EI  LN  + LP 
Sbjct  223   GARRINIAGAPPIGCVPSQRTNAGGLERECVPLYNQAAVVFNAALEKEIKRLNGSDALPA  282

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKYVFW  273
             S + Y+D+Y PLLD+IQ P  YGF V +RGCCGTGV EVT  CN+YT   C D +K++FW
Sbjct  283   SVLQYIDLYTPLLDMIQRPDAYGFNVTNRGCCGTGVFEVTLTCNRYTAEPCRDPSKFLFW  342

Query  272   DSFHPTERAYGILVHQILQKY  210
             D++H TER Y +L+ QI+ +Y
Sbjct  343   DTYHLTERGYDLLMAQIINRY  363



>emb|CBI19911.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   360 bits (923),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 215/288 (75%), Gaps = 1/288 (0%)
 Frame = -1

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G  PTGRF NGK P DFIAEELG+KELLP Y +P LQ  D  TGVSFAS G G+DP+T +
Sbjct  2     GGFPTGRFSNGKIPPDFIAEELGIKELLPPYSNPALQLSDLLTGVSFASSGSGYDPMTPK  61

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             +A+ + L  QL  FKEY  KLK MVGE +TN I+  +LF+VVAG++D+ N+YF   +R+ 
Sbjct  62    LASVLSLRDQLEMFKEYIRKLKMMVGEERTNTILSKSLFLVVAGSDDIANSYFVSGVRKI  121

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             +YD+ AY DLMI  A+ F +ELY LGARR V+   PP GC+PSQR+LAGG  R C E++N
Sbjct  122   QYDVPAYTDLMIASASSFFKELYGLGARRIVVGSAPPLGCLPSQRSLAGGILRECAEDHN  181

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             +A+++ N+KLS+++DSLN   PQ+  VY+DIYNP LDLIQNPQ  GFEV D+GCCGTG I
Sbjct  182   DAAKLFNTKLSSQLDSLNANFPQAKFVYIDIYNPFLDLIQNPQKSGFEVVDKGCCGTGKI  241

Query  338   EVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             EV  LCN ++  TC D + YVFWDS+HPTE+AY +L+ +I+QK V  F
Sbjct  242   EVAVLCNPFSPFTCEDASNYVFWDSYHPTEKAYKVLIGEIIQKCVDSF  289



>ref|XP_008809448.1| PREDICTED: uncharacterized protein LOC103721152 [Phoenix dactylifera]
Length=864

 Score =   378 bits (970),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/318 (56%), Positives = 225/318 (71%), Gaps = 2/318 (1%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              +IVFGDSIVD G NN + T  RCN+PPYG+DF G   TGRF NGK PSD +A  +G+KE
Sbjct  542   ALIVFGDSIVDPGNNNAIITTVRCNFPPYGKDFVGHKATGRFSNGKIPSDILASLIGIKE  601

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
              +PAY    L  +D  TGVSFASGG G+DPLTAQ+  A+ +  QLN FKEYK KLK + G
Sbjct  602   YVPAYLGTKLDAQDLLTGVSFASGGGGYDPLTAQLVQALTMDDQLNLFKEYKEKLKAIAG  661

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLG  621
             E + + II  +L++VV G +D+ NTYF+ P RR  YD+++Y   ++Q A+ F Q+LY LG
Sbjct  662   EKKASTIISRSLYIVVTGNDDLANTYFTSPFRR-NYDLSSYIRFVVQSASSFFQKLYRLG  720

Query  620   ARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTI  441
             ARR  I G+PP GC+PSQR+ AGG  R CV  YN+AS+ +NS+L  EI  LN+ L  S I
Sbjct  721   ARRIGITGLPPVGCLPSQRSRAGGIERDCVTLYNQASKTLNSELQKEIQRLNHTLAGSRI  780

Query  440   VYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWDSF  264
             VY+D+Y PLLD+I  P  YGFE   RGCCGTG+ EVTF CN YT   C D +KY+FWD +
Sbjct  781   VYIDMYTPLLDMIIRPFAYGFEEVKRGCCGTGIFEVTFTCNSYTAPACDDVSKYLFWDVY  840

Query  263   HPTERAYGILVHQILQKY  210
             HPTERAY IL+ Q+ Q+Y
Sbjct  841   HPTERAYNILMRQVQQRY  858


 Score =   369 bits (946),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 229/322 (71%), Gaps = 1/322 (0%)
 Frame = -1

