BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26796_g1_i1 len=1727 path=[1705:0-1726]

Length=1727
                                                                      Score     E

ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    599   0.0      
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    598   0.0      
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    593   0.0      
emb|CDP15106.1|  unnamed protein product                                593   0.0      
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    586   0.0      
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    578   0.0      
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    577   0.0      
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    568   0.0      
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    566   0.0      
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                565   0.0      
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   561   0.0      
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             560   0.0      
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    551   0.0      
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    551   0.0      
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    551   0.0      
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    550   0.0      
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             548   0.0      
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             547   0.0      
gb|KDP32593.1|  hypothetical protein JCGZ_13143                         546   0.0      
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    542   0.0      
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    542   0.0      
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           542   0.0      
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein            543   0.0      
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    535   0.0      
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    535   0.0      
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    535   0.0      
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    532   0.0      
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    526   7e-179   
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    522   3e-177   
ref|XP_004147671.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    518   5e-176   
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             518   1e-175   
ref|XP_002298669.2|  glucan endo-1 family protein                       514   5e-175   Populus trichocarpa [western balsam poplar]
gb|KFK39673.1|  a6 anther-specific protein                              515   1e-174   
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    515   1e-174   
emb|CDY50110.1|  BnaC01g43580D                                          514   2e-174   
emb|CDY18092.1|  BnaA01g23530D                                          514   3e-174   
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    514   3e-174   
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    512   1e-173   
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         512   2e-173   
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    511   3e-173   
gb|KGN57233.1|  hypothetical protein Csa_3G172380                       509   4e-172   
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    508   5e-172   
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    509   7e-172   
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    508   1e-171   
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    507   1e-171   
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             507   2e-171   
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    507   2e-171   
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    506   3e-171   
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    506   5e-171   
emb|CDY63754.1|  BnaAnng19080D                                          505   1e-170   
emb|CDY59775.1|  BnaCnng35540D                                          505   2e-170   
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    505   2e-170   
ref|XP_006492526.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    501   2e-170   
gb|AAM64490.1|  beta-1,3-glucanase, putative                            504   4e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503             503   6e-170   
emb|CDY53213.1|  BnaC03g74070D                                          503   1e-169   
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               502   2e-169   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28569.1|  unknown                                                 502   3e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    501   4e-169   
ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    501   4e-169   
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             501   4e-169   
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           499   3e-168   
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    499   3e-168   
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          499   3e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    498   3e-168   
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    498   5e-168   
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       498   7e-168   
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    497   1e-167   Ricinus communis
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg             495   9e-167   
ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    494   2e-166   
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    494   3e-166   
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             493   8e-166   
emb|CDY08310.1|  BnaA05g13090D                                          492   2e-165   
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg             492   2e-165   
ref|XP_006386885.1|  3-glucanase family protein                         491   3e-165   
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    491   3e-165   
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    491   4e-165   
emb|CDY12732.1|  BnaC04g29090D                                          491   4e-165   
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    489   1e-164   
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    489   1e-164   
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    490   1e-164   
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    489   1e-164   
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    489   2e-164   
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    489   3e-164   
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    488   3e-164   
emb|CDY01191.1|  BnaA04g06280D                                          489   3e-164   
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    488   4e-164   
ref|XP_003626949.1|  Beta-1 3-glucanase                                 487   7e-164   
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    487   1e-163   
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    487   1e-163   
emb|CDY27122.1|  BnaA08g07600D                                          487   1e-163   
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    487   2e-163   
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    486   4e-163   
emb|CDY06469.1|  BnaC06g11750D                                          485   8e-163   
emb|CAA49513.1|  beta-1,3-glucanase homologue                           485   9e-163   Brassica napus [oilseed rape]
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    484   1e-162   
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    484   1e-162   
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    484   2e-162   
emb|CDY12371.1|  BnaC08g08340D                                          483   6e-162   
gb|EYU31523.1|  hypothetical protein MIMGU_mgv1a005774mg                481   6e-162   
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             481   4e-161   
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    478   4e-160   
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    478   4e-160   
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    475   9e-159   
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    473   4e-158   
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    472   7e-158   
emb|CDY24629.1|  BnaA05g30280D                                          471   1e-157   
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    473   2e-157   
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    472   3e-157   
gb|EPS58986.1|  hypothetical protein M569_15824                         469   4e-157   
gb|ADE76604.1|  unknown                                                 468   2e-156   
emb|CDY28063.1|  BnaC05g44650D                                          468   4e-156   
emb|CDP15107.1|  unnamed protein product                                462   6e-156   
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             467   7e-156   
ref|XP_006830555.1|  hypothetical protein AMTR_s00117p00104410          467   1e-155   
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    466   2e-155   
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    464   5e-155   
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    464   6e-155   
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               464   8e-155   
ref|XP_006830552.1|  hypothetical protein AMTR_s00117p00097230          463   2e-154   
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    462   3e-154   
emb|CDY45466.1|  BnaC09g12840D                                          462   5e-154   
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    462   6e-154   
ref|XP_002303070.2|  3-glucanase family protein                         462   7e-154   Populus trichocarpa [western balsam poplar]
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    462   7e-154   
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    485   8e-154   
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             461   1e-153   
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    460   4e-153   
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    459   7e-153   
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    459   7e-153   
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           456   8e-153   
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               459   1e-152   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE80092.1|  glycosyl hydrolase family 17                           457   1e-152   Silene latifolia
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      459   2e-152   Zea mays [maize]
ref|XP_008792941.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    455   2e-152   
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             457   6e-152   
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          457   7e-152   Sorghum bicolor [broomcorn]
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               456   8e-152   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA89481.1|  beta-1,3-glucanase                                     457   9e-152   Salix gilgiana
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                447   2e-148   
dbj|BAJ88052.1|  predicted protein                                      448   3e-148   
emb|CDY08004.1|  BnaC03g35190D                                          446   9e-148   
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             439   3e-146   
dbj|BAG16366.1|  tapetum-specific protein A6 family protein             437   4e-145   Brassica rapa var. perviridis [kabuna]
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    439   4e-145   
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    436   1e-144   Ricinus communis
ref|NP_001063586.1|  Os09g0502200                                       437   5e-144   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84834.1|  hypothetical protein OsI_31928                          437   5e-144   Oryza sativa Indica Group [Indian rice]
emb|CDO96794.1|  unnamed protein product                                435   1e-143   
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                  432   2e-143   
dbj|BAG16359.1|  tapetum-specific protein A6 family protein             431   9e-143   Brassica oleracea var. italica [asparagus broccoli]
dbj|BAK04571.1|  predicted protein                                      436   9e-143   
emb|CAN60692.1|  hypothetical protein VITISV_007558                     430   2e-142   Vitis vinifera
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          432   3e-142   Sorghum bicolor [broomcorn]
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    432   3e-142   
dbj|BAK05423.1|  predicted protein                                      430   2e-141   
ref|XP_003541516.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    427   3e-141   
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    431   4e-141   
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         428   6e-141   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74052.1|  BnaA03g29950D                                          432   9e-141   
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...    424   4e-139   
ref|XP_007049652.1|  O-Glycosyl hydrolases family 17 protein isof...    409   2e-135   
ref|NP_001062294.2|  Os08g0525800                                       411   6e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007153895.1|  hypothetical protein PHAVU_003G073900g             407   7e-134   
dbj|BAC75423.1|  putative beta-1,3-glucanase                            410   2e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298215.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    400   3e-131   
ref|XP_004973968.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    400   1e-130   
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    405   5e-130   
ref|XP_007134153.1|  hypothetical protein PHAVU_010G0238001g            392   1e-128   
gb|EAZ07710.1|  hypothetical protein OsI_29967                          412   3e-128   Oryza sativa Indica Group [Indian rice]
gb|KHN47213.1|  Putative glucan endo-1,3-beta-glucosidase A6            391   4e-128   
gb|ABR16205.1|  unknown                                                 393   1e-126   Picea sitchensis
ref|XP_001777261.1|  predicted protein                                  380   4e-122   
ref|XP_001780045.1|  predicted protein                                  377   8e-121   
ref|NP_001168659.1|  uncharacterized protein LOC100382447               371   8e-120   Zea mays [maize]
gb|ACN28576.1|  unknown                                                 369   2e-119   Zea mays [maize]
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767             373   3e-119   
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643             372   4e-119   
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              362   6e-115   
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              362   6e-115   
ref|NP_001051879.1|  Os03g0845600                                       359   8e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    358   2e-113   
ref|XP_002976500.1|  hypothetical protein SELMODRAFT_105435             357   6e-113   
ref|XP_001784285.1|  predicted protein                                  355   6e-113   
gb|EEC76519.1|  hypothetical protein OsI_14305                          356   9e-113   Oryza sativa Indica Group [Indian rice]
emb|CAB71021.1|  putative beta-1,3-glucanase                            352   2e-112   Hieracium piloselloides
ref|XP_002973407.1|  hypothetical protein SELMODRAFT_413735             348   7e-109   
emb|CDP14397.1|  unnamed protein product                                346   2e-108   
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    343   2e-107   
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430          343   2e-107   Sorghum bicolor [broomcorn]
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     339   7e-107   
ref|XP_001781801.1|  predicted protein                                  340   9e-107   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    340   1e-106   
ref|XP_008669802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    340   2e-106   
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   340   3e-106   
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    339   5e-106   
emb|CDP13790.1|  unnamed protein product                                342   5e-106   
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    338   6e-106   
ref|XP_006837267.1|  hypothetical protein AMTR_s00112p00108890          338   1e-105   
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         337   3e-105   
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    336   5e-105   
gb|ACN39797.1|  unknown                                                 334   4e-104   Picea sitchensis
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             333   7e-104   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    333   8e-104   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     333   1e-103   
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     332   1e-103   
gb|KHG05496.1|  hypothetical protein F383_30989                         333   1e-103   
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    330   2e-102   
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    330   3e-102   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             328   7e-102   
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             328   7e-102   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     328   1e-101   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    327   2e-101   
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     326   3e-101   
gb|EPS73917.1|  hypothetical protein M569_00835                         325   3e-101   
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      326   3e-101   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     326   5e-101   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    328   5e-101   
ref|XP_010264204.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    321   6e-101   
emb|CDP05678.1|  unnamed protein product                                325   1e-100   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    325   1e-100   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    325   1e-100   
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     325   2e-100   
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    323   4e-100   
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    323   4e-100   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             323   4e-100   
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        323   5e-100   Populus trichocarpa [western balsam poplar]
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    323   5e-100   
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    323   5e-100   
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     322   1e-99    
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             322   1e-99    
emb|CDY18049.1|  BnaC07g04210D                                          321   1e-99    
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            322   2e-99    
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     322   2e-99    
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     322   2e-99    Vitis vinifera
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                322   2e-99    
emb|CDX92794.1|  BnaC07g40520D                                          321   2e-99    
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    322   3e-99    
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             321   3e-99    
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     321   3e-99    Vitis vinifera
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             321   3e-99    
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               321   5e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             320   6e-99    
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    320   6e-99    
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    320   7e-99    
ref|XP_004304085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    321   7e-99    
emb|CDY46679.1|  BnaA03g48290D                                          319   1e-98    
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    321   1e-98    
gb|ADU15553.1|  GLU                                                     319   2e-98    
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    319   2e-98    
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    323   2e-98    
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        319   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     318   2e-98    
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     318   3e-98    
ref|XP_002971665.1|  hypothetical protein SELMODRAFT_231791             318   3e-98    
gb|KHG21190.1|  hypothetical protein F383_01641                         318   4e-98    
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             318   5e-98    
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                317   8e-98    
gb|KHG04965.1|  hypothetical protein F383_30444                         317   8e-98    
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             317   9e-98    
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    317   1e-97    
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    317   1e-97    
ref|XP_011095448.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     316   3e-97    
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    316   3e-97    
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    316   3e-97    
ref|XP_001761806.1|  predicted protein                                  316   4e-97    
emb|CDY56498.1|  BnaAnng14330D                                          315   4e-97    
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        315   4e-97    Nicotiana tabacum [American tobacco]
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    315   5e-97    
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    315   5e-97    
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    316   6e-97    
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    315   7e-97    
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    315   8e-97    
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    315   8e-97    
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   317   9e-97    
gb|KHN10950.1|  Putative glucan endo-1,3-beta-glucosidase A6            312   9e-97    
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    315   9e-97    
gb|KFK39880.1|  hypothetical protein AALP_AA3G300600                    315   1e-96    
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     315   1e-96    
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    315   1e-96    
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             313   1e-96    
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    314   1e-96    
gb|AFU52656.1|  beta-1,3-glucanase 23                                   314   2e-96    
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    314   3e-96    
emb|CDY19908.1|  BnaC09g31740D                                          313   3e-96    
gb|AAD26909.1|  putative beta-1,3-glucanase                             313   4e-96    
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    313   4e-96    
ref|XP_010675772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    313   5e-96    
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    312   8e-96    
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...    316   1e-95    
gb|EPS59841.1|  hypothetical protein M569_14964                         312   1e-95    
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               311   1e-95    
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    311   1e-95    
emb|CDY20780.1|  BnaA02g09200D                                          311   2e-95    
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  312   2e-95    
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               311   2e-95    
emb|CDY36734.1|  BnaA03g11520D                                          311   3e-95    
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    310   3e-95    
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                311   3e-95    
gb|AAL77689.1|  AT5g55180/MCO15_13                                      310   3e-95    
ref|XP_002965673.1|  hypothetical protein SELMODRAFT_85067              310   3e-95    
gb|EPS68573.1|  hypothetical protein M569_06194                         309   4e-95    
ref|XP_009365112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    310   5e-95    
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         310   6e-95    
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    310   7e-95    
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    311   8e-95    
emb|CDY06601.1|  BnaC02g13250D                                          309   9e-95    
ref|XP_010689521.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     310   1e-94    
ref|XP_002962313.1|  hypothetical protein SELMODRAFT_438073             310   1e-94    
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    310   1e-94    
emb|CDY17308.1|  BnaA10g09420D                                          308   2e-94    
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         308   3e-94    
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    308   3e-94    
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                308   4e-94    
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    307   5e-94    
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             307   6e-94    
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    307   7e-94    
gb|KHG21189.1|  hypothetical protein F383_01641                         308   7e-94    
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             306   8e-94    
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    307   8e-94    
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    307   9e-94    
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        306   1e-93    
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    306   2e-93    
ref|XP_002964439.1|  hypothetical protein SELMODRAFT_230318             301   2e-93    
ref|XP_010046177.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    305   3e-93    
ref|XP_010046172.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    305   5e-93    
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               304   6e-93    
ref|XP_002965231.1|  hypothetical protein SELMODRAFT_439107             307   7e-93    
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  304   1e-92    
ref|XP_002975458.1|  hypothetical protein SELMODRAFT_415534             303   2e-92    
ref|XP_002967282.1|  hypothetical protein SELMODRAFT_87871              302   3e-92    
ref|XP_002960438.1|  hypothetical protein SELMODRAFT_75479              302   3e-92    
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        303   4e-92    
ref|XP_004954063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    303   4e-92    
ref|XP_009132399.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    303   5e-92    
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein        302   6e-92    
emb|CDY12009.1|  BnaC03g14350D                                          302   6e-92    
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein            302   6e-92    
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    302   1e-91    
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     301   2e-91    
ref|XP_001767901.1|  predicted protein                                  301   2e-91    
ref|XP_006452449.1|  hypothetical protein CICLE_v10008176mg             301   2e-91    
ref|XP_006475009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    301   2e-91    
ref|XP_002527772.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    302   3e-91    
ref|XP_002973118.1|  hypothetical protein SELMODRAFT_442025             300   7e-91    
gb|KDP33779.1|  hypothetical protein JCGZ_07350                         300   9e-91    
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    298   1e-90    
ref|XP_002976593.1|  hypothetical protein SELMODRAFT_443280             298   2e-90    
ref|XP_004954064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    298   3e-90    
ref|NP_001048260.1|  Os02g0771700                                       298   3e-90    
ref|XP_008450796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     298   3e-90    
ref|XP_001779924.1|  predicted protein                                  293   8e-90    
ref|XP_001759996.1|  predicted protein                                  292   8e-90    
ref|XP_004135678.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    297   9e-90    
ref|XP_003538392.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    297   1e-89    
ref|XP_006378440.1|  hypothetical protein POPTR_0010s11880g             296   1e-89    
emb|CAB36529.1|  putative beta-1, 3-glucanase                           295   2e-89    
gb|EPS73640.1|  hypothetical protein M569_01113                         297   2e-89    
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                  296   2e-89    
ref|XP_004954062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    297   2e-89    
ref|XP_002314794.2|  hypothetical protein POPTR_0010s11880g             296   3e-89    
ref|XP_006596503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    294   4e-89    
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                  295   4e-89    
gb|KHN17951.1|  Glucan endo-1,3-beta-glucosidase 2                      296   4e-89    
ref|XP_003519328.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    295   1e-88    
ref|XP_002975355.1|  hypothetical protein SELMODRAFT_103308             289   1e-88    
ref|XP_003544983.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    294   2e-88    
ref|XP_010688353.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    294   2e-88    
ref|XP_001784088.1|  predicted protein                                  293   2e-88    
gb|EMT13087.1|  Putative glucan endo-1,3-beta-glucosidase A6            289   2e-88    
ref|XP_006575486.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    294   3e-88    
ref|XP_008775304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    293   5e-88    
ref|XP_011070588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      293   6e-88    
ref|XP_001766544.1|  predicted protein                                  291   6e-88    
ref|XP_003518194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    292   7e-88    
gb|KDP38099.1|  hypothetical protein JCGZ_04742                         292   8e-88    
gb|AAZ40342.1|  beta-1,3-glucanase 2                                    291   8e-88    
gb|KHN00662.1|  Glucan endo-1,3-beta-glucosidase 3                      292   8e-88    
ref|XP_008457482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        294   9e-88    
ref|XP_010271297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      292   1e-87    
ref|XP_009417707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   1e-87    
ref|XP_004490818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    290   2e-87    
ref|XP_003631648.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      291   2e-87    
ref|XP_010906169.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    282   2e-87    
ref|XP_001762206.1|  predicted protein                                  286   2e-87    
ref|XP_007163382.1|  hypothetical protein PHAVU_001G230000g             291   2e-87    
ref|XP_009776400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     291   3e-87    
ref|XP_011021800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   3e-87    
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   3e-87    
ref|XP_011021799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   3e-87    
ref|XP_006364623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   3e-87    
ref|NP_001275288.1|  glucan endo-1,3-beta-glucosidase 2-like prec...    291   3e-87    
gb|EYU41109.1|  hypothetical protein MIMGU_mgv1a005128mg                290   4e-87    
ref|XP_004288596.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    291   4e-87    
ref|XP_008795501.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     290   6e-87    
ref|XP_007215258.1|  hypothetical protein PRUPE_ppa004534mg             290   6e-87    
ref|XP_010924450.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     290   6e-87    
ref|XP_009628676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     290   6e-87    
ref|XP_003548935.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    290   6e-87    
ref|XP_008361481.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    290   8e-87    
ref|XP_002283473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     290   8e-87    
gb|KHN38251.1|  Glucan endo-1,3-beta-glucosidase 12                     286   8e-87    
ref|XP_004490817.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    290   9e-87    
ref|XP_010926119.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    290   1e-86    
ref|XP_007032975.1|  Glucan endo-1,3-beta-glucosidase, putative i...    289   1e-86    
ref|XP_010049602.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     289   1e-86    
gb|KHG06295.1|  hypothetical protein F383_32557                         289   1e-86    
ref|XP_007141916.1|  hypothetical protein PHAVU_008G236700g             289   2e-86    
ref|XP_007151812.1|  hypothetical protein PHAVU_004G077000g             289   2e-86    
ref|XP_010653417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   2e-86    
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   2e-86    
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    289   2e-86    
emb|CBI26850.3|  unnamed protein product                                288   2e-86    
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   2e-86    
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     287   3e-86    
ref|XP_010324460.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   3e-86    
gb|AES70967.2|  glucan endo-1,3-beta-glucosidase-like protein           288   3e-86    
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     287   3e-86    
emb|CDP00829.1|  unnamed protein product                                288   3e-86    
ref|XP_004244387.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   3e-86    
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     288   3e-86    
ref|XP_004151673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    288   4e-86    
ref|XP_010681923.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   4e-86    
ref|XP_008460531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    287   4e-86    
ref|XP_006378439.1|  hypothetical protein POPTR_0010s11880g             285   4e-86    
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     288   4e-86    
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    286   5e-86    
ref|XP_003616282.1|  Glucan endo-1,3-beta-glucosidase                   291   5e-86    
emb|CDY14214.1|  BnaA08g13450D                                          288   5e-86    
ref|XP_011097437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   5e-86    
ref|XP_010653375.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   5e-86    
ref|XP_010066584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    288   5e-86    
ref|XP_008385844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    286   6e-86    
ref|XP_001752749.1|  predicted protein                                  285   6e-86    
ref|XP_001775863.1|  predicted protein                                  283   7e-86    
ref|XP_002312098.1|  glucan endo-1 family protein                       286   7e-86    
ref|XP_011029787.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    286   8e-86    
ref|XP_009351539.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      287   1e-85    
gb|KHG17836.1|  hypothetical protein F383_07126                         287   1e-85    
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    286   1e-85    
ref|XP_004140301.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    286   2e-85    
ref|XP_009602434.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    286   2e-85    
ref|NP_001031936.1|  O-Glycosyl hydrolases family 17 protein            285   2e-85    
ref|XP_002532848.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    285   3e-85    
ref|XP_009762818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    286   4e-85    
gb|AFU52641.1|  beta-1,3-glucanase 6                                    285   4e-85    
gb|KCW69377.1|  hypothetical protein EUGRSUZ_F02860                     283   5e-85    
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            285   5e-85    
ref|XP_004142367.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    285   5e-85    
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     285   6e-85    
ref|XP_010493578.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        283   7e-85    
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    283   7e-85    
gb|KHN32747.1|  Glucan endo-1,3-beta-glucosidase 3                      283   7e-85    
ref|XP_008221445.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      285   9e-85    
ref|XP_010553889.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    284   9e-85    
ref|XP_010062264.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 2      284   1e-84    
ref|XP_007032976.1|  Glucan endo-1,3-beta-glucosidase, putative i...    283   1e-84    
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    284   1e-84    
ref|XP_006430586.1|  hypothetical protein CICLE_v10011549mg             284   1e-84    
gb|AAK85402.2|  beta-1,3-glucanase                                      284   1e-84    
ref|XP_006355069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    284   1e-84    
ref|XP_002967295.1|  hypothetical protein SELMODRAFT_87381              283   1e-84    
ref|XP_008460530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    283   1e-84    
emb|CDY62033.1|  BnaC03g77660D                                          285   2e-84    
gb|ACF88240.1|  unknown                                                 283   2e-84    
gb|KHG26459.1|  hypothetical protein F383_04538                         283   2e-84    
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          285   2e-84    
ref|XP_004297451.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    283   2e-84    
gb|ACF79018.1|  unknown                                                 283   2e-84    
ref|NP_001136613.1|  uncharacterized protein LOC100216736 precursor     282   3e-84    
ref|XP_009394832.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    283   3e-84    
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             281   3e-84    
ref|XP_002960423.1|  hypothetical protein SELMODRAFT_73476              281   3e-84    
ref|XP_006482110.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    283   3e-84    
ref|XP_003552878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    283   3e-84    
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    281   4e-84    
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     283   4e-84    
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    281   4e-84    
ref|XP_010545323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     283   4e-84    
ref|XP_009109043.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    283   4e-84    
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             281   5e-84    
ref|XP_007045239.1|  O-Glycosyl hydrolases family 17 protein            282   5e-84    
ref|XP_002305879.1|  glycosyl hydrolase family 17 family protein        282   5e-84    
ref|XP_008783477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      281   5e-84    
ref|XP_011009861.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     282   5e-84    
ref|XP_008805608.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    282   5e-84    
ref|XP_010108988.1|  Glucan endo-1,3-beta-glucosidase 2                 282   5e-84    
ref|XP_010421259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    280   6e-84    
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    282   6e-84    
gb|AIR93910.1|  glucanase                                               281   6e-84    
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             281   6e-84    
ref|XP_002887020.1|  glycosyl hydrolase family 17 protein               282   6e-84    
ref|XP_004169494.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    281   7e-84    
gb|EPS65983.1|  hypothetical protein M569_08793                         281   7e-84    
ref|XP_007201010.1|  hypothetical protein PRUPE_ppa005375mg             281   7e-84    
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      281   7e-84    
ref|XP_011021801.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    281   7e-84    
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    281   7e-84    
ref|XP_002531922.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    282   7e-84    
ref|XP_004147788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    281   8e-84    



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/474 (60%), Positives = 366/474 (77%), Gaps = 8/474 (2%)
 Frame = -3

Query  1677  MFKAKEMQKPIFALIFFTLLASSNGLPSSN-IGINYGRVGNDLPSAYETIETLKAMRVSQ  1501
             MFK K M + I A+ F + LA S+  P +N IG+NYGR+GN+LPS YE+IE +K M+  +
Sbjct  1     MFKEKIMVEVILAVAFLSFLAFSDAFPLANMIGVNYGRLGNNLPSQYESIEHMKNMKAGR  60

Query  1500  VKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMI  1321
             VK+YD++ EIL+LLSGT + V+IMV N+ I   +      +AA +WV DNVL + P TMI
Sbjct  61    VKLYDANPEILRLLSGTNLHVSIMVPNDQI---SIVAANQSAANQWVRDNVLSYYPNTMI  117

Query  1320  RGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSS  1141
             R +LVGNEVLS+   QSLW  +VPAM+NIKK+++ H IHNIK+GTP+AMD+L+TSFPPSS
Sbjct  118   RYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDEHRIHNIKIGTPLAMDMLQTSFPPSS  177

Query  1140  GRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVV  961
             G FR DIPR+ +L+PLL FLN T+SYFF+DVYPYFSWS+NP ++SLDFALF+G    +  
Sbjct  178   GEFRLDIPRNSLLIPLLRFLNWTKSYFFIDVYPYFSWSQNPSSISLDFALFKGTQ--IYK  235

Query  960   DSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYN  781
             D  +G VYTNLLDQMLDSV+FAM+ LGF ++R+AI+ETGWPN GD DQ GA+++NAA YN
Sbjct  236   DPLSGYVYTNLLDQMLDSVIFAMEKLGFYNIRLAIAETGWPNGGDYDQIGANIYNAATYN  295

Query  780   RNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNL  601
             RNLV ++   PP+GTPARPG  IPTFIFSLYDEN+K GPGTERHWG+L+P G  +Y+++L
Sbjct  296   RNLVRRLTSQPPIGTPARPGSTIPTFIFSLYDENQKEGPGTERHWGLLQPNGKAIYDIDL  355

Query  600   TTAVPETEYPPLPEPDNNRPYEGNLWCVVATGI-RILDLGPALDFACAAGNGTCDDLAPG  424
             T  + E+E   LP P NN P+ G LWCV+A  I    DLG AL+FAC   +G CD+L+P 
Sbjct  356   TGEISESELSKLPVPKNNGPFHGKLWCVLAKDIVNEKDLGQALEFACKR-DGICDELSPE  414

Query  423   GDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
               CY+PVSI+AHANYAFSS+WAK+R  G +C+FNGLA  TT+DPSHG+CK P V
Sbjct  415   KSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTTLDPSHGSCKFPYV  468



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/474 (60%), Positives = 364/474 (77%), Gaps = 8/474 (2%)
 Frame = -3

Query  1677  MFKAKEMQKPIFALIFFTLLASSNGLPSSN-IGINYGRVGNDLPSAYETIETLKAMRVSQ  1501
             MFK K M + IF + F + LA S   P +N IG+NYGR+GN+LPS YE+IE +K M+  +
Sbjct  1     MFKEKIMVEVIFTIAFLSFLAFSGAFPLANMIGVNYGRLGNNLPSPYESIELIKTMKAGK  60

Query  1500  VKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMI  1321
             VK+YD++ EIL+LLSGT + V+IMV N+ I   +      + A +WV DNVL + P TMI
Sbjct  61    VKLYDANPEILRLLSGTNLHVSIMVPNDQI---SIVAANQSVANQWVRDNVLSYYPNTMI  117

Query  1320  RGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSS  1141
             R +LVGNEVLS+   QSLW  +VPAM+NIKK+++ H IHNIK+GTP+AMD+L+TSFPPSS
Sbjct  118   RYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSIDGHRIHNIKIGTPLAMDMLQTSFPPSS  177

Query  1140  GRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVV  961
             G FR DIPR+ +L+PLL FLN T+SYFF+DVYPYFSWS+NP +++LDFALF+G    +  
Sbjct  178   GEFRLDIPRNSLLIPLLRFLNWTKSYFFIDVYPYFSWSQNPSSINLDFALFKG--TQMYK  235

Query  960   DSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYN  781
             D  +G VYTNLLDQMLDSV+FAM+ LGF ++R+AI+ETGWPN GD DQ GA+++NAA YN
Sbjct  236   DPVSGYVYTNLLDQMLDSVIFAMEKLGFYNIRLAIAETGWPNGGDYDQIGANIYNAATYN  295

Query  780   RNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNL  601
             RNLV ++   P +GTPARP   IPTFIFSLYDEN+K GPGTERHWG+L P G P+Y+++L
Sbjct  296   RNLVRRLTSQPLIGTPARPESTIPTFIFSLYDENQKEGPGTERHWGLLLPNGKPIYDIDL  355

Query  600   TTAVPETEYPPLPEPDNNRPYEGNLWCVVATGI-RILDLGPALDFACAAGNGTCDDLAPG  424
             T  + E E+  LP P NN P+ G LWCV+A  I   +DLG AL+FAC   +G CD+L+PG
Sbjct  356   TGEISEAEFSKLPVPKNNGPFNGKLWCVLAKDIVNEMDLGQALEFACKR-DGICDELSPG  414

Query  423   GDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
               CY+PVSI+AHANYAFSS+WAK+R  G +C+FNGLA  TTVDPSHG+CK P V
Sbjct  415   KSCYQPVSIVAHANYAFSSYWAKFRKDGETCHFNGLAVQTTVDPSHGSCKFPYV  468



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/474 (60%), Positives = 360/474 (76%), Gaps = 8/474 (2%)
 Frame = -3

Query  1677  MFKAKEMQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQV  1498
             MFK K M +  FA+ F + L  SN    S IGINYGRV N+LPS Y++IE LK M+  +V
Sbjct  1     MFKEKIMVEVTFAIAFLSFLLFSNVCRGSIIGINYGRVANNLPSPYDSIELLKNMKAGRV  60

Query  1497  KIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIR  1318
             KIYD++ EIL+LLSGT ++V+IMV N  I   +      +AA +WV DNVL + P TMIR
Sbjct  61    KIYDANPEILRLLSGTNLQVSIMVPNNQI---SIVAANQSAANQWVRDNVLPYYPNTMIR  117

Query  1317  GVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSG  1138
              +LVGNEVLS+   Q LW  ++PAM NI+ +++ HNIHNIK+GTP AMDILETSFPPSSG
Sbjct  118   YILVGNEVLSNKDDQGLWYDLIPAMNNIRNSIDQHNIHNIKIGTPFAMDILETSFPPSSG  177

Query  1137  RFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVD  958
              FR DI R+ +L+PLL FLN T+SYFFLD YPYFSWS+N  ++SLD+ALF+G      VD
Sbjct  178   EFRLDISRNNLLMPLLRFLNWTKSYFFLDAYPYFSWSQNTSSISLDYALFQGSQ--TYVD  235

Query  957   SETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNR  778
               +G VYTNLLDQMLDSVVFAMQ LGFN++R+AI+ETGWPN GD D+ GA+++NAA YNR
Sbjct  236   PVSGYVYTNLLDQMLDSVVFAMQKLGFNNIRVAIAETGWPNGGDYDEIGANIYNAATYNR  295

Query  777   NLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT  598
             NL+ +++  PP+GTPARPG+ IPTFIFSLYDEN+K GPGTERHWG+L P G P+Y+++LT
Sbjct  296   NLIRRVVSKPPIGTPARPGLTIPTFIFSLYDENQKEGPGTERHWGMLHPNGRPMYDIDLT  355

Query  597   TAVPETEYPPLPEPDNNRPYEGNLWCVVATG--IRILDLGPALDFACAAGNGTCDDLAPG  424
                 ++E+  LP+P NN P+ G LWCVV     +  +DLG AL+FAC   N TCD+++PG
Sbjct  356   GQTLDSEFIDLPQPTNNGPFHGKLWCVVTNDHTMNEMDLGQALEFACRR-NETCDEISPG  414

Query  423   GDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
               CY+PVSI++HANYAFSS+WAKY+  G +CYFNGLA  T VDPSHG+CK P V
Sbjct  415   KSCYQPVSIVSHANYAFSSYWAKYKEDGETCYFNGLAVQTNVDPSHGSCKFPYV  468



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/473 (61%), Positives = 364/473 (77%), Gaps = 6/473 (1%)
 Frame = -3

Query  1677  MFKAKEMQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQV  1498
             M K K  +  IF L+F++LLA SN   SS IGINYG  G++L S + +I  L++M  S+V
Sbjct  1     MAKKKLAENSIFYLLFYSLLAFSNATISSKIGINYGLNGDNLQSVHHSINLLQSMNASRV  60

Query  1497  KIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIR  1318
             KIYD++ E+LKLLSGT ++ +IM+++  IP +AS+ + +    +WV DNVL + P TMIR
Sbjct  61    KIYDANPEVLKLLSGTKLQASIMIQDGLIPDIASDQSIA---DQWVRDNVLAYYPQTMIR  117

Query  1317  GVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSG  1138
              VLVGNE+LS S+   LW  +VPAM  I  ++   NI NIKVGTPVAMDILE++FPPSSG
Sbjct  118   FVLVGNEILS-SNNTLLWYNLVPAMVRIHNSIKAQNIQNIKVGTPVAMDILESTFPPSSG  176

Query  1137  RFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVD  958
             +FR +I   QV +PLL+FLN+TRS+FF++V+PYFSWSENP N+SLDFALF   N +   D
Sbjct  177   KFRPEILNHQVTVPLLSFLNKTRSFFFVNVFPYFSWSENPTNLSLDFALFTAKNSSYT-D  235

Query  957   SETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNR  778
              E+GL+YTNLLDQMLDSV+FA + LGF+++ +AISETGWPN GD+DQPGA++HNAA YNR
Sbjct  236   PESGLIYTNLLDQMLDSVLFAARKLGFDNISLAISETGWPNAGDIDQPGANIHNAAIYNR  295

Query  777   NLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT  598
             NLV K+   PP+GTPA+PGV IPTFIFSLYDENRK G GTERHWG+L+P G+P YE++LT
Sbjct  296   NLVRKVTATPPIGTPAQPGVVIPTFIFSLYDENRKFGRGTERHWGLLQPNGLPNYEIDLT  355

Query  597   TAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGD  418
                 E+ YP LP+P NN+P++G +WCVVA G RI DLGP L+  C   NG CD LAPG +
Sbjct  356   GVQSESNYPTLPQPTNNKPFKGKIWCVVAPGSRITDLGPVLNSVCKEDNGACDALAPGKE  415

Query  417   CYEPVSILAHANYAFSSFWAKYR-STGASCYFNGLATMTTVDPSHGACKVPSV  262
             CYEPVS++AHA+YA SS+WAK+R S GA+CYFNG A  TT DPSHG CK PSV
Sbjct  416   CYEPVSLVAHASYALSSYWAKHRDSAGATCYFNGFAEQTTRDPSHGPCKFPSV  468



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/467 (60%), Positives = 353/467 (76%), Gaps = 7/467 (1%)
 Frame = -3

Query  1659  MQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSD  1480
             M +  FA+     L  SN   +S IG+NYGRV N+LPS Y++IE LK M+  +VKIYD++
Sbjct  1     MVEVTFAIALLCFLLFSNVCRASPIGVNYGRVANNLPSPYDSIELLKNMKAGRVKIYDAN  60

Query  1479  HEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGN  1300
              EIL+LLSGT ++V+IMV N  I   +       AA +WV DNVL + P TMIR +LVGN
Sbjct  61    PEILRLLSGTNLQVSIMVPNNQI---SVVAANQTAANQWVRDNVLPYYPNTMIRYILVGN  117

Query  1299  EVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADI  1120
             EVLS+   Q LW  ++PAM NI+ +++ HNIHNIK+GTP AMD+LET+FPPSSG FR DI
Sbjct  118   EVLSNKDDQGLWYDLIPAMNNIRNSIDQHNIHNIKIGTPFAMDLLETTFPPSSGEFRLDI  177

Query  1119  PRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLV  940
              R+ +L+PLL FLN TRSYFFLD YPYFSWS+N   +SLD+ALF+G      VD  +G V
Sbjct  178   SRNNILMPLLRFLNWTRSYFFLDAYPYFSWSQNTSFISLDYALFQGSQ--TYVDPVSGYV  235

Query  939   YTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKM  760
             YTNLLDQMLDSVVFAMQ LGFN++R+AI+ETGWPN GD D+ GA+++NAA YNRNL+ ++
Sbjct  236   YTNLLDQMLDSVVFAMQKLGFNNIRLAIAETGWPNGGDYDEIGANIYNAATYNRNLIRRI  295

Query  759   MQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPET  580
             +  P +GTPARPG+AIPTFIFSLYDEN+K GPGTERHWG+L P G P+Y+++LT    +T
Sbjct  296   VSKPAIGTPARPGLAIPTFIFSLYDENQKEGPGTERHWGMLNPNGRPMYDIDLTGQTLDT  355

Query  579   EYPPLPEPDNNRPYEGNLWCVVATG-IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPV  403
             E+  LP+P NN PY G LWCVV    +  +DLG AL+FAC   N TCDD++PG  CY+PV
Sbjct  356   EFIDLPQPTNNGPYHGKLWCVVTNDTMNEMDLGQALEFACRR-NETCDDISPGKSCYQPV  414

Query  402   SILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             SI++HANYAFSS+WAKYR  G +CYFNGLA  T VDPSHG+CK P V
Sbjct  415   SIVSHANYAFSSYWAKYREDGETCYFNGLAVQTNVDPSHGSCKFPYV  461



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/443 (61%), Positives = 347/443 (78%), Gaps = 7/443 (2%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             IG+NYGR+GN+LPS YE+IE +K M+  +VK+YD++ EIL+LLSGT + V+IMV N+ I 
Sbjct  2     IGVNYGRLGNNLPSPYESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPNDQI-  60

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
               +      + A +WV DNVL + P TMIR +LVGNEVLS+   QSLW  +VPAM+NIKK
Sbjct  61    --SIVAANQSVANQWVRDNVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKK  118

Query  1227  ALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDV  1048
             +++ H IHNIK+GTP+AMD+L+TSFPPSSG FR DIPR+ +L+PLL FLN T+SYFF+DV
Sbjct  119   SIDGHRIHNIKIGTPLAMDMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFIDV  178

Query  1047  YPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDV  868
             YPYFSWS+NP +++LDFALF+G    +  D  +G VYTNLLDQMLDSV+FAM+ LGF ++
Sbjct  179   YPYFSWSQNPSSINLDFALFKG--TQMYKDPVSGYVYTNLLDQMLDSVIFAMEKLGFYNI  236

Query  867   RIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLY  688
             R+AI+ETGWPN GD DQ GA+++NAA YNRNLV ++   P +GTPARP   IPTFIFSLY
Sbjct  237   RLAIAETGWPNGGDYDQIGANIYNAATYNRNLVRRLTSQPLIGTPARPESTIPTFIFSLY  296

Query  687   DENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVAT  508
             DEN+K GPGTERHWG+L P G P+Y+++LT  + E E+  LP P NN P+ G LWCV+A 
Sbjct  297   DENQKEGPGTERHWGLLLPNGKPIYDIDLTGEISEAEFSKLPVPKNNGPFNGKLWCVLAK  356

Query  507   GI-RILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASC  331
              I   +DLG AL+FAC   +G CD+L+PG  CY+PVSI+AHANYAFSS+WAK+R  G +C
Sbjct  357   DIVNEMDLGQALEFACKR-DGICDELSPGKSCYQPVSIVAHANYAFSSYWAKFRKDGETC  415

Query  330   YFNGLATMTTVDPSHGACKVPSV  262
             +FNGLA  TTVDPSHG+CK P V
Sbjct  416   HFNGLAVQTTVDPSHGSCKFPYV  438



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/474 (59%), Positives = 352/474 (74%), Gaps = 6/474 (1%)
 Frame = -3

Query  1677  MFKAKEMQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQV  1498
             M+  K     IFA     +LA S  L S  IGINYGR+GN+LPS Y+TI  L +M    V
Sbjct  1     MYTKKAANTVIFAFSLSYILACSCALSSEKIGINYGRLGNNLPSPYQTITLLNSMEAGHV  60

Query  1497  KIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIR  1318
             K+YD++ E+LKLLSGT + V+IMV NE I   +      + A  WV +NV+ + P T IR
Sbjct  61    KLYDANPEVLKLLSGTDLHVSIMVTNEQI---SGIAANQSKADLWVQENVVAYYPSTKIR  117

Query  1317  GVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSG  1138
              VLVGNEV S +  + +W  +VPAM+NIK++L++ +IHN+KV T +AM+ LE+SFPPSSG
Sbjct  118   FVLVGNEVFSYNDLK-MWHDLVPAMRNIKRSLSIRDIHNVKVSTAIAMETLESSFPPSSG  176

Query  1137  RFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVD  958
             +FR+DIP  +V+LPLL FLN T+S+ FLDVY YF WS +P N++LDFAL + GN+T   D
Sbjct  177   KFRSDIP-GEVILPLLKFLNGTKSFLFLDVYTYFPWSLDPTNMNLDFALLKDGNETYQ-D  234

Query  957   SETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNR  778
              E+ L+Y NLLDQMLDSV+FAM   GF+++ +AISETGWP+ GD+DQPGA+ +NAA YNR
Sbjct  235   PESCLIYKNLLDQMLDSVIFAMGKYGFDNILLAISETGWPHAGDIDQPGANAYNAATYNR  294

Query  777   NLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT  598
             NLV KM  +PPLGTPARPG+ I TFIFSLYDEN+K GPGTERHWG+L   G P YE++LT
Sbjct  295   NLVMKMTSNPPLGTPARPGIEILTFIFSLYDENQKPGPGTERHWGLLSNNGKPTYEVDLT  354

Query  597   TAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGD  418
                PET Y  LP+P NN PY+G LWCV  +   + DLGPALDFAC  GNGTC++LAPG  
Sbjct  355   GTRPETSYAILPKPSNNHPYKGKLWCVADSRASLTDLGPALDFACGQGNGTCNELAPGKG  414

Query  417   CYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             CY+PVSI AHA+YAFSS+WAK+R+ GA CYF+GLA  TT DPSHG+C+ PSV +
Sbjct  415   CYQPVSISAHASYAFSSYWAKFRNAGAVCYFDGLAVQTTTDPSHGSCQFPSVLL  468



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/453 (60%), Positives = 349/453 (77%), Gaps = 11/453 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS IGINYGR+GN+LPSA  +IE L AM   +VK+YD+D EILKLLSGT ++V+IMV N 
Sbjct  20    SSKIGINYGRLGNNLPSANRSIELLMAMNAGRVKLYDADPEILKLLSGTNLQVSIMVPNN  79

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSA---QSLWLQMVPA  1246
             +I   ++  +    A  WV +NVL + P TMIR +L+GNEVLS +S+   + +W  +VPA
Sbjct  80    EI---STIASDQIKADEWVRNNVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPA  136

Query  1245  MKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRS  1066
             M  IK +L   NI NIKVGTP+AMD L+++FPPS   FRADI  D V+ P+L FLNRT+S
Sbjct  137   MSKIKSSLKSQNITNIKVGTPLAMDALQSTFPPSKATFRADI-SDTVMAPMLRFLNRTKS  195

Query  1065  YFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQY  886
             +FF+DVYP+F WS NP N+SLDFALFRG +     D  TGLVYTNLLDQMLDS++FAM  
Sbjct  196   FFFIDVYPFFPWSSNPGNISLDFALFRGNSTMEYTDPGTGLVYTNLLDQMLDSLIFAMTK  255

Query  885   LGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPT  706
             LG+ ++R+ I+ETGWP++GD++QPGA++HNAA YNRNL+ +M+  PPLGTPARPGV IPT
Sbjct  256   LGYPNIRLLITETGWPSSGDIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPT  315

Query  705   FIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNL  526
             FIFSL+DEN+K GPGTERHWG+L   G P+Y+++LT   P  +Y PLPE  NNRPY+G +
Sbjct  316   FIFSLFDENQKTGPGTERHWGLLHADGTPIYDVDLTGKRPLEDYEPLPEEQNNRPYKGAV  375

Query  525   WCVVATGIRILD--LGPALDFACAAGN--GTCDDLAPGGDCYEPVSILAHANYAFSSFWA  358
             WCVVA G+ + D  LG A++ AC AGN  GTCD L+PG +CYEPVS+  HA+YAFSS+WA
Sbjct  376   WCVVAKGVSVNDEELGSAVNNACIAGNATGTCDALSPGKECYEPVSLTWHASYAFSSYWA  435

Query  357   KYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             K+RS GA+C+FNGLA  T++DPSHG+CK PSV 
Sbjct  436   KFRSQGATCHFNGLAEQTSLDPSHGSCKFPSVI  468



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/453 (60%), Positives = 349/453 (77%), Gaps = 11/453 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS IGINYGR+GN+LPSA  +IE LKAM   +VK+YD+D EILKLLSGT ++V+IMV N 
Sbjct  20    SSKIGINYGRLGNNLPSANRSIELLKAMNAGRVKLYDADLEILKLLSGTNLQVSIMVPNN  79

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSA---QSLWLQMVPA  1246
             +I   ++  +    A  WV +NVL + P TMIR +L+GNEVLS +S+   + +W  +VPA
Sbjct  80    EI---STIXSDQTKADEWVRNNVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPA  136

Query  1245  MKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRS  1066
             M  IK +L   NI NIKVGTP+AMD L+++FPPS   FRADI  D V+ P+L FLNRTRS
Sbjct  137   MSKIKSSLKSQNITNIKVGTPLAMDALQSTFPPSKATFRADI-SDTVMAPMLRFLNRTRS  195

Query  1065  YFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQY  886
             +FF+DVYP+F WS NP N+SLDFALF+G +     D  TGLVYTNLLDQMLDS++FAM  
Sbjct  196   FFFIDVYPFFPWSSNPGNISLDFALFKGNSTMEYTDPGTGLVYTNLLDQMLDSLIFAMTK  255

Query  885   LGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPT  706
             LG+ ++R+ I+ETGWP++GD++QPGA++HNAA YNRNL+ +M+  PPLGTPARPGV IPT
Sbjct  256   LGYPNIRLLITETGWPSSGDIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIPT  315

Query  705   FIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNL  526
             FIFSL+DEN+K GPGTERHWG+L   G P+Y+++LT      +Y PLPE  NNRPY+G +
Sbjct  316   FIFSLFDENQKTGPGTERHWGLLHADGTPIYDVDLTGKRVLEDYEPLPEEQNNRPYKGAV  375

Query  525   WCVVATGIRILD--LGPALDFACAAGN--GTCDDLAPGGDCYEPVSILAHANYAFSSFWA  358
             WCVVA G+ + D  LG A++ AC AGN  GTCD L+PG +CYEPVS+  HA++AFSS+WA
Sbjct  376   WCVVAKGVSVNDEELGSAVNNACIAGNASGTCDALSPGKECYEPVSLTWHASFAFSSYWA  435

Query  357   KYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             K+RS GA+C+FNGLA  T++DPSHG+CK PSV 
Sbjct  436   KFRSQGATCHFNGLAEQTSLDPSHGSCKFPSVI  468



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/464 (58%), Positives = 345/464 (74%), Gaps = 6/464 (1%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             + +++ F    S     S+ IG+NYGR+GN+LPS +E+I+ L +M+   VK+YD+D E+L
Sbjct  14    LLSIMSFYSFCSGASNSSNKIGVNYGRLGNNLPSPFESIQLLLSMKAGHVKLYDADPEVL  73

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             KLLS T + VTIMV N++I   +   +  + A  W+ DNVL   P T IR +LVGNEV S
Sbjct  74    KLLSDTDLHVTIMVTNQEI---SMIASNESHADAWIDDNVLAHYPSTKIRFILVGNEVFS  130

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
              +  Q LWL +VPAM+ IK++LN H IHNIKVGTP+AMD LE++FPPSS RFR+ IP  +
Sbjct  131   YNDRQ-LWLDLVPAMRRIKRSLNKHQIHNIKVGTPLAMDALESTFPPSSARFRSSIPA-E  188

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V++PL+ FLN T+S+FF+DVY YF WS NP N SLD+AL + G +    D  +GL YTNL
Sbjct  189   VIVPLMRFLNSTKSFFFVDVYTYFPWSVNPTNTSLDYALMKSGINETYKDPVSGLTYTNL  248

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
             LDQMLDSV FAMQ LGFN+VR+AI+ETGWP+ GD D+PGA+ +NAA Y  NLV+K+  DP
Sbjct  249   LDQMLDSVHFAMQKLGFNNVRVAIAETGWPHDGDFDEPGANAYNAATYVSNLVAKVTSDP  308

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
             P+GTPA+PG+ IPTF+FSLYDEN+K GPGTERHWG+L  TG P+YE++LT    E     
Sbjct  309   PIGTPAKPGIEIPTFVFSLYDENQKPGPGTERHWGLLSNTGSPIYEVDLTGTSHENN-TK  367

Query  567   LPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
             L EP NN PY G +WCVVA+     DLGPAL+FAC  GNGTCD LAPG +CYEP+SI++H
Sbjct  368   LSEPSNNGPYNGKIWCVVASTASPDDLGPALEFACRQGNGTCDQLAPGKECYEPISIVSH  427

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             A+YAFSSFWA++RS GASCYF GLA  T  DP HG+C+ PSV +
Sbjct  428   ASYAFSSFWAQFRSAGASCYFGGLAVQTITDPGHGSCEFPSVLL  471



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/439 (61%), Positives = 334/439 (76%), Gaps = 7/439 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S  IGINYG++G++LPS+Y++IE++K ++   VKIYD++ EILKLLSGT ++V+IMV+N 
Sbjct  25    SDKIGINYGKLGSNLPSSYQSIESIKFLQAGSVKIYDANPEILKLLSGTDLKVSIMVQNH  84

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
             +I       ++   A +WVHDNVL F P TMIR +LVGNE+LS SS +   +W  +VPAM
Sbjct  85    EI---IDIASKQKVADQWVHDNVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAM  141

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
               IKK LN HNIHNIKVGTP+AMDI +T+FPPS+G FR+DI    V+ PLL FLNRT+S+
Sbjct  142   HRIKKCLNAHNIHNIKVGTPLAMDIFQTTFPPSNGTFRSDISAS-VMEPLLQFLNRTKSF  200

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FFLDVYPYF+WS NP  +SLDFAL R  N T   D  +GLVYTNLLDQMLDSV+FAM  L
Sbjct  201   FFLDVYPYFAWSTNPKTISLDFALLRETN-TSYTDPNSGLVYTNLLDQMLDSVIFAMAKL  259

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G++D+R+AISETGWPN GD DQ GA+++NAA YNRNL+ KM   P LGTPARPG  IPTF
Sbjct  260   GYSDIRLAISETGWPNAGDFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGSIIPTF  319

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             IFSLYDEN+K GPGTERHWG+L   G+P+YE++L+     ++Y PLP   NN PY+G +W
Sbjct  320   IFSLYDENQKTGPGTERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVW  379

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             CVVA G  +L L  AL +AC  GNGTCD L PG  CY+P+S+  HA+YAFSS+WAK+   
Sbjct  380   CVVARGADLLALTSALGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGK  439

Query  342   GASCYFNGLATMTTVDPSH  286
             GA+CYFNGLA  T ++PS 
Sbjct  440   GATCYFNGLAQQTIINPSE  458



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/443 (60%), Positives = 335/443 (76%), Gaps = 8/443 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S  IGINYG++G++LPS+Y++IE++K ++   VKIYD++ EILKLLSGT ++V+IMV+N 
Sbjct  25    SDKIGINYGKLGSNLPSSYQSIESIKFLKAGSVKIYDANPEILKLLSGTDLKVSIMVQNH  84

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
             +I       ++   A +WVHDNVL F P TMIR +LVGNE+LS SS +   +W  +VPAM
Sbjct  85    EI---IDIASKQKVADQWVHDNVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAM  141

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
               IKK LN HNIHNIKVGTP+AMDI +T+FPPS+G FR+DI    V+ PLL FLNRT+S+
Sbjct  142   HRIKKCLNAHNIHNIKVGTPLAMDIFQTTFPPSNGTFRSDISAS-VMEPLLQFLNRTKSF  200

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FFLDVYPYF+WS NP  +SLDFAL R  N T   D  +GLVYTNLLDQMLDSV+FAM  L
Sbjct  201   FFLDVYPYFAWSTNPKTISLDFALLRETN-TSYTDPNSGLVYTNLLDQMLDSVIFAMAKL  259

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G++D+R+AISETGWPN GD DQ GA+++NAA YNRNL+ KM   P LGTPARPG  IPTF
Sbjct  260   GYSDIRLAISETGWPNAGDFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGSIIPTF  319

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             IFSLYDEN+K GPGTERHWG+L   G+P+YE++L+     ++Y PLP   NN PY+G +W
Sbjct  320   IFSLYDENQKTGPGTERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPYKGKVW  379

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             CVVA G  +L L  AL +AC  GNGTCD L PG  CY+P+S+  HA+YAFSS+WAK+   
Sbjct  380   CVVARGADLLALTSALGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWAKFMGK  439

Query  342   GASCYFNGLATMTTVDP-SHGAC  277
             GA+CYFNGLA  T ++P   G C
Sbjct  440   GATCYFNGLAQQTIINPRKKGIC  462



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/445 (60%), Positives = 341/445 (77%), Gaps = 10/445 (2%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +GINYGRVGN+LPS  +++E ++ MR  +VK+YD+D EILKLLS T ++V+IMV+N++IP
Sbjct  1     MGINYGRVGNNLPSPSQSVERIQLMRARRVKLYDADPEILKLLSRTQVQVSIMVQNQEIP  60

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSA---QSLWLQMVPAMKN  1237
              +AS+   +    +WV +NVL + P TMIR +LVGNEVLS +S    + LW  +VPAM+ 
Sbjct  61    GVASSQALA---DKWVRNNVLPYYPRTMIRFILVGNEVLSYNSTDRDRQLWGDLVPAMRR  117

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             IK +L  + I NIKVGTP+AMD++E++FPPSSGRFR+D+  + V++PL+ FLN TRSYFF
Sbjct  118   IKSSLRSNRIRNIKVGTPMAMDVVESTFPPSSGRFRSDVA-ESVIMPLVRFLNSTRSYFF  176

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             LDVYPYF WS NP ++SLDFALFRG  +    D  TGL YTNLLDQMLDS++FAM+ LG+
Sbjct  177   LDVYPYFPWSRNPGDISLDFALFRGNFN--YTDPATGLTYTNLLDQMLDSLIFAMERLGY  234

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
             ++V + I+ETGWPN+GD+D+PGA+++NAA YNRNL+ KMM +PP GTPARPGV IPTFIF
Sbjct  235   SNVPLLIAETGWPNSGDIDEPGANINNAATYNRNLIKKMMAEPPAGTPARPGVVIPTFIF  294

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SLYDEN+K GPGTERHWG+L   G  VYE++LT   P + Y PLP P NNRPY+G LWCV
Sbjct  295   SLYDENQKAGPGTERHWGLLHANGDAVYEIDLTEKRPASTYGPLPLPTNNRPYKGKLWCV  354

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                   + DLG AL  AC   NG CD L PG +C+EP S   HA+YAFS++WA++RS GA
Sbjct  355   ARIDANVTDLGSALSSACRV-NGMCDILMPGRECHEPASTFRHASYAFSAYWARFRSRGA  413

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
             +CYF+GLA  T  DPS G+CK PSV
Sbjct  414   TCYFDGLAEQTVGDPSRGSCKFPSV  438



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/462 (56%), Positives = 346/462 (75%), Gaps = 9/462 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             IF+++FF     S+   S  +G+NYG +GN+LP+A  +++ +K ++  +VK+YD + EIL
Sbjct  13    IFSILFFL----SSAEISPKVGVNYGLLGNNLPAASRSVQLIKGLKAGRVKLYDPNPEIL  68

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             + LSGT ++V+IMV N+ I   ++ +     + +WV  NV+ + P TMIR VLVGNEVLS
Sbjct  69    EALSGTELQVSIMVPNQQI---SNISRSQKLSDQWVKTNVVPYYPETMIRYVLVGNEVLS  125

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
                 +  W  +VPAM+ IK +L   +IH +KVGTP+AMD+LE+SFPPS+G FR+DI    
Sbjct  126   LYDQKQGWPDLVPAMRRIKGSLRKFHIHKVKVGTPLAMDVLESSFPPSNGTFRSDI-SVS  184

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ PLL FLNRT+S+FFLDVYPYF WS  P+N+ LD+ALF GGN T   D  TGL YTNL
Sbjct  185   VVKPLLQFLNRTKSFFFLDVYPYFPWSSQPHNIKLDYALFEGGNLTYT-DPGTGLTYTNL  243

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
             LDQMLDSVVFAM+ LGF ++R+ I+ETGWPN GD+DQ GA+++NAA YNRNL+ ++   P
Sbjct  244   LDQMLDSVVFAMKRLGFPEIRLWIAETGWPNAGDIDQIGANIYNAATYNRNLIKRLNAKP  303

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
             P+GTPARPG  +PTFIFSLY+EN+K GPGTERHWG+L P    VY+++LT   PE+EYPP
Sbjct  304   PVGTPARPGSVLPTFIFSLYNENQKGGPGTERHWGLLYPNESSVYQIDLTGETPESEYPP  363

Query  567   LPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
             LP P+NN PY+G +WCVVA G    +LG AL +AC  GNGTC+ + PG  CY+PVS++ H
Sbjct  364   LPAPENNEPYKGKIWCVVAKGANRTELGSALTYACGQGNGTCEPVQPGRKCYKPVSLVRH  423

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             A++AFSS+WA++RSTG +CYFNGLA  T  DPS+G+CK PSV
Sbjct  424   ASFAFSSYWAQFRSTGGTCYFNGLAVQTMKDPSYGSCKFPSV  465



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/464 (57%), Positives = 342/464 (74%), Gaps = 8/464 (2%)
 Frame = -3

Query  1641  ALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKL  1462
             AL FF+LL  S+ +    IG+NYGR GN+LPSAYE+IE L++M+   VK+YD++ EIL+L
Sbjct  18    ALFFFSLLVFSDAITLRKIGVNYGRFGNNLPSAYESIEILRSMKAGSVKLYDANPEILRL  77

Query  1461  LSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDS  1282
             L+ T I V+IMV N++I    +       A +WV DNVL + P T+IR +LVGNEVLS S
Sbjct  78    LARTNIHVSIMVSNDEI---INIAANQTTANKWVEDNVLRYYPDTIIRIILVGNEVLSYS  134

Query  1281  S--AQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
             S   + +W  +VPAM+ I  +L   +I NIKVGTP+AMD+L+T+FPPS+G FR+DI    
Sbjct  135   SDAGKQIWNNLVPAMRRINISLRAQDIRNIKVGTPLAMDVLQTAFPPSNGIFRSDI-STS  193

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V++PLLNFLN T+S+FF+D YPYF W+ NP N+SL+FALF+  ++    D  TGLVYTNL
Sbjct  194   VMVPLLNFLNSTKSFFFIDAYPYFPWAANPINISLNFALFQ--SNIKYRDPGTGLVYTNL  251

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
             LDQMLDS+V+AM  LG+ DVR++I+ETGWPN GD+D+ GA++ NAA YNRNLV KM    
Sbjct  252   LDQMLDSLVYAMTKLGYPDVRLSIAETGWPNAGDIDEAGANIKNAATYNRNLVRKMTASN  311

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
             P GTPARPG  IPTFIF+LYDEN K GPGTERHWG+L P G  +Y+++LT     ++Y  
Sbjct  312   PTGTPARPGALIPTFIFALYDENTKTGPGTERHWGLLHPNGTSIYQIDLTGKRASSDYET  371

Query  567   LPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
             LP   NN PY+G LWC+ A  + + +L  AL FAC  GNGTCD L PG +CYEP+S+  H
Sbjct  372   LPPAHNNVPYKGKLWCIAAPEVNLTELERALTFACNQGNGTCDSLTPGKECYEPLSVTWH  431

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             A+YAFSS+WAK+RS GA+CYFNGLA  TT +PS G+C+ PSV +
Sbjct  432   ASYAFSSYWAKFRSQGANCYFNGLAQQTTSNPSRGSCQFPSVTI  475



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/479 (57%), Positives = 354/479 (74%), Gaps = 17/479 (4%)
 Frame = -3

Query  1659  MQKPIFALIFFT---LLASSNGLP----SSNIGINYGRVGNDLPSAYETIETLKAMRVSQ  1501
             M + I   I F+   LL S  G+     SS IGINYG++GN+LPS   +IE +K+M   +
Sbjct  1     MHQAILVFILFSCSSLLDSYFGVGNLAISSKIGINYGQLGNNLPSPNSSIELIKSMNAGR  60

Query  1500  VKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMI  1321
             VK+YD++ EIL LLSGT ++V+IMV N +I   +   +  A A  WV +NVL + P TMI
Sbjct  61    VKLYDANPEILNLLSGTNLQVSIMVPNSEI---SIIASNQAKADEWVRNNVLPYYPQTMI  117

Query  1320  RGVLVGNEVLSDSSA---QSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFP  1150
             R +LVGNEVLS +S+   + +WL +VPAM  IK +L   NI NIKVGTP+A+D+L+++FP
Sbjct  118   RYLLVGNEVLSYNSSDQDRQMWLDLVPAMTKIKSSLKAQNITNIKVGTPLAIDVLQSTFP  177

Query  1149  PSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDT  970
             PS+  FR DI  + V+ P+L FLNRT S+ F+DVYPYF WS N  N+SLDFALF G N+T
Sbjct  178   PSNSMFRPDI-SNSVMAPMLRFLNRTNSFMFIDVYPYFPWSSNTTNISLDFALFGGNNNT  236

Query  969   -VVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNA  793
                 D  +GL+YTNLLDQMLDS++ AM  LG+ ++R+ I+ETGWPN+GD++QPGA++HNA
Sbjct  237   DCYTDPGSGLIYTNLLDQMLDSLIHAMATLGYPNIRLLITETGWPNSGDIEQPGANIHNA  296

Query  792   AAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVY  613
             A YNRNL+ +M+  PPLGTPARPGV IPTFIFSL+DEN+K GPGTERHWG+L   G P+Y
Sbjct  297   ATYNRNLIHRMVAKPPLGTPARPGVVIPTFIFSLFDENQKTGPGTERHWGLLHADGTPIY  356

Query  612   ELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFAC--AAGNGTCD  439
             +++L       +Y PLPE +NN PY+G++WCVVA G+   +LG AL   C   AGNGTCD
Sbjct  357   DIDLAGKRRLEDYEPLPEANNNSPYKGSVWCVVAKGVNNDELGSALTNLCNSGAGNGTCD  416

Query  438   DLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
              L+PG +CYEPVS + HA+YAFSS+WAK+RS GA+CYFNGLA  TTVDPSHG+CK PSV
Sbjct  417   ALSPGKECYEPVSEILHASYAFSSYWAKFRSHGATCYFNGLAEQTTVDPSHGSCKFPSV  475



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/451 (58%), Positives = 346/451 (77%), Gaps = 10/451 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS IGINYG++GN+LPS   ++E +K+M   +VK+YD++ EIL LLSGT ++V+IMV N 
Sbjct  4     SSKIGINYGQLGNNLPSPNSSVEFIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMVPNN  63

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSA---QSLWLQMVPA  1246
             +I   ++  +  A A  WV +NVL + P TMIR +LVGNEVLS +S+   + +WL +VPA
Sbjct  64    EI---STIASNQAKADEWVRNNVLPYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPA  120

Query  1245  MKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRS  1066
             M   K +L   NI NIKVGTP+AMD+LE++FPPS+  FR DI  + V+ P+L FLNRT S
Sbjct  121   MTKFKSSLKAQNITNIKVGTPLAMDVLESTFPPSNSMFRPDI-SNSVMAPMLRFLNRTNS  179

Query  1065  YFFLDVYPYFSWSENPYNVSLDFALFRGGNDT-VVVDSETGLVYTNLLDQMLDSVVFAMQ  889
             + F+DVYP+F WS N  N+SLDFALFRG N+T    DS +GL+YTNLLDQMLDS+++AM 
Sbjct  180   FMFIDVYPFFPWSSNSTNISLDFALFRGNNNTNYYTDSGSGLIYTNLLDQMLDSLIYAMA  239

Query  888   YLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIP  709
              LG+ ++R+ I+ETGWPN+GD++QPGA++HNAA YNRNL+ +M+  PPLGTPARPGV IP
Sbjct  240   KLGYQNIRLLITETGWPNSGDIEQPGANIHNAATYNRNLIHRMVAKPPLGTPARPGVVIP  299

Query  708   TFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGN  529
             TFIFSL+DEN+K GPGTERHWG+L   G P+Y+++LT      +Y PLPE +NN PY+G 
Sbjct  300   TFIFSLFDENQKTGPGTERHWGLLHADGTPIYDIDLTGKRRLEDYKPLPEANNNSPYKGM  359

Query  528   LWCVVATGIRILDLGPALDFAC--AAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAK  355
             +WCVVA G+   +L  AL+  C  ++GNGTCD L+PG +CYEPVS + HA+YAFSS+WAK
Sbjct  360   VWCVVAKGVNNDELDSALNNLCSSSSGNGTCDALSPGKECYEPVSEILHASYAFSSYWAK  419

Query  354   YRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             + S GA+CYF+GLA  TTVDPSHG+CK PSV
Sbjct  420   FWSHGATCYFDGLAEQTTVDPSHGSCKFPSV  450



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/453 (57%), Positives = 341/453 (75%), Gaps = 8/453 (2%)
 Frame = -3

Query  1608  NGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIM  1429
             + +PS  IG+NYG +GN+LPSA ++IE+L+AM+   VK+YD++ EIL+LL+GT IRV+IM
Sbjct  20    DAMPSGKIGVNYGLLGNNLPSAGQSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIM  79

Query  1428  VRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS--AQSLWLQM  1255
             V N +I    +      +A +WV DNVL + P TMIR +LVGNEVLS  S   + +W  +
Sbjct  80    VPNYEI---INIATNQTSANKWVEDNVLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHL  136

Query  1254  VPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNR  1075
             VPAM+ IK +L   +I NIKVGTP+AMD+L+T+FPPS+G FR DI    V++PLL FLN 
Sbjct  137   VPAMRRIKISLRAQDIRNIKVGTPLAMDVLQTTFPPSTGTFRPDI-STTVMVPLLKFLNS  195

Query  1074  TRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFA  895
             T+S+FF+DVYPYF WSENP N++LD+ALF+  ++    D  +GLVYTNLLDQMLDS+VFA
Sbjct  196   TKSFFFIDVYPYFPWSENPININLDYALFQ--SNIKYTDPSSGLVYTNLLDQMLDSLVFA  253

Query  894   MQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVA  715
             M  LGF+ +R++I+ETGWPN GD+ + GAS++NAA YNRNLV+KM   P +GTPARPG+ 
Sbjct  254   MTKLGFHSIRLSIAETGWPNAGDIGETGASIYNAATYNRNLVTKMTGQPLIGTPARPGLF  313

Query  714   IPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYE  535
             IP FIFSLYDEN+K GPGTERHWG+L P G  +Y+++LT     ++Y PLP   N+ PYE
Sbjct  314   IPAFIFSLYDENQKTGPGTERHWGLLHPNGTSIYQIDLTGKRASSDYEPLPATHNDMPYE  373

Query  534   GNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAK  355
             G  WCV    + + +L  AL FAC+ GNGTC+ L PG +CYEP+S++ HA++AFSS+WAK
Sbjct  374   GKSWCVATPDVNLTELERALTFACSQGNGTCEALTPGKECYEPLSVIWHASFAFSSYWAK  433

Query  354   YRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             +RS GA+CYFNGLA  TT DPS G C+ PSV +
Sbjct  434   FRSQGANCYFNGLAVQTTSDPSRGLCQFPSVTI  466



>gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/455 (56%), Positives = 342/455 (75%), Gaps = 11/455 (2%)
 Frame = -3

Query  1611  SNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTI  1432
             S+   S  +GINYG++G++LPS Y++I+ LK++  S+VK+Y++D EIL+LL+G+ I+V+I
Sbjct  33    SDAQVSGKMGINYGQLGSNLPSPYQSIQILKSINASRVKLYNADPEILRLLAGSKIQVSI  92

Query  1431  MVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQS---LWL  1261
             MV N++I       +    A +WV  NVL++ P TMIR +LVGNE+ S  S Q    +W 
Sbjct  93    MVPNQEI---IRIASDQTLANQWVRQNVLQYYPNTMIRFILVGNEIFSSVSVQEQNYVWP  149

Query  1260  QMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFL  1081
              +VPAM+NIK +L +HNI NIKVGTP++MDIL+T+FPPS+G FR ++    +L PLL FL
Sbjct  150   NLVPAMRNIKNSLKIHNIKNIKVGTPLSMDILQTTFPPSNGTFRTNV---SILPPLLKFL  206

Query  1080  NRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVV  901
             N T+SYFF+DVYPYFS+S +P + SL+F LFR  +     D   GLVY+N+LDQMLDSV+
Sbjct  207   NGTKSYFFIDVYPYFSYSADPTSTSLEFCLFR--SRESYTDPANGLVYSNMLDQMLDSVI  264

Query  900   FAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPG  721
             FAM  LG+ ++++AISETGWP+ GD+DQ GA++HNAA YNRNLV KM  +PP+GTPARPG
Sbjct  265   FAMSKLGYPNIQLAISETGWPSGGDIDQAGANIHNAATYNRNLVKKMTANPPMGTPARPG  324

Query  720   VAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRP  541
               IPTFIFSLY+ENRK GPGTERHWG+    G  +Y+++L+    E+EY PLPE  NNRP
Sbjct  325   TMIPTFIFSLYNENRKDGPGTERHWGVFNENGKAIYDIDLSGQRQESEYEPLPEGINNRP  384