Query  1169  VVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELG  990
             +V  VIVFGDSIVD G NN+L+T  +CN+PPYGQDF    PTGRF NGK PSDFIA  +G
Sbjct  33    MVPAVIVFGDSIVDAGNNNDLETIVKCNFPPYGQDFIDHQPTGRFSNGKVPSDFIASMMG  92

Query  989   VKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKE  810
             VKELLP Y   +LQPED  TGV+FASG  G+DPLT+ I   I +  QL  F+EYK ++K 
Sbjct  93    VKELLPPYIGYDLQPEDILTGVTFASGATGYDPLTSTILNVISMPDQLKMFEEYKERMKA  152

Query  809   MVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELY  630
             + GE +T  I+  +L+VV AGT+D+ NTYF+ P R+  YDI +Y +L+I GA+ F+++L 
Sbjct  153   IAGEERTASILSKSLYVVCAGTDDIANTYFTTPFRQQHYDIPSYVNLLITGASTFLEKLV  212

Query  629   DLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQ  450
             ++GA++     +PP GCVPSQRTL GG  R C    N+A+++ NSK+  EID +  +   
Sbjct  213   EMGAQKIGFVSLPPIGCVPSQRTLGGGILRDCEPTRNQAARLFNSKIKEEIDIIAGQHKG  272

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKYVFW  273
               I+Y+DIY+ LLDLI  P  YGF+V+ +GCCGTG +EV+ LCN+ T  TC +  +YVFW
Sbjct  273   IKIIYIDIYSILLDLILQPSKYGFDVSTKGCCGTGELEVSVLCNRLTASTCSNITEYVFW  332

Query  272   DSFHPTERAYGILVHQILQKYV  207
             DS+HPTERAY I+V +I + Y+
Sbjct  333   DSYHPTERAYKIMVDKIFKDYI  354


 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 69/127 (54%), Gaps = 19/127 (15%)
 Frame = -1

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             P   IA  LG+KE +PAY    L  +D  TG                   A+ L  QLN 
Sbjct  374   PFLHIASLLGIKEHVPAYLGTKLDAQDLLTG------------------QALTLDDQLNL  415

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             FKEYK KL+ + GE + + II  +L+++V G +D+ NTYF+ P RR  YD++AY   ++Q
Sbjct  416   FKEYKEKLRAIAGEKKASTIISRSLYIIVTGNDDLANTYFTSPFRR-NYDLSAYIRFVVQ  474

Query  659   GAADFIQ  639
              A+ F Q
Sbjct  475   SASSFFQ  481



>ref|XP_010266838.1| PREDICTED: GDSL esterase/lipase EXL3-like [Nelumbo nucifera]
Length=366

 Score =   362 bits (929),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 174/329 (53%), Positives = 226/329 (69%), Gaps = 2/329 (1%)
 Frame = -1

Query  1178  PGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAE  999
             P V    V VFGDSIVD G NN L + A+ N+PPYG+DF     TGRFCNG+ PSDF+AE
Sbjct  39    PNVTFPAVFVFGDSIVDTGNNNYLVSVAKSNFPPYGRDFPERKATGRFCNGRVPSDFLAE  98

Query  998   ELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGK  819
              LGVK LLP Y DPNLQ ED  TGV+FAS G  FD +T  + +AIPLS QL  FKEY  K
Sbjct  99    NLGVKNLLPPYLDPNLQIEDLLTGVNFASAGGAFDIVTPAVLSAIPLSDQLKMFKEYIEK  158

Query  818   LKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQ  639
             ++  VGE +T  +I  +++++ AG+ND L  YF    R++ YDI  Y  LM+Q A+ FIQ
Sbjct  159   VEAAVGEEKTAALISESMYMLCAGSND-LAGYFITTARQFTYDITEYTTLMVQLASTFIQ  217

Query  638   ELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNK  459
             EL+ LG R   I   PP GCVP QRT+ GG  R C E+ N  +++ N+KLS+E++SL NK
Sbjct  218   ELHALGVRNIGIVNTPPVGCVPFQRTIGGGVDRGCSEKLNVGAKLFNAKLSSELESLQNK  277

Query  458   LPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-TCPDHNKY  282
             LP +T+V +++Y+PLLD+IQ P  YGFE   RGCCGTG +E++ LCN  T  TC D + Y
Sbjct  278   LPTATLVLLEVYHPLLDIIQRPHVYGFEEVMRGCCGTGNVELSILCNDLTPFTCSDVSNY  337

Query  281   VFWDSFHPTERAYGILVHQILQKYVYRFA  195
             VFWDS+HPTE+AY IL+  + Q  + +F+
Sbjct  338   VFWDSYHPTEKAYKILMDAVTQDIIKKFS  366



>ref|XP_007223325.1| hypothetical protein PRUPE_ppa009531mg [Prunus persica]
 gb|EMJ24524.1| hypothetical protein PRUPE_ppa009531mg [Prunus persica]
Length=288

 Score =   359 bits (921),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 170/287 (59%), Positives = 210/287 (73%), Gaps = 2/287 (1%)
 Frame = -1

Query  1052  MPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIA  873
             MPTGRF NGK PSD I E  G+KELLPAY DP LQPED  TGV  A+GG G+DPLTAQ+A
Sbjct  1     MPTGRFSNGKVPSDLIVEAFGIKELLPAYLDPTLQPEDLLTGVVIAAGGAGYDPLTAQLA  60

Query  872   TAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKY  693
                 LS QL  F+EY  KLK + GE +TN+II N L  VVAG+ND+ NTYF    R+ +Y
Sbjct  61    GVASLSDQLKQFQEYVEKLKGIAGEERTNFIIANCLIFVVAGSNDISNTYFLSGARKLEY  120

Query  692   DINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEA  513
             D+ +Y D M+  A+ ++++LY LGARR  +   PP GCVPSQRT+ GG  R C ++ N+A
Sbjct  121   DVPSYTDFMLNYASQYVKDLYGLGARRIGVLNAPPIGCVPSQRTIGGGVLRECDDKQNQA  180

Query  512   SQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEV  333
             SQ+ N KLSAE+D LN  LP S +VY++IYNPLLDLI NP  YGFEV ++GCCG+G+IEV
Sbjct  181   SQLFNFKLSAEMDGLNKILPNSRVVYIEIYNPLLDLIINPTKYGFEVVNKGCCGSGIIEV  240

Query  332   TFLCNKY--TGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             T LCN++   GTC D +KYVFWDS+HPTE AY I+V Q+L KY  RF
Sbjct  241   TKLCNQFQPAGTCSDDSKYVFWDSYHPTESAYKIIVQQMLDKYANRF  287



>gb|EPS65517.1| hypothetical protein M569_09255 [Genlisea aurea]
Length=325

 Score =   360 bits (924),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 226/321 (70%), Gaps = 24/321 (7%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
             GV  +GDS+VDQG NN + T A+ N+ PYG+DFAG +PTGRF NGKTP D IAEEL VK 
Sbjct  28    GVFAYGDSVVDQGNNNGIITLAKANFEPYGKDFAGGIPTGRFSNGKTPPDLIAEELNVKY  87

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
              +PA+ DPNL   D  TGVSFASGGCGFDP+T+++A+AIPLSTQL + K+YK K   MVG
Sbjct  88    AVPAFLDPNLTSGDLLTGVSFASGGCGFDPMTSRLASAIPLSTQLKFLKQYKRKAIAMVG  147

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLG  621
               + + I+ ++L +VV GT+D++NTYF+L   R +Y+++ Y D +   A+DF++EL++ G
Sbjct  148   SRRADTIVNDSLHLVVVGTDDLVNTYFTLGALRLRYNVSEYTDYIASRASDFVRELHETG  207

Query  620   ARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKLPQSTI  441
             ARR  +FG+PP GC+PSQRTLAGG  R C +EYNEA++++NSKLS  +DS  +     T 
Sbjct  208   ARRIALFGVPPVGCLPSQRTLAGGPERQCNDEYNEAARLLNSKLSNVVDSRASSPATKT-  266

Query  440   VYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGTCPDHNKYVFWDSFH  261
                                     DRGCCGTG+IEVT LCN Y+ TC D ++YVFWDS+H
Sbjct  267   -----------------------HDRGCCGTGLIEVTPLCNVYSETCGDDSEYVFWDSYH  303