Query  540   YEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFW  361
             Y+G LWCVV     ++++   L   C+ GN TC+ LAPG DCYEP+S++ HA+YAFSS+W
Sbjct  385   YKGKLWCVVRREAGLMEVERELSTVCSQGNETCEALAPGNDCYEPISVIWHASYAFSSYW  444

Query  360   AKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             A++RS GASCYFNGLA  TT DPSHG+CK PSV V
Sbjct  445   AQFRSQGASCYFNGLAKQTTTDPSHGSCKFPSVTV  479



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/453 (57%), Positives = 342/453 (75%), Gaps = 8/453 (2%)
 Frame = -3

Query  1608  NGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIM  1429
             + +PS  +G+NYG +GN+LPSA ++IE+L+AM+   VK+YD++ EIL+LL+GT IRV+IM
Sbjct  20    DAMPSGKVGVNYGLLGNNLPSAGQSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIM  79

Query  1428  VRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS--AQSLWLQM  1255
             V N +I    S      +A +WV DNVL + P TMIR +LVGNEVLS  S   + +W  +
Sbjct  80    VPNYEI---ISIATNQTSANKWVEDNVLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHL  136

Query  1254  VPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNR  1075
             V AM+ IK +L   +I NIKVGTP+AMD+L+T+FPPS+G FR+DI    V++PLL FLN 
Sbjct  137   VLAMRRIKISLRAQDIRNIKVGTPLAMDVLQTAFPPSTGIFRSDI-STTVMVPLLKFLNS  195

Query  1074  TRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFA  895
             T+S+FF+DVYPYF WS NP N++LDFALF+  ++    D  +GLVYTNLLDQMLDS+VFA
Sbjct  196   TKSFFFIDVYPYFPWSANPININLDFALFQ--SNIKYTDPGSGLVYTNLLDQMLDSLVFA  253

Query  894   MQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVA  715
             M  LGF+ +R++I+ETGWPN GD+ + GAS++NAA YNRNLV+KM   P +GTPARPG+ 
Sbjct  254   MAKLGFHSIRLSIAETGWPNAGDIGETGASIYNAATYNRNLVTKMTGRPQIGTPARPGLF  313

Query  714   IPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYE  535
             IP FIFSLYDEN+K GPGTERHWG+L P G  +Y+++LT     ++Y PLP   N+ PYE
Sbjct  314   IPAFIFSLYDENQKTGPGTERHWGLLHPNGTSIYQIDLTGKRASSDYEPLPATQNDMPYE  373

Query  534   GNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAK  355
             G  WCV A  + + +L  AL+FAC+ GNGTC+ L PG +CYEP+S++ HA++AFSS+WAK
Sbjct  374   GKSWCVAAPDVNLTELERALNFACSKGNGTCEALTPGKECYEPLSVIWHASFAFSSYWAK  433

Query  354   YRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             +RS GA+CYFNGLA  TT +PS G C+ PSV +
Sbjct  434   FRSQGANCYFNGLAVQTTRNPSRGLCQFPSVTI  466



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 351/464 (76%), Gaps = 8/464 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             + AL FF+ LA ++    S IG+NYG++G++LPS  ++IE +K+M+  +VK+YD++ EIL
Sbjct  15    LLALSFFSFLAFTHAEIPSKIGVNYGQLGDNLPSPSQSIELIKSMKAGRVKLYDANPEIL  74

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
              LLSGT I+V+IMV N++I   ++ ++    A +WV DNVL + P TMIR ++VGNEVLS
Sbjct  75    NLLSGTKIQVSIMVPNQEI---SNISSNQTLADQWVRDNVLSYYPQTMIRFIVVGNEVLS  131

Query  1287  DSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPR  1114
               S +    W  +VPAM+ IKK+L  +NI NIKVGT VAMD++E+SFPPSSG FR+DI  
Sbjct  132   YYSDRDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVAMDVMESSFPPSSGMFRSDI-L  190

Query  1113  DQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYT  934
             D V++PLL FL+ T S+FFLDVYPY +WS NP N+SLD+ALFR GN     D  + L YT
Sbjct  191   DTVMVPLLEFLSGTNSFFFLDVYPYLAWSANPSNISLDYALFRDGNLNYT-DPISNLTYT  249

Query  933   NLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQ  754
             NLLD+MLDSV+FAM+ LG+ ++R+ ISETGWPN GD+DQPGA+V+NAA  N+NL+ KM  
Sbjct  250   NLLDEMLDSVIFAMEKLGYPNIRLLISETGWPNAGDVDQPGANVYNAALXNQNLIKKMTA  309

Query  753   DPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY  574
              P +GTPARPG+ IPTFIF+LY+EN+K GPGTERHWG+L   G PVY ++LT  + E+  
Sbjct  310   KPAVGTPARPGMTIPTFIFALYNENQKRGPGTERHWGLLDCNGKPVYGVDLTGEL-ESND  368

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
               LP P NN+PY+G +WCVVA+ +    L  AL +AC+ GNGTCD L PG +CYEP S+L
Sbjct  369   DQLPMPQNNKPYQGKIWCVVASEVNPEQLVSALIYACSQGNGTCDALMPGKECYEPFSLL  428

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +HA+YAFSS+WAK+RS GA+CYFNGLA  TT DPS G+CK P+V
Sbjct  429   SHASYAFSSYWAKFRSLGANCYFNGLAVQTTEDPSRGSCKFPTV  472



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/465 (54%), Positives = 346/465 (74%), Gaps = 8/465 (2%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
              A+    LL+ S+   +SNIG+NYG +GN+LPS Y +IE L  M+  +VK+YD++ +IL+
Sbjct  4     LAIYLVCLLSLSSAKANSNIGVNYGVLGNNLPSLYRSIELLTTMKAGRVKLYDANPDILR  63

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
             LLS T ++V+IM+ N +I   +      + A  WV +N+L + P T+ R +LVGNEVLS 
Sbjct  64    LLSTTKLKVSIMIPNHEI---SGIAANQSIADEWVRNNILPYYPNTLFRYLLVGNEVLSY  120

Query  1284  SSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             +S Q   +W  +VPAM++IK+ALN  NI  IK+GTP+AMD+LE++FPPSSG FR+DI RD
Sbjct  121   NSEQGHKMWHDLVPAMRSIKRALNSQNIRGIKIGTPLAMDVLESTFPPSSGTFRSDI-RD  179

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              V+ P+L FLNRT S+FF+D YPYF WS++P N+ LD+ALFRG  D    D ++GL+Y N
Sbjct  180   SVMAPMLKFLNRTNSFFFIDAYPYFPWSQDPNNIPLDYALFRG--DFTTRDPDSGLIYRN  237

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             LLDQMLDS++FAM  LG++++++ ISETGWPN+GD+++ GA+++NAA YNRNL+ +M   
Sbjct  238   LLDQMLDSLLFAMSKLGYSNIQLVISETGWPNSGDIEETGANIYNAATYNRNLIQRMTAK  297

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP  571
             PP+GTPARPGV I TF+FSL+DEN+K GPGTERHWG+L   G P+Y+L+LT     T+Y 
Sbjct  298   PPIGTPARPGVPITTFLFSLFDENQKPGPGTERHWGLLHTDGTPIYDLDLTGKKTNTDYA  357

Query  570   PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
             PL  P NN PY+G +WCV A G   ++L  AL +AC   N TCD L+PG +CYEPVSI  
Sbjct  358   PLQAPKNNVPYKGKVWCVAAEGANEIELAAALTYACNVANMTCDALSPGNECYEPVSIPL  417

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             HA+Y FS++WA+++S+GA+CYFNGLAT TT DPS  +CK PSV +
Sbjct  418   HASYVFSTYWAQFKSSGATCYFNGLATETTKDPSRNSCKFPSVIL  462



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/449 (58%), Positives = 340/449 (76%), Gaps = 9/449 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS IGINYGR G++LPS Y++IE +K+M+  +VK+YDSD EILKL SGT I + IMV N+
Sbjct  111   SSKIGINYGRQGDNLPSPYQSIEIMKSMKARRVKLYDSDPEILKLFSGTNIDMAIMVPNK  170

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
             DI      ++   AA++WV +NVL + P T IR VLVGNEVLS  S Q  ++W  +VPAM
Sbjct  171   DI---VLISSSQTAAEQWVRNNVLAY-PNTNIRFVLVGNEVLSYVSKQDQTIWAHLVPAM  226

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
             + IK +L+ ++I NIK+GTP+AMDIL+++FPPSSG FR+DI  + V+ PLL FLN ++S+
Sbjct  227   RRIKNSLSANDIKNIKIGTPLAMDILQSTFPPSSGTFRSDI-SNTVMAPLLKFLNGSKSF  285

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FFLDVYPYF WS NP N+SLDFALF  G +    D  +GLVYTNLLDQMLDSV FAM+ L
Sbjct  286   FFLDVYPYFPWSANPMNISLDFALF--GGNVNHTDPGSGLVYTNLLDQMLDSVTFAMEKL  343

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G+  +R+AI+ETGWP  GD+DQ GA+++NAA YNRNL+ KM   PPLGTPARPG+ IPTF
Sbjct  344   GYPSIRLAIAETGWPTAGDVDQVGANIYNAATYNRNLIRKMTAKPPLGTPARPGLVIPTF  403

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             IFSLY+EN+K GPGTERHWG+L   G  +Y+++LT     ++Y PLP   NN PY+G +W
Sbjct  404   IFSLYEENQKTGPGTERHWGLLHSNGTAIYDIDLTGKRLASDYKPLPPAQNNVPYKGKVW  463

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             C VA G  +++L  AL +AC+  N TC  L+PG +CYEP+S+  H++YAFSS+WAK+RS 
Sbjct  464   CEVAPGANLMNLSSALTYACSQDNQTCAALSPGKECYEPISVFWHSSYAFSSYWAKFRSQ  523

Query  342   GASCYFNGLATMTTVDPSHGACKVPSVFV  256
             GA+CYF+GLA  TTV+PS G CK PSV +
Sbjct  524   GATCYFSGLARQTTVNPSRGRCKFPSVIL  552



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/465 (54%), Positives = 348/465 (75%), Gaps = 8/465 (2%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
              A++F  L++ S     SNIG+NYG +GN+LPS Y +IE L  M+ ++VK+YD++ +IL+
Sbjct  4     LAILFVCLVSLSGAKAYSNIGVNYGVLGNNLPSPYRSIELLTIMKAARVKLYDANPDILR  63

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
             LLS T ++V+IM+ N +I   +      + A  WV +NV+ F P TMIR +LVGNEVLS 
Sbjct  64    LLSTTKLKVSIMIPNHEI---SGIAANQSIADEWVRNNVVPFYPKTMIRFLLVGNEVLSY  120

Query  1284  SSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             +S Q   +W  +VPAM++IK++L   NI +IK+GTP+AMD+L+++FPPS G FR+DI RD
Sbjct  121   NSEQGHKMWHDLVPAMRSIKRSLKSLNIRDIKIGTPLAMDVLQSTFPPSRGTFRSDI-RD  179

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              V++P+L FL+RT+S+FF+D YPYF WS++P N++LDFALFRG   T   D  +GL+Y+N
Sbjct  180   SVIVPMLKFLDRTKSFFFIDAYPYFPWSQDPNNINLDFALFRGNFTTR--DPGSGLLYSN  237

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             LLDQMLDS++FAM  LG+ ++++ ISETGWPN+GD+++PGA++ NA  YNRNL+ +M   
Sbjct  238   LLDQMLDSLIFAMSKLGYTNIQLVISETGWPNSGDIEEPGANIFNAPTYNRNLIQRMTTK  297

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP  571
             PP+GTPARPGV IPTFIFSL++EN+K GPGTERHWG+L   G P+Y+L+LT     T++ 
Sbjct  298   PPIGTPARPGVTIPTFIFSLFNENQKPGPGTERHWGLLETDGTPIYDLDLTGKKHITDFA  357

Query  570   PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
              LP P+NN P++G +WCV A G   ++L  AL +AC   N TC+ L+PG +CYEPVS+  
Sbjct  358   SLPAPENNVPFKGKVWCVAAKGANEIELASALSYACNEVNMTCEALSPGNECYEPVSVTD  417

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             HA+Y FS+FWAK+++TGA+CYFNGLA  TT DPS   CK PSV +
Sbjct  418   HASYVFSTFWAKFKTTGATCYFNGLAEQTTKDPSRPFCKFPSVTI  462



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/461 (56%), Positives = 341/461 (74%), Gaps = 8/461 (2%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
              +FF+L+  S+   SS IG+NYG++GN+LP     IE + +M+V +VK+YD++HEIL  L
Sbjct  11    FLFFSLILISDAEISSKIGVNYGQLGNNLPPPNLAIEMMNSMKVGRVKLYDANHEILGNL  70

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             S T  +V+IM+ N +I   +   N    A +W+ +NVL F P TMIR +LVGNEVLS  S
Sbjct  71    SKTKFQVSIMIPNNEI---SDIANNQTRADQWISNNVLPFYPQTMIRFILVGNEVLSFDS  127

Query  1278  AQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQV  1105
              +   +W  +VPAM+ I  +L  +N+  IKVGTPVAMDILET+FPPS G FR+DI +  V
Sbjct  128   DKDRQVWNDLVPAMRRIWSSLKANNLQTIKVGTPVAMDILETTFPPSRGTFRSDI-QQTV  186

Query  1104  LLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLL  925
             + P+LNFLN TRS+FF +VYPYFSW+ NP N++LDFALF G  + +  D  +GLVYTNLL
Sbjct  187   VAPMLNFLNETRSFFFANVYPYFSWAANPMNINLDFALFNGNFEQI--DGGSGLVYTNLL  244

Query  924   DQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPP  745
             D+MLDS++FAM  LG+ D+R+ ISETGWP  GD++QPGA++ NAA YNRNLV ++   P 
Sbjct  245   DEMLDSLIFAMAKLGYPDIRLVISETGWPTAGDIEQPGANLLNAATYNRNLVKRITAKPT  304

Query  744   LGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPL  565
             +GTPARPGV IPTFIF+L+DEN+K G GTERHWG+LR  G P Y+++LT      EY PL
Sbjct  305   VGTPARPGVVIPTFIFALFDENQKPGSGTERHWGLLRSDGSPNYQIDLTGKESSVEYDPL  364

Query  564   PEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHA  385
             P  +NN P+ G LWCV A G+ +++L  A+D  C  G+GTC+ L+PG +CYEPVS+  HA
Sbjct  365   PVVENNAPFRGRLWCVAARGVDLMELEAAVDDVCGRGDGTCEALSPGRECYEPVSVYWHA  424

Query  384   NYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +YAFSS+W+K+RS GASCYFNGLA  TTVDPS+G+C+ PSV
Sbjct  425   SYAFSSYWSKFRSQGASCYFNGLAEQTTVDPSNGSCRFPSV  465



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/446 (59%), Positives = 326/446 (73%), Gaps = 8/446 (2%)
 Frame = -3

Query  1593  SNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNED  1414
             S IG+NYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTIMV N  
Sbjct  39    SKIGVNYGRQGNNLPSPYQSINLIKSVKAGHVKLYDADPETLTLLSQTNLYVTIMVPNHQ  98

Query  1413  IPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAMK  1240
             +    S  +   AA  WV  NVL + P T+IR VLVGNEVLS S+ Q   +W  +VPAM+
Sbjct  99    V---ISIGSDQTAADNWVKTNVLPYYPQTLIRFVLVGNEVLSYSTDQDREVWRNLVPAMR  155

Query  1239  NIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
              +  +L    I NIKVGTP+AMD+L+++FPPSSG FR DI    V+LPLL FLN T S+F
Sbjct  156   KLVNSLRAQGIRNIKVGTPLAMDVLQSTFPPSSGTFREDIA-GPVMLPLLKFLNGTNSFF  214

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
             F+D YPYF WS +P N  LDFALF G  +T   D +TGLVYTNLLDQMLDSV+ AM  LG
Sbjct  215   FIDAYPYFPWSSDPVNTGLDFALFEG--NTTYTDPKTGLVYTNLLDQMLDSVISAMSSLG  272

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             + D+R+AISETGWPN+GD+D+ GASVHNAA YNRNL+ +M  +PP+GTPARPG++IPTF+
Sbjct  273   YPDIRLAISETGWPNSGDIDEIGASVHNAATYNRNLIKRMTANPPVGTPARPGLSIPTFV  332

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWC  520
             FSL+DENRK GPGTERHWGILRP+G PVYE++ T     + Y PLP PDNN PY+GN+WC
Sbjct  333   FSLFDENRKPGPGTERHWGILRPSGTPVYEVDFTGKKQVSGYGPLPAPDNNVPYKGNVWC  392

Query  519   VVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTG  340
             V   G  +  LG AL FAC   N TC  LAPG +CYEPVS+  HA+YAFSS+WA++RS  
Sbjct  393   VANEGADMAALGEALRFACGRSNDTCQALAPGRECYEPVSVTWHASYAFSSYWAQFRSQN  452

Query  339   ASCYFNGLATMTTVDPSHGACKVPSV  262
             A CYF+GLA  TT +P +  CK PSV
Sbjct  453   ARCYFDGLARETTTNPGNDRCKFPSV  478



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/454 (56%), Positives = 333/454 (73%), Gaps = 8/454 (2%)
 Frame = -3

Query  1617  ASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRV  1438
             A +N   S  +G+NYG++GN+LPS   +IE +K+++  +VK+YD++ +ILK L GT I V
Sbjct  15    ACTNAEISKKMGVNYGQLGNNLPSPSRSIELIKSLKAGRVKLYDANPDILKALEGTNIHV  74

Query  1437  TIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLW  1264
             +IMV N+ I   ++ ++  + A  WV  NV+ F P T+IR +LVGNE+ S  S Q    W
Sbjct  75    SIMVPNQLI---SNISSSQSLANEWVRTNVVPFYPKTLIRYLLVGNEIFSFYSDQDRQTW  131

Query  1263  LQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNF  1084
               +V AM+ +K +L +H+I NIK+GT  AMD+L++SFPPS+G FR+DI    V+ PLL F
Sbjct  132   YDLVQAMRRLKYSLKIHSIRNIKIGTTAAMDVLQSSFPPSNGTFRSDI-SIPVMKPLLQF  190

Query  1083  LNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSV  904
             LNRT+SYFFLD YPYF WS +  N++LD+ALF+G  +    D  +GL YTNLLDQMLDSV
Sbjct  191   LNRTKSYFFLDAYPYFPWSGDTTNINLDYALFKG--NQTYTDPRSGLTYTNLLDQMLDSV  248

Query  903   VFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARP  724
             +FAM  LGF +VR+ I+ETGWPN GD+DQ GA++ NAA YNRNL+ +M   P +GTPARP
Sbjct  249   IFAMTKLGFPNVRLVIAETGWPNAGDVDQIGANIFNAATYNRNLIRRMTSKPAIGTPARP  308

Query  723   GVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNR  544
             GV IPTFIF+LY+EN+K GPGTERHWG+L P G  VYE++LT   PE +Y PLP P NN 
Sbjct  309   GVVIPTFIFALYNENQKGGPGTERHWGLLNPDGTSVYEVDLTGKRPEFDYKPLPAPLNNE  368

Query  543   PYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSF  364
             PY+G +WCVVA G     LG A+ +AC  GNGTC+++ PG DCYEPVS++ HA+YAFSS+
Sbjct  369   PYKGKIWCVVARGANRTALGSAIKYACGQGNGTCEEIRPGSDCYEPVSLVRHASYAFSSY  428

Query  363   WAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             WA++R  G +CYFNGLA  TT DP HG+CK PSV
Sbjct  429   WAQFRKFGGTCYFNGLAVQTTKDPGHGSCKYPSV  462



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   526 bits (1354),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 256/457 (56%), Positives = 336/457 (74%), Gaps = 10/457 (2%)
 Frame = -3

Query  1623  LLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYI  1444
             +L S+N   SS +GINYGR+GN+LPS   +IE +K +   ++K+YD++ EIL  L+ T I
Sbjct  13    VLVSTNAEISSKMGINYGRLGNNLPSPSRSIEFIKTLEAGRIKLYDANPEILNALAWTNI  72

Query  1443  RVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL---SDSSAQ  1273
             +V+IMV N+ I   ++ ++  A A  WV  NV+ F   T+IR +LVGNE+    SD   Q
Sbjct  73    QVSIMVPNQLI---SNISSSQAVADEWVRTNVIPFYSKTLIRHLLVGNEIFNFYSDEDRQ  129

Query  1272  SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPL  1093
             + W  +V AM+ IK +L+ +NI NIKVGTPVAMDILET+FPPS+G FR+DI    V+ PL
Sbjct  130   T-WYNLVLAMRRIKHSLSTYNIRNIKVGTPVAMDILETAFPPSNGAFRSDIAV-PVMKPL  187

Query  1092  LNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQML  913
             L FLNRTRS+FFLDVYPYFSWS +P  ++LD+ALFRG  +    D  + L YTNLLDQML
Sbjct  188   LQFLNRTRSFFFLDVYPYFSWSRDPTRINLDYALFRG--NRTYTDPRSRLTYTNLLDQML  245

Query  912   DSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTP  733
             DSV+FAM  LGF +VR+ I+ETGWP+ GD+DQ GA++ NAA YNRNL+ +M   PP GTP
Sbjct  246   DSVIFAMTKLGFPNVRLVIAETGWPHAGDIDQIGANIFNAATYNRNLIRRMTSKPPAGTP  305

Query  732   ARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPD  553
             ARPGV IPTFIF+LY+EN+K GPGTERHWG++ P G PVYE++L    PE ++  LP P 
Sbjct  306   ARPGVVIPTFIFALYNENQKGGPGTERHWGLMNPDGTPVYEVDLNGKRPENDFKSLPAPL  365

Query  552   NNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAF  373
             NN  Y+G +WCVVA G    +L  A++FAC  GN TCD + PG +CY PVS+++HA+YAF
Sbjct  366   NNELYKGKIWCVVADGANSTELESAIEFACRLGNNTCDAIRPGSECYHPVSLVSHASYAF  425

Query  372   SSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             SS+WA+++ +G +CYFNGLA  TT DPS+G+CK PSV
Sbjct  426   SSYWAQFKQSGGTCYFNGLAVQTTEDPSNGSCKFPSV  462



>ref|XP_010673323.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   522 bits (1344),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 254/474 (54%), Positives = 340/474 (72%), Gaps = 11/474 (2%)
 Frame = -3

Query  1674  FKAKEMQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVK  1495
             F+   M       IF T++A S   P   IG+NYG++G++LPS Y++IE +K+M  S VK
Sbjct  10    FQVASMTHLAAIFIFSTIIAFSCAQPIDRIGVNYGKLGSNLPSPYKSIELIKSMNASMVK  69

Query  1494  IYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRG  1315
             +YD+D E +KLL+GT + V+IMVRN++I            A +WVH+NV  + P TMIR 
Sbjct  70    LYDADPETMKLLAGTDLHVSIMVRNDEI---VELATNDTLANQWVHENVFAYYPTTMIRS  126

Query  1314  VLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGR  1135
             ++VGNEV S+ + +  W  +V AM++I+  L+ H+IHNIKVGTP+AMDIL ++FPPS+G 
Sbjct  127   IMVGNEVYSNHNLEQ-WDNLVLAMQHIRNTLHTHDIHNIKVGTPLAMDILGSTFPPSNGT  185

Query  1134  FRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDS  955
             FR D      ++PLL FLNRT S+FFLD+YPYF WS NP  + L+F LFRG  +   VD 
Sbjct  186   FRVDTL--TTIVPLLQFLNRTGSFFFLDIYPYFPWSSNPNTIDLNFTLFRG--NLTYVDP  241

Query  954   ETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRN  775
              + L YTNLLDQMLDS+ FAM  +GF+++ I I+ETGWPN GDLDQPGA+V+NAA YNRN
Sbjct  242   GSNLTYTNLLDQMLDSIYFAMSKVGFSNIPIYIAETGWPNEGDLDQPGANVYNAAIYNRN  301

Query  774   LVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT  595
             LV K++ DPPLGTPARPG  IPTF+FSLY+E+ K GP TERHWG+L+P G PVY ++LT 
Sbjct  302   LVQKVLADPPLGTPARPGTIIPTFLFSLYNEDLKDGPKTERHWGLLKPDGTPVYPIDLTG  361

Query  594   AVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCD-DLAPGGD  418
             A  +T + PL +P+NN  Y+G +WCVV     I +LGPAL   C+  N TC+  L PG  
Sbjct  362   A--QTNFGPLRQPENNMGYKGKVWCVVDKMANITELGPALRRTCSRLNETCELSLGPGKH  419

Query  417   CYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             CYEPVS++ HA++AF+++WAK+R +G  CYF GLA++TT +PSHG+C  PSV +
Sbjct  420   CYEPVSVVWHASFAFNAYWAKFRDSGEICYFGGLASLTTRNPSHGSCHFPSVTI  473



>ref|XP_004147671.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
Length=461

 Score =   518 bits (1335),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 249/447 (56%), Positives = 331/447 (74%), Gaps = 8/447 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS IGINYG++GN+LP+    IE + +MRV +VK+YD++HEIL  LS T  +V+IM+ N 
Sbjct  19    SSKIGINYGQLGNNLPAPNLAIEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMIPNN  78

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSA--QSLWLQMVPAM  1243
             +I   +   N    A +W+ +N+L F P TMIR +LVGNEVLS  S   + +W  +VPAM
Sbjct  79    EI---SGIANNQTRADQWILNNLLPFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAM  135

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
             + I  +L  +N+  I+VGTPVAMD+LET+FPPS G FR+DI R  V+ P+L+FLN TRS+
Sbjct  136   RRIWSSLKANNLQIIRVGTPVAMDVLETTFPPSRGTFRSDIQR-TVVAPMLDFLNETRSF  194

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FF +VYPYF+W+ +P N++LDFALF G  + +  D  +GLVYTNLLD+MLDS++FAM  L
Sbjct  195   FFANVYPYFAWAADPMNINLDFALFNGNFEQI--DGGSGLVYTNLLDEMLDSLIFAMAKL  252

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G+ D+R+ ISETGWP  GD++QPGA++ NAA YNRNLV ++   P +GTPARP V IPTF
Sbjct  253   GYPDIRLVISETGWPTAGDMEQPGANLLNAATYNRNLVKRITAKPTVGTPARPKVVIPTF  312

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             IFSL+DEN+K G GTERHWG+L   G P Y+++LT      EY PLP  +NN P+ G LW
Sbjct  313   IFSLFDENQKPGSGTERHWGLLSSDGSPNYQIDLTGKESSVEYDPLPVVENNMPFRGRLW  372

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             CV A G+ +++LG  +D  C  G+GTC+ L+PG +CYEPVS+  HA+YAFSS+W+K+RS 
Sbjct  373   CVAARGVDLMELGATVDDVCGRGDGTCEALSPGRECYEPVSVYWHASYAFSSYWSKFRSQ  432

Query  342   GASCYFNGLATMTTVDPSHGACKVPSV  262
             GASCYFNGLA  TT DPS+G+C+ PSV
Sbjct  433   GASCYFNGLAEQTTTDPSNGSCRFPSV  459



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   518 bits (1334),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 266/477 (56%), Positives = 332/477 (70%), Gaps = 22/477 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLP--------------SSNIGINYGRVGNDLPSAYETIETLKAMRV  1507
              AL  FTLL  S+                 +S IGINYG++GN+LPS Y++I  +K ++ 
Sbjct  4     LALFLFTLLVLSSSCCYAIGSQNNRTVLALASRIGINYGKLGNNLPSPYQSINLIKTIKA  63

Query  1506  SQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGT  1327
               VK+YD+D E LKLLS T + VTIMV N+ I    S  +  AAA +WV  NVL F P T
Sbjct  64    GHVKLYDADPETLKLLSKTNLYVTIMVPNDQI---ISVGSDQAAADKWVATNVLPFYPQT  120

Query  1326  MIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSF  1153
              IR VLVGNEVLS SS Q   +W  +VPAM+ +  +L    IHNIKVGTP+AMD L +SF
Sbjct  121   RIRFVLVGNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSF  180

Query  1152  PPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGND  973
             PPSSG FR D+    V+LPLL FLN T S+FFLDVYPYF WS +P N  LD+ALF   ++
Sbjct  181   PPSSGAFREDLAV-PVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDYALFE--SN  237

Query  972   TVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNA  793
             +   D +TGLVYTNLLDQMLDSV+FAM  LG+ DVR+AISETGWPN+GD+ + GA+V NA
Sbjct  238   STYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPDVRLAISETGWPNSGDIHETGANVLNA  297

Query  792   AAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVY  613
             A YNRNL+ KM  +PPLGTPAR G  IPTF+FSL++EN+K G GTERHWGIL P G P+Y
Sbjct  298   ATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIY  357

Query  612   ELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDL  433
             E++ T   P + +  LP+PDNN P++GN+WCV   G    +LG AL+FAC   N TC  L
Sbjct  358   EIDFTGTRPVSSFGELPKPDNNVPFKGNVWCVAIDGASEAELGQALNFACGRSNETCAAL  417

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             APG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  418   APGKECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSV  474



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score =   514 bits (1324),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 244/422 (58%), Positives = 313/422 (74%), Gaps = 8/422 (2%)
 Frame = -3

Query  1515  MRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFL  1336
             M+   VK+YD++ EIL+LL+ T I V+IMVRN++I    +       A +WV DNVL + 
Sbjct  1     MKAGSVKLYDANPEILRLLARTNIHVSIMVRNDEI---INIAANQTTANKWVEDNVLRYY  57

Query  1335  PGTMIRGVLVGNEVLSDSS--AQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILE  1162
             P T+IR +LVGNEVLS SS   + +W  +VPAM+ IK +L   +I NIKVGTP+AMD+L+
Sbjct  58    PDTIIRTILVGNEVLSYSSDAGKQIWNHLVPAMRRIKISLRAQDIRNIKVGTPLAMDVLQ  117

Query  1161  TSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRG  982
             T+FPPS+G FR+DI    V++PLLNFLN T+S+FF+D YPYF WS NP N+SL+FALF+ 
Sbjct  118   TAFPPSNGTFRSDI-STSVMVPLLNFLNSTKSFFFIDAYPYFPWSANPINISLNFALFQ-  175

Query  981   GNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASV  802
              ++    D  TGLVYTNLLDQMLDS+VFAM  LG+ DVR++I+ETGWPN GD+D+ GA++
Sbjct  176   -SNIKYTDPGTGLVYTNLLDQMLDSLVFAMTKLGYPDVRLSIAETGWPNAGDIDEAGANI  234

Query  801   HNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGM  622
              NAA YNRNLV KM    P GTPARPG  IPTFIF+LYDENRK GPGTERHWG+L P G 
Sbjct  235   KNAATYNRNLVRKMTASNPTGTPARPGSLIPTFIFALYDENRKTGPGTERHWGLLHPNGT  294

Query  621   PVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTC  442
              +Y+++LT     ++Y  LP   NN PY+G LWC+ A  + + +L  AL FAC  GNGTC
Sbjct  295   SIYQIDLTGKRASSDYETLPPAQNNVPYKGKLWCIAAPEVNLTELESALTFACNQGNGTC  354

Query  441   DDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             D L PG +CYEP+S+  HA+YAFSS+WAK+RS GA+CYFNGLA  TT +PS G+C+ PSV
Sbjct  355   DSLTPGKECYEPLSVTWHASYAFSSYWAKFRSQGANCYFNGLAQQTTSNPSRGSCQFPSV  414

Query  261   FV  256
              +
Sbjct  415   TI  416



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 260/475 (55%), Positives = 333/475 (70%), Gaps = 20/475 (4%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPS------------SNIGINYGRVGNDLPSAYETIETLKAMRVSQ  1501
             FAL  FTLL  S+   S            S IGINYG++GN+LPS Y++I  +K+++   
Sbjct  4     FALFLFTLLVLSSSRCSAVPNNKTMLSLASRIGINYGKLGNNLPSPYQSINLIKSIKAGH  63

Query  1500  VKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMI  1321
             VK+YD+D E L LL+ T + VTIMV N+ I    S  +  +AA  WV  +V+ + P T I
Sbjct  64    VKLYDADPETLMLLAQTNLYVTIMVPNDHI---ISIGSDQSAADNWVATSVIPYYPATRI  120

Query  1320  RGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPP  1147
             R VLVGNE+LS SS Q   +W  +VPAM+ I  +L    IHNIKVGTP+AMD+L +SFPP
Sbjct  121   RFVLVGNEILSYSSDQDKQIWTNLVPAMRKIVNSLRARGIHNIKVGTPLAMDVLRSSFPP  180

Query  1146  SSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTV  967
             SSG FR D+    V+LPLL FLN T S+FFLDVYPYF WS +P N  LD+ALF   ++  
Sbjct  181   SSGTFREDVAA-PVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDYALFE--SNLT  237

Query  966   VVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAA  787
               D +TG +YTNLLDQMLDSV+FAM  LG+ ++R+AISETGWPN+GD+D+ GA+V NAA 
Sbjct  238   YTDPQTGFIYTNLLDQMLDSVIFAMTKLGYPNIRLAISETGWPNSGDIDETGANVLNAAT  297

Query  786   YNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYEL  607
             YNRNL+ KM  +PPLGTPAR G  IPTF+FSL++EN+K G GTERHWGIL P G P+YE+
Sbjct  298   YNRNLIRKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIYEI  357

Query  606   NLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAP  427
             + +   P   +  LP+P NN P++GN+WCVVA G    +LG AL+FAC   N TC  LAP
Sbjct  358   DFSGTRPVNSFGSLPKPSNNVPFKGNVWCVVAEGASEAELGQALNFACGESNATCAALAP  417

Query  426   GGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             G +CYEPVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  418   GRECYEPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNERCKFPSV  472



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   515 bits (1327),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 262/478 (55%), Positives = 332/478 (69%), Gaps = 22/478 (5%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLP--------------SSNIGINYGRVGNDLPSAYETIETLKAMR  1510
              FAL  FTL+A S+                 +S IGINYGR+GN+LPS Y++I  +K+++
Sbjct  3     FFALFIFTLVALSSSCSYAIGPQNNKTLLSLASRIGINYGRLGNNLPSPYQSINLVKSIK  62

Query  1509  VSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPG  1330
                VK+YD+D E L LLS T + VTIMV N  I    S     AAA  WV+ NVL   P 
Sbjct  63    AGHVKLYDADQETLMLLSQTNLYVTIMVPNNQI---ISIGADQAAADNWVNTNVLPHYPQ  119

Query  1329  TMIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETS  1156
             T IR VLVGNE+LS +S Q   +W  +VPAM+ I  +L    IHNIKVGTP+AMD+L +S
Sbjct  120   TRIRFVLVGNEILSYNSDQDKQIWANLVPAMRKIVNSLRARGIHNIKVGTPLAMDVLRSS  179

Query  1155  FPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGN  976
             FPPS+G FR ++    V+LPLL FLN T S+FFLDVYPYF WS +P N  LDFALF   +
Sbjct  180   FPPSNGTFREEVAAP-VMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDFALFE--S  236

Query  975   DTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHN  796
             ++   D +TGLVYTNLLDQMLDSV+FAM  LG+ +VR+AISETGWPN+GD+D+ GA++ N
Sbjct  237   NSTYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNVRLAISETGWPNSGDIDETGANIFN  296

Query  795   AAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPV  616
             AA YNRNL+ KM  +PPLGTPAR G  IPTF+FSL++ENRK G GTERHWGIL P G  +
Sbjct  297   AATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENRKPGSGTERHWGILNPDGTQI  356

Query  615   YELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDD  436
             Y+++L+   P +    LP+P+NN P++GN+WCV   G    +LG ALDFAC   N TC  
Sbjct  357   YDIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDFACGRSNATCAA  416

Query  435   LAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             LAPG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  417   LAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNEQCKFPSV  474



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   514 bits (1325),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 261/477 (55%), Positives = 332/477 (70%), Gaps = 22/477 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLP--------------SSNIGINYGRVGNDLPSAYETIETLKAMRV  1507
             FAL  FTL+A S+                 +S IGINYGR+GN+LPS Y++I  +K+++ 
Sbjct  4     FALFIFTLVALSSSCSYAIGPQNNKTLLSLASRIGINYGRLGNNLPSPYQSINLVKSIKA  63

Query  1506  SQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGT  1327
               VK+YD+D E L LLS T + VTIMV N  I    S     AAA  WV+ NVL   P T
Sbjct  64    GHVKLYDADQETLMLLSQTNLYVTIMVPNNQI---ISIGADQAAADNWVNTNVLPHYPQT  120

Query  1326  MIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSF  1153
              IR VLVGNE+LS +S Q   +W  +VPAM+ I  +L    IHNIKVGTP+AMD+L +SF
Sbjct  121   RIRFVLVGNEILSYNSDQDKQIWANLVPAMRKIVNSLRARGIHNIKVGTPLAMDVLRSSF  180

Query  1152  PPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGND  973
             PPS+G FR ++    V+LPLL FLN T S+FFLDVYPYF WS +P N  LDFALF   ++
Sbjct  181   PPSNGTFREEVAAP-VMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDFALFE--SN  237

Query  972   TVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNA  793
             +   D +TGLVYTNLLDQMLDSV+FAM  LG+ +VR+AISETGWPN+GD+D+ GA++ NA
Sbjct  238   STYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNVRLAISETGWPNSGDIDETGANIFNA  297

Query  792   AAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVY  613
             A YNRNL+ KM  +PPLGTPAR G  IPTF+FSL++EN+K G GTERHWGIL P G  +Y
Sbjct  298   ATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERHWGILNPNGTQIY  357

Query  612   ELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDL  433
             +++L+   P +    LP+P+NN P++GN+WCV   G    +LG ALDFAC   N TC  L
Sbjct  358   DIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDFACGRSNATCAAL  417

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             APG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  418   APGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNEQCKFPSV  474



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   514 bits (1325),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 261/477 (55%), Positives = 332/477 (70%), Gaps = 22/477 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLP--------------SSNIGINYGRVGNDLPSAYETIETLKAMRV  1507
             FAL  FTL+A S+                 +S IGINYGR+GN+LPS Y++I  +K+++ 
Sbjct  4     FALFIFTLVALSSSCSYAIGPQNNKTLLSLASRIGINYGRLGNNLPSPYQSINLVKSIKA  63

Query  1506  SQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGT  1327
               VK+YD+D E L LLS T + VTIMV N  I    S     AAA  WV+ NVL   P T
Sbjct  64    GHVKLYDADQETLMLLSQTNLYVTIMVPNNQI---ISIGADQAAADNWVNTNVLPHYPQT  120

Query  1326  MIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSF  1153
              IR VLVGNE+LS +S Q   +W  +VPAM+ +  +L    IHNIKVGTP+AMD+L +SF
Sbjct  121   RIRFVLVGNEILSYNSDQDKQIWANLVPAMRKMVNSLRARGIHNIKVGTPLAMDVLRSSF  180

Query  1152  PPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGND  973
             PPS+G FR ++    V+LPLL FLN T S+FFLDVYPYF WS +P N  LDFALF   ++
Sbjct  181   PPSNGTFREEVAAP-VMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDFALFE--SN  237

Query  972   TVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNA  793
             +   D +TGLVYTNLLDQMLDSV+FAM  LG+ +VR+AISETGWPN+GD+D+ GA++ NA
Sbjct  238   STYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNVRLAISETGWPNSGDIDETGANIFNA  297

Query  792   AAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVY  613
             A YNRNL+ KM  +PPLGTPAR G  IPTF+FSL++ENRK G GTERHWGIL P G  +Y
Sbjct  298   ATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENRKPGSGTERHWGILNPDGTQIY  357

Query  612   ELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDL  433
             +++L+   P +    LP+P+NN P++GN+WCV   G    +LG ALDFAC   N TC  L
Sbjct  358   DIDLSGTRPVSSLGSLPKPNNNVPFKGNVWCVAVEGANETELGQALDFACGRSNATCAAL  417

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             APG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  418   APGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNEQCKFPSV  474



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 ref|XP_004167264.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   514 bits (1323),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 326/445 (73%), Gaps = 6/445 (1%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S+ +GINYG++GN+LP    ++  +K++    VKIYD++ +ILK L  T +RV++MV NE
Sbjct  23    STLVGINYGQLGNNLPPPSHSVNLIKSLNAQIVKIYDANPQILKALKNTDLRVSVMVPNE  82

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    + ++    A +WV  N+L F P T IR +LVGNE++S +  Q+ W  +VPAM+ 
Sbjct  83    LI---INISSSQNLADQWVRTNILPFYPQTKIRYLLVGNEIISSTGNQT-WFSLVPAMRR  138

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             IK +L  + IH +KVGTP AMD+L++SFPPS+G FRADI  D+V+ P+L FLNRT+S+FF
Sbjct  139   IKHSLKTYGIHKVKVGTPSAMDVLQSSFPPSNGTFRADI-ADRVMRPMLQFLNRTKSFFF  197

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             LDVYPYF WS +  N+ LD+ALF   N T   D  +GLVYTNL DQM+DSV+FAM+ LGF
Sbjct  198   LDVYPYFPWSSDSVNIKLDYALFESKNITYS-DPVSGLVYTNLFDQMVDSVIFAMKRLGF  256

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
              D+R+ I+ETGWPN GD DQ GAS+HNAA YNRN+V ++   PP+GTPARPG  +PT IF
Sbjct  257   PDIRVFIAETGWPNGGDYDQIGASIHNAAVYNRNIVKRVTSKPPVGTPARPGRMLPTIIF  316

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SLY+EN+K GPGTERH+G+L P G  VYE++L+ +  ET++ PLPE + N PY+G +WCV
Sbjct  317   SLYNENQKPGPGTERHFGLLYPKGKAVYEMDLSGSRAETKFKPLPEAERNEPYKGKIWCV  376

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
             V  G+ + D+  AL +AC+ GN TC+ +  GG CYEP S+  HA++AFSS+WA++R  G 
Sbjct  377   VGKGVNMSDVVGALSYACSQGNKTCEPIRKGGPCYEPDSLKRHASFAFSSYWAQFRKVGG  436

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
             +CYFNGLAT T  DPS+G CK PSV
Sbjct  437   TCYFNGLATQTIKDPSYGKCKFPSV  461



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   512 bits (1319),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 248/457 (54%), Positives = 328/457 (72%), Gaps = 7/457 (2%)
 Frame = -3

Query  1626  TLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTY  1447
             T+ + + G   + +G+NYG +G+DLPSA  +I  L+++R   VKIYD++  IL+ L+GT 
Sbjct  14    TIPSPAQGGSFAKLGVNYGTLGDDLPSAARSIGFLQSLRAGAVKIYDANPAILRALAGTR  73

Query  1446  IRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSL  1267
             +RV+IMV N+  P+LA+N + + A   W+  N+L F P   IR +LVGNEVLSD S +S 
Sbjct  74    LRVSIMVPNQVFPSLAANRSLADA---WLAANLLPFYPQARIRFLLVGNEVLSDYSVKSS  130

Query  1266  WLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLN  1087
             W  +VPAM N+ +AL   +I ++KVGT +AMD L+TSFPPS+G FR DI    V+ PLL 
Sbjct  131   WPSLVPAMANLHRALRARSIRDVKVGTTLAMDSLKTSFPPSAGEFRDDIA-GTVIRPLLR  189

Query  1086  FLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDS  907
             F NRTRS++F+DVYPYF+W+ +P  VSLD+ALFRG + T  +D  T L YTNLLDQMLDS
Sbjct  190   FANRTRSFYFVDVYPYFAWASSPSTVSLDYALFRGNSATNYLDPGTHLTYTNLLDQMLDS  249

Query  906   VVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPAR  727
             VV AM  LGF  VR+AI+ETGWPN GDLDQ GA+++NAA YNRNL  ++ + P LGTPAR
Sbjct  250   VVAAMAKLGFGGVRLAIAETGWPNAGDLDQIGANIYNAATYNRNLARRLSKRPALGTPAR  309

Query  726   PGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNN  547
             PG  +P F+F+LY+EN+K GPGTERHWG+L P    VYE++LT   P+  Y PLP P+NN
Sbjct  310   PGAVMPVFVFALYNENQKPGPGTERHWGLLYPNATRVYEVDLTGRRPDASYGPLPAPENN  369

Query  546   RPYEGNLWCVVATGIR---ILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYA  376
              PY+G +WCV   G +     ++G A+ +AC  G GTCD + PGG CY P S  AHA+YA
Sbjct  370   EPYKGKIWCVFGGGKKGANATEVGAAIAYACGQGKGTCDAIQPGGPCYRPASPTAHASYA  429

Query  375   FSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             F+S+W ++R +G +CYFNGLA  T  DPSHG+CK PS
Sbjct  430   FNSYWQQFRRSGGTCYFNGLAVQTAQDPSHGSCKYPS  466



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   512 bits (1318),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/464 (54%), Positives = 336/464 (72%), Gaps = 8/464 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSN-IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEI  1471
              F L  F LL S+     SN IGIN+G +GN+LP    T+E +K+++  +VKIY +D EI
Sbjct  5     FFPLFVFALLFSTCSSEISNKIGINWGTLGNNLPPPPHTVELIKSLKAKRVKIYSADQEI  64

Query  1470  LKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL  1291
             L  L  T I+V+IM+ NE IP ++ + + S     WV +NV+ FLP   IR +LVGNE+L
Sbjct  65    LTALKNTDIQVSIMLPNELIPNVSKSQHFS---DHWVKNNVVRFLPDVKIRYLLVGNEIL  121

Query  1290  SDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             ++    + W  +VPAM+ IK +L  + IH +KVGTP A+++LE+SFPPS+G FR+DI  D
Sbjct  122   TNPDVGT-WFNLVPAMRRIKCSLRAYKIHKVKVGTPSALNVLESSFPPSNGTFRSDI-AD  179

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              ++ P+L FLNRT+S+FFLDVYPYF+W++NP +++LD+ALF+  N TV  D  T L YTN
Sbjct  180   PIMRPMLQFLNRTKSFFFLDVYPYFAWADNPVDINLDYALFKATNITVT-DPVTKLTYTN  238

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             L DQM+D+V+FAM+ LG+ D+RI I+ETGWPN GD+DQ GA+++NAA YNRN+V ++   
Sbjct  239   LFDQMIDAVIFAMKRLGYPDIRIFIAETGWPNNGDIDQIGANIYNAATYNRNVVKRLTAK  298

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-  574
             P +GTPARPG  IP+FIF++Y+EN+K GPGTERH+G+L P G  VY+++L+    E+EY 
Sbjct  299   PAIGTPARPGSVIPSFIFAMYNENQKPGPGTERHFGLLYPNGSKVYDIDLSGEKTESEYT  358

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
              PLP P NN PY G +WCVVA G     LG AL +AC+ GN TCD + PG  C++P S++
Sbjct  359   KPLPAPINNAPYTGKIWCVVAKGANRTALGDALGYACSQGNKTCDPIQPGKKCFKPDSVV  418

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
              HA+YAFSSFWA+ R  GA+CYFNGLAT TT DPS G CK PSV
Sbjct  419   WHASYAFSSFWAQMRQAGATCYFNGLATQTTKDPSFGHCKFPSV  462



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   511 bits (1317),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 247/454 (54%), Positives = 326/454 (72%), Gaps = 7/454 (2%)
 Frame = -3

Query  1617  ASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRV  1438
              ++ G   + +G+NYG +G+DLPSA  +I  L+++R   VKIYD++  IL+ L+GT +RV
Sbjct  20    GTAQGGSFAKLGVNYGTLGDDLPSAARSIGFLQSLRAGAVKIYDANPAILRALAGTRLRV  79

Query  1437  TIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQ  1258
             +IMV N+  P+LA+N + + A   W+  N+L F P   IR +LVGNEVLSD S +S W  
Sbjct  80    SIMVPNQVFPSLAANRSLADA---WLAANLLPFYPQARIRFLLVGNEVLSDYSVKSSWPS  136

Query  1257  MVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLN  1078
             +VPAM N+ +AL   +I ++KVGT +AMD L+TSFPPS+G FR DI    V+ PLL F N
Sbjct  137   LVPAMANLHRALRARSIRDVKVGTTLAMDSLKTSFPPSAGEFRDDIA-GTVIRPLLRFAN  195

Query  1077  RTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVF  898
             RTRS++F+DVYPYF+W+ +P  VSLD+ALFRG + T  +D  T L YTNLLDQMLDSVV 
Sbjct  196   RTRSFYFVDVYPYFAWASSPSTVSLDYALFRGNSATNYLDPGTHLTYTNLLDQMLDSVVA  255

Query  897   AMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGV  718
             AM  LGF  VR+AI+ETGWPN GDLDQ GA+++NAA YNRNL  ++ + P LGTPARPG 
Sbjct  256   AMAKLGFGGVRLAIAETGWPNAGDLDQIGANIYNAATYNRNLARRLSKRPALGTPARPGA  315

Query  717   AIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPY  538
              +P F+F+LY+EN+K GPGTERHWG+L P    VYE++LT   P+  Y PLP P+NN PY
Sbjct  316   VMPVFVFALYNENQKPGPGTERHWGLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPY  375

Query  537   EGNLWCVVATGIR---ILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
             +G +WCV   G +     ++G A+ +AC  G GTCD + PGG CY P S  AHA+YAF+S
Sbjct  376   KGKIWCVFGGGKKGANATEVGAAIAYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNS  435

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +W ++R +G +CYFNGLA  T  DPSHG+CK PS
Sbjct  436   YWQQFRRSGGTCYFNGLAVQTAQDPSHGSCKYPS  469



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score =   509 bits (1311),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 246/455 (54%), Positives = 331/455 (73%), Gaps = 8/455 (2%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             +  + F+L+  S+   SS IGINYG++GN+LP+    IE + +MRV +VK+YD++HEIL 
Sbjct  9     YLFLCFSLILISDAEISSKIGINYGQLGNNLPAPNLAIEMMNSMRVGRVKLYDANHEILS  68

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
              LS T  +V+IM+ N +I   +   N    A +W+ +N+L F P TMIR +LVGNEVLS 
Sbjct  69    NLSKTKFQVSIMIPNNEI---SGIANNQTRADQWILNNLLPFYPQTMIRFILVGNEVLSL  125

Query  1284  SSA--QSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
              S   + +W  +VPAM+ I  +L  +N+  I+VGTPVAMD+LET+FPPS G FR+DI R 
Sbjct  126   DSDIDRQVWNDLVPAMRRIWSSLKANNLQIIRVGTPVAMDVLETTFPPSRGTFRSDIQR-  184

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              V+ P+L+FLN TRS+FF +VYPYF+W+ +P N++LDFALF G  + +  D  +GLVYTN
Sbjct  185   TVVAPMLDFLNETRSFFFANVYPYFAWAADPMNINLDFALFNGNFEQI--DGGSGLVYTN  242

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             LLD+MLDS++FAM  LG+ D+R+ ISETGWP  GD++QPGA++ NAA YNRNLV ++   
Sbjct  243   LLDEMLDSLIFAMAKLGYPDIRLVISETGWPTAGDMEQPGANLLNAATYNRNLVKRITAK  302

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP  571
             P +GTPARP V IPTFIFSL+DEN+K G GTERHWG+L   G P Y+++LT      EY 
Sbjct  303   PTVGTPARPKVVIPTFIFSLFDENQKPGSGTERHWGLLSSDGSPNYQIDLTGKESSVEYD  362

Query  570   PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
             PLP  +NN P+ G LWCV A G+ +++LG  +D  C  G+GTC+ L+PG +CYEPVS+  
Sbjct  363   PLPVVENNMPFRGRLWCVAARGVDLMELGATVDDVCGRGDGTCEALSPGRECYEPVSVYW  422

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSH  286
             HA+YAFSS+W+K+RS GASCYFNGLA  TT DP+ 
Sbjct  423   HASYAFSSYWSKFRSQGASCYFNGLAEQTTTDPNR  457



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   508 bits (1309),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 246/465 (53%), Positives = 330/465 (71%), Gaps = 10/465 (2%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
               LIFF +  SS    S  +G+NYG +GN+LP   +++E +K+++  +VK+Y+ D EILK
Sbjct  6     LCLIFFFVFLSSAAAFSPKVGVNYGTLGNNLPKPSKSVELIKSLKAGRVKLYNPDPEILK  65

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS-  1288
              L+GT I+V+IMV NE I   ++ +     A  WVH N++ + P T+IR +LVGNE+LS 
Sbjct  66    ALNGTNIQVSIMVPNEII---SNISTNQTMANEWVHKNLVAYYPHTLIRYLLVGNEILSL  122

Query  1287  -DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
                + +  W  +VPAM+ ++ AL +H I  +KVGT +AMD+LE+SFPPS+G FR+DI   
Sbjct  123   MGEADKKTWHDLVPAMRKLQYALKIHGIRKVKVGTTMAMDVLESSFPPSNGTFRSDIAVS  182

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              V+ PLL FLN T+S+FF+D YPYF+WS+N  ++SLD+ALF+GG      D  + L YTN
Sbjct  183   -VMRPLLQFLNNTKSFFFIDCYPYFAWSQNYQSISLDYALFKGG--VTYKDPVSKLTYTN  239

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             LLDQMLDSV FAM+ LG+ D+RI I+ETGWPN GD+DQ GA+V+NAA YNRNLV ++   
Sbjct  240   LLDQMLDSVHFAMKKLGYPDIRIWIAETGWPNGGDIDQIGANVYNAATYNRNLVQRLNAK  299

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP  571
             P +GTPA PGV +PTFIF+L++EN+K G GTERHWG+  PT   VY ++LT       YP
Sbjct  300   PLVGTPAMPGVVLPTFIFALFNENQKGGQGTERHWGLFYPTEAHVYPIDLTGETDLASYP  359

Query  570   PLPEPDNNRPYEGNLWCVV--ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSI  397
              LP+P NN PY+G +WCVV  A G  +  LG A+ +AC  GNGTC  + P G CY P S+
Sbjct  360   ALPKPKNNEPYKGKIWCVVAEAKGANMTALGDAVTYACGQGNGTCAAIQPKGLCYNPKSL  419

Query  396   LAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             + HANYAFSS+WA+++S GA+C+FNGLA  TT DPSHG CK PSV
Sbjct  420   IYHANYAFSSYWAQFKSQGATCFFNGLAVQTTKDPSHGKCKYPSV  464



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score =   509 bits (1310),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 261/455 (57%), Positives = 320/455 (70%), Gaps = 16/455 (4%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S  +GI+YGR G++LPS Y++I  +K++    VK+YD+D E L LLS T +RVTIMV+N 
Sbjct  39    SGRVGISYGRQGDNLPSPYKSINLIKSVNAGHVKLYDADPETLILLSQTNLRVTIMVQNH  98

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS---DSSAQSLWLQMVPA  1246
             DI    S  +   AA  WV  NVL + P T+IR VLVGNEVLS       + +W  +VPA
Sbjct  99    DI---VSIGSDQRAADDWVRTNVLPYYPRTLIRFVLVGNEVLSYYNTDQDRDIWRNLVPA  155

Query  1245  MKNIKKALNLHNIHNIKVGTPVAMDILE--TSFPPSSGRFRADIPRDQVLLPLLNFLNRT  1072
             M+ I K+L    IHN+KVGTP+AMD+L+  T+FPPSSG FR DI    V+LPLL FLN T
Sbjct  156   MRKIVKSLRAQGIHNVKVGTPLAMDVLQSATTFPPSSGTFRDDIAF-PVMLPLLKFLNGT  214

Query  1071  RSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAM  892
              S+FF+DVYPYF WS +P N  LDFALF G  +T   D +TGLVY+NLLDQMLDSV+ AM
Sbjct  215   NSFFFIDVYPYFPWSSDPVNTGLDFALFEG--NTTYTDPKTGLVYSNLLDQMLDSVISAM  272

Query  891   QYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAI  712
               LG+  +R+AIS TGWPN+GD+D+ GASV NAA YNRNL+ KM  DPP+GTPARPG  I
Sbjct  273   SNLGYPSIRLAISGTGWPNSGDIDEIGASVRNAATYNRNLIKKMTADPPIGTPARPGSVI  332

Query  711   PTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNR----  544
             PTF+FSL+DENRK GPGTERHWGILRP+G PVYE++ T   P + Y P  +P N      
Sbjct  333   PTFVFSLFDENRKPGPGTERHWGILRPSGTPVYEIDFTGRKPVSGYGPPAKPGNGGVGVA  392

Query  543   -PYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
                +   WCVV  G  +  LG AL FAC   N TC  LAPG +CY+PV+I  HA+YAFSS
Sbjct  393   PCKKRRAWCVVKEGADVAALGQALGFACGRSNETCSALAPGRECYQPVTITWHASYAFSS  452

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +WA++RS  A CYFNGLA  TTVDP +G CK PSV
Sbjct  453   YWAQFRSQNARCYFNGLARETTVDPGNGRCKFPSV  487



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   508 bits (1308),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 263/484 (54%), Positives = 332/484 (69%), Gaps = 24/484 (5%)
 Frame = -3

Query  1659  MQKPI--FALIFFTLLASSN------GLP--------SSNIGINYGRVGNDLPSAYETIE  1528
             M  P+  FAL FFTL+  S+      G P        +S IGINYGR GN+LPS Y++I 
Sbjct  1     MSSPMASFALFFFTLIVLSSSCRYAIGSPNNKTFLSLASRIGINYGRFGNNLPSPYQSIN  60

Query  1527  TLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNV  1348
              +K++    VK+YD+D E L +LS T + VTIMV N  I          AAA  WV+ NV
Sbjct  61    LIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPNNHI---IPIGADQAAADNWVNTNV  117

Query  1347  LEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAM  1174
             L   P T IR VLVGNE+LS++S Q    W  +VPAM+ I  +L    IHNIKVGTP+AM
Sbjct  118   LAHYPQTKIRFVLVGNEILSNNSDQDKQTWSSLVPAMRKIVTSLRARGIHNIKVGTPLAM  177

Query  1173  DILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFA  994
             D+L TSFPPSSG FR ++    V+LPLL FLN T S+FFLDVYPYF WS +P N  LDFA
Sbjct  178   DVLRTSFPPSSGAFREEV-AALVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNPLDFA  236

Query  993   LFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQP  814
             LF+  +++   D +TGLVYTNLLDQMLDSV+FAM  LG+ +VR+AISETGWPN+GD+D+ 
Sbjct  237   LFQ--SNSTYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNVRLAISETGWPNSGDIDET  294

Query  813   GASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILR  634
             GA++ NAA YNRNL+ KM  +PPLGTPARPG  IPTF+FSL++EN+K G GTERHWGIL+
Sbjct  295   GANILNAATYNRNLIKKMTANPPLGTPARPGSPIPTFLFSLFNENQKPGSGTERHWGILK  354

Query  633   PTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAG  454
             P G  +YE++ +   P      LP+P NN P++GN+WCV   G    +L  AL+FAC   
Sbjct  355   PDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQALNFACGQS  414

Query  453   NGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACK  274
             N TC  LAPG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  C 
Sbjct  415   NATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNEHCT  474

Query  273   VPSV  262
              PSV
Sbjct  475   FPSV  478



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   507 bits (1306),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 327/450 (73%), Gaps = 6/450 (1%)
 Frame = -3

Query  1611  SNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTI  1432
             S+G  SS +G+NYG++GN+LPS  ++++ ++++R  +VKIYD++H+IL  L GT ++V I
Sbjct  16    SSGEFSSQVGVNYGQLGNNLPSPKQSVKLIQSLRAKRVKIYDANHDILNALKGTNLQVCI  75

Query  1431  MVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMV  1252
             MV NE I    + +     A  WV  NV+ F   T IR +LVGNEV+S  S + +W  +V
Sbjct  76    MVPNEII---NNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVIS-GSPKDIWPNIV  131

Query  1251  PAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRT  1072
             PAM+ IKK+L  H +  IKV T +AMD+LE+SFPPS+G FR+DI  D ++ PLL FL+RT
Sbjct  132   PAMRKIKKSLKAHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDI-ADSIVRPLLQFLHRT  190

Query  1071  RSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAM  892
             +S++FLDVYPYF+W  +P N++LD+ALF         D  + L YTNL DQM+DSVVFAM
Sbjct  191   KSFYFLDVYPYFAWVMDPKNINLDYALFES-RTIKYTDPVSNLTYTNLFDQMVDSVVFAM  249

Query  891   QYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAI  712
             + LG+ D+RI I+ETGWPN GD+DQ GA+++NAA YNRN+V K+   PP+GTPARPG  I
Sbjct  250   KRLGYPDIRIWIAETGWPNAGDIDQIGANIYNAATYNRNVVKKLTAKPPIGTPARPGWVI  309

Query  711   PTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEG  532
             P+ IF+LY+EN+K GPGTERH+G+L P G  VY ++L+   P++ + PLP+PDNN PY+G
Sbjct  310   PSLIFALYNENQKPGPGTERHFGLLYPNGTNVYGIDLSGKTPDSCFEPLPKPDNNEPYKG  369

Query  531   NLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
              +WCV A G+    L  AL +AC+ GN TCD + PG  C++P S+  HA+YAFSS+W++Y
Sbjct  370   KIWCVAAKGVNETALSSALSYACSQGNKTCDPIQPGKKCFKPDSLFWHASYAFSSYWSQY  429

Query  351   RSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             R TGA+CYFNGLAT T  DPS G CK PSV
Sbjct  430   RKTGATCYFNGLATQTAKDPSFGHCKFPSV  459



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 260/475 (55%), Positives = 330/475 (69%), Gaps = 20/475 (4%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLP------------SSNIGINYGRVGNDLPSAYETIETLKAMRVSQ  1501
             FAL  FTLL  S+               +S IGINYGR+GN+LPS Y++I  +K+++   
Sbjct  4     FALFLFTLLVLSSSCCYAIGNNKTLLSLASRIGINYGRLGNNLPSPYQSINLIKSLKAGH  63

Query  1500  VKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMI  1321
             VK+YD+D E LKLLS T + VTIMV N  I    S  +  AAA  WV+ NVL + P T I
Sbjct  64    VKLYDADPETLKLLSQTNLYVTIMVPNNQI---ISVGSDKAAADNWVNTNVLPYHPQTRI  120

Query  1320  RGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPP  1147
             R VLVGNE+LS SS Q   +W  +VPAM+ I  +L    IHNIKVGTP+AMD+L +SFPP
Sbjct  121   RFVLVGNEILSYSSDQDKQIWSNLVPAMRKIVNSLRARGIHNIKVGTPLAMDVLRSSFPP  180

Query  1146  SSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTV  967
             SSG FR +I    V+ PLL FLN T S+FFLDVYPYF WS +P N  LD+ALF   +++ 
Sbjct  181   SSGTFREEI-TAPVISPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDYALFE--SNST  237

Query  966   VVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAA  787
               D ++GLVYTNLLDQMLDSV+FAM  LG+ ++R+AISETGWPN GD+D+ GA+V NAA 
Sbjct  238   YTDPQSGLVYTNLLDQMLDSVIFAMTKLGYPNIRLAISETGWPNAGDIDETGANVPNAAT  297

Query  786   YNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYEL  607
             YNRNL+ KM  +PPLGTPAR G  IPTF+FSL++EN+K G GTERHWGIL P G  +YE+
Sbjct  298   YNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTRIYEI  357

Query  606   NLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAP  427
             + +       +  +P+P NN P++GN+WCVV  G    +LG AL+FAC   N TC  LAP
Sbjct  358   DFSGTRQVNSFGSMPKPSNNVPFKGNVWCVVVEGASEAELGQALEFACGRSNVTCAALAP  417

Query  426   GGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             G +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  418   GRECYAPVSVTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNERCKFPSV  472



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   507 bits (1306),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 260/477 (55%), Positives = 330/477 (69%), Gaps = 24/477 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLP--------------SSNIGINYGRVGNDLPSAYETIETLKAMRV  1507
             FAL  FTLL  S+                 +S IGINYG++GN+LPS Y++I  +K+++ 
Sbjct  4     FALFLFTLLVLSSSCCYAIGSQSNRTVLALASRIGINYGKLGNNLPSPYQSINLIKSLKA  63

Query  1506  SQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGT  1327
               VK+YD+D E LKLLS T + VTIMV N+ I    S     A A  WV  NVL F P T
Sbjct  64    GHVKLYDADPETLKLLSKTNLYVTIMVPNDQI---ISIGADQATADNWVATNVLPFYPQT  120

Query  1326  MIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSF  1153
              IR VLVGNE+LS SS Q   +W  +VPAM+ +  +L +  IHNIKVGTP+AMD L +SF
Sbjct  121   RIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRVRGIHNIKVGTPLAMDALRSSF  180

Query  1152  PPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGND  973
             PPSSG FR DI    V+LPLL FLN T S+FFLDVYPYF WS +P N  LD+ALF   ++
Sbjct  181   PPSSGAFREDIAV-PVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDYALFE--SN  237

Query  972   TVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNA  793
             +  +D +TGLVYTNLLDQMLDSV+FAM  LG+ DVR+AISETGWPN GD+ + GA++ NA
Sbjct  238   STYIDPQTGLVYTNLLDQMLDSVIFAMTKLGYPDVRLAISETGWPNAGDILETGANILNA  297

Query  792   AAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVY  613
             A YNRNL+ K+  +PPLGTPAR G  IPTF+FSL++EN+K G GTERHWGIL   G P+Y
Sbjct  298   ATYNRNLIKKLTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILNHDGTPIY  357

Query  612   ELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDL  433
             E++ +  +  + +  LP+P NN P++GN+WCV   G    +LG AL+FAC   N TC  L
Sbjct  358   EIDFSGTI--SSFDKLPKPSNNVPFKGNVWCVAVDGAGEAELGQALNFACGRSNETCAAL  415

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             APG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  416   APGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSV  472



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   506 bits (1304),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/445 (53%), Positives = 323/445 (73%), Gaps = 6/445 (1%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS +GINYG++GN+LPS   ++  +K++    VKIYD++ +IL  L  T +RV++MV NE
Sbjct  23    SSLVGINYGQLGNNLPSPSHSVNLIKSLNAQIVKIYDANPQILNALKNTDLRVSVMVPNE  82

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    + ++    A +WV  N+L F P   IR +LVGNE++S +  Q+ W  +VPAM+ 
Sbjct  83    LI---INISSNQNLADQWVRTNILPFYPQIKIRYLLVGNEIISSTGNQT-WFSLVPAMRR  138

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             IK +L  + IH +KVGT  AMD+L++SFPPS+G FR DI  D+V+ P+L FLNRT+S++F
Sbjct  139   IKHSLKTYGIHKVKVGTSSAMDVLQSSFPPSNGTFREDIA-DRVMRPMLQFLNRTKSFYF  197

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             LDVYPYF WS +  N+ LD+ALF   N T   D  +GLVYTNL DQM+DSV+FAM+ LGF
Sbjct  198   LDVYPYFPWSSDSVNIKLDYALFESKNITYS-DPVSGLVYTNLFDQMVDSVIFAMKRLGF  256

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
              D+R+ I+ETGWPN GD DQ GA++HNAA YNRN+V +M   PP+GTPARPG  +PT IF
Sbjct  257   PDIRVFIAETGWPNGGDYDQIGANIHNAAVYNRNIVKRMTSKPPVGTPARPGRVLPTIIF  316

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SLY+EN K GPGTERH+G+L P+G  VYE++L+ +  ET++ PLPE + N PY+G +WCV
Sbjct  317   SLYNENEKGGPGTERHFGLLYPSGKAVYEMDLSGSTAETKFKPLPEAETNEPYKGRIWCV  376

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
             V  G+ + ++  AL +AC+ GN TC+ +  GG CYEP S+  HA++AFSS+WA++R  G 
Sbjct  377   VGKGVNMSEVVGALSYACSQGNKTCEPIRKGGPCYEPDSLKRHASFAFSSYWAQFRKIGG  436

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
             +CYFNGLAT T  DPS+G CK PSV
Sbjct  437   TCYFNGLATQTIKDPSYGKCKFPSV  461



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   506 bits (1303),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 260/477 (55%), Positives = 325/477 (68%), Gaps = 22/477 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLP--------------SSNIGINYGRVGNDLPSAYETIETLKAMRV  1507
             FAL   TLL  SN                 +S IGINYG++GN+LPS Y++I  +K+++ 
Sbjct  4     FALFLLTLLVISNSCCYAIGSQSNRTVLALASRIGINYGKLGNNLPSPYQSINLIKSLKA  63

Query  1506  SQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGT  1327
               VK+YD+D E LKLLS T + VTIMV N+ I    S     A A  W+  NVL F P T
Sbjct  64    GHVKLYDADPETLKLLSKTNLYVTIMVPNDQI---ISIGADQATADNWIATNVLPFSPQT  120

Query  1326  MIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSF  1153
              IR VLVGNE+LS SS Q   +W  +VPAM+ +  +L    IHNIKVGTP+AMD L +SF
Sbjct  121   RIRFVLVGNEILSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSF  180

Query  1152  PPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGND  973
             PPSSG FR DI    V+LPLL FLN T S+FFLDVYPYF WS +P N  LD+ALF    +
Sbjct  181   PPSSGAFREDIAV-PVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDYALFEP--N  237

Query  972   TVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNA  793
             +   D +TGLVYTNLLDQMLDSV+FAM  LG+ DVR+AISETGWPN GD+ + GA++ NA
Sbjct  238   STYTDPQTGLVYTNLLDQMLDSVIFAMAKLGYPDVRLAISETGWPNAGDIHETGANILNA  297

Query  792   AAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVY  613
             A YNRNL+ KM  +PPLGTPAR G  IPTF+FSL++EN+K G GTERHWGIL   G P+Y
Sbjct  298   ATYNRNLIKKMTANPPLGTPARRGAPIPTFLFSLFNENQKPGSGTERHWGILDHDGTPIY  357

Query  612   ELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDL  433
             E++ +     + +  LP+P NN P++GN+WCV   G    +LG AL+FAC   N TC  L
Sbjct  358   EIDFSGTRSVSSFDKLPKPSNNVPFKGNVWCVAVDGAGEAELGQALNFACGRSNETCAAL  417

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             APG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  418   APGRECYAPVSVSWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSV  474



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   505 bits (1300),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 259/482 (54%), Positives = 331/482 (69%), Gaps = 22/482 (5%)
 Frame = -3

Query  1659  MQKPI--FALIFFTL--LASSNGLP----------SSNIGINYGRVGNDLPSAYETIETL  1522
             M  P+  FAL  FTL  L+SS+             +S IGI+YGR GN+LPS Y++I  +
Sbjct  1     MSSPMAYFALFLFTLIVLSSSSCYAIGNNRTLSSLASRIGISYGRSGNNLPSPYQSINLI  60