Query  260   PTERAYGILVHQILQKYVYRF  198
             PTE AY I+V Q+L++YV RF
Sbjct  304   PTEMAYRIIVRQLLRRYVRRF  324



>gb|EMT27012.1| GDSL esterase/lipase EXL3 [Aegilops tauschii]
Length=373

 Score =   362 bits (928),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 233/352 (66%), Gaps = 7/352 (2%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVE---GVIVFGDSIVDQGMNNNLQTFARCNYPP  1077
             L+++ +  ++LL R C       PG        +I+FGDSIVD G NN L T  RC++ P
Sbjct  20    LIITALVALMLLQRPCCCTAASQPGSSQTRPPALILFGDSIVDPGNNNGLTTAVRCDFAP  79

Query  1076  YGQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGF  897
             YGQDF     TGRF NGK   D +A  +G+K+ +PAY    L   D  TGVSFASGGCGF
Sbjct  80    YGQDFPAHNATGRFSNGKIVGDILAARMGLKQYVPAYLGTELSDSDLLTGVSFASGGCGF  139

Query  896   DPLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFS  717
             DPLTA+I + + +  QL  FKEYKGK+  + G  +   I+  +L++VV GT+D+ NTYF+
Sbjct  140   DPLTAEIVSVLSMDDQLELFKEYKGKIGRIAGAQRAADIVSTSLYLVVTGTDDLANTYFT  199

Query  716   LPIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRA  537
              P+RR  YD+ +Y + ++Q A+ FIQ+L+ LGARR  + G PP GCVPSQRT AGG+ RA
Sbjct  200   TPLRR-DYDLESYIEFIVQCASAFIQKLHGLGARRVSVAGAPPIGCVPSQRTNAGGEERA  258

Query  536   CVEEYNEASQIVNSKLSAEIDSLNNK--LPQSTIVYVDIYNPLLDLIQNPQNYGFEVADR  363
             CV  YN+A+ + N+ L  E+  LN    LP S + Y+D+Y PLLD+IQ P  YGF+V+DR
Sbjct  259   CVSLYNQAAVLYNAALEKELRRLNGTALLPGSVLKYIDLYTPLLDMIQRPAAYGFQVSDR  318

Query  362   GCCGTGVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKY  210
             GCCGTG+ EVT  CN+YT   C D  K++FWD++H TE  Y +L+ QI+ +Y
Sbjct  319   GCCGTGLFEVTLTCNRYTAHACSDPTKFLFWDTYHLTETGYNLLMAQIINRY  370



>ref|XP_002464577.1| hypothetical protein SORBIDRAFT_01g021130 [Sorghum bicolor]
 gb|EER91575.1| hypothetical protein SORBIDRAFT_01g021130 [Sorghum bicolor]
Length=382

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 222/320 (69%), Gaps = 4/320 (1%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              + VFGDSIVD G NN + T  RCN+ PYGQDF G   TGRF NGK P D +A +LG+KE
Sbjct  62    ALFVFGDSIVDPGNNNAIMTTVRCNFAPYGQDFPGHNATGRFSNGKVPGDILASQLGIKE  121

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMVG  801
              +PAY    L   D  TGVSFASGGCGFDPLTA++ + + +  QL+ FKEYK KLK + G
Sbjct  122   YVPAYLGTELSDFDLLTGVSFASGGCGFDPLTAELVSVLTMDNQLDLFKEYKEKLKRVAG  181

Query  800   ENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDLG  621
              ++   I+ ++L++VV GT+D+ NTYF+ P RR  YD+ +Y + ++Q A+DFI++LY  G
Sbjct  182   AHRAADIVSSSLYMVVTGTDDLANTYFTTPFRR-DYDLESYIEFVVQCASDFIKKLYGQG  240

Query  620   ARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNK--LPQS  447
             ARR  I G PP GCVPSQRT AGG  R CV  YN+A+ + N+ L  EI  LN    LP S
Sbjct  241   ARRINIAGAPPIGCVPSQRTNAGGLERECVPLYNQAAVVFNTALEKEIKRLNGSEALPGS  300

Query  446   TIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKYVFWD  270
              + Y+D+Y PLLD+IQ P  YGF V +RGCCGTGV EVT  CN+YT   C D +K++FWD
Sbjct  301   VLKYIDLYTPLLDMIQRPDAYGFNVTNRGCCGTGVFEVTLTCNRYTAEPCRDPSKFLFWD  360

Query  269   SFHPTERAYGILVHQILQKY  210
             ++H TER Y +L+ QI+ +Y
Sbjct  361   TYHLTERGYNLLMAQIINRY  380



>tpg|DAA49872.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=365

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 223/321 (69%), Gaps = 5/321 (2%)
 Frame = -1