Query  1521  KAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLE  1342
             K ++   VK+YD+D E L LLS T + VTIMV N  I    +      AA  WV+ NVL 
Sbjct  61    KTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQI---ITIGADQTAADNWVNTNVLP  117

Query  1341  FLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDI  1168
               P T IR VLVGNE+LS +S Q    W  +VPAM+ I  +L    IHNIKVGTP+AMD+
Sbjct  118   HYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPLAMDV  177

Query  1167  LETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALF  988
             L +S+PPSSG FR ++    V+LPLL FLN T S+FFLDVYPYF WS +P N  L FALF
Sbjct  178   LRSSYPPSSGAFREEVAA-LVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNDLGFALF  236

Query  987   RGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGA  808
                +++   D +TGLVYTNLLDQMLDSV+FAM  LG+ ++ +AISETGWPN+GD+D+ GA
Sbjct  237   E--SNSTYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNISLAISETGWPNSGDIDETGA  294

Query  807   SVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPT  628
             ++ NAA YNRNL+ KM  +PPLGTPARPG+ IPTF+FSL++EN+K G GTERHWGIL P 
Sbjct  295   NILNAATYNRNLIKKMTANPPLGTPARPGLPIPTFLFSLFNENQKPGSGTERHWGILNPD  354

Query  627   GMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNG  448
             G  +Y+++ +   P +    LP+P NN P++GN+WCVV  G    +LG ALDFAC   N 
Sbjct  355   GTQIYDIDFSGTKPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDFACGRSNE  414

Query  447   TCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             TC  LAPG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK P
Sbjct  415   TCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFP  474

Query  267   SV  262
             SV
Sbjct  475   SV  476



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 257/475 (54%), Positives = 327/475 (69%), Gaps = 20/475 (4%)
 Frame = -3

Query  1644  FALIFFTL--LASSNGLP----------SSNIGINYGRVGNDLPSAYETIETLKAMRVSQ  1501
             F L  FTL  L+SS+             +S IGI+YGR GN+LPS Y++I  +K ++   
Sbjct  4     FVLFLFTLIVLSSSSCYAIGNNKTLSSLASRIGISYGRSGNNLPSPYQSINLIKTLKAGH  63

Query  1500  VKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMI  1321
             VK+YD+D E L LLS T + VTIMV N  I    +      AA  WV+ NVL   P T I
Sbjct  64    VKLYDADQETLTLLSKTNLYVTIMVPNNQI---ITIGADQTAADNWVNTNVLPHYPQTRI  120

Query  1320  RGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPP  1147
             R VLVGNE+LS +S Q    W  +VPAM+ I  +L    IHNIKVGTP+AMD+L +S+PP
Sbjct  121   RFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPLAMDVLRSSYPP  180

Query  1146  SSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTV  967
             SSG FR ++    V+LPLL FLN T S+FFLDVYPYF WS +P N  LDFALF   +++ 
Sbjct  181   SSGAFREEVAA-PVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNDLDFALFE--SNST  237

Query  966   VVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAA  787
               D +TGLVYTNLLDQMLDSV+FAM  LG+ ++ +AISETGWPN+GD+D+ GA++ NAA 
Sbjct  238   YTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNISLAISETGWPNSGDIDETGANILNAAT  297

Query  786   YNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYEL  607
             YNRNL+ KM  +PPLGTPARPG  IPTF+FSL++EN+K G GTERHWGIL P G  +Y++
Sbjct  298   YNRNLIKKMTANPPLGTPARPGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTQIYDI  357

Query  606   NLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAP  427
             + +   P +    LP+P NN P++GN+WCVV  G    +LG ALDFAC   N TC  LAP
Sbjct  358   DFSGTRPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDFACGRSNETCAALAP  417

Query  426   GGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             G +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK PSV
Sbjct  418   GRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFPSV  472



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 259/482 (54%), Positives = 330/482 (68%), Gaps = 22/482 (5%)
 Frame = -3

Query  1659  MQKPI--FALIFFTL--LASSNGLP----------SSNIGINYGRVGNDLPSAYETIETL  1522
             M  P+  F L  FTL  L+SS+             +S IGI+YGR GN+LPS Y++I  +
Sbjct  1     MSSPMAYFVLFLFTLIVLSSSSCYAIGNNKTLSSLASRIGISYGRSGNNLPSPYQSINLI  60

Query  1521  KAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLE  1342
             K ++   VK+YD+D E L LLS T + VTIMV N  I    +      AA  WV+ NVL 
Sbjct  61    KTLKAGHVKLYDADQETLTLLSKTNLYVTIMVPNNQI---ITIGADQTAADNWVNTNVLP  117

Query  1341  FLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDI  1168
               P T IR VLVGNE+LS +S Q    W  +VPAM+ I  +L    IHNIKVGTP+AMD+
Sbjct  118   HYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAMRKIVNSLRARGIHNIKVGTPLAMDV  177

Query  1167  LETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALF  988
             L +S+PPSSG FR ++    V+LPLL FLN T S+FFLDVYPYF WS +P N  L FALF
Sbjct  178   LRSSYPPSSGAFREEVAAP-VMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNDLGFALF  236

Query  987   RGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGA  808
                +++   D +TGLVYTNLLDQMLDSV+FAM  LG+ ++ +AISETGWPN+GD+D+ GA
Sbjct  237   E--SNSTYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNISLAISETGWPNSGDIDETGA  294

Query  807   SVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPT  628
             ++ NAA YNRNL+ KM  +PPLGTPARPG+ IPTF+FSL++EN+K G GTERHWGIL P 
Sbjct  295   NILNAATYNRNLIKKMTANPPLGTPARPGLPIPTFLFSLFNENQKPGSGTERHWGILNPD  354

Query  627   GMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNG  448
             G  +YE++ +   P +    LP+P NN P++GN+WCVV  G    +LG ALDFAC   N 
Sbjct  355   GTQIYEIDFSGTRPVSSLGSLPKPSNNVPFKGNVWCVVVEGASEEELGQALDFACGRSNE  414

Query  447   TCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             TC  LAPG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  CK P
Sbjct  415   TCAALAPGRECYAPVSVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTTNPGNERCKFP  474

Query  267   SV  262
             SV
Sbjct  475   SV  476



>ref|XP_006492526.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=389

 Score =   501 bits (1290),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 239/392 (61%), Positives = 292/392 (74%), Gaps = 7/392 (2%)
 Frame = -3

Query  1431  MVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQ  1258
             MV+N +I       ++   A +WVHDNVL F P TMIR +LVGNE+LS SS +   +W  
Sbjct  1     MVQNHEI---IDIASKQKVADQWVHDNVLSFYPETMIRFILVGNEILSQSSEEYKQIWKN  57

Query  1257  MVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLN  1078
             +VPAM  IKK LN HNIHNIKVGTP+AMDI +T+FPPS+G FR+DI    V+ PLL FLN
Sbjct  58    LVPAMHRIKKCLNAHNIHNIKVGTPLAMDIFQTTFPPSNGTFRSDISAS-VMEPLLQFLN  116

Query  1077  RTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVF  898
             RT+S+FFLDVYPYF+WS NP  +SLDFAL R  N T   D  +GLVYTNLLDQMLDSV+F
Sbjct  117   RTKSFFFLDVYPYFAWSTNPKTISLDFALLRETN-TSYTDPNSGLVYTNLLDQMLDSVIF  175

Query  897   AMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGV  718
             AM  LG++D+R+AISETGWPN GD DQ GA+++NAA YNRNL+ KM   P LGTPARPG 
Sbjct  176   AMAKLGYSDIRLAISETGWPNAGDFDQIGANIYNAATYNRNLIKKMTSKPALGTPARPGS  235

Query  717   AIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPY  538
              IPTFIFSLYDEN+K GPGTERHWG+L   G+P+YE++L+     ++Y PLP   NN PY
Sbjct  236   IIPTFIFSLYDENQKTGPGTERHWGMLHGNGVPIYEIDLSGNRSLSQYRPLPLAHNNVPY  295

Query  537   EGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWA  358
             +G +WCVVA    +L L  AL +AC  GNGTCD L PG  CY+P+S+  HA+YAFSS+WA
Sbjct  296   KGKVWCVVARSADLLALTSALGYACGQGNGTCDALVPGQRCYQPLSLYWHASYAFSSYWA  355

Query  357   KYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             K+   GA+CYFNGLA  T ++PS G C+ PSV
Sbjct  356   KFMGKGATCYFNGLAQQTIINPSRGNCRFPSV  387



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   504 bits (1297),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 318/447 (71%), Gaps = 8/447 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYG++GN+LPS Y++I  +K ++   VK+YD+D E LKLLS T + VTIMV N 
Sbjct  34    ASRIGINYGKLGNNLPSPYQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPNN  93

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
              I    S     AAA  WV  NVL F P T IR VLVGNEVLS SS Q   +W  +VPAM
Sbjct  94    QI---ISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
             + +  +L    IHNIKVGTP+AMD L +SFPPSSG FR DI    ++LPLL FLN T S+
Sbjct  151   RKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAV-PMMLPLLKFLNGTNSF  209

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FFLDVYPYF WS +P N  LDFALF   +++   D +TGLVYTNLLDQMLDSV+FAM  L
Sbjct  210   FFLDVYPYFPWSTDPVNNHLDFALFE--SNSTYTDPQTGLVYTNLLDQMLDSVIFAMTKL  267

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G+ ++ +AISETGWPN GD+ + GA++ NAA YNRNL+ KM  +PPLGTPAR G  IPTF
Sbjct  268   GYPNISLAISETGWPNDGDIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTF  327

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             +FSL++EN+K G GTERHWGIL P G P+Y+++ +     + +  LP+P NN P++GN+W
Sbjct  328   LFSLFNENQKPGSGTERHWGILNPDGTPIYDIDFSGTRSFSGFDSLPKPSNNVPFKGNVW  387

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             CV   G    +LG AL+FAC   N TC  LAPGG+CY PV++  HA+YAFSS+WA++R+ 
Sbjct  388   CVAVDGADEAELGQALNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQ  447

Query  342   GASCYFNGLATMTTVDPSHGACKVPSV  262
              + CYFNGLA  TT +P +  CK PSV
Sbjct  448   SSQCYFNGLARETTTNPGNERCKFPSV  474



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   503 bits (1296),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 249/445 (56%), Positives = 317/445 (71%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N 
Sbjct  39    ASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNH  98

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S ++    A  WV  N+L + P T IR VLVGNE+LS +   ++   +VPAM+ 
Sbjct  99    QI---TSLSSNQTTADEWVRTNILPYYPQTQIRFVLVGNEILSYNYG-NVSANLVPAMRK  154

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L LH IHNIKVGTP+AMD L +SFPPS+G FR +I    V+LPLL FLN T SYFF
Sbjct  155   IVNSLRLHGIHNIKVGTPLAMDSLRSSFPPSNGTFREEI-TGPVMLPLLKFLNGTNSYFF  213

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             L+V+PYF WS+NP N SLDFALF+G  ++   D +TGLVY NLLDQMLDSV+FAM  LG+
Sbjct  214   LNVHPYFRWSKNPMNTSLDFALFQG--NSTYTDPQTGLVYRNLLDQMLDSVLFAMTKLGY  271

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +R+AISETGWPN GD+D+ GA++ NAA YNRNL+ KM   PP+GTP+RPG+ IPTF+F
Sbjct  272   PHMRLAISETGWPNFGDIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVF  331

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K GPGT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  332   SLFNENQKSGPGTQRHWGILHPDGSPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCV  391

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L   L  ACA  N TC  LAPG +CYEPVSI  HA+YA SS+WA++R+   
Sbjct  392   PVEGANETELEETLRMACAQSNTTCAALAPGRECYEPVSIYWHASYALSSYWAQFRNQSI  451

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  452   QCYFNGLAHETTTNPGNDRCKFPSV  476



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   503 bits (1294),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 260/484 (54%), Positives = 330/484 (68%), Gaps = 24/484 (5%)
 Frame = -3

Query  1659  MQKPI--FALIFFTLLASSN------GLP--------SSNIGINYGRVGNDLPSAYETIE  1528
             M  P+  FAL FFTL+  S+      G P        +S IGINYGR+GN+LPS Y++I 
Sbjct  1     MSSPMASFALFFFTLIVLSSSCRYAIGSPNNKTFLSLASRIGINYGRLGNNLPSPYQSIN  60

Query  1527  TLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNV  1348
              +K++    VK+YD+D E L +LS T + VTIMV N  I          AAA  WV+ NV
Sbjct  61    LIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPNNQI---IPIGADQAAADNWVNTNV  117

Query  1347  LEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAM  1174
             L   P T IR VLVGNE+LS++S Q    W  +VPAM+ I  +L    IHNIKVGTP+AM
Sbjct  118   LAHYPQTRIRFVLVGNEILSNNSDQDKQTWSSLVPAMRKIITSLRARGIHNIKVGTPLAM  177

Query  1173  DILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFA  994
             D+L TSFPPSSG FR ++    V+LPLL FLN T S+FFLD YPYF WS +P N  LDFA
Sbjct  178   DVLRTSFPPSSGAFREEV-AAPVMLPLLKFLNGTNSFFFLDSYPYFPWSTDPVNNPLDFA  236

Query  993   LFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQP  814
             LF+  +++   D +TGLVYTNLLDQMLDSV+FAM  LG+ +VR+AISETGWPN+GD+D+ 
Sbjct  237   LFQ--SNSTYTDPQTGLVYTNLLDQMLDSVIFAMTKLGYPNVRLAISETGWPNSGDIDET  294

Query  813   GASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILR  634
             GA++ NAA YNRNL+ KM  +PP+GTP RPG  IPTF+FSL++EN+K G GTERHWGIL 
Sbjct  295   GANILNAATYNRNLIKKMTANPPIGTPVRPGSPIPTFLFSLFNENQKPGSGTERHWGILN  354

Query  633   PTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAG  454
             P G  +YE++ +   P      LP+P NN P++GN+WCV   G    +L  AL+FAC   
Sbjct  355   PDGTQIYEIDFSGTRPVPSPGSLPKPSNNVPFKGNVWCVAVEGASEAELQQALNFACGQS  414

Query  453   NGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACK  274
             N TC  LAPG +CY PVS+  HA+YAFSS+WA++R+  + CYFNGLA  TT +P +  C 
Sbjct  415   NATCAALAPGRECYAPVSLTWHASYAFSSYWAQFRNQSSRCYFNGLARETTTNPGNEHCT  474

Query  273   VPSV  262
              PSV
Sbjct  475   FPSV  478



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 317/447 (71%), Gaps = 8/447 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYG++GN+LP  Y++I  +K ++   VK+YD+D E LKLLS T + VTIMV N 
Sbjct  34    ASRIGINYGKLGNNLPFPYQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPNN  93

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
              I    S     AAA  WV  NVL F P T IR VLVGNEVLS SS Q   +W  +VPAM
Sbjct  94    QI---ISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
             + +  +L    IHNIKVGTP+AMD L +SFPPSSG FR DI    V+LPLL FLN T S+
Sbjct  151   RKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAV-PVMLPLLKFLNGTNSF  209

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FFLDVYPYF WS +P N  LDFALF   +++   D +TGLVYTNLLDQMLDSV+FAM  L
Sbjct  210   FFLDVYPYFPWSTDPVNNHLDFALFE--SNSTYTDPQTGLVYTNLLDQMLDSVIFAMTKL  267

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G+ ++ +AISETGWPN GD+ + GA++ NAA YNRNL+ KM  +PPLGTPAR G  IPTF
Sbjct  268   GYPNISLAISETGWPNDGDIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTF  327

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             +FSL++EN+K G GTERHWGIL P G P+Y+++ +     + +  LP+P NN P++GN+W
Sbjct  328   LFSLFNENQKPGSGTERHWGILNPDGTPIYDIDFSGRRSFSGFDSLPKPSNNVPFKGNVW  387

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             CV   G    +LG AL+FAC   N TC  LAPGG+CY PV++  HA+YAFSS+WA++R+ 
Sbjct  388   CVAVDGADEAELGQALNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQ  447

Query  342   GASCYFNGLATMTTVDPSHGACKVPSV  262
              + CYFNGLA  TT +P +  CK PSV
Sbjct  448   SSQCYFNGLARETTTNPGNERCKFPSV  474



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   502 bits (1292),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 252/447 (56%), Positives = 317/447 (71%), Gaps = 8/447 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYG++GN+LP  Y++I  +K ++   VK+YD+D E LKLLS T + VTIMV N 
Sbjct  34    ASRIGINYGKLGNNLPFPYQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPNN  93

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
              I    S     AAA  WV  NVL F P T IR VLVGNEVLS SS Q   +W  +VPAM
Sbjct  94    QI---ISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAM  150

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
             + +  +L    IHNIKVGTP+AMD L +SFPPSSG FR DI    V+LPLL FLN T S+
Sbjct  151   RKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAV-PVMLPLLKFLNGTNSF  209

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FFLDVYPYF WS +P N  LDFALF   +++   D +TGLVYTNLLDQMLDSV+FAM  L
Sbjct  210   FFLDVYPYFPWSTDPVNNHLDFALFE--SNSTYTDPQTGLVYTNLLDQMLDSVIFAMTKL  267

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G+ ++ +AISETGWPN GD+ + GA++ NAA YNRNL+ KM  +PPLGTPAR G  IPTF
Sbjct  268   GYPNISLAISETGWPNDGDIHETGANIVNAATYNRNLIKKMTANPPLGTPARRGAPIPTF  327

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             +FSL++EN+K G GTERHWGIL P G P+Y+++ +     + +  LP+P NN P++GN+W
Sbjct  328   LFSLFNENQKPGSGTERHWGILNPDGTPIYDIDFSGRRSFSGFDSLPKPSNNVPFKGNVW  387

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             CV   G    +LG AL+FAC   N TC  LAPGG+CY PV++  HA+YAFSS+WA++R+ 
Sbjct  388   CVAVDGADEAELGQALNFACGRSNATCAALAPGGECYAPVTVTWHASYAFSSYWAQFRNQ  447

Query  342   GASCYFNGLATMTTVDPSHGACKVPSV  262
              + CYFNGLA  TT +P +  CK PSV
Sbjct  448   SSQCYFNGLARETTTNPGNERCKFPSV  474



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   501 bits (1289),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 333/458 (73%), Gaps = 6/458 (1%)
 Frame = -3

Query  1635  IFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLS  1456
             + F   + S G  SS +GINYG++G++LPS  ++++ ++++   +VKIYD++ +IL  L 
Sbjct  8     VLFLFFSISRGEISSQVGINYGQLGDNLPSPKQSVKLIQSLGAKRVKIYDANPDILNALK  67

Query  1455  GTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSA  1276
              T ++V+IMV N+ +    + +     A  WV  NV+ F P T IR +LVGNEV+S SS 
Sbjct  68    DTNLQVSIMVPNQLL---TNISTNQKLADSWVESNVVPFYPKTKIRYLLVGNEVIS-SSP  123

Query  1275  QSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLP  1096
             +  W  +VPAM+ +K +L +H+++ IKVGT +AMD+LE+SFPPS+G FR+DI    ++ P
Sbjct  124   KETWYSIVPAMRKLKNSLKIHSLNKIKVGTSMAMDVLESSFPPSNGTFRSDI-AGPIVKP  182

Query  1095  LLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQM  916
             +L FL+RT+S++FLDVYPYF WS  P N++LD+ALF     T   D  + L YTN+ DQM
Sbjct  183   MLQFLSRTKSFYFLDVYPYFPWSSEPKNINLDYALFESRTITYT-DPVSNLTYTNMFDQM  241

Query  915   LDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGT  736
             +DSVVFAM+ LG+ DVRI I+ETGWPN GD+DQ GA+++NAA YNRN + K+   P +GT
Sbjct  242   VDSVVFAMKKLGYPDVRIWIAETGWPNAGDIDQIGANIYNAATYNRNAIKKLTAKPAIGT  301

Query  735   PARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEP  556
             PARPG  +P+FIF+LY+EN+K GPGTERH+G+L P G  VY ++L+   P++++ PLP+P
Sbjct  302   PARPGWVLPSFIFALYNENQKPGPGTERHFGLLYPNGSNVYGIDLSGETPDSDFEPLPKP  361

Query  555   DNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYA  376
             DNN PY+G +WCV A G+   +LG AL +AC+ GN TCD + PG +C++P S++ HA+YA
Sbjct  362   DNNEPYKGKIWCVAARGVNASELGSALSYACSQGNKTCDPIQPGKECFKPDSLVWHASYA  421

Query  375   FSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             FSS+W++ + TGA+CYFNGLAT T  DPS G CK PSV
Sbjct  422   FSSYWSQLKQTGATCYFNGLATQTAKDPSFGHCKFPSV  459



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   501 bits (1290),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 232/445 (52%), Positives = 329/445 (74%), Gaps = 6/445 (1%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS +GI YG++GN+LP   ++++ +  ++ ++VKIYD++ EILK   GT I+V++MV NE
Sbjct  26    SSKVGICYGQLGNNLPLPTKSVDLINGLKANRVKIYDANPEILKAFKGTKIQVSVMVPNE  85

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    + +     A +WV  NV+ F P TMIR +LVGNE+LS+    + W  +VPA++ 
Sbjct  86    LI---NNISTNQDLADQWVKTNVVPFYPDTMIRYLLVGNEILSNP-PNTTWFNLVPAIRK  141

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I+ ++    +  IKVGTP+A+D+LE+SFPPS+G FR+DI  ++V++PLL+FLNRT+S+FF
Sbjct  142   IRYSVKKFGLGKIKVGTPLAIDMLESSFPPSNGTFRSDI-SEKVMIPLLHFLNRTKSFFF  200

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +DVYPYF+W+  P  ++LD+AL    N TV  D  +GL YTNLLDQM+D+V FAM+ +G+
Sbjct  201   IDVYPYFAWAAQPTVINLDYALLESKNITVT-DPVSGLTYTNLLDQMIDAVYFAMKRVGY  259

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
              DVR+ I+ETGWPN G++DQ GAS++NAA YNRN++ K    PP+GTPA+PGV +PT +F
Sbjct  260   PDVRLFIAETGWPNAGNVDQIGASIYNAATYNRNVIKKFTAKPPVGTPAKPGVIVPTLLF  319

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             +LY+EN+K GPGTERH+G+L P G  +YE++L+   P +EY PLP P NN PY+G +WCV
Sbjct  320   ALYNENQKPGPGTERHFGLLYPNGTNIYEIDLSGKTPLSEYEPLPRPRNNEPYKGKIWCV  379

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
             V     + ++  AL +AC  GN TCD++ PGG CY+P S++ HANYAFSS+WA+++S G 
Sbjct  380   VGRKASVTEVSGALAYACGQGNRTCDEIRPGGKCYKPNSLVLHANYAFSSYWAQFKSAGG  439

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
             +CYFNGLA  T  DPS+GACK PSV
Sbjct  440   TCYFNGLAIPTKSDPSYGACKFPSV  464



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   501 bits (1290),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 256/477 (54%), Positives = 328/477 (69%), Gaps = 22/477 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPS--------------SNIGINYGRVGNDLPSAYETIETLKAMRV  1507
             FAL  FT L  S+   S              S IGINYG++GN+LPS Y++I  +K ++ 
Sbjct  4     FALFLFTFLVLSSSCFSAIGSQNNRTVLALASRIGINYGKLGNNLPSPYQSINLIKTLKA  63

Query  1506  SQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGT  1327
               VK+YD+D E LKLLS T + VTIMV N  I    S     AAA  WV  NVL + P T
Sbjct  64    GHVKLYDADPETLKLLSKTNLYVTIMVPNNQI---ISIGADQAAADNWVATNVLPYYPQT  120

Query  1326  MIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSF  1153
              IR VLVGNE+LS ++ Q   +W  +VPAM+ +  +L    IHNIKVGTP+AMD L +SF
Sbjct  121   RIRFVLVGNEILSYNTDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSF  180

Query  1152  PPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGND  973
             PPSSG FR DI    V+LPLL FLN T S+FFLDVYPYF WS +P N  LDFALF   ++
Sbjct  181   PPSSGTFREDIAV-PVMLPLLKFLNGTNSFFFLDVYPYFPWSTDPVNNHLDFALFE--SN  237

Query  972   TVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNA  793
             +   D +TGLVYTNLLDQMLDSV++AM  LG+ ++ +AISETGWPN+GD+ + GA++ NA
Sbjct  238   STYTDPQTGLVYTNLLDQMLDSVIYAMTKLGYPNIPLAISETGWPNSGDIHEIGANILNA  297

Query  792   AAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVY  613
             A YNRNL+ KM  +PPLGTPAR G  IPTF+FSL++EN+K G GTERHWGIL P G P+Y
Sbjct  298   ATYNRNLIKKMTANPPLGTPARRGSPIPTFLFSLFNENQKPGSGTERHWGILNPDGTPIY  357

Query  612   ELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDL  433
             +++ +     + +  LP+P NN P++GN+WCV   G    +LG AL+FAC   N TC  L
Sbjct  358   DIDFSGTRSVSSFGTLPKPSNNVPFKGNVWCVAVDGADEAELGLALNFACGRNNETCAAL  417

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             APGG+CY PV++  HA+YAFSS+WA++R+  + CYFNGLA  TT++P +  CK PSV
Sbjct  418   APGGECYAPVTVTWHASYAFSSYWAQFRNQSSQCYFNGLARETTINPGNERCKFPSV  474



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   499 bits (1284),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 322/441 (73%), Gaps = 6/441 (1%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             GI YG++GN+LP   +++  +K++   ++KIYD++ +IL  L  T I+V+IM+ NE I  
Sbjct  27    GICYGQLGNNLPKPSKSLSLIKSLNAKRIKIYDTNPQILTTLKNTNIQVSIMLPNELI--  84

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + ++    + +W+  N+L + P T+IR +LVGNE++S S+  S WL +VPAM+ IK +
Sbjct  85    -TNISSNQTLSDQWIKSNILPYYPQTLIRYLLVGNEIIS-STPNSTWLHLVPAMRRIKHS  142

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  IKVGT  AMD+LETSFPPS+  FR DI   QV+ P+L FLNRT+S+FFLDVY
Sbjct  143   LKKFRVKRIKVGTSSAMDVLETSFPPSNAAFRKDIAV-QVIKPMLRFLNRTKSFFFLDVY  201

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             P+F WS +P NV+LD+ALFR  N TV  D  +GLVYTNL DQM+D+V FAM+ LGF D+R
Sbjct  202   PFFPWSSDPVNVNLDYALFRESNVTVK-DPGSGLVYTNLFDQMVDAVYFAMEKLGFPDIR  260

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I I+ETGWPN GD+DQ GA+V NAA YNRN V K+M+ P +GTPARPG+ +P+F+F+L++
Sbjct  261   IFIAETGWPNGGDVDQIGANVFNAATYNRNFVKKVMKKPIVGTPARPGLILPSFLFALFN  320

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATG  505
             EN K GPGTERH+G+L P G  VY+++L+   PE E+P LP P+NN PY+G +WCV   G
Sbjct  321   ENIKPGPGTERHFGLLYPNGSRVYDIDLSGKTPEVEFPALPPPENNEPYKGKIWCVAVRG  380

Query  504   IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYF  325
               +  LG AL +AC+ GN TCD + PG  C++P S+  HA+YAFSS+WA+++  G +CYF
Sbjct  381   SNVTALGEALTYACSQGNRTCDPVQPGKKCFKPDSVFWHASYAFSSYWAQFKKIGGTCYF  440

Query  324   NGLATMTTVDPSHGACKVPSV  262
             NGLAT T  DPS+G+CK PSV
Sbjct  441   NGLATQTAKDPSYGSCKFPSV  461



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   499 bits (1285),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 248/447 (55%), Positives = 318/447 (71%), Gaps = 8/447 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYG++ N+LPS Y++I  +K+++   VK+YD+D E LKLLS T + VTIMV N+
Sbjct  34    ASRIGINYGKLDNNLPSPYQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPND  93

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
              I    S     A A  W+  NVL F P T IR VLVGNE+LS SS Q   +W  +VPAM
Sbjct  94    QI---ISIGADQATADNWIATNVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAM  150

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
             + +  +L    IHNIKVGTP+AMD L +SFPPSSG FR DI    V+LPLL FLN T S+
Sbjct  151   RKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFREDIAV-PVMLPLLKFLNGTNSF  209

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FFLDVYPYF WS +P N  LD+ALF   +++  +D +TGLVYTNLLDQMLDSV+FAM  L
Sbjct  210   FFLDVYPYFPWSTDPVNNHLDYALFE--SNSTYIDPQTGLVYTNLLDQMLDSVIFAMAKL  267

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G+ DVR+AISETGWPN GD+ + GA++ NAA YNRNL+ K+  +PPLGTPAR G  IPTF
Sbjct  268   GYPDVRLAISETGWPNAGDILETGANILNAATYNRNLIKKLTANPPLGTPARRGAPIPTF  327

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             +FSL++EN+K G GTERHWGIL   G P+YE++ +     + +  LP+P NN P++G++W
Sbjct  328   LFSLFNENQKPGSGTERHWGILNHDGTPIYEIDFSGTRSVSSFDKLPKPSNNVPFKGSVW  387

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             CV   G    +LG AL+FAC   N TC  LAPG +CY PVS+  HA+YAFSS+WA++R+ 
Sbjct  388   CVAVDGAGEAELGQALNFACGRSNETCAALAPGRECYAPVSVSWHASYAFSSYWAQFRNQ  447

Query  342   GASCYFNGLATMTTVDPSHGACKVPSV  262
              + CYFNGL+  TT +P +  CK PSV
Sbjct  448   SSQCYFNGLSRETTTNPGNERCKFPSV  474



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   499 bits (1285),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 316/445 (71%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N 
Sbjct  39    ASKIGINYGRRGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNH  98

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    + ++    A  WV  N+L + P T IR VLVGNE+LS +S  ++ + +VPAM+ 
Sbjct  99    QI---TALSSNQTIADEWVRTNILPYYPQTQIRFVLVGNEILSYNSG-NVSVNLVPAMRK  154

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L LH IHNIKVGTP+AMD L +SFPPS+G FR +I    V+LPLL FLN T SYFF
Sbjct  155   IVNSLRLHGIHNIKVGTPLAMDSLRSSFPPSNGTFREEI-TGPVMLPLLKFLNGTNSYFF  213

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             L+V+PYF WS NP N SLDFALF+G   +   D +TGLVY NLLDQMLDSV+FAM  LG+
Sbjct  214   LNVHPYFRWSRNPMNTSLDFALFQG--HSTYTDPQTGLVYRNLLDQMLDSVLFAMTKLGY  271

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +R+AISETGWPN GD+D+ GA++ NAA YNRNL+ KM   PP+GTP+RPG+ IPTF+F
Sbjct  272   PHMRLAISETGWPNFGDIDETGANILNAATYNRNLIKKMSASPPIGTPSRPGLPIPTFVF  331

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  332   SLFNENQKSGSGTQRHWGILHPDGSPIYDVDFTGQTPLTGFNPLPKPTNNVPYKGQVWCV  391

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L   L  ACA  N TC  LAPG +CYEPVSI  HA+YA +S+WA++R+   
Sbjct  392   PVEGANETELEETLRMACAQSNTTCAALAPGRECYEPVSIYWHASYALNSYWAQFRNQSI  451

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              C+FNGLA  TT +P +  CK PSV
Sbjct  452   QCFFNGLAHETTTNPGNDRCKFPSV  476



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   498 bits (1283),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 237/445 (53%), Positives = 324/445 (73%), Gaps = 6/445 (1%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS  GI YG++GN+LP    +I  +K++   ++KIYD++ +IL  L  T I+V+IM+ NE
Sbjct  23    SSQPGICYGQLGNNLPKPQNSISLIKSLNSKRIKIYDTNPQILTSLKNTNIQVSIMLPNE  82

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    + +     + +W+  NV+ F P T+IR +L+GNE++S S+  S W  +VPAM+ 
Sbjct  83    LI---TNISTNQTLSDQWIKSNVVPFYPQTLIRYLLIGNEIIS-STPNSTWPHLVPAMRR  138

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             IK +L    I  IKVGT  AMD+LETSFPPS+  FR DI   QV+ P+L FLNRT+S+FF
Sbjct  139   IKHSLKKFRIKKIKVGTSSAMDVLETSFPPSNAAFRKDIAV-QVIKPMLRFLNRTKSFFF  197

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             LDVYP+F+WS +P +V+LD+ALFR  N TV  D  +GLVYTNL DQM+D+V FAM+ LGF
Sbjct  198   LDVYPFFAWSSDPVHVNLDYALFRATNVTVK-DPGSGLVYTNLFDQMVDAVYFAMEKLGF  256

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
              D+RI I+ETGWPN GD+DQ GA+V NAA YNRN + K+M+ P +GTPARPG+ +P+F+F
Sbjct  257   PDIRIFIAETGWPNGGDIDQIGANVFNAATYNRNFIRKVMKKPVVGTPARPGLILPSFLF  316

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             +L++EN K GPGTER++G+L P G  VYE++L    PE+++P LP P+NN PY+G +WCV
Sbjct  317   ALFNENIKPGPGTERNFGLLYPNGSRVYEIDLFGKTPESDFPALPPPENNEPYKGKIWCV  376

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
              A G  + +LG AL +AC+ GN TCD + PG  C++P SI  HA+YAFSS+WA+++  G 
Sbjct  377   AARGSNLTELGEALSYACSQGNRTCDAVQPGKKCFKPESIFWHASYAFSSYWAQFKKIGG  436

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
             +CYFNGLAT T  DPS+G+CK PSV
Sbjct  437   TCYFNGLATQTAKDPSYGSCKFPSV  461



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   498 bits (1282),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 330/450 (73%), Gaps = 6/450 (1%)
 Frame = -3

Query  1611  SNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTI  1432
             S+G  SS +GINYG++G++LPS  ++++ ++++   +VKIYD++ +IL  L GT ++V+I
Sbjct  19    SSGEISSQVGINYGQLGDNLPSPEKSVKLIQSIGAKRVKIYDANPDILNALRGTDLQVSI  78

Query  1431  MVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMV  1252
             MV N+ +    + +     A  W+  NVL F P   IR +LVGNEV+S SS + +W  +V
Sbjct  79    MVPNQHL---TNISTNQKLADSWIQSNVLPFYPKVKIRYLLVGNEVIS-SSPKEIWYSIV  134

Query  1251  PAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRT  1072
             PAM+ IK ALN H ++ IKVGT +AM +LE+SFPPS+G FR+DI    ++ P+L FL+RT
Sbjct  135   PAMRKIKNALNTHRLNKIKVGTSMAMGVLESSFPPSNGTFRSDIAY-PIVKPMLQFLSRT  193

Query  1071  RSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAM  892
             +S++FLDVYPYF WS +  N++LD+ALF         D  + L Y+NL DQM+DSV+FAM
Sbjct  194   KSFYFLDVYPYFPWSTDSNNINLDYALFES-RTIKYTDPVSNLTYSNLFDQMVDSVIFAM  252

Query  891   QYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAI  712
             + LG+ DVRI I+ETGWPN GD+DQ GA+++NAA YNRN++ K+   PP+GTPARPG  +
Sbjct  253   EKLGYPDVRIWIAETGWPNAGDIDQIGANIYNAATYNRNVIKKLTAKPPVGTPARPGRVL  312

Query  711   PTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEG  532
             P+FIF+LY+EN+K GPGTERH+G+L P G  VY ++L+   P++ Y PLP+P NN PY+G
Sbjct  313   PSFIFALYNENQKPGPGTERHFGLLYPNGSNVYAIDLSGKTPDSAYEPLPKPTNNEPYKG  372

Query  531   NLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
              +WCV A G+   +LG AL +AC+ GN TCD + PG +C++P S++ HA+YAFSS+W+++
Sbjct  373   KIWCVAARGVNASELGSALSYACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQF  432

Query  351   RSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             + TGA+CYFNGLAT T  DPS G CK PSV
Sbjct  433   KKTGATCYFNGLATPTAKDPSFGRCKFPSV  462



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   498 bits (1282),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 324/448 (72%), Gaps = 9/448 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S  +G+NYG +GN+LPS   ++E +K ++  +VKIY++D EIL  L  T I+V+IMV NE
Sbjct  27    SGKVGVNYGGLGNNLPSPKRSVELIKTLKAKRVKIYNADPEILTALRNTNIQVSIMVPNE  86

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    + +     A  WVH N++ F   TMIR +LVGNE++S S+A+ +W  +VPAM+ 
Sbjct  87    IL---INISTNQTLADEWVHTNLVPFYHDTMIRYLLVGNEIIS-STAKPVWYALVPAMRK  142

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             IK AL  H I  +KVGTP AMD+L++SFPPS+G FR+DI    ++ P+L FLNRT+S+FF
Sbjct  143   IKSALRTHGIRKVKVGTPSAMDVLQSSFPPSNGSFRSDI-SGPIIKPMLQFLNRTKSFFF  201

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +DVYPYFSW   P +++LD+ALF+  N T   D  TGL YTNL DQMLD++ FAM+ LGF
Sbjct  202   VDVYPYFSWVSEPNSINLDYALFQSRNITYT-DPNTGLTYTNLFDQMLDALHFAMKRLGF  260

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
              D+RI I+ETGWPN GD+DQ GA+++NAA YNRN+V K+   PP+GTPARPG  +P+FIF
Sbjct  261   PDIRIFIAETGWPNGGDIDQIGANIYNAATYNRNVVKKLSAKPPVGTPARPGSVLPSFIF  320

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             +LY+EN+K GPGTERH+G+L P+G  +Y +NL+   P ++YPPLP P+NN PY+G +WCV
Sbjct  321   ALYNENQKPGPGTERHFGLLYPSGKNIYPINLSGETPLSDYPPLPAPENNTPYKGKIWCV  380

Query  516   VAT-GIR--ILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRS  346
             VA   +R    +L  AL +AC+ GN TCD + PGG C  P S++  A+YAFSS+WA+++ 
Sbjct  381   VAKEAMRGNKTELAAALSYACSQGNKTCDAIQPGGICSRPDSLVRRASYAFSSYWAQFKK  440

Query  345   TGASCYFNGLATMTTVDPSHGACKVPSV  262
              G  CYFNGLA  TT DPS+G CK  SV
Sbjct  441   LGGGCYFNGLAVQTTKDPSYGYCKYASV  468



>ref|XP_002520622.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF41758.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=463

 Score =   497 bits (1279),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 241/447 (54%), Positives = 327/447 (73%), Gaps = 21/447 (5%)
 Frame = -3

Query  1647  IFALIF-FTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEI  1471
             + A+IF F+L+ASSN   S+ IGINYG++G++LPS Y +I+ L++M   +VK+YD++ EI
Sbjct  7     VVAVIFLFSLVASSNAETSNKIGINYGQLGDNLPSPYRSIQILQSMNTGRVKLYDANPEI  66

Query  1470  LKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL  1291
             L+LL+GT I+V++MV N +I    +  +    A  WV +NVL++ P TMIR +LVGNE+L
Sbjct  67    LRLLAGTKIQVSVMVPNNEI---NNIASNQTIAHNWVRENVLQYYPNTMIRFILVGNEIL  123

Query  1290  SDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIP  1117
             S SS Q   +W  +VPAM+ IK +L  HNI NIKVGTP+AMD+L+T+ PPS+G FR+DI 
Sbjct  124   SYSSDQDKKIWSNLVPAMRKIKNSLRSHNIQNIKVGTPLAMDVLQTTSPPSNGTFRSDI-  182

Query  1116  RDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVY  937
                V+LPLL FLN T+S+FF+DVYPYF +S NP ++SLD+ALF+   +    D  TGL+Y
Sbjct  183   SGTVILPLLKFLNGTKSFFFIDVYPYFPFSSNPTSISLDYALFKSSQN--YTDLRTGLIY  240

Query  936   TNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMM  757
              NLLDQMLDS+VFAM  L ++++R+AI+ETGWPN GDLDQPGA+++NAA YNRNL+ KM 
Sbjct  241   HNLLDQMLDSLVFAMTKLNYSNIRLAIAETGWPNAGDLDQPGANIYNAATYNRNLIKKMT  300

Query  756   QDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETE  577
               PP+GTPARPGV IPTFIFSLY+ENRK GPGTERHWG+L   G  +YE++L+    ++E
Sbjct  301   AKPPIGTPARPGVVIPTFIFSLYNENRKTGPGTERHWGLLNANGTAIYEIDLSGKQADSE  360

Query  576   YPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCY-----  412
             Y  LP+P+NN+PY+G LWC+ A G  + +LG A+ FAC+ GNGTCD LAPGG        
Sbjct  361   YRALPQPNNNKPYKGKLWCIAAQGADLTELGTAVTFACSQGNGTCDALAPGGKVAVATSM  420

Query  411   ------EPVSILAHANYAFSSFWAKYR  349
                    P+ ++ HAN + +S    +R
Sbjct  421   DLQSRPPPILVMDHAN-SLASLSEDFR  446



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score =   495 bits (1275),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 315/445 (71%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N 
Sbjct  40    ASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSHTNLYVTITVPNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S  +    A+ WV  N+L + P T IR VLVGNE+LS +  +++   +VPAM+ 
Sbjct  100   QI---ISLGSNQTTAEDWVKTNILPYYPQTQIRFVLVGNEILS-AENRNITANLVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L  H IHNIKVGTP+AMD L ++FPPS+  FR DI   +++LPL+ FLN T SYFF
Sbjct  156   IVTSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFREDI-AGELMLPLMKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +++ PYF WS NP N SLDFALF+G  ++   D  TGLVY NLLDQMLDSV++AM  LG+
Sbjct  215   INLQPYFRWSRNPMNTSLDFALFQG--NSTYTDPHTGLVYHNLLDQMLDSVIYAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWPN GD+D+ GA++ NAA YNRNL+ KM  +PP+GTPARPG+ IPTF+F
Sbjct  273   PHIRIAISETGWPNFGDIDETGANILNAATYNRNLIKKMTANPPIGTPARPGLPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWG+L P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENQKSGSGTQRHWGLLHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L  AL  AC   N TC  LAPG +CYEPVSI  HA+YA SS+WA++R+   
Sbjct  393   PVEGANETELEEALRLACGQSNTTCAALAPGRECYEPVSIYWHASYAVSSYWAQFRTQDV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT++P +  CK PSV
Sbjct  453   RCYFNGLAHETTINPGNDRCKFPSV  477



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   494 bits (1271),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 230/445 (52%), Positives = 325/445 (73%), Gaps = 6/445 (1%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS +GI YG++GN+LP   ++++ +  ++ ++VKIYD++ EILK   GT +++++MV NE
Sbjct  25    SSKVGICYGQLGNNLPIPTKSVDLINGLKANRVKIYDANPEILKAFKGTKLQLSVMVPNE  84

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    + +     A +WV  NV+ F P TMIR VLVGNE+LS S   + W  +VPA++ 
Sbjct  85    LI---NNISTNQDLADQWVKTNVVPFYPDTMIRYVLVGNEILS-SPPNTTWFNLVPAIRK  140

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I+ A+    +  IKVGTP+A+D+LE+SFPPS+G FR+DI  ++V+ PLL+FLNRT+S+FF
Sbjct  141   IRYAVKKFGLGKIKVGTPLAIDMLESSFPPSNGTFRSDI-SEKVMKPLLHFLNRTKSFFF  199

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +DVYPYF+W+  P  ++LD+AL    N TV  D  +GL YTNLLDQM+D+V FAM+ +G+
Sbjct  200   IDVYPYFAWAAQPTVINLDYALLESKNITVT-DPGSGLTYTNLLDQMIDAVYFAMKRVGY  258

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
              DVR+ I+ETGWPN G++DQ GA+++NAA YNRN++ K    PP+GTPA+PGV +PT +F
Sbjct  259   PDVRLFIAETGWPNAGNVDQIGANIYNAATYNRNVIKKFTAKPPVGTPAKPGVVVPTLLF  318

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             +LY+EN K GPGTERH+G+L P G  +Y ++L+     +EY PLP P NN PY+G +WCV
Sbjct  319   ALYNENEKPGPGTERHFGLLYPNGTNIYGIDLSGKTSLSEYEPLPRPRNNEPYKGKIWCV  378

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
             V     + ++  AL +AC  GN TCD++ PGG CY+P S++ HANYAFSS+WA+++S G 
Sbjct  379   VGRKASVTEVSGALAYACGQGNRTCDEIRPGGKCYKPNSLVLHANYAFSSYWAQFKSAGG  438

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
             +CYFNGLA  T  DPS+GACK PSV
Sbjct  439   TCYFNGLAIPTKSDPSYGACKFPSV  463



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   494 bits (1271),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 232/462 (50%), Positives = 335/462 (73%), Gaps = 9/462 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             +F+L F +    S+   SS +GI YG++GN+LP    +++ +K ++  +VKIYD++ +IL
Sbjct  10    LFSLAFASF---SSAEISSQVGICYGQLGNNLPIPKNSVDLIKGLKAKRVKIYDTNPQIL  66

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             + L GT ++V++MV NE I    + +     A +WV +NV+ F P TMIR +LVGNE+LS
Sbjct  67    EALKGTNLQVSVMVPNELI---NNISTNQTLADQWVKNNVVPFYPHTMIRYLLVGNEILS  123

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
              S   + W  +VPA++ I+ ++    +  IK+GTP+A+D+LE+SFPPS+G FR+DI  ++
Sbjct  124   -SPPNTTWFNLVPAIRKIRFSVKKFGLGKIKIGTPLAIDMLESSFPPSNGTFRSDI-SEK  181

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ PLL+FLNRT+S+FF+DVYPYF+W+  P  ++LD+AL    N TV  D  +GLVYTNL
Sbjct  182   VMKPLLHFLNRTKSFFFIDVYPYFAWAAQPTVINLDYALLDSKNITVS-DPGSGLVYTNL  240

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
             LDQM+D+V FAM+ +G+ DVR+ I+ETGWPN G +DQ GA+++NAA YNRN++ K    P
Sbjct  241   LDQMIDAVYFAMKRVGYPDVRLFIAETGWPNAGGMDQIGANIYNAATYNRNVIKKFTAKP  300

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
             P+GTPA+PGV +PT +F+LY+EN+K GPGTERH+G+L P G  VY ++L+   PE+EY  
Sbjct  301   PIGTPAKPGVVVPTLLFALYNENQKPGPGTERHFGLLYPNGTNVYGIDLSGKTPESEYKA  360

Query  567   LPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
             LP   NN PY+G +WCVV       +LG A+ +AC  GN TCD++ PGG CY P S+++H
Sbjct  361   LPRARNNEPYKGKIWCVVGRNANASELGGAMSYACGQGNRTCDEIRPGGKCYNPNSLVSH  420

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             ANYAFSS+W++++S+G +CYFNGL   T  DPS+G+CK PSV
Sbjct  421   ANYAFSSYWSQFKSSGGTCYFNGLTIPTKKDPSYGSCKFPSV  462



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   493 bits (1268),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 332/461 (72%), Gaps = 9/461 (2%)
 Frame = -3

Query  1641  ALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIE-TLKAMRVSQVKIYDSDHEILK  1465
             +++FF++ ++     SS +G+ YG++GN+LPS  E++E  +K+++ ++VKIYD++ +ILK
Sbjct  12    SVMFFSIGSAEM---SSKVGVCYGQLGNNLPSPQESVELMIKSLKATRVKIYDANPKILK  68

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
              L  T I+V+IMV NE I     + +  + + +WV  NVL +LPGT IR +LVGNE+LS 
Sbjct  69    ALKNTDIQVSIMVPNEII--NNISLSSQSLSDQWVRTNVLPYLPGTKIRYLLVGNEILSL  126

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQV  1105
                +S+W  +VPAM+ I+K+L       IKVGTP AMD+L++SFPPS+G FR+DI  + V
Sbjct  127   PD-KSIWPNLVPAMRKIRKSLKTLGARKIKVGTPSAMDVLQSSFPPSNGTFRSDI-SESV  184

Query  1104  LLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLL  925
             + P+L+FLNRT+S+FF+D Y +F WS +P N+ LD+AL    N T   D  T L YTNL 
Sbjct  185   MRPMLHFLNRTKSFFFVDAYTFFPWSSDPKNIHLDYALLESTNITYT-DPVTKLTYTNLF  243

Query  924   DQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPP  745
             DQMLD+VVFAM+ LG+ D+RI I+ETGWPN GD DQ GA+++NAA YNRN+V K+   P 
Sbjct  244   DQMLDAVVFAMKKLGYPDIRIFIAETGWPNGGDYDQIGANIYNAATYNRNIVKKLTAKPA  303

Query  744   LGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPL  565
             +GTPARPG  +P+FIF+LY+EN+K GPGTERH+G+L P G  VYE++L+   PE EY PL
Sbjct  304   IGTPARPGWVLPSFIFALYNENQKPGPGTERHFGLLYPNGSHVYEIDLSGNAPEKEYGPL  363

Query  564   PEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHA  385
             P+P NN PY+G +WCV A       L  AL +AC+ GN TCD + PG  C +P S++  A
Sbjct  364   PKPTNNEPYKGKIWCVAAKVANTTALSSALSYACSQGNKTCDPIQPGKPCAKPGSLVWKA  423

Query  384   NYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +YAFSS+W+++R  G +CYFNGLAT T  DPSHG+CK PSV
Sbjct  424   SYAFSSYWSQFRKLGGTCYFNGLATQTIKDPSHGSCKFPSV  464



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 243/445 (55%), Positives = 312/445 (70%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K ++   VK+YD+D E L LLS T + VTI V N 
Sbjct  40    ASRIGINYGRQGNNLPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S +     A  WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ 
Sbjct  100   QI---TSLSANQTTADDWVKTNILPYYPQTQIRFVLVGNEILSVQD-RNITANVVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L  H IHNIKVGTP+AMD L ++FPPS+  FR DI    ++LPLL FLN T SYFF
Sbjct  156   IVNSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFREDIALP-LMLPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +++ PYF WS NP N +LDFALF+G  ++   D  TGLVY NL+DQMLDSV+FAM  LG+
Sbjct  215   INLQPYFRWSRNPNNTTLDFALFQG--NSTYTDPHTGLVYHNLVDQMLDSVIFAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWP++GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG  IPTF+F
Sbjct  273   PYIRIAISETGWPHSGDIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
             +  G    +L  AL  ACA  N TC  LAPG +CYEPVS+ +HA+YA +S+WA++RS   
Sbjct  393   LVEGANEAELEEALRMACARSNTTCAALAPGRECYEPVSVYSHASYALNSYWAQFRSQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   QCYFNGLAHETTTNPGNDRCKFPSV  477



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 239/445 (54%), Positives = 315/445 (71%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N 
Sbjct  39    ASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNH  98

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S ++    A  WV  N++ + P T IR VLVG+E+LS +   ++   +VPAM+ 
Sbjct  99    QI---TSLSSNQTIADEWVRTNIIPYYPQTQIRFVLVGHEILSYNYG-NVSANLVPAMRK  154

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L  H IHNIKVGTP+AMD L +SFPPS+G FR ++    V+LPLL FLN T SYFF
Sbjct  155   IVNSLRFHGIHNIKVGTPLAMDSLRSSFPPSNGTFREEV-AGPVILPLLKFLNGTNSYFF  213

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             ++V+PYF WS NP N SLD+ALF+G  ++   D  TGLVY NLLDQMLDSV+FAM  LG+
Sbjct  214   INVHPYFRWSRNPMNTSLDYALFQG--NSTYTDPHTGLVYRNLLDQMLDSVLFAMTKLGY  271

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +R+AISETGWPN+GD+D+ GA++ NAA YNRNL+ KM   PP+GTP+RPG+ IPTF+F
Sbjct  272   PHIRLAISETGWPNSGDIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVF  331

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G+P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  332   SLFNENQKSGSGTQRHWGILHPDGIPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCV  391

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G  + +L   L   C+  N TC  LAPG +CYEPVS+  HA+YA SS+WA++R+   
Sbjct  392   PVDGANVSELEETLRTTCSRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNV  451

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  452   QCYFNGLAHETTTNPGNDRCKFPSV  476



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   491 bits (1264),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 333/462 (72%), Gaps = 9/462 (2%)
 Frame = -3

Query  1650  PIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEI  1471
             PIF+L    L++ S+   S+ +GINYG++GN+LPS  E++E LK+++  +VKIYD++ +I
Sbjct  8     PIFSLAL--LVSISSAEISNKVGINYGQLGNNLPSPSESVELLKSLKAKRVKIYDANPDI  65

Query  1470  LKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL  1291
             LK L  T I+V+IM+ NE I    + +   + +  WV  NV+ +     IR +LVGNE+L
Sbjct  66    LKSLKDTDIQVSIMIPNELI---QNISKSQSLSDHWVKTNVVPYYSDVKIRYLLVGNEIL  122

Query  1290  SDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             ++    + W  +VPAM+ IK +L  H I  IKVGTP A+++LE+SFPPS+G FR+DI   
Sbjct  123   TNPDTGT-WFNLVPAMRRIKASLKTHKITKIKVGTPSALNVLESSFPPSNGTFRSDI-SG  180

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              ++ P+L FL+RT+S+FF+DVYPYF+W++N  N++LD+ALF+  N T   D  T L YTN
Sbjct  181   PIIKPMLRFLDRTKSFFFIDVYPYFAWADNHQNINLDYALFKAKNVTYT-DPGTNLTYTN  239

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             LLDQMLD+V FAM+ LG+ DVRI I+ETGWPN GD+DQ GA+++N+A +NRN++ K+   
Sbjct  240   LLDQMLDAVAFAMKRLGYPDVRIFIAETGWPNDGDIDQIGANIYNSATFNRNVIKKLTTK  299

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-  574
             P +GTPARPG  IP+ IF+LY+EN+K GPGTERH+G+L P G  +YE++L+   P +EY 
Sbjct  300   PAIGTPARPGWVIPSIIFALYNENQKPGPGTERHFGLLYPNGTKIYEIDLSGDTPLSEYT  359

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
              PLP P NN PY+G +WC+VA G+    +G AL +AC+ GN TCD +  G +CY+P S+ 
Sbjct  360   KPLPAPTNNEPYKGKIWCMVAKGVNETAVGDALSYACSQGNKTCDAIQTGKECYKPDSLF  419

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
              HA+YAFSS+WA+++ +G +C FNGLATMT  DPS G CK P
Sbjct  420   WHASYAFSSYWAQFKKSGGTCSFNGLATMTPKDPSFGHCKFP  461



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   491 bits (1265),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 243/444 (55%), Positives = 312/444 (70%), Gaps = 6/444 (1%)
 Frame = -3

Query  1593  SNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNED  1414
             S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N  
Sbjct  41    SKIGINYGRRGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHL  100

Query  1413  IPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNI  1234
             I    S +     A+ WV  N++ + P T IR VLVGNE+LS    +++   +VPAM+ I
Sbjct  101   I---TSLSTNQTTAEDWVQTNIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKI  157

Query  1233  KKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
               +L  H IHNIKVGT + MD L +SFPPS+  FR DI  + ++LPLL FLN T SYFF+
Sbjct  158   VTSLRAHGIHNIKVGTALDMDSLRSSFPPSNSTFREDIA-EPLMLPLLKFLNGTNSYFFI  216

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             ++ PYF WS NP N SLD+ALF+G  ++   D +TGLVY NLLDQMLDSV+FAM  LG+ 
Sbjct  217   NLQPYFRWSRNPMNTSLDYALFQG--NSTYTDPQTGLVYRNLLDQMLDSVIFAMTKLGYP  274

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
              +RIAISETGWPN+GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG+AIPTF+FS
Sbjct  275   HIRIAISETGWPNSGDIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLAIPTFVFS  334

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVV  514
             L+DE++K G GT+RH+GIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV 
Sbjct  335   LFDEDQKSGSGTQRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPTNNVPYKGIVWCVP  394

Query  513   ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGAS  334
               G     L  AL  AC   N TC  LAPG +CYEPVS+  HA+YA SS+WA++R+    
Sbjct  395   VVGASEAQLEEALRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVR  454

Query  333   CYFNGLATMTTVDPSHGACKVPSV  262
             CYFNGLA MTTV+P +  CK P V
Sbjct  455   CYFNGLARMTTVNPGNDRCKFPGV  478



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   491 bits (1264),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 313/445 (70%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N 
Sbjct  40    ASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPECLTLLSQTNLYVTITVPNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S ++    A  WV  N+L + P T IR VLVGNEVLS +   ++   +VPAM+ 
Sbjct  100   QI---TSLSSNQTTADEWVRTNILPYYPQTQIRFVLVGNEVLSYNYG-NISANLVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L    IHNIKVGTP+AMD L +SFPPS+G FR +I    V+LPLL FLN T SYFF
Sbjct  156   IVNSLRFRGIHNIKVGTPLAMDALRSSFPPSNGTFREEIA-GPVVLPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             ++V+PYF WS NP + SLD+ALF+G  D+   D +TGLVY NLLDQMLDSV+FAM  LG+
Sbjct  215   INVHPYFRWSRNPMDTSLDYALFQG--DSTYTDPQTGLVYRNLLDQMLDSVLFAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +R+AISETGWPN+GD+D+ GA++ NAA YNRNL+ KM   PP+GTP+RPG+ IPTF+F
Sbjct  273   PHIRLAISETGWPNSGDIDETGANILNAATYNRNLIKKMTTSPPIGTPSRPGLPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGI+ P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENQKPGSGTQRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L   L  AC   N TC  LAPG +CYEPVS+  HA+YA SS+WA++R+   
Sbjct  393   PVEGANEAELEETLRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   RCYFNGLAHETTTNPGNDRCKFPSV  477



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score =   491 bits (1264),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 241/444 (54%), Positives = 312/444 (70%), Gaps = 6/444 (1%)
 Frame = -3

Query  1593  SNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNED  1414
             S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N  
Sbjct  41    SKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHL  100

Query  1413  IPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNI  1234
             I    S +    +A+ WV  N+  + P T IR VLVGNE+LS    +++   +VPAM+ I
Sbjct  101   I---TSLSTNQTSAEDWVQTNITPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKI  157

Query  1233  KKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
               +L  H IHNIKVGT + MD L ++FPPS+  FR DI  + ++LPLL FLN T SYFF+
Sbjct  158   VTSLRAHGIHNIKVGTALDMDSLRSTFPPSNSTFREDIA-ETLMLPLLKFLNGTNSYFFI  216

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             ++ PYF WS NP N SLD+ALF+G  ++   D +TGLVY NLLDQMLDSV+FAM  LG+ 
Sbjct  217   NLQPYFRWSRNPMNTSLDYALFQG--NSTYTDPQTGLVYRNLLDQMLDSVIFAMTKLGYP  274

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
              +R+AISETGWPN+GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG+AIPTF+FS
Sbjct  275   HIRVAISETGWPNSGDIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLAIPTFVFS  334

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVV  514
             L+DEN+K G GT+RH+GIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV 
Sbjct  335   LFDENQKSGSGTQRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPKNNVPYKGIVWCVP  394

Query  513   ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGAS  334
               G     L  AL  AC   N TC  LAPG +CYEPVS+  HA+YA SS+WA++R+    
Sbjct  395   VEGASEAQLEEALRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVR  454

Query  333   CYFNGLATMTTVDPSHGACKVPSV  262
             CYFNGLA MTT++P +  CK P V
Sbjct  455   CYFNGLARMTTINPGNDRCKFPGV  478



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 239/461 (52%), Positives = 331/461 (72%), Gaps = 9/461 (2%)
 Frame = -3

Query  1641  ALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIE-TLKAMRVSQVKIYDSDHEILK  1465
             +++FF++ ++     SS +G+ YG++GN+LPS  E++E  +K+++ ++VKIYD++ +ILK
Sbjct  12    SVMFFSIGSAEM---SSKVGVCYGQLGNNLPSPQESVELMIKSLKATRVKIYDANPKILK  68

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
              L  T I+V+IMV NE I     + +  + + +WV  NVL +LPGT IR +LVGNE+LS 
Sbjct  69    ALKNTDIQVSIMVPNEII--NNISLSSQSLSDQWVRTNVLPYLPGTKIRYLLVGNEILSL  126

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQV  1105
                +S+W  +VPAM+ I+K+L       IKVGTP AMD+L++SFPPS+G FR+DI  + V
Sbjct  127   PD-KSIWPNLVPAMRKIRKSLKTLGARKIKVGTPSAMDVLQSSFPPSNGTFRSDI-SESV  184

Query  1104  LLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLL  925
             + P+L+FLNRT+S+FF+D Y +F WS +P N+ LD+AL    N T   D  T L YTNL 
Sbjct  185   MRPMLHFLNRTKSFFFVDAYTFFPWSSDPKNIHLDYALLESTNITYT-DPVTKLTYTNLF  243

Query  924   DQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPP  745
             DQMLD+VVFAM+ LG+ D+RI I+ETGWPN GD DQ GA+++NAA YNRN+V K+     
Sbjct  244   DQMLDAVVFAMKKLGYPDIRIFIAETGWPNGGDYDQIGANIYNAATYNRNIVKKLTAKRA  303

Query  744   LGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPL  565
             +GTPARPG  +P+FIF+LY+EN+K GPGTERH+G+L P G  VYE++L+   PE EY PL
Sbjct  304   IGTPARPGWVLPSFIFALYNENQKPGPGTERHFGLLYPNGSHVYEIDLSGNAPEKEYEPL  363

Query  564   PEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHA  385
             P+P NN PY+G +WCV A       L  AL +AC+ GN TCD + PG  C +P S++  A
Sbjct  364   PKPTNNEPYKGKIWCVAAKVANTTALSSALSYACSQGNKTCDPIQPGKPCAKPGSLVWKA  423

Query  384   NYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +YAFSS+W+++R  G +CYFNGLAT T  DPSHG+CK PSV
Sbjct  424   SYAFSSYWSQFRKLGGTCYFNGLATQTIKDPSHGSCKFPSV  464



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   489 bits (1259),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 237/449 (53%), Positives = 319/449 (71%), Gaps = 9/449 (2%)
 Frame = -3

Query  1593  SNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNED  1414
             + +G+NYG +G+DLPSA  ++  L+++    VKIYD++  IL  L+GT +RV+IMV NE 
Sbjct  9     TRLGVNYGTLGDDLPSAARSVALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEI  68

Query  1413  IPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKN  1237
             +P+L +N + +     WV DN+  F P   +R VLVGNE+LSD+S A S W  +VPAM N
Sbjct  69    VPSLGANASLA---DAWVADNLAPFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMAN  125

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I +AL   ++ ++KVGT +AMD L T+FPPS+G FRADI    V+ PLL+FL+RTRSY+F
Sbjct  126   IHRALRARSVCDVKVGTTLAMDALATAFPPSAGAFRADI-AGPVMRPLLDFLSRTRSYYF  184

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +D YPY +W+ NP ++ LD+ALF   +    +D  + L YTNLLDQM D+VV AM+ LGF
Sbjct  185   VDAYPYLAWASNPSSIRLDYALFAANSSLSYIDPGSNLTYTNLLDQMFDAVVAAMRRLGF  244

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               V IA++ETGWPN GDLDQ GA+VHNAA YNRNL  +M   P  GTPARPG A+P FIF
Sbjct  245   GGVPIAVAETGWPNAGDLDQIGANVHNAATYNRNLARRMAVRPAAGTPARPGAAMPVFIF  304

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SLY+E+RK GPGTERHWG+L P G  VYE++L+   P   YPPLP P+N+ PY G +WCV
Sbjct  305   SLYNEDRKPGPGTERHWGLLSPDGKQVYEVDLSGRRPLESYPPLPPPENDVPYMGKIWCV  364

Query  516   V-ATGIRILD---LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYR  349
             + A G    +   +G AL +AC  G GTCD + PGG CY+P +++ HA+YAF+S+W ++R
Sbjct  365   LDAEGKATANTTAVGAALAYACGQGTGTCDAIRPGGPCYQPNTLVTHASYAFNSYWQQFR  424

Query  348   STGASCYFNGLATMTTVDPSHGACKVPSV  262
               G +C+F+GLA  T  DPS+G+CK PS+
Sbjct  425   QAGGTCFFDGLAVQTKADPSYGSCKYPSL  453



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 312/445 (70%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N 
Sbjct  40    ASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVPNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S ++    A  WV  N+L F P T IR VLVGNEVL + +  ++   +VPAM+ 
Sbjct  100   QI---TSISSNQTTADEWVRTNILPFYPQTQIRFVLVGNEVL-NYNYGNISANLVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L    IHNIKVGTP+AMD L +SFPPS+G FR +I    V+LPLL FLN T SYFF
Sbjct  156   IVNSLRFRGIHNIKVGTPLAMDSLRSSFPPSNGTFREEIA-GPVILPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             ++V+PYF WS NP N SLD+ALF+G  ++   D +TGLVY NLLDQMLDSV+FAM  LG+
Sbjct  215   INVHPYFRWSRNPMNTSLDYALFQG--NSTYTDPQTGLVYRNLLDQMLDSVLFAMSKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +R+AISETGWPN GD+D+ GA++ NAA YNRNL+ KM   PP+GTP+RPG+ IPTF+F
Sbjct  273   PHIRLAISETGWPNFGDIDETGANIFNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGI+ P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENQKPGSGTQRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L   L  AC   N TC  LAPG +CYEPVS+  HA+YA SS+WA++R+   
Sbjct  393   PVEGANEAELEETLRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   RCYFNGLAHETTTNPGNDRCKFPSV  477



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 241/445 (54%), Positives = 313/445 (70%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S  GINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N 
Sbjct  40    ASKAGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPETLTLLSQTNLYVTITVPNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S ++  + A+ WV  N+L + P T IR VLVGNE+LS +   ++   +VPAM+ 
Sbjct  100   QI---TSLSSNQSIAEDWVKTNILPYYPQTQIRFVLVGNEILS-AQDTNVTANLVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L  H IHNIKVGTP+AMD L ++FPPS+  FR DI    ++LPLL FLN T SYFF
Sbjct  156   IVNSLRTHGIHNIKVGTPLAMDSLRSTFPPSNSTFREDI-AGPLVLPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             ++V+PYF WS NP N SLDFALF+G  ++   D +TGLVY NLLDQMLDSV++AM  LG+
Sbjct  215   INVHPYFRWSRNPMNTSLDFALFQG--NSTYTDPQTGLVYRNLLDQMLDSVIYAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWPN+GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG+ IPTF+F
Sbjct  273   PHIRIAISETGWPNSGDIDETGANVLNAATYNRNLIKKMTASPPIGTPARPGLPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWG+L P G P+Y+++ T     T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENQKPGSGTQRHWGVLHPDGTPIYDIDFTGQKNLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L   L  AC   N TC  LAPG +CYEPVS+  HA+YA SS+WA++R+   
Sbjct  393   PVEGANETELEETLRIACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAQFRNESI  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   QCYFNGLAHETTTNPGNDRCKFPSV  477



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   489 bits (1259),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 237/449 (53%), Positives = 319/449 (71%), Gaps = 9/449 (2%)
 Frame = -3

Query  1593  SNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNED  1414
             + +G+NYG +G+DLPSA  ++  L+++    VKIYD++  IL  L+GT +RV+IMV NE 
Sbjct  23    TRLGVNYGTLGDDLPSAARSVALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEI  82

Query  1413  IPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKN  1237
             +P+L +N + +     WV DN+  F P   +R VLVGNE+LSD+S A S W  +VPAM N
Sbjct  83    VPSLGANASLA---DAWVADNLAPFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMAN  139

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I +AL   ++ ++KVGT +AMD L T+FPPS+G FRADI    V+ PLL+FL+RTRSY+F
Sbjct  140   IHRALRARSVCDVKVGTTLAMDALATAFPPSAGAFRADI-AGPVMRPLLDFLSRTRSYYF  198

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +D YPY +W+ NP ++ LD+ALF   +    +D  + L YTNLLDQM D+VV AM+ LGF
Sbjct  199   VDAYPYLAWASNPSSIRLDYALFAANSSLSYIDPGSNLTYTNLLDQMFDAVVAAMRRLGF  258

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               V IA++ETGWPN GDLDQ GA+VHNAA YNRNL  +M   P  GTPARPG A+P FIF
Sbjct  259   GGVPIAVAETGWPNAGDLDQIGANVHNAATYNRNLARRMAVRPAAGTPARPGAAMPVFIF  318

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SLY+E+RK GPGTERHWG+L P G  VYE++L+   P   YPPLP P+N+ PY G +WCV
Sbjct  319   SLYNEDRKPGPGTERHWGLLSPDGKQVYEVDLSGRRPLESYPPLPPPENDVPYMGKIWCV  378

Query  516   V-ATGIRILD---LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYR  349
             + A G    +   +G AL +AC  G GTCD + PGG CY+P +++ HA+YAF+S+W ++R
Sbjct  379   LDAEGKATANTTAVGAALAYACGQGTGTCDAIRPGGPCYQPNTLVTHASYAFNSYWQQFR  438

Query  348   STGASCYFNGLATMTTVDPSHGACKVPSV  262
               G +C+F+GLA  T  DPS+G+CK PS+
Sbjct  439   QAGGTCFFDGLAVQTKADPSYGSCKYPSL  467



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   489 bits (1259),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 242/445 (54%), Positives = 312/445 (70%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K ++   VK+YD+D E L LLS T + VTI V N 
Sbjct  40    ASKIGINYGRQGNNLPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S +     A  WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ 
Sbjct  100   QI---TSLSANQTTADDWVKTNILPYYPQTQIRFVLVGNEILSVKD-RNITANVVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L  H IHNIKVGTP+AMD L ++FPPS+  FR DI    ++LPLL FLN T SYFF
Sbjct  156   IVNSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFREDIALP-LMLPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +++ PYF WS+NP + +LDFALF+G  ++   D  TGLVY NL+DQMLDSV+FAM  LG+
Sbjct  215   INLQPYFRWSKNPNHTTLDFALFQG--NSTYTDPHTGLVYHNLVDQMLDSVIFAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWP++GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG  IPTF+F
Sbjct  273   PYIRIAISETGWPHSGDIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
             +  G    +L  AL  ACA  N TC  LAPG +CYEPVS+  HA+YA +S+WA++RS   
Sbjct  393   LVEGANETELEEALRMACARSNTTCAALAPGRECYEPVSVYWHASYALNSYWAQFRSQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   QCYFNGLAHETTTNPGNDRCKFPSV  477



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   488 bits (1257),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 320/441 (73%), Gaps = 7/441 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++G+ LPS  E+++ ++++  ++VKIYD+DH IL+ L+GT I V++MV NE I  
Sbjct  25    GVNYGQLGDSLPSPTESVKLIRSLNATRVKIYDADHSILEALNGTDIAVSVMVPNEMI--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +     +  WV  NVL F P T I  +LVGNEVLS+   + L   +VPAM+ IK++
Sbjct  83    -VNISKSRTQSDNWVLTNVLPFYPTTKILYLLVGNEVLSNPHPE-LRSGLVPAMRKIKQS  140