Query  1160  GVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEELGVKE  981
              + VFGDSIVD G NN L T  RCN+PPYGQDF G   TGRF NG+ P D +A  LG+KE
Sbjct  44    ALFVFGDSIVDPGNNNALTTTVRCNFPPYGQDFPGHNATGRFSNGRVPGDIVASRLGIKE  103

Query  980   LLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKLKEMV-  804
              LPAY    L   D  TGVSFASGGCGFDPLTA++ + + +  QL+ FKEYK KL+ +  
Sbjct  104   HLPAYLGTELSDFDLLTGVSFASGGCGFDPLTAELVSVLTMDNQLDLFKEYKEKLERVAG  163

Query  803   GENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQELYDL  624
             G ++   I+  +L++VV GT+D+ NTYF+ P RR  YD+ +Y + ++Q A+DFI++LY L
Sbjct  164   GAHRAADIVSRSLYMVVTGTDDLANTYFTTPFRR-DYDLESYIEFVVQCASDFIKKLYGL  222

Query  623   GARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLN--NKLPQ  450
             GARR  I G PP GCVPSQRT AGG  R CV  YN+A+ + N+ L  EI  LN  + LP 
Sbjct  223   GARRINIAGAPPIGCVPSQRTNAGGLDRECVPLYNQAAVVFNAALEKEIKRLNGSDALPA  282

Query  449   STIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKYVFW  273
             S + Y+D+Y PLLD+IQ P  YGF V +RGCCGTGV EVT  CN+YT   C D +K++FW
Sbjct  283   SVLQYIDLYTPLLDMIQRPDAYGFNVTNRGCCGTGVFEVTLTCNRYTAEPCRDPSKFLFW  342

Query  272   DSFHPTERAYGILVHQILQKY  210
             D++H TER Y +L+ QI+ +Y
Sbjct  343   DTYHLTERGYDLLMAQIINRY  363



>gb|EYU38776.1| hypothetical protein MIMGU_mgv1a009257mg [Erythranthe guttata]
Length=348

 Score =   358 bits (920),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 229/352 (65%), Gaps = 18/352 (5%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRR--CEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPY  1074
             L+ +V FP+LL        A IKLP    +  V+VFGDS+VD GMNN + T A+CN+PPY
Sbjct  6     LLFTVFFPLLLSCNNNIANAVIKLPRNATIPAVVVFGDSVVDTGMNNYIITIAKCNFPPY  65

Query  1073  GQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFD  894
             GQDF G  PTGRF NGK P+DF+AEELG+K  LP Y DP+LQ ED+  G+          
Sbjct  66    GQDFLGGKPTGRFSNGKVPADFLAEELGIKSYLPPYLDPSLQDEDFLPGLILR-------  118

Query  893   PLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSL  714
                    +   L+ QL  FKEY  KLK++ G+ +T+YII  +L  VV G ND L  YF  
Sbjct  119   ------PSVFSLTDQLEMFKEYIAKLKKIAGDERTSYIIRESLVAVVIGNNDFLINYFMT  172

Query  713   PIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRAC  534
             P+R  +YD+ +Y DL++   + F+Q+LY LGARR  +FG+PP GC+P +RTL GG  R C
Sbjct  173   PLRSLQYDVPSYTDLLMSYFSTFLQDLYQLGARRIAVFGLPPLGCLPLERTLRGGLGRNC  232

Query  533   VEEYNEASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCC  354
              EEYNE ++  N++LS E+ S  ++ P +TI + DIY   LD+IQ PQ YGF++ADRGCC
Sbjct  233   FEEYNENARFFNNRLSDEVASHKSQFPDATITFADIYPAFLDIIQTPQKYGFKIADRGCC  292

Query  353   GTGVIEVTFLCNKYTGTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             GTG IE+  LC   T  C +   YVFWD  HPTE+AYGI+V ++L +Y+  F
Sbjct  293   GTGTIELAILC---TFACSNVEDYVFWDGAHPTEKAYGIIVRRVLDEYINNF  341



>emb|CBI19912.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/285 (58%), Positives = 212/285 (74%), Gaps = 1/285 (0%)
 Frame = -1

Query  1058  GEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQ  879
             G +PTGRF NGK PSDFIAE LG+KEL+P Y +  LQ  D  TGVSFAS G GFDP+T +
Sbjct  2     GGVPTGRFSNGKIPSDFIAEALGIKELVPPYSNAALQLGDLLTGVSFASSGSGFDPMTPK  61

Query  878   IATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRY  699
             +A+ + L  QL  FKEY  KLK MVG  +TN I+  +LF+VVAG++D+ N+YF   ++++
Sbjct  62    LASVLSLRDQLEMFKEYIRKLKRMVGVERTNTILSKSLFLVVAGSDDIANSYFDSRVQKF  121

Query  698   KYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYN  519
             +YD+ AY DLM+  AA F++ELY LGARR V+   PP GC+PSQR+LAGG  R C E +N
Sbjct  122   QYDVPAYTDLMVTSAASFLKELYGLGARRTVVTSAPPLGCLPSQRSLAGGTQRECAEGHN  181

Query  518   EASQIVNSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVI  339
             EA+++ N KLS+ +DSLN   PQ+  VYVDIY PLLDLIQNPQ  GFEV D+GCCG+G I
Sbjct  182   EAAKLFNFKLSSRLDSLNANFPQAKFVYVDIYKPLLDLIQNPQKSGFEVVDKGCCGSGTI  241

Query  338   EVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             EV  LCN+ +  TC D + YVFWDS+HPTERAY +++ +I+QK V
Sbjct  242   EVAVLCNQLSPFTCEDASTYVFWDSYHPTERAYKVIIDEIIQKCV  286



>dbj|BAK03291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   359 bits (921),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 229/351 (65%), Gaps = 6/351 (2%)
 Frame = -1

Query  1247  LMVSVVFPMLLLGRRCEAKIKLPPGVVVE--GVIVFGDSIVDQGMNNNLQTFARCNYPPY  1074
             L+V+ +  ++L+   C      P         +I+FGDSIVD G NN L T  RC++ PY
Sbjct  20    LVVTALVALMLVRPSCCTAASQPSSSQTRPPALILFGDSIVDPGNNNGLTTAVRCDFAPY  79

Query  1073  GQDFAGEMPTGRFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFD  894
             GQDF     TGRF NGK   D +A  +G+K+ +PAY    L   D  TGVSFASGGCGFD
Sbjct  80    GQDFPAHNATGRFSNGKIVGDILATRMGLKQYVPAYLGTELSDSDLLTGVSFASGGCGFD  139

Query  893   PLTAQIATAIPLSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSL  714
             PLTA+I + + +  QL  FKEYKGK+  + G  +   I+  +L++VV GT+D+ NTYF+ 
Sbjct  140   PLTAKIVSVLSMDDQLELFKEYKGKISRIAGAQRAANIVSTSLYMVVTGTDDLANTYFTT  199

Query  713   PIRRYKYDINAYADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRAC  534
             P RR  YD+ +Y D ++Q A+ FIQ+LY LGARR  + G PP GCVPSQRT AGG+ RAC
Sbjct  200   PFRR-DYDLESYIDFIVQCASAFIQKLYGLGARRVSVAGAPPIGCVPSQRTNAGGEGRAC  258

Query  533   VEEYNEASQIVNSKLSAEIDSLNNK--LPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRG  360
             V  YN+A+ + N+ L  E+  LN    LP + + Y+D+Y PLLD+IQ P  YGFEV+DRG
Sbjct  259   VSLYNQAAVLYNAALEKEMRRLNGTALLPGAVLKYIDLYAPLLDMIQRPAAYGFEVSDRG  318

Query  359   CCGTGVIEVTFLCNKYTG-TCPDHNKYVFWDSFHPTERAYGILVHQILQKY  210
             CCGTG+ EVT  CN YT   C D  K++FWD++H TE  Y +L+ QI+ +Y
Sbjct  319   CCGTGLFEVTLTCNSYTAHACRDPAKFLFWDTYHLTETGYNLLMAQIISRY  369



>ref|XP_004957497.1| PREDICTED: GDSL esterase/lipase EXL3-like [Setaria italica]
Length=388

 Score =   359 bits (921),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 223/327 (68%), Gaps = 1/327 (0%)
 Frame = -1

Query  1175  GVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEE  996
             G  V  V+VFGDSIVD G NN + T  + N+ PYG D  G +PTGRF NG+ P+D +A  
Sbjct  61    GPRVPAVLVFGDSIVDTGNNNAVLTLTKSNFRPYGHDLNGGVPTGRFSNGRIPTDLLASR  120