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +H +KVGT +AMD+L+TS+PPSSG FR+DI    V+ P+L FLN+T+S+ F+DVY
Sbjct  141   LKRLGVHKVKVGTTLAMDVLQTSYPPSSGEFRSDI-SGLVMKPMLQFLNKTKSFLFVDVY  199

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+WS++P N+ LD+ALF   N T+  D  T L Y NL DQM+D+ VFAM+ +G+ D+R
Sbjct  200   PYFAWSQDPRNIDLDYALFESKNITIT-DPATNLTYHNLFDQMVDAFVFAMERIGYPDIR  258

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I +SETGWPN GD DQ GA++ NAA YNRN+V K+  DPP+GTPARPG  +P FIFSLY+
Sbjct  259   IWVSETGWPNNGDYDQIGANIFNAATYNRNVVKKLTIDPPVGTPARPGRVLPAFIFSLYN  318

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATG  505
             EN+K GPGTERH+G+  P G PVY+++L+    E E   LPEP NN PY+G +WCVVA G
Sbjct  319   ENQKPGPGTERHFGLYNPNGNPVYDMDLSGKTTEYE-DVLPEPGNNEPYKGKIWCVVAKG  377

Query  504   IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYF  325
                 +LG AL +AC+ GN TCD + PGG C +P  IL HA++AFSS+WA++R +GA+C+F
Sbjct  378   ANWTELGEALSYACSQGNNTCDPIRPGGPCNKPEFILTHASFAFSSYWAEFRKSGATCHF  437

Query  324   NGLATMTTVDPSHGACKVPSV  262
             NGLAT T  DPS+G C+ PSV
Sbjct  438   NGLATQTVKDPSYGRCEFPSV  458



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score =   489 bits (1258),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 241/444 (54%), Positives = 312/444 (70%), Gaps = 6/444 (1%)
 Frame = -3

Query  1593  SNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNED  1414
             S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N  
Sbjct  41    SKIGINYGRRGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVPNHL  100

Query  1413  IPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNI  1234
             I    S +     A+ WV  N++ + P T IR VLVGNE+LS    +++   +VPAM+ I
Sbjct  101   I---TSLSTNQTTAEDWVQTNIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKI  157

Query  1233  KKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
               +L  H IHNIKVGT + MD L +SFPPS+  FR DI  + ++LPLL FLN T SYFF+
Sbjct  158   VTSLRAHGIHNIKVGTALDMDSLRSSFPPSNSTFREDIA-EPLMLPLLKFLNGTNSYFFI  216

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             ++ PYF WS NP N SL++ALF+G  ++   D +TGLVY NLLDQMLDSV+FAM  LG+ 
Sbjct  217   NLQPYFRWSRNPMNTSLEYALFQG--NSTYTDPQTGLVYRNLLDQMLDSVIFAMTKLGYP  274

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
              +RIAISETGWPN+GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG++IPTF+FS
Sbjct  275   HIRIAISETGWPNSGDIDETGANVLNAATYNRNLIKKMTAIPPIGTPARPGLSIPTFVFS  334

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVV  514
             L+DE++K G GT+RH+GIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV 
Sbjct  335   LFDEDQKSGSGTQRHYGILHPDGTPIYDIDFTGEKPLTGFNPLPKPTNNVPYKGIVWCVP  394

Query  513   ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGAS  334
               G     L  AL  AC   N TC  LAPG +CYEPVS+  HA+YA SS+WA++R+    
Sbjct  395   VVGASEAQLEEALRMACGRSNTTCAALAPGRECYEPVSVYWHASYAVSSYWAEFRTENVR  454

Query  333   CYFNGLATMTTVDPSHGACKVPSV  262
             CYFNGLA MTTV+P +  CK P V
Sbjct  455   CYFNGLARMTTVNPGNDRCKFPGV  478



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   488 bits (1257),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 240/445 (54%), Positives = 307/445 (69%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR G D+PS Y++I  +K+++   VK+YD+D E L LLS T + V+I V N 
Sbjct  40    ASKIGINYGRQGKDIPSPYQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S       A+ WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ 
Sbjct  100   QI---TSLGTNQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVQD-RNITSNLVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  AL  H IHNIKVGTP+ MD L ++FPPS+  FR DI    ++LPLL FLN T SYFF
Sbjct  156   IVNALRAHGIHNIKVGTPLPMDSLRSTFPPSNSTFREDI-AGPLMLPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +++ PY+ W  NP N SLDFALF+G  D+   D  TGLVY NL+DQMLDSV+ AM  LG+
Sbjct  215   INLQPYYRWLRNPMNTSLDFALFQG--DSTYTDPRTGLVYHNLVDQMLDSVILAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWPN+GD+D+ GA++ NAA YNRNL+ KM   PP+GTPARPG+ IPTF+F
Sbjct  273   PHIRIAISETGWPNSGDIDETGANILNAATYNRNLIKKMTAIPPIGTPARPGLPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENQKSGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQMWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G +  +L  AL  AC   N TC  LAPG +CYEPVSI  HA YA SS+WA++R+   
Sbjct  393   PVEGAKEAELEEALRMACGRSNTTCAALAPGKECYEPVSIYWHARYAVSSYWAQFRTQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   GCYFNGLAHETTTNPGNDRCKFPSV  477



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   487 bits (1254),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 234/464 (50%), Positives = 329/464 (71%), Gaps = 9/464 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             IF  +F +L   S+   S   G+NYG++GN+LP+   ++  +K ++  +VKIYD++ +IL
Sbjct  9     IFLFVFSSLFTISSAEISGQPGVNYGQLGNNLPTPTTSVSLIKNLKAKRVKIYDANPQIL  68

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             K L  T I+V+IM+ NE +    + ++    A +WV  N++ F   T+IR +LVGNE++S
Sbjct  69    KALENTGIQVSIMLPNELV---TNVSSNQTLANQWVQTNLVPFYSKTLIRYLLVGNELIS  125

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
              ++ Q+ W  +VPAM  +K +L +  +H +KVGTP+AMD+L+TSFPPS+G FR DI    
Sbjct  126   STTNQT-WPHIVPAMYRMKHSLTIFGLHKVKVGTPLAMDVLQTSFPPSNGTFRNDIALS-  183

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L FL+ T S+FFLDVYP+F+W+ +P N++LD+ALF   N TV  DS TGLVYTNL
Sbjct  184   VMKPMLEFLHVTNSFFFLDVYPFFAWTSDPININLDYALFESDNITVT-DSGTGLVYTNL  242

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              DQM+D+V FAM+ LG+ D++I I+ETGWPN GDLDQ GA++HNA  YNRN V K+ + P
Sbjct  243   FDQMVDAVYFAMERLGYPDIQIFIAETGWPNDGDLDQIGANIHNAGTYNRNFVKKVTKKP  302

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
             P+GTPARPG  +P+FIF+LY+EN K G GTERH+G+L P G  +YE++L+   PE EY P
Sbjct  303   PVGTPARPGSILPSFIFALYNENLKTGLGTERHFGLLYPNGSRIYEIDLSGKTPEYEYKP  362

Query  567   LPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
             LP PD+   Y+G  WCVVA G     +  AL +AC+ GN TC+ + PG  C+EP S++ H
Sbjct  363   LPPPDD---YKGKAWCVVAEGANKTAVVEALSYACSQGNRTCELVQPGKPCFEPDSVVGH  419

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             A+YAFSS+WA++R  G +C FNGLAT    DPS+G+CK PSV +
Sbjct  420   ASYAFSSYWAQFRRVGGTCNFNGLATQIAEDPSYGSCKYPSVIL  463



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   487 bits (1254),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/470 (51%), Positives = 329/470 (70%), Gaps = 10/470 (2%)
 Frame = -3

Query  1659  MQKPIFALIFFT--LLASSNGLPSSNIGINYGRVGNDLPSAYETIETLK-AMRVSQVKIY  1489
             MQ  +  L+ F+  LLA  +    S IG+NYG++GN+LPS   ++  +K  ++  +VKIY
Sbjct  1     MQMGLLHLLVFSSLLLALCSAEILSKIGVNYGQLGNNLPSPTRSVWLIKHQLKAQRVKIY  60

Query  1488  DSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVL  1309
             D++  IL+ L  T I+V++MV NE I    +       A  WV  NV+ F P T IR +L
Sbjct  61    DANPSILRALEHTGIQVSVMVPNELI---NAIAVNQTLADSWVGSNVVPFHPATKIRYLL  117

Query  1308  VGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRF  1132
             VGNE+LS S+  + W  +VPAM+ +KKAL  H +H+ +KVGTP+AMD+L TS+PPSSG F
Sbjct  118   VGNEILS-SADNTTWFNLVPAMRKVKKALKRHKVHHKVKVGTPLAMDVLATSYPPSSGSF  176

Query  1131  RADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSE  952
             R D+  D+V+ P+L FLNRT+S+FF+DVYPYF+WS +P  + L++ALF   N TV  D  
Sbjct  177   RPDV-SDRVMKPMLQFLNRTKSFFFIDVYPYFAWSSDPKTIDLNYALFESKNVTVK-DPG  234

Query  951   TGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNL  772
             TGLVYTNL DQM+D+V FAM+ LG+ ++ I I+ETGWPN GD DQ GA+++NAA YNRN+
Sbjct  235   TGLVYTNLFDQMVDAVTFAMKKLGYPNIPIWIAETGWPNAGDYDQIGANIYNAATYNRNV  294

Query  771   VSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA  592
             V K+   P +GTPARPG  +P+F+F+LY+EN+K GPGTERH+G+L P    VY+++L+  
Sbjct  295   VKKLSARPAIGTPARPGWVLPSFMFALYNENQKTGPGTERHFGLLYPNDSFVYDIDLSGE  354

Query  591   VPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCY  412
              P+TEY  LP P NN PYEG +WCVVA       L  AL +AC+ GN TC  + PG  C+
Sbjct  355   TPDTEYGKLPAPTNNEPYEGKIWCVVAKRANRSALASALSYACSQGNATCGPIQPGKACH  414

Query  411   EPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
                S++  A+YAFSS+WA++R TG SCYFNGLAT T  DPS+G+C+ P+V
Sbjct  415   RKGSLVRQASYAFSSYWAQFRKTGGSCYFNGLATQTIEDPSYGSCEFPAV  464



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   487 bits (1254),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 240/445 (54%), Positives = 313/445 (70%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K+++   VK+YD+D E L LLS T + VTI V N 
Sbjct  40    ASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVPNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S ++    A  WV  N+L + P T IR VLVGNEVL + +  ++   +VPAM+ 
Sbjct  100   QI---TSLSSNQTTADEWVRTNILPYYPQTQIRFVLVGNEVL-NYNYGNISANLVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L    IHNIKVGTP+AMD L +SFPPS+G FR +I    V+LPLL FLN T SYFF
Sbjct  156   IVNSLRFRGIHNIKVGTPLAMDSLRSSFPPSNGTFREEIA-GPVILPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             ++V+PYF WS NP N +LD+ALF+G  ++   D +TGLVY NLLDQMLDSV+FAM  LG+
Sbjct  215   INVHPYFRWSRNPMNSTLDYALFQG--NSTYTDPQTGLVYRNLLDQMLDSVLFAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +R+AISETGWPN+GD+D+ GA++ NAA YNRNL+ KM   PP+GTP+RPG+ IPTF+F
Sbjct  273   PHIRLAISETGWPNSGDIDETGANILNAATYNRNLIKKMTASPPIGTPSRPGLPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGI+ P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENQKPGSGTQRHWGIMHPDGQPIYDIDFTGQRPLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L   L  AC   N TC  LAPG +CYEPVS+  HA+YA SS+WA++R+   
Sbjct  393   PVEGANEAELEDTLRTACGRSNTTCAALAPGRECYEPVSVYWHASYAISSYWAQFRNQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   RCYFNGLAHETTTNPGNDRCKFPSV  477



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score =   487 bits (1254),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/445 (54%), Positives = 307/445 (69%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR G D+PS Y++I  +K+++   VK+YD+D E L LLS T + V+I V N 
Sbjct  40    ASKIGINYGRQGKDIPSPYQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S       A+ WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ 
Sbjct  100   QI---TSLGTNQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVQD-RNITSNLVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  AL  H IHNIKVGTP+ MD L ++FPPS+  FR DI    ++LPLL FLN T SYFF
Sbjct  156   IVNALRAHGIHNIKVGTPLPMDSLRSTFPPSNSTFREDIA-GPLMLPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +++ PY+ W  NP N SLDFALF+G  ++   D  TGLVY NL+DQMLDSV+ AM  LG+
Sbjct  215   INLQPYYRWLRNPMNTSLDFALFQG--NSTYTDPRTGLVYHNLVDQMLDSVILAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWPN+GD+D+ GA++ NAA YNRNL+ KM   PP+GTPARPG+ IPTF+F
Sbjct  273   PHIRIAISETGWPNSGDIDETGANILNAATYNRNLIKKMTAIPPIGTPARPGLPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENKKSGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQMWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G +  +L  AL  AC   N TC  LAPG +CYEPVSI  HA YA SS+WA++R+   
Sbjct  393   PVEGAKEAELEEALRMACGRSNTTCAALAPGKECYEPVSIYWHARYAVSSYWAQFRTQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   GCYFNGLAHETTTNPGNDRCKFPSV  477



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   487 bits (1253),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 240/457 (53%), Positives = 316/457 (69%), Gaps = 9/457 (2%)
 Frame = -3

Query  1617  ASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRV  1438
             A++ G   + +GINYG +G+DLPSA  ++  L ++    VKIYD++  IL+ L+GT  RV
Sbjct  20    ATAKGGRFARLGINYGTLGDDLPSAARSVHLLHSIGAGAVKIYDANPAILRALAGTRFRV  79

Query  1437  TIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWL  1261
             +IMV NE IP+L  N + + A   WV  N+  F P   +R +LVGNE+LS +S A S W 
Sbjct  80    SIMVPNEIIPSLGVNASAADA---WVGTNLGPFYPAVRVRYLLVGNEILSYTSLANSTWP  136

Query  1260  QMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFL  1081
              +VPAM NI +AL+  +I ++KVGT +AMD L TSFPPS+G FR+DI  + V+ PLL FL
Sbjct  137   FLVPAMVNIHRALSARSIRDVKVGTTLAMDALVTSFPPSAGAFRSDIA-EPVMRPLLRFL  195

Query  1080  NRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVV  901
             +RTRSY+F+D YPYF+W+ NP ++ LD+ALF         D  + L YTNL DQMLD+V 
Sbjct  196   HRTRSYYFVDAYPYFAWASNPSSIRLDYALFTSNASFNYFDPGSKLTYTNLFDQMLDAVA  255

Query  900   FAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPG  721
              AM  LG  DVRIA++ETGWPN GDLDQ GA+VHNAA YNRNL  ++   P +GTPARPG
Sbjct  256   AAMGRLGSGDVRIAVAETGWPNAGDLDQIGANVHNAAIYNRNLARRLAARPAVGTPARPG  315

Query  720   VAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRP  541
               +P F+FSLY+EN+K GPGTERHWG+L P G  VYE++L+   P   YPPLP PDNN P
Sbjct  316   AVMPVFVFSLYNENQKPGPGTERHWGLLYPNGSKVYEVDLSGRRPLDSYPPLPPPDNNEP  375

Query  540   YEGNLWCVVA----TGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAF  373
             Y+G +WCV             +G AL +AC  GNGTCD + PGG CY+P ++LAHA+YAF
Sbjct  376   YKGKIWCVFGGDRKAAANATTVGAALAYACGQGNGTCDAIRPGGPCYKPNTLLAHASYAF  435

Query  372   SSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +S+W ++R  G +C+F+GLA  T  DPS+G CK  S+
Sbjct  436   NSYWQQFRQAGGTCFFDGLAVQTKTDPSYGTCKYASL  472



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   486 bits (1250),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 323/442 (73%), Gaps = 6/442 (1%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +GI YG++GN+LP    +++ +K ++  +VKIYD++ +IL  L GT ++V++MV NE I 
Sbjct  27    LGICYGQLGNNLPIPKNSVDLIKGLKAKRVKIYDTNPQILDALKGTNLQVSVMVPNELI-  85

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
                + +     A +WV +N++ F P TMIR +LVGNE+LS S   + W  +VP ++ I+ 
Sbjct  86    --NNISTNQTLADQWVKNNIVPFYPHTMIRYLLVGNEILS-SPPNTTWFNLVPTIRKIRF  142

Query  1227  ALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDV  1048
             ++    +  IKVGTP+A+D+LE+SFPPS+G FR+DI  ++V+ PLL+FLNRT+S+FF+DV
Sbjct  143   SVKKFGLGKIKVGTPLAIDMLESSFPPSNGTFRSDI-SEKVMKPLLHFLNRTKSFFFIDV  201

Query  1047  YPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDV  868
             YPYF+W+  P  ++LD+AL    N TV  D  TGLVYTNLLDQM+D+V +AM+ +G+ DV
Sbjct  202   YPYFAWASQPTVINLDYALLNSKNITVS-DPGTGLVYTNLLDQMIDAVYYAMKRVGYPDV  260

Query  867   RIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLY  688
             R+ I+ETGWPN G +DQ GA+++NAA YNRN++ K    PP+GTPA+PGV +PT +F+LY
Sbjct  261   RLFIAETGWPNAGGVDQIGANIYNAATYNRNVIKKFTVKPPIGTPAKPGVVVPTLLFALY  320

Query  687   DENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVAT  508
             +EN+K GPGTERH+G+L P G  +Y ++L+   PE+EY  LP   NN PY G +WCVV+ 
Sbjct  321   NENQKPGPGTERHFGLLYPNGTNIYGIDLSGKTPESEYKALPRARNNEPYTGKIWCVVSR  380

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
                  +LG A+ +AC  GN TCD++ PGG CY P S+++HANYAFSS+W++++S+G +CY
Sbjct  381   SANASELGGAMSYACGQGNRTCDEIQPGGKCYNPNSLVSHANYAFSSYWSQFKSSGGTCY  440

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGL   T  DPS+G+CK PSV
Sbjct  441   FNGLTIPTKKDPSYGSCKFPSV  462



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score =   485 bits (1249),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 241/445 (54%), Positives = 309/445 (69%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K ++   VK+YD+D E L LLS T + VTI V   
Sbjct  40    ASKIGINYGRQGNNLPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S +     A+ WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ 
Sbjct  100   QI---TSLSANQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVKD-RNITGNVVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L  H IHNIKVGTP+AMD L ++FPPS+  FR DI    ++LPLL FLN T SYFF
Sbjct  156   IVNSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFRGDIALP-LMLPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +++ PYF WS NP + +LDFALF+G  ++   D  TGLVY NL+DQMLDSV+FAM  LG+
Sbjct  215   INLQPYFRWSRNPNHTTLDFALFQG--NSTYTDPHTGLVYHNLVDQMLDSVIFAMTKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWPN+GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG  IPTF+F
Sbjct  273   PYIRIAISETGWPNSGDIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L  AL  ACA  N TC  L PG +CYEPVS+  HA+YA +S+WA++RS   
Sbjct  393   PVEGANETELEEALRMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRSQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  453   QCYFNGLAHETTTNPGNDRCKFPSV  477



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score =   485 bits (1248),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 241/445 (54%), Positives = 309/445 (69%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR GN+LPS Y++I  +K ++   VK+YD+D E L LLS T + VTI V   
Sbjct  35    ASKIGINYGRQGNNLPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTH  94

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S +     A+ WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ 
Sbjct  95    QI---TSLSANQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVKD-RNITGNVVPAMRK  150

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  +L  H IHNIKVGTP+AMD L ++FPPS+  FR DI    ++LPLL FLN T SYFF
Sbjct  151   IVNSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFRGDIALP-LMLPLLKFLNGTNSYFF  209

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +++ PYF WS NP + +LDFALF+G  ++   D  TGLVY NL+DQMLDSV+FAM  LG+
Sbjct  210   INLQPYFRWSRNPNHTTLDFALFQG--NSTYTDPHTGLVYHNLVDQMLDSVIFAMTKLGY  267

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWPN+GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG  IPTF+F
Sbjct  268   PYIRIAISETGWPNSGDIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVF  327

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  328   SLFNENKKPGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCV  387

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                G    +L  AL  ACA  N TC  L PG +CYEPVS+  HA+YA +S+WA++RS   
Sbjct  388   PVEGANETELEEALRMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRSQNV  447

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  TT +P +  CK PSV
Sbjct  448   QCYFNGLAHETTTNPGNDRCKFPSV  472



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 234/464 (50%), Positives = 332/464 (72%), Gaps = 9/464 (2%)
 Frame = -3

Query  1650  PIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEI  1471
             PIF+L    L++ S+   S+ +GINYG++GN+LPS  E++E +K+++  +VKIYD++ +I
Sbjct  8     PIFSLAL--LVSISSAEISNKVGINYGQLGNNLPSPSESVELIKSLKAKRVKIYDANPDI  65

Query  1470  LKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL  1291
             LK L  T I+V+IM+ NE I    + +   + +  WV  NV+ +     IR +LVGNE+L
Sbjct  66    LKSLKDTDIQVSIMIPNELI---QNISKSQSLSDHWVKTNVVPYYSDVKIRYLLVGNEIL  122

Query  1290  SDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             ++    + W  +VPAM+ IK +L  H I  IKVGT  A+++LE+SFPPS+G FR+DI   
Sbjct  123   TNPDTGT-WFNLVPAMRRIKASLKSHKIKKIKVGTTSAINVLESSFPPSNGTFRSDI-SG  180

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              ++ P+L FL+RT+S+FF+DVYPYF+W++N  N++LD+ALF+  N T   D  T L YTN
Sbjct  181   PIIKPMLRFLDRTKSFFFIDVYPYFAWADNYKNINLDYALFKAKNLTYT-DPGTNLTYTN  239

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             LLDQMLD+VVFAM+ LG+  VR+ I+ETGWPN GD+DQ GA+++N+A +NRN+V K+   
Sbjct  240   LLDQMLDAVVFAMKRLGYPGVRLFIAETGWPNDGDIDQIGANIYNSATFNRNVVKKLTTK  299

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-  574
             P +GTPARPG  IP+ IF+LY+EN+K GPGTERH+G+L P G  +YE++L+   P +EY 
Sbjct  300   PAIGTPARPGWVIPSIIFALYNENQKPGPGTERHFGLLYPNGTKIYEIDLSGDTPLSEYK  359

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
              PLP P NN PY+G +WC+VA G+    +  AL +AC+ GNGTCD +  G  CY+P S+ 
Sbjct  360   KPLPAPTNNEPYKGKIWCMVAKGVNETAVRDALSYACSQGNGTCDAIQTGKKCYKPDSLF  419

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
              HA+YAFSS+WA+++ +G +C FNGLATMT  DPS G CK P V
Sbjct  420   WHASYAFSSYWAQFKKSGGTCSFNGLATMTPKDPSFGHCKFPGV  463



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   484 bits (1246),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 235/442 (53%), Positives = 323/442 (73%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  E+++ +K++  ++VKIYD++H ILK L+GT I V++MV NE I  
Sbjct  25    GVNYGQLGNNLPSPTESVKLIKSLNATRVKIYDANHSILKALNGTDIAVSVMVPNEII--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +   A +  WV + +L F P T IR +LVGNEVLS+    +L   +V AM  IK +
Sbjct  83    -VNVSKSQAQSDDWVRNKILPFYPTTKIRYLLVGNEVLSNPDP-ALRSGLVSAMCKIKHS  140

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +H +KVGT +AMD+L+TS+PPSSG FR DI   +V+ P+L FLN+T+S+ F+DVY
Sbjct  141   LKRFGVHKVKVGTTLAMDVLQTSYPPSSGEFRPDI-AGRVMKPMLQFLNKTKSFLFVDVY  199

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+WS++P N++LD+ALF   N TV  D  T L Y NL DQM+D+ VFAM+ +G+ ++R
Sbjct  200   PYFAWSQDPKNINLDYALFESENITVT-DPVTNLTYHNLFDQMVDAFVFAMKRIGYPEIR  258

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA++HNAA YNRN+V K+  DPP+GTPARPG  +P+FIFSLY+
Sbjct  259   IWVAETGWPNNGDYDQIGANIHNAAIYNRNVVKKLTADPPVGTPARPGRVLPSFIFSLYN  318

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVVAT  508
             EN+K GPGTERH+G+  P G  VY+++L+     TEY   LPEP+NN PY+G +WCVVA 
Sbjct  319   ENQKPGPGTERHFGMYHPNGTRVYDIDLSGK--RTEYEDVLPEPENNEPYKGRIWCVVAK  376

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G    +LG AL +AC+ GN TC  + PGG+C +P  I+ HA+YAFSS+WA+ R +GA+C+
Sbjct  377   GANWTELGEALSYACSQGNNTCAPIRPGGECSKPDLIVLHASYAFSSYWAQSRKSGATCF  436

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DPS+G C+ PSV
Sbjct  437   FNGLATQTIKDPSYGRCEFPSV  458



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   484 bits (1245),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 228/461 (49%), Positives = 325/461 (70%), Gaps = 8/461 (2%)
 Frame = -3

Query  1650  PIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEI  1471
             P+  L     ++S+   P   +G+NYG++GN+LP   ++++ +++++  +VK+YD++ +I
Sbjct  7     PLLILCLSVSISSAELAP--KVGVNYGQLGNNLPPPSQSVKLIQSLKAKRVKLYDANPKI  64

Query  1470  LKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL  1291
             L  L  T ++V+IMV NE I    + ++    A  WV+ N++ F P T+IR +LVGNE+L
Sbjct  65    LTALRNTDLQVSIMVPNELI---NNISSNQTLADHWVYTNLVPFYPETLIRYLLVGNEIL  121

Query  1290  SDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             S    Q +W  +VPAM+ IK AL  H I  +KVGTP+AMD+LE+SFPPS+G FR+D+   
Sbjct  122   SQPDKQ-VWYNLVPAMRKIKAALKTHRITKVKVGTPLAMDVLESSFPPSNGTFRSDV-SG  179

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              VL P+L F+N+T+S+FF+DVY YF WS +P N+ L +ALF   N TV  D  +GL Y N
Sbjct  180   LVLKPMLKFINKTKSFFFVDVYTYFPWSSDPTNIDLAYALFESKNITVT-DPVSGLTYHN  238

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             L DQM+D+++FAM+ LG+ D RI I+ETGWP++GD DQ GA++ NAA YNRN+V K    
Sbjct  239   LFDQMVDALIFAMKRLGYPDTRIWIAETGWPSSGDFDQIGANIRNAATYNRNVVKKFNAK  298

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP  571
             PP+GTPARPGV +P+FIF+L++EN K GP TER++G+L P G  VY ++L+   P +EYP
Sbjct  299   PPVGTPARPGVVLPSFIFALFNENTKPGPSTERNFGLLYPNGSHVYPIDLSGKTPLSEYP  358

Query  570   PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
             PLP   NN+PYEG +WC+VA G     +  AL +AC+ GN TCD + PGG C++P S+  
Sbjct  359   PLPAAKNNKPYEGPIWCIVAKGANRSAVASALSYACSQGNKTCDPIQPGGKCFKPDSLFW  418

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             HA+YAFS++WA++R  G SCYF GLAT T  DPS+G+CK P
Sbjct  419   HASYAFSAYWAQFRKAGGSCYFGGLATQTIKDPSYGSCKFP  459



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score =   483 bits (1243),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 237/445 (53%), Positives = 308/445 (69%), Gaps = 7/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +S IGINYGR G DLPS Y++I  +K+++   VK+YD+D E L LLS T + V+I V N 
Sbjct  40    ASKIGINYGRQGKDLPSPYQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHNH  99

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I    S       A+ WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ 
Sbjct  100   QI---TSLGTNQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVQD-RNITANLVPAMRK  155

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             I  AL  H IHNIKVGTP+ MD L ++FPPS+  FR DI    ++LPLL FLN T SYFF
Sbjct  156   IVNALRAHGIHNIKVGTPLPMDSLRSTFPPSNSTFREDIA-GPLMLPLLKFLNGTNSYFF  214

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +++ PY+ W  NP N SLDFALF+G  ++   D  TGLVY NL+DQMLDSV+ AM  LG+
Sbjct  215   INLQPYYRWLRNPMNTSLDFALFQG--NSTYTDPRTGLVYHNLVDQMLDSVILAMIKLGY  272

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               +RIAISETGWPN+GD+D+ GA++ NAA YNRNL+ KM   PP+GTPARP + IPTF+F
Sbjct  273   PHIRIAISETGWPNSGDIDETGANILNAATYNRNLIKKMTAIPPIGTPARPALPIPTFVF  332

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SL++EN+K G GT+RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV
Sbjct  333   SLFNENQKSGSGTQRHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCV  392

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
             +  G    +L  AL  AC   N TC  LAPG +CY+PVSI  HA+YA SS+WA++R+   
Sbjct  393   LVEGANEAELEEALRIACGRSNTTCAALAPGKECYDPVSIYWHASYAVSSYWAQFRTQNV  452

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
              CYFNGLA  +T++P +  CK PSV
Sbjct  453   GCYFNGLAHESTINPGNDRCKFPSV  477



>gb|EYU31523.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=426

 Score =   481 bits (1238),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 238/419 (57%), Positives = 304/419 (73%), Gaps = 7/419 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             + +++ F    S     S+ IG+NYGR+GN+LPS +E+I+ L +M+   VK+YD+D E+L
Sbjct  14    LLSIMSFYSFCSGASNSSNKIGVNYGRLGNNLPSPFESIQLLLSMKAGHVKLYDADPEVL  73

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             KLLS T + VTIMV N++I   +   +  + A  W+ DNVL   P T IR +LVGNEV S
Sbjct  74    KLLSDTDLHVTIMVTNQEI---SMIASNESHADAWIDDNVLAHYPSTKIRFILVGNEVFS  130

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
              +  Q LWL +VPAM+ IK++LN H IHNIKVGTP+AMD LE++FPPSS RFR+ IP  +
Sbjct  131   YNDRQ-LWLDLVPAMRRIKRSLNKHQIHNIKVGTPLAMDALESTFPPSSARFRSSIPA-E  188

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V++PL+ FLN T+S+FF+DVY YF WS NP N SLD+AL + G +    D  +GL YTNL
Sbjct  189   VIVPLMRFLNSTKSFFFVDVYTYFPWSVNPTNTSLDYALMKSGINETYKDPVSGLTYTNL  248

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
             LDQMLDSV FAMQ LGFN+VR+AI+ETGWP+ GD D+PGA+ +NAA Y  NLV+K+  DP
Sbjct  249   LDQMLDSVHFAMQKLGFNNVRVAIAETGWPHDGDFDEPGANAYNAATYVSNLVAKVTSDP  308

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
             P+GTPA+PG+ IPTF+FSLYDEN+K GPGTERHWG+L  TG P+YE++LT    E     
Sbjct  309   PIGTPAKPGIEIPTFVFSLYDENQKPGPGTERHWGLLSNTGSPIYEVDLTGTSHENN-TK  367

Query  567   LPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPG-GDCYEPVSIL  394
             L EP NN PY G +WCVVA+     DLGPAL+FAC  GNGTCD LAPG G C  P  +L
Sbjct  368   LSEPSNNGPYNGKIWCVVASTASPDDLGPALEFACRQGNGTCDQLAPGHGSCEFPSVLL  426



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   481 bits (1237),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 318/441 (72%), Gaps = 6/441 (1%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             GI YG++G++LP A +++  L ++   +VK+YD++  IL  L  T ++V++MV N+ I  
Sbjct  29    GICYGQLGDNLPPARQSVSHLTSLHAKRVKLYDANPAILHALQHTRLQVSVMVPNDLI--  86

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + ++    A +WV  NV  FLP T IR +LVGNE++S S+  + W  +VPAM+ IK A
Sbjct  87    -MNISSNQTLADKWVSSNVAAFLPNTRIRYILVGNEIIS-STTNATWRHVVPAMRRIKHA  144

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    I  +KVGT  AMD+L+TSFPPS+  FR DI    V+ P+L FLNRT+S+FFLDVY
Sbjct  145   LKSLGIRKVKVGTSSAMDVLQTSFPPSNAAFREDIAVP-VMKPMLKFLNRTKSFFFLDVY  203

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             P+F+WS +P N++LD+ALF   N TV  D  +GLVYTNL DQM+D+V FAM+ LGF  +R
Sbjct  204   PFFAWSSDPVNINLDYALFESNNITVT-DPGSGLVYTNLFDQMVDAVYFAMEKLGFPGIR  262

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GDLDQ GA+V+NAA YNRN + K+ + P +GTPARPG  +P+F+F+L++
Sbjct  263   IFVAETGWPNGGDLDQIGANVYNAATYNRNFIKKVTRKPRVGTPARPGSLLPSFLFALFN  322

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATG  505
             EN+K GPGTERH+G+L P G  V++++L+   PE+++ PLP P+NN  ++G +WCV A  
Sbjct  323   ENQKSGPGTERHFGLLHPNGSRVFDIDLSGKTPESDFQPLPAPENNEKFKGKIWCVAARR  382

Query  504   IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYF  325
               + +L  AL +AC+ GNGTCD +   G C++P S+  HA+YAFS++WA+++  GA+CYF
Sbjct  383   DNVTELAAALSYACSQGNGTCDPIQTRGKCFKPGSVFWHASYAFSAYWAQFKKIGATCYF  442

Query  324   NGLATMTTVDPSHGACKVPSV  262
             NGLAT T  DPS+G+CK PSV
Sbjct  443   NGLATQTAKDPSYGSCKFPSV  463



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Fragaria vesca subsp. vesca]
Length=463

 Score =   478 bits (1230),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 324/455 (71%), Gaps = 8/455 (2%)
 Frame = -3

Query  1632  FFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSG  1453
             FF  ++S+    S+ +G+NYG++GN+LPS  E+++ ++ ++  +VKIYD++ +IL+ L  
Sbjct  13    FFISISSAEF--SAKVGVNYGQLGNNLPSPSESVKLIQNLKAKRVKIYDANPKILEALRN  70

Query  1452  TYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ  1273
             T ++V++MV NE I    + ++    A +WVH NV+ F P T+IR +LVGNE+LS +  +
Sbjct  71    TDLQVSMMVPNELI---NNISSNQTLANQWVHANVVPFYPHTLIRYLLVGNEILS-APDK  126

Query  1272  SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPL  1093
             S+W  +VPAM+ IKKAL +H I  +KVGTP AMD+LE+SFPPS+G FR+DI    V+ P+
Sbjct  127   SIWFNLVPAMRKIKKALKIHGITKVKVGTPSAMDVLESSFPPSNGTFRSDI-SSSVIKPM  185

Query  1092  LNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQML  913
             L FL +T+S+FF+DVYP+F W+ +P ++ LD+AL    N T   D  +GL Y NL DQM+
Sbjct  186   LKFLFKTKSFFFVDVYPFFPWASDPTHIDLDYALLEFTNITYT-DPVSGLTYHNLFDQMV  244

Query  912   DSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTP  733
             D+++FAM+  G+ D+R+ I+ETGWP+ GD DQ G ++HNAA YNRN++ K    PP+GTP
Sbjct  245   DALIFAMKRRGYPDIRVWIAETGWPSGGDYDQIGTNIHNAATYNRNVIKKFTAKPPVGTP  304