Query  995   LGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKL  816
             LG+K+L+PAY   +L   D +TGVSFASGG G+DPLT+ +   +P+  +LN F EYK KL
Sbjct  121   LGLKDLVPAYLGTDLTDYDLRTGVSFASGGTGYDPLTSTLVAVLPMQEELNMFAEYKEKL  180

Query  815   KEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQE  636
               +VG+     I+  +LF+V AGT+D+ N Y+  P+R  +YDI+AY D ++Q A DFI++
Sbjct  181   AGVVGDEAAEGIVTESLFLVCAGTDDIANNYYLAPVRPLQYDISAYVDFLVQQACDFIKQ  240

Query  635   LYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKL  456
             LYD GARR  I G+PP GC+PSQRTLAGG +R C    N A+++ NS+L   +  L  +L
Sbjct  241   LYDRGARRIAILGLPPIGCLPSQRTLAGGLARDCDPARNRAARMFNSRLQGVVARLQGEL  300

Query  455   PQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYT-GTCPDHNKYV  279
                 I YVDIY+ L D+I +P  YGF+V+ RGCCGTG  EV+ LCN+ T  TCPD  KYV
Sbjct  301   RCQRIGYVDIYDVLHDMITDPCRYGFDVSTRGCCGTGDFEVSLLCNRLTAATCPDDRKYV  360

Query  278   FWDSFHPTERAYGILVHQILQKYVYRF  198
             FWDSFHPTERAY I+V  +  +YV + 
Sbjct  361   FWDSFHPTERAYEIIVDYLFPRYVEKL  387



>ref|XP_009123675.1| PREDICTED: GDSL esterase/lipase At5g42170 [Brassica rapa]
 emb|CDY02386.1| BnaA02g22950D [Brassica napus]
Length=392

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/332 (50%), Positives = 232/332 (70%), Gaps = 5/332 (2%)
 Frame = -1

Query  1199  EAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKT  1020
             E  IKLP  V + GVI FGDSIVD G NNNL+T  + N+PPYGQDF G+  TGRF +G+ 
Sbjct  61    EVTIKLPRNVTIPGVIAFGDSIVDSGNNNNLRTILKSNFPPYGQDFRGKFATGRFTDGRV  120

Query  1019  PSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNY  840
             PSDF+AE LG+ + +PAY DP L+ +D   G++FASGG G+DPLTA+I   + L  QL Y
Sbjct  121   PSDFVAERLGIAKTIPAYLDPALKGKDLLKGINFASGGSGYDPLTAKIVRVVSLEDQLKY  180

Query  839   FKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQ  660
             F+EYK K+K +VGE +  +++EN+L++VVA +ND+ +TY +   R  +Y+   Y D +  
Sbjct  181   FQEYKEKIKAIVGEEKAKFMVENSLYLVVASSNDLAHTYIA---RSLRYNSTEYPDYLAD  237

Query  659   GAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAE  480
              ++ F+++LY LGARR  +F   P GC+PS+RTL G K R C E  N+ +   N+KLS  
Sbjct  238   MSSKFVKKLYGLGARRIAVFSAVPVGCLPSRRTLNGVK-RKCSENLNKMALQFNAKLSPA  296

Query  479   IDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTG-T  303
             + +L  K P S IV VD+Y+ L ++I+NP+ YGFEVA+RGCCGTG+ EV  LCNK    T
Sbjct  297   LVALRKKSPGSKIVLVDVYDILHNMIENPKKYGFEVANRGCCGTGLFEVLILCNKINPFT  356

Query  302   CPDHNKYVFWDSFHPTERAYGILVHQILQKYV  207
             C + + YVFWDS+HPTE+AY ++V ++L  Y+
Sbjct  357   CKNASSYVFWDSYHPTEKAYQVIVDKLLGIYI  388



>ref|XP_009397996.1| PREDICTED: GDSL esterase/lipase EXL3-like [Musa acuminata subsp. 
malaccensis]
Length=367

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/325 (53%), Positives = 221/325 (68%), Gaps = 2/325 (1%)
 Frame = -1

Query  1175  GVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTGRFCNGKTPSDFIAEE  996
             G +V  +I FGDSIVD G N+ L T  RC++PPYGQDF     TGRF NG  P+D IA  
Sbjct  39    GSMVPAIIAFGDSIVDPGNNDVLATTIRCDFPPYGQDFIDHQATGRFSNGLIPTDLIASG  98

Query  995   LGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIPLSTQLNYFKEYKGKL  816
             LGVKELLP Y   +L PED  TGVSFASG  GFDP+T +I +   ++ +L  F EYK KL
Sbjct  99    LGVKELLPPYLGVDLSPEDILTGVSFASGATGFDPITPEIVSVFSMTDELKLFAEYKEKL  158

Query  815   KEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINAYADLMIQGAADFIQE  636
               + GE +   I+   L+VV AGT+D+ NTYF+ P RR  YDI +Y +L+I GA+DFI++
Sbjct  159   YAIAGEERGAEIVSEALYVVCAGTDDIANTYFTTPFRRPHYDIPSYVNLLISGASDFIKQ  218

Query  635   LYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIVNSKLSAEIDSLNNKL  456
             L+ +GAR+    G+PP GCVPSQRT+ GG  R C E  N+A+Q+ NSK+  EI  L+ + 
Sbjct  219   LHGMGARKIGFVGLPPIGCVPSQRTVGGGILRQCEETRNQAAQLYNSKIEQEIRRLSGEF  278

Query  455   PQST-IVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLCNKYTGT-CPDHNKY  282
                T ++Y+DIY+ LLDLI+ P  YGF+V+ +GCCGTG IEVT LCN  T T C D   Y
Sbjct  279   GDGTKLIYIDIYDVLLDLIRRPGYYGFKVSTKGCCGTGTIEVTLLCNSKTATVCSDVTDY  338

Query  281   VFWDSFHPTERAYGILVHQILQKYV  207
             VFWDS+HPTE+AY I+V  I   Y+
Sbjct  339   VFWDSYHPTEKAYKIIVGSIFDNYI  363



>ref|XP_003629270.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AET03746.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=358

 Score =   356 bits (914),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 168/342 (49%), Positives = 223/342 (65%), Gaps = 1/342 (0%)
 Frame = -1

Query  1220  LLLGRRCEAKIKLPPGVVVEGVIVFGDSIVDQGMNNNLQTFARCNYPPYGQDFAGEMPTG  1041
             ++L       + LP    V  V VFGDSIVD G NN + T  +C++PPYG+DF G +PTG
Sbjct  16    IILQHVSSVSLPLPNNETVPAVFVFGDSIVDPGNNNYISTLIKCDFPPYGRDFDGGVPTG  75

Query  1040  RFCNGKTPSDFIAEELGVKELLPAYFDPNLQPEDYKTGVSFASGGCGFDPLTAQIATAIP  861
             RF NG  PSD +AE+ GVK+ LPAY DPN+Q  D  TGVSFASGG G+DPLTAQI +   
Sbjct  76    RFSNGLVPSDLVAEKFGVKKFLPAYLDPNIQLPDLLTGVSFASGGSGYDPLTAQITSVKS  135

Query  860   LSTQLNYFKEYKGKLKEMVGENQTNYIIENTLFVVVAGTNDVLNTYFSLPIRRYKYDINA  681
             LS QL+ FK Y  K+ E +G  +   I+  ++++V  G++D+ NTY   P RR++YDI +
Sbjct  136   LSDQLDMFKGYMKKIDEAIGREERALIVSKSIYIVCIGSDDIANTYAQTPFRRFQYDIQS  195

Query  680   YADLMIQGAADFIQELYDLGARRAVIFGIPPAGCVPSQRTLAGGKSRACVEEYNEASQIV  501
             Y D M   A+ F+QELY LG RR  +F +P  GCVPSQRTL GG  R C    N+A+ + 
Sbjct  196   YTDFMAYEASKFLQELYRLGGRRIGVFDVPVIGCVPSQRTLGGGIFRECSNSSNQAAMLF  255

Query  500   NSKLSAEIDSLNNKLPQSTIVYVDIYNPLLDLIQNPQNYGFEVADRGCCGTGVIEVTFLC  321
             NSKL  E+ +L  +   +  V ++ YNP +D+IQNP  YGF   ++GCCGTG IEV  LC
Sbjct  256   NSKLFKEMRALGKEYSDARFVSLETYNPFMDIIQNPSKYGFNETEKGCCGTGNIEVGILC  315

Query  320   NKYT-GTCPDHNKYVFWDSFHPTERAYGILVHQILQKYVYRF  198
             N Y+  TC + + YVFWDS+HPTE+AY +L   +L K +  F
Sbjct  316   NPYSINTCSNPSDYVFWDSYHPTEKAYNVLSSLVLDKKIKDF  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3583994365200