Query  732   ARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPD  553
             ARPGV +P+FIF+LY+EN K GPGTER++G+L P G  VYE++LT   P  E+ PLP   
Sbjct  305   ARPGVVLPSFIFALYNENMKPGPGTERNFGLLYPNGSNVYEIDLTGKTPVLEFKPLPPAT  364

Query  552   NNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAF  373
             NN+PY G +WC+V  G     +  AL +AC+ GN TCD + PGG C++P ++  HA+YAF
Sbjct  365   NNKPYPGPIWCLVKEGANKTAVAEALSYACSQGNKTCDPIQPGGKCFKPNTLAQHASYAF  424

Query  372   SSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             S++WA++R  G SC F GLA  T  DPS+G+CK P
Sbjct  425   SAYWAQFRKAGGSCSFGGLAVQTIKDPSYGSCKYP  459



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   478 bits (1230),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 223/440 (51%), Positives = 314/440 (71%), Gaps = 6/440 (1%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYG++GN+LP   ++++ +++++  +VK+YD++ +IL  L  T ++V+IMV NE I 
Sbjct  26    VGVNYGQLGNNLPPPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMVPNELI-  84

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
                + ++    A  WVH NV+ F P T+IR +LVGNE+LS    Q +W  +VPAM+ IK 
Sbjct  85    --NNISSNQTLADHWVHTNVVPFYPETLIRYLLVGNEILSQPDKQ-IWYNLVPAMRKIKA  141

Query  1227  ALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDV  1048
             AL  H I  +KVGTP+AMD+LE+SFPPS+G FR+D+    VL PLL F+N+T+S+FF+DV
Sbjct  142   ALKTHRITKVKVGTPLAMDVLESSFPPSNGTFRSDV-SGLVLKPLLKFINKTKSFFFVDV  200

Query  1047  YPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDV  868
             Y YF WS +P N+ L +ALF   N TV  D  +GL Y NL DQM+D+++FAM+ LG+ D 
Sbjct  201   YTYFPWSSDPTNIDLGYALFESKNITVT-DPVSGLTYHNLFDQMVDALIFAMKRLGYPDT  259

Query  867   RIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLY  688
             RI I+ETGWP+ GD DQ GA++ NAA YNRN+V K    PP+GTPARPGV  P+F+F+L+
Sbjct  260   RIWIAETGWPSGGDYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGVVFPSFVFALF  319

Query  687   DENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVAT  508
             +EN K GP TER++G+L P G  VY ++L+   P +EYPPLP   NN+P +G +WC+VA 
Sbjct  320   NENTKTGPSTERNFGLLYPNGSHVYPIDLSGKTPVSEYPPLPAAKNNKPXKGPIWCMVAK  379

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     +  AL +AC+ GN TCD + PGG C++P ++  HA+YAFS++WA++R  G SCY
Sbjct  380   GANRSAVASALSYACSQGNKTCDPIQPGGKCFKPDTLSWHASYAFSAYWAQFRKAGGSCY  439

Query  327   FNGLATMTTVDPSHGACKVP  268
             F GLAT T  DPS+G+CK P
Sbjct  440   FGGLATQTIKDPSYGSCKFP  459



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   475 bits (1222),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 237/461 (51%), Positives = 319/461 (69%), Gaps = 10/461 (2%)
 Frame = -3

Query  1629  FTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGT  1450
             F+ LA+  G   + +GINYG +G+DLPSA  ++  L+++    VKIYD++  IL+ L+GT
Sbjct  19    FSSLAAKGGR-FARLGINYGTLGDDLPSAARSVALLRSIGAGAVKIYDANPAILRALAGT  77

Query  1449  YIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQ  1273
              +RV+IMV NE IP+L +N + + A   WV   +  F P   +R +LVGNE+LS +S A 
Sbjct  78    RLRVSIMVPNEIIPSLGTNASLADA---WVAAYLTPFYPAVRVRYLLVGNEILSYTSLAN  134

Query  1272  SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPL  1093
             S W  +VPAM NI ++L   +I ++KV T  AMD L  SFPPS+G FR+DI  + V+ PL
Sbjct  135   STWPFLVPAMVNIHRSLIARSIRDVKVSTTFAMDALGISFPPSAGAFRSDIA-EPVIRPL  193

Query  1092  LNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQML  913
             L FL++TRSY+F+D YPY +W+ NP ++ LD+ALF   +     D  + L YTNLLDQML
Sbjct  194   LRFLHKTRSYYFVDAYPYLAWASNPSSIRLDYALFTANSSFNYFDPGSKLTYTNLLDQML  253

Query  912   DSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTP  733
             D+V  AM  LGF DVR+A++ETGWPN GDLDQ GA+VHNAA YNRNLV +M   P  GTP
Sbjct  254   DAVAAAMGRLGFGDVRMAVAETGWPNAGDLDQIGANVHNAATYNRNLVQRMAARPAAGTP  313

Query  732   ARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPD  553
             ARPG  +P FIFSLY+EN+K GPGTERHWG+L P G   Y+++L+   P   YP LP P+
Sbjct  314   ARPGALMPVFIFSLYNENQKPGPGTERHWGLLYPHGKMAYDVDLSGRRPLASYPSLPPPE  373

Query  552   NNRPYEGNLWCVVATGIRILD----LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHA  385
             NN PY+G +WCV   G R       +G AL +AC  GNGTCD + PGG C++P +I++HA
Sbjct  374   NNEPYKGRIWCVFGGGRRAASNATAVGAALAYACGQGNGTCDGIRPGGPCHKPNTIVSHA  433

Query  384   NYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +YAF+S+W  +R  GA+C+F+GLA  T  DPS+G+CK  S+
Sbjct  434   SYAFNSYWQLFRRAGATCFFDGLALQTKTDPSYGSCKYRSL  474



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   473 bits (1217),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 237/477 (50%), Positives = 323/477 (68%), Gaps = 9/477 (2%)
 Frame = -3

Query  1677  MFKAKEMQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQV  1498
             M + +EM      ++     + + G   + +GINYG +G+DLPSA  ++  L+++    V
Sbjct  1     MPRHREMALLPLLILLCLFSSLAKGGRFARLGINYGTLGDDLPSAARSVALLRSIGAGAV  60

Query  1497  KIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIR  1318
             KIYD++  IL+ L+GT +RV+IMV NE IP+L +N + + A   WV   +  F P   +R
Sbjct  61    KIYDANPAILRALAGTRLRVSIMVPNEIIPSLGTNASLADA---WVAAYLTPFYPAVRVR  117

Query  1317  GVLVGNEVLSDSS-AQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSS  1141
              +LVGNE+LS +S A S W  +VPAM NI ++L   +I ++KV T  AMD L  SFPPS+
Sbjct  118   YLLVGNEILSYTSLANSTWPFLVPAMVNIHRSLIARSIRDVKVSTTFAMDALGISFPPSA  177

Query  1140  GRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVV  961
             G FR+DI  + V+ PLL FL++TRSY+F+D YPY +W+ NP ++ LD+ALF   +     
Sbjct  178   GAFRSDIA-EPVIRPLLRFLHKTRSYYFVDAYPYLAWASNPSSIRLDYALFTANSSFNYF  236

Query  960   DSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYN  781
             D  + L YTNLLDQMLD+V  AM  LGF DVR+A++ETGWPN GDLDQ GA+VHNAA YN
Sbjct  237   DPGSKLTYTNLLDQMLDAVAAAMGRLGFGDVRMAVAETGWPNAGDLDQIGANVHNAATYN  296

Query  780   RNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNL  601
             RNLV +M   P  GTPARPG  +P FIFSLY+EN+K GPGTERHWG+L P G   Y+++L
Sbjct  297   RNLVQRMAARPAAGTPARPGALMPVFIFSLYNENQKPGPGTERHWGLLYPHGKMAYDVDL  356

Query  600   TTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILD----LGPALDFACAAGNGTCDDL  433
             +   P   YP LP P+NN PY+G +WCV   G R       +G AL +AC  GNGTCD +
Sbjct  357   SGRRPLASYPSLPPPENNEPYKGRIWCVFGGGRRAASNATAVGAALAYACGQGNGTCDGI  416

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
              PGG C++P +I++HA+YAF+S+W  +R  GA+C+F+GLA  T  DPS+G+CK  S+
Sbjct  417   RPGGPCHKPNTIVSHASYAFNSYWQLFRRAGATCFFDGLALQTKTDPSYGSCKYRSL  473



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   472 bits (1214),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 322/442 (73%), Gaps = 10/442 (2%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             IG+ YG +GN+LP+   +I+ ++ +   ++KIY ++ +ILK + GT ++++IMV N  IP
Sbjct  28    IGVCYGELGNNLPTPSASIQLIQKLNGKRIKIYGTNPKILKSIQGTDLQISIMVPNNLIP  87

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
              +++N   +    +WV  NV+ F P + IR +LVGNE+LS+    + W ++VPAM+ I+ 
Sbjct  88    DISTNQTLA---DQWVQTNVVPFYPESKIRYLLVGNEILSNP-PNTTWFKLVPAMRKIRS  143

Query  1227  ALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDV  1048
             ++  + +H IKVGTP+AMD LE+SFPPS+G FR+D+ R++V+ P+L+FLNRT+S+FF+DV
Sbjct  144   SVKKYGLHKIKVGTPLAMDALESSFPPSNGTFRSDV-REKVIRPMLHFLNRTKSFFFVDV  202

Query  1047  YPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDV  868
             Y YF+W   P  ++LD+AL +  N T   D  +GL YTNLLDQMLD++VFAM+ LG+ D+
Sbjct  203   YTYFAWVSQPLQINLDYALLQPTNITYT-DPVSGLTYTNLLDQMLDALVFAMKRLGYPDI  261

Query  867   RIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLY  688
             R+ ++ETGWP+ GD DQ GA+++NAA YNRN+V K M  PP+GTPARPG  IPT IF+LY
Sbjct  262   RLFLAETGWPSGGDPDQLGANIYNAATYNRNVVKKFMAKPPIGTPARPGAVIPTMIFALY  321

Query  687   DENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVAT  508
             +EN+K GPGTER++G+L P G  VY ++L+     ++YPPL +P NN    G LWCVVA 
Sbjct  322   NENQKPGPGTERNFGLLYPNGSHVYPIDLSGKTQVSDYPPLAKPANN----GKLWCVVAE  377

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     L  AL +AC+ GN TCD + PGG CY+P S++ HA+YAFSS+WA+ R+ GA+C 
Sbjct  378   GANKTALTGALSYACSQGNRTCDPIQPGGKCYKPNSLIKHASYAFSSYWAQMRAAGATCS  437

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             F+GLA M + DPS+GACK PSV
Sbjct  438   FSGLAVMISKDPSYGACKYPSV  459



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 312/442 (71%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  +++  +K++    VK+YD++  IL  L+ T I V++MV NE I  
Sbjct  25    GVNYGQLGNNLPSPSDSVTLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELI--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               +       +  W+  NVL F P T IR +LVGNE+LS   ++ L   +VPAM+ I+++
Sbjct  83    -VNITKSKTLSDDWIKSNVLPFYPSTKIRYLLVGNEILSSQDSE-LKSALVPAMRKIQRS  140

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +AMD+L +S+PPSSG FR+DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  141   LKTLGVKKVKVGTTLAMDVLNSSYPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVY  199

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W+++P +++LD+A+F   N TVV D  T L Y NL DQM+D+ VFAM+ LG+ D+R
Sbjct  200   PYFAWAQDPAHINLDYAIFESTNVTVV-DPVTNLTYHNLFDQMIDAFVFAMKRLGYPDLR  258

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+++NAA YNRN+V K+  +PP+GTPARPG  +P+FIF+LY+
Sbjct  259   IWVAETGWPNHGDYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFIFALYN  318

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVVAT  508
             EN+K GPGTERH+G+L P G  VYE+ L+     TEY   LP P+NN  Y+G +WCVVA 
Sbjct  319   ENQKTGPGTERHFGLLHPNGSQVYEIELSGKT--TEYKESLPAPENNEGYKGKIWCVVAK  376

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     LG AL +AC+ GN TCD + PGG C++P  ++ HA+YAFSS+WA +R  G +CY
Sbjct  377   GANWTQLGDALSYACSQGNNTCDSIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCY  436

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DP +G C+ PSV
Sbjct  437   FNGLATQTIKDPGYGRCEFPSV  458



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   473 bits (1217),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 326/469 (70%), Gaps = 7/469 (1%)
 Frame = -3

Query  1671  KAKEMQKPIFALIFFTLLAS-SNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVK  1495
             K  +M+  +  ++   L AS S+    + +G+NYG++GN+LP   ++++ ++++   +VK
Sbjct  49    KPTKMELGLLPVLILCLSASISSAELVAKVGVNYGQLGNNLPPPSQSVKLIQSLNAKRVK  108

Query  1494  IYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRG  1315
             +YD++ +IL  L  T ++V+IMV NE I   ++ ++    A +WV  NV+ F P T+IR 
Sbjct  109   LYDANPKILAALRNTDLQVSIMVPNELI---SNISSNQTLADQWVRTNVVPFYPDTLIRY  165

Query  1314  VLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGR  1135
             +LVGNE+LS  + Q +W  +VPAM+ IK AL  H I  +KVGTP+AMD+LE+SFPPS+G 
Sbjct  166   LLVGNEILSQPNKQ-IWFNLVPAMRKIKAALKTHRITKVKVGTPLAMDVLESSFPPSNGT  224

Query  1134  FRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDS  955
             FR+DI    V+ P+L F+N+T+S+FF+D+Y YF WS +P ++ L +AL    N TV  D 
Sbjct  225   FRSDI-SGSVIKPMLKFINKTKSFFFVDLYTYFPWSSDPTHIDLGYALLESKNITVT-DP  282

Query  954   ETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRN  775
              +GL Y NL DQM+D+++FAM+ LG+ D RI I+ETGWP+ GD DQ GA++ NAA YNRN
Sbjct  283   ASGLTYHNLFDQMVDALIFAMKRLGYPDTRIWIAETGWPSGGDYDQIGANIRNAATYNRN  342

Query  774   LVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT  595
             +V K    PP+GTPARPG  +P+F+F+L++EN K GP TER++G L P G  VY ++L+ 
Sbjct  343   VVKKFNAKPPVGTPARPGAVLPSFVFALFNENTKPGPSTERNFGFLYPNGSNVYPIDLSG  402

Query  594   AVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDC  415
               PE+EY PLP   NN PY+G +WC+VA G     +  AL +AC+ GN TCD + PGG C
Sbjct  403   KTPESEYAPLPVATNNEPYKGPIWCMVAKGANQSAVASALSYACSQGNKTCDPIQPGGKC  462

Query  414   YEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             ++P S+  HA+YAFS++W+++R  G SCYF GLAT T  DPS+G+CK P
Sbjct  463   FKPDSLAWHASYAFSAYWSQFRKAGGSCYFGGLATQTIKDPSYGSCKFP  511



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   472 bits (1214),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 237/500 (47%), Positives = 333/500 (67%), Gaps = 25/500 (5%)
 Frame = -3

Query  1722  INSSVVRSSDPKLSSMFKAKEMQKPIFALIFFTLL------------ASSNGLPSSNIGI  1579
             ++SS++RS    +SS    KE    I + I   L             A  +G P    G+
Sbjct  12    LHSSLLRSYQKLISSPQTKKEKNTAISSTIMSVLHLLTLSLLISISGAKFSGRP----GV  67

Query  1578  NYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPala  1399
             NYG++GN+LPS  +++  +K++    VK+YD++  IL  L+ T I V++MV NE I    
Sbjct  68    NYGQLGNNLPSPSDSVTLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELI---V  124

Query  1398  snnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALN  1219
             +       +  W+  NVL F P T IR +LVGNE+LS   ++ L   +VPAM+ I+++L 
Sbjct  125   NITKSKTLSDDWIKSNVLPFYPSTKIRYLLVGNEILSSQDSE-LKSALVPAMRKIQRSLK  183

Query  1218  LHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPY  1039
                +  +KVGT +AMD+L +S+PPSSG FR+DI    V+ P+L FLNRT+S+ F+DVYPY
Sbjct  184   TLGVKKVKVGTTLAMDVLNSSYPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVYPY  242

Query  1038  FSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIA  859
             F+W+++P +++LD+A+F   N TV+ D  T L Y NL DQM+D+ VFAM+ LG+ D+RI 
Sbjct  243   FAWAQDPAHINLDYAIFESTNVTVM-DPVTNLTYHNLFDQMIDAFVFAMKRLGYPDLRIW  301

Query  858   ISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDEN  679
             ++ETGWPN GD DQ GA+++NAA YNRN+V K+  +PP+GTPARPG  +P+FIF+LY+EN
Sbjct  302   VAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFIFALYNEN  361

Query  678   RKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP-PLPEPDNNRPYEGNLWCVVATGI  502
             +K GPGTERH+G+L P G  VYE+ L+     TEY   LP P+NN  Y+G +WCVVA G 
Sbjct  362   QKTGPGTERHFGLLHPNGSQVYEIELSGKT--TEYKEALPGPENNEGYKGKIWCVVAKGA  419

Query  501   RILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFN  322
                 LG AL +AC+ GN TCD + PGG C++P  ++ HA+YAFSS+WA +R  G +CYFN
Sbjct  420   NWTQLGDALSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFN  479

Query  321   GLATMTTVDPSHGACKVPSV  262
             GLAT T  DP +G C+ PSV
Sbjct  480   GLATQTIKDPGYGRCEFPSV  499



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   469 bits (1208),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 231/463 (50%), Positives = 322/463 (70%), Gaps = 14/463 (3%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             +  L++F     S+G P++ +GI YG +GN+LP   E++  ++ ++  +VKIYD++ EIL
Sbjct  2     LIGLLYFF----SDGTPATKLGICYGELGNNLPPPSESVRLIEKLKAGRVKIYDANPEIL  57

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             K L G  + V++M+ N+ IPA+A++   S     WV  NV  F P T IR +LVGNE+LS
Sbjct  58    KALKGKNLLVSVMLPNQLIPAVAADQKFS---DEWVRKNVAPFYPATKIRYILVGNEILS  114

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
             +    + W ++VPAMK I+ ++    +  IK+GTP+AMD+LE+S+PPS+G FR+ +  D 
Sbjct  115   NPP-NTTWFELVPAMKRIRISVVKLGMKKIKIGTPLAMDVLESSYPPSAGAFRSGVIADD  173

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ PLL FLNRT+S+FF+DVYPYF+W   P  + LD+AL +  N T   D  +GL YTNL
Sbjct  174   VIKPLLRFLNRTKSFFFVDVYPYFAWVSQPLQIKLDYALLQPTN-TTYTDPGSGLRYTNL  232

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
             LDQMLD+VV AM  LGF D+R+ ++ETGWPN G+ DQ GA+++NAA YNRN V K   +P
Sbjct  233   LDQMLDAVVSAMAKLGFPDIRLFVAETGWPNAGNPDQLGANIYNAATYNRNAVKKFSANP  292

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
             P+G P+RPG  IP  IF+L++EN+K GPGTERH+G L P G  VY ++L+   P + YPP
Sbjct  293   PVGIPSRPGAVIPATIFALFNENKKPGPGTERHFGQLYPDGKFVYPIDLSGKTPISAYPP  352

Query  567   LPEPDNNRPYEGNLWCVVATGIR-ILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
             L +P +N    G LWCVVA G+R    L  AL +AC  GNGTCD + PGG C+ P S++ 
Sbjct  353   LRKPASN----GRLWCVVANGVRNATSLTAALTYACGNGNGTCDGIRPGGKCFRPDSLIR  408

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             HA+Y FSS+WA++ + GA+C FNGLAT+T+ DPS+G CK PSV
Sbjct  409   HASYGFSSYWAQFSAQGATCSFNGLATLTSKDPSYGYCKYPSV  451



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   468 bits (1204),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 319/440 (73%), Gaps = 8/440 (2%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             IG++YG++G++LPS  E I  ++ M+  +VKIYD++ EILK LS T I+V++MV+NEDI 
Sbjct  29    IGVDYGQLGDNLPSTQEAIHLIQRMKAGRVKIYDTNPEILKALSHTGIKVSVMVKNEDI-  87

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
               A+ ++  + A +WV +NV+ F P T I  +LVGNE+LSD S    W Q+VPAM  I++
Sbjct  88    --ANVSSNQSFANKWVKNNVVYFYPATRINIILVGNEILSDYSNNQTWYQLVPAMLRIRR  145

Query  1227  ALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDV  1048
             AL  + +H+IKVGTP+AMD+L TSFPPSSG FR D+  + V+ P+L FL+RTRSYFF+DV
Sbjct  146   ALLRYKLHHIKVGTPLAMDVLNTSFPPSSGIFRDDVA-ETVMKPMLEFLSRTRSYFFIDV  204

Query  1047  YPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDV  868
             YPYF+WS +  N+SL++A F G +D    D   GLVYTNLLDQ LD+V+ AM  LG+ D+
Sbjct  205   YPYFAWSSDSNNISLEYANF-GDHDKNYTDPN-GLVYTNLLDQQLDAVIAAMSKLGYEDI  262

Query  867   RIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLY  688
             R+ I+ETGWPN GDL+Q GA++ NAA YNR ++ +M+ DPPLGTP RP   IPT+IFSL+
Sbjct  263   RLVIAETGWPNAGDLNQLGANIFNAAHYNRRIIRRMLADPPLGTPRRPNQFIPTYIFSLF  322

Query  687   DENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVAT  508
             +EN+K G GTERHWG+L P G  +YE++LT  + ++EY PLP      PY+G LWCVV  
Sbjct  323   NENQKTGLGTERHWGLLYPNGSRLYEIDLTGELQDSEYKPLPP--PPPPYKGKLWCVVDA  380

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
                +  L  A+ +AC+ GN TC  + PG  CY+P +++ HA+YAF+S+W +++++G +CY
Sbjct  381   NANVSALPSAITYACSQGNNTCVAIQPGKPCYQPNTVIDHASYAFNSYWQQFKNSGGTCY  440

Query  327   FNGLATMTTVDPSHGACKVP  268
             FNG AT+ T DPS   C+ P
Sbjct  441   FNGAATLVTKDPSSKICRYP  460



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   468 bits (1203),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 223/442 (50%), Positives = 311/442 (70%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  +++  +K++    VK+YD++  IL  L  T I V++MV NE I  
Sbjct  25    GVNYGQLGNNLPSPSDSVSLIKSLNAKSVKLYDANPSILAALKATDIVVSVMVPNELI--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               +       +  WV  NVL F P T IR +LVGNE+LS   ++ L   +VPAM+ I+++
Sbjct  83    -VNITKSKTLSDDWVKSNVLPFYPSTKIRYLLVGNEILSSPDSE-LKSALVPAMRKIQRS  140

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L +S+PPSSG FR+DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  141   LKTLGVKKVKVGTTLAVDVLNSSYPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVY  199

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W+++P +++LD+A+F   N TVV D  T L Y NL DQM+D+ VFAM+ LG+ D+R
Sbjct  200   PYFAWAQDPAHINLDYAIFESTNVTVV-DPVTNLTYHNLFDQMIDAFVFAMKRLGYPDLR  258

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+++NAA YNRN+V K+  +PP+G+PARPG  +P+FIF+LY+
Sbjct  259   IWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAAEPPVGSPARPGKVLPSFIFALYN  318

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVVAT  508
             EN+K GPGTERH+G+L P G  VYE+ L+     TEY   LP P+NN  Y+G +WCVVA 
Sbjct  319   ENQKTGPGTERHFGLLHPNGSQVYEIELSGKT--TEYKESLPAPENNEVYKGKIWCVVAK  376

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     LG AL +AC+ GN TCD + PGG C++P  ++ HA+YAFSS+WA +R  G +CY
Sbjct  377   GANWTQLGDALSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCY  436

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DP +G C+ PSV
Sbjct  437   FNGLATQTIKDPGYGRCEFPSV  458



>emb|CDP15107.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   462 bits (1189),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 209/329 (64%), Positives = 268/329 (81%), Gaps = 0/329 (0%)
 Frame = -3

Query  1245  MKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRS  1066
             M+ I  ++  HNIHNIKVGTP+AMDILE++FPPSSG+FR+DIP DQV++PLL FLN+T+S
Sbjct  1     MRRILDSVRSHNIHNIKVGTPLAMDILESTFPPSSGKFRSDIPHDQVIIPLLQFLNQTKS  60

Query  1065  YFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQY  886
             YFFL+V+PYF+WS NP NVSLD ALFRG  ++   D E+GL+YTNLLDQMLDSV+FA + 
Sbjct  61    YFFLNVFPYFTWSANPTNVSLDLALFRGDKNSSYRDPESGLIYTNLLDQMLDSVLFASKK  120

Query  885   LGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPT  706
             LG + V +AISETGWP+ GD+DQPGA+ +NAA YNRNLV +M  +PP+GTPARP V IPT
Sbjct  121   LGLDHVALAISETGWPHAGDIDQPGANRYNAATYNRNLVRRMSAEPPIGTPARPSVFIPT  180

Query  705   FIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNL  526
             FI++L+DE++  G GT RH+GIL+    PVY+L+LT  + E +YPPLP P NN P++GNL
Sbjct  181   FIYALFDEDQIPGRGTARHFGILQANSWPVYDLDLTGKLGEGDYPPLPLPSNNEPFKGNL  240

Query  525   WCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRS  346
             WCVVA+   I++L P L+  C+ GNG CD L+PG DCYEPV+I AHA+YAFSS+W K+RS
Sbjct  241   WCVVASEANIMELVPQLESVCSLGNGICDALSPGNDCYEPVTIRAHASYAFSSYWVKFRS  300

Query  345   TGASCYFNGLATMTTVDPSHGACKVPSVF  259
              GA+C+FNGLA ++T DPSHG+CK PSV+
Sbjct  301   RGAACHFNGLAVLSTTDPSHGSCKFPSVY  329



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   467 bits (1202),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 222/441 (50%), Positives = 313/441 (71%), Gaps = 7/441 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             GINYG++GN+LPS  ++++ +K++   +VK+YD++  IL  L+ T I V++MV N+ I  
Sbjct  34    GINYGQLGNNLPSPSDSVKLIKSLNAKRVKLYDANPTILAALNATDIAVSVMVPNQLI--  91

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +   + +  W+  N+L F P T IR +LVGNE+LS + ++ L   +VPAM+ I+++
Sbjct  92    -VNISKSDSLSDDWIRSNILPFYPDTKIRYLLVGNEILSSTDSE-LKSALVPAMRKIQRS  149

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L++SFPPSSG FR+DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  150   LKTLGVKKVKVGTSLAVDVLQSSFPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVY  208

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W+++P +V L +A+F   N TV  D  T L Y NL DQM+DS VFAM+ LG+ D+R
Sbjct  209   PYFAWAQDPTHVDLGYAIFESSNVTVT-DPVTNLTYHNLFDQMIDSFVFAMKRLGYPDLR  267

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+++NAA YNRN++ K   +PP+GTPARPG  +P FIF+LY+
Sbjct  268   IWVAETGWPNNGDYDQIGANIYNAATYNRNVIKKFAAEPPVGTPARPGEVLPAFIFALYN  327

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATG  505
             EN+K GPGTERH+G+L P G  VYE+ L+    E +   LP P+NN  Y+G +WCVVA G
Sbjct  328   ENQKTGPGTERHFGLLHPNGTQVYEIELSGKTTEFK-ESLPAPENNEVYKGKIWCVVAKG  386

Query  504   IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYF  325
                  LG AL +AC+ GN TCD + PGG C++P   + HA+YAFSS+WA +R TGA+C F
Sbjct  387   ANWTQLGDALSYACSQGNNTCDPIKPGGPCHKPDLTILHASYAFSSYWASFRKTGATCSF  446

Query  324   NGLATMTTVDPSHGACKVPSV  262
             NGLAT T  DPS+G C+ PSV
Sbjct  447   NGLATQTIKDPSYGRCEFPSV  467



>ref|XP_006830555.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
 gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   467 bits (1202),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/481 (49%), Positives = 327/481 (68%), Gaps = 26/481 (5%)
 Frame = -3

Query  1659  MQKPIFALIF-FTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAM-RVSQVKIYD  1486
             +Q   F+L F F  L  S G P   IGINYG++G++L S  ++I  ++ + +VS++KIYD
Sbjct  11    LQLLTFSLYFHFISLQISGGFP---IGINYGQLGSNLSSPLQSINLIQTLIKVSRIKIYD  67

Query  1485  SDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLV  1306
             ++ +IL  L+ T I+V++M+ N+ I    + +    A+  WV  N+L F P T IR +LV
Sbjct  68    TNPQILHALTNTKIQVSVMLPNQAI---QNISATQEASDSWVKTNILPFYPLTRIRTILV  124

Query  1305  GNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRA  1126
             GNEVLSDSS +  W  +VPAM+NIK++L    IHNIKVGTP+AMD+L+ SFPPSSG FR 
Sbjct  125   GNEVLSDSSIEPTWTMLVPAMQNIKRSLRALGIHNIKVGTPLAMDVLKASFPPSSGAFRD  184

Query  1125  DIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETG  946
             DI  + V+ PLL FL +T+S+FFLD YPY +W++N  ++ L++ LF     T   D  +G
Sbjct  185   DIA-ETVMRPLLQFLKKTKSFFFLDAYPYLTWADNLGSIDLNYTLFMNQTFTYK-DPNSG  242

Query  945   LVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVS  766
             LVY NLLDQM+D++V AM  LG+  +RI I+ETGWPN GD+DQ GA+++NAA YNRNL+ 
Sbjct  243   LVYRNLLDQMVDAIVSAMAKLGYPRIRITIAETGWPNAGDVDQIGANIYNAAHYNRNLIR  302

Query  765   KMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVP  586
             K+      GTP RP   + T+IFSLY+E++K G GTERHWG+L P G  V+E++L     
Sbjct  303   KLTSRE--GTPMRPNQTMFTYIFSLYNEDQKPGRGTERHWGLLYPNGSRVFEIDLNGRKL  360

Query  585   ETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEP  406
             ++EY PLPEP NN  ++G +WCVV  G  +  +GPALD ACA GNGTCD +  G +CYEP
Sbjct  361   DSEYEPLPEPVNNEEFKGKIWCVVVHGANVSAVGPALDHACAQGNGTCDAIKSGRECYEP  420

Query  405   VSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPS--------------HGACKVP  268
              +I+ HA+YAF+++W ++R +G +CYF+GLA  T VDPS              HG+C  P
Sbjct  421   NTIVGHASYAFNAYWQRFRKSGGTCYFDGLAEQTAVDPSEFSNLYPTTISEAGHGSCNYP  480

Query  267   S  265
             +
Sbjct  481   A  481



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   466 bits (1199),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 326/465 (70%), Gaps = 9/465 (2%)
 Frame = -3

Query  1650  PIF--ALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDH  1477
             P+F  ++  FT+  SS    S++ GI YG++G++LP   +++  + ++   +VK+YD++ 
Sbjct  8     PLFLSSIALFTI--SSATTFSTHPGICYGQLGDNLPPPQKSVSLITSLHAKRVKLYDANP  65

Query  1476  EILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNE  1297
              IL  L  T ++V+IMV N+ I    + +   + + +WV DNV+ + P T+IR +LVGNE
Sbjct  66    AILHALRDTSLQVSIMVPNDLI---VNISRNQSLSDKWVSDNVVPYHPRTLIRYLLVGNE  122

Query  1296  VLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIP  1117
             V S ++    W  +VPAM+ IK +L    I  +KVGT  A+D+LE SFPPS+G FR D+ 
Sbjct  123   VTSSTAPNGTWPYLVPAMRRIKHSLKSLGIRKVKVGTSSAIDVLEASFPPSNGAFRKDL-  181

Query  1116  RDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVY  937
                V+ P+L FLNRT+S+FFLDVYP+FSWS +P N++LD+ALF+  N TV  D  TGLVY
Sbjct  182   SAPVMKPMLKFLNRTKSFFFLDVYPFFSWSADPLNINLDYALFQSKNLTVT-DPGTGLVY  240

Query  936   TNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMM  757
             TNL DQM+D+V FAM  LGF  VRI I+ETGWPN GDLDQ GA++ NAA YNRN + K+ 
Sbjct  241   TNLFDQMVDAVYFAMNRLGFPGVRIFIAETGWPNGGDLDQIGANIFNAATYNRNFIKKVT  300

Query  756   QDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETE  577
             + P LGTPARPG A+P+F+F+L++EN+K GPGTERH+G+L P G  VY+++L+   PE  
Sbjct  301   RKPWLGTPARPGSALPSFLFALFNENQKPGPGTERHFGLLHPNGSRVYDVDLSGETPEAG  360

Query  576   YPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSI  397
             + PLP P+NN  ++G +WCV A       L  AL +AC+ GNGTCD + P G C++P S+
Sbjct  361   FRPLPVPENNEKFKGEIWCVAARPHNATALAAALAYACSQGNGTCDPIQPKGKCFKPDSV  420

Query  396   LAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
               HA+YAFS++WA++R  G +CYFNGLAT T  DPS+G+CK PSV
Sbjct  421   FWHASYAFSAYWAQFRKVGGTCYFNGLATQTAKDPSYGSCKFPSV  465



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   464 bits (1195),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 221/441 (50%), Positives = 316/441 (72%), Gaps = 7/441 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             GINYG++GN+LP+  ++I+ ++++   +VK+YD++ +IL  L+ T I V++MV NE I  
Sbjct  27    GINYGQLGNNLPTPSDSIKLIQSLNAKRVKLYDANPKILTALNSTDISVSVMVPNELI--  84

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +  +  +  WV   +L F P T IR +LVGNE+LS  ++Q L   +VPAM+ I+++
Sbjct  85    -INISKSNTLSDEWVKSKILPFYPTTKIRYLLVGNEILSSQNSQ-LKSSLVPAMRKIQRS  142

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  IKVGT +A+D+L+TSFPPSSG FR+DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  143   LKTLGVKKIKVGTTLAVDVLQTSFPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVY  201

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W ++P +V L++ALF   N TV+ D  T L Y NL DQM+D+ VFAM+ +G++D+R
Sbjct  202   PYFAWVQDPTHVDLNYALFESENVTVL-DPVTNLTYHNLFDQMIDAFVFAMKRIGYSDLR  260

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+++NAA YNRN+V K+  +PP+GTPARPG+ +P+FIF+LY+
Sbjct  261   IWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLTAEPPIGTPARPGLVLPSFIFALYN  320

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATG  505
             EN+K GPGTERH+G+L P G  VYE+ L+    E +   LP P+NN  Y+G +WCVVA G
Sbjct  321   ENQKTGPGTERHFGLLHPNGSQVYEIELSGKTTEFK-DSLPAPENNELYKGKIWCVVAKG  379

Query  504   IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYF  325
                  L  AL +AC+ GN TC+ +  GG C++P   + HA+YAFSS+WA++R TG +C F
Sbjct  380   ANWTQLRDALSYACSQGNNTCEPIQTGGLCHKPDLTVLHASYAFSSYWAQFRKTGGTCSF  439

Query  324   NGLATMTTVDPSHGACKVPSV  262
             NGLAT T  DPS+G C+ PSV
Sbjct  440   NGLATQTIKDPSYGRCEFPSV  460



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   464 bits (1195),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 231/463 (50%), Positives = 321/463 (69%), Gaps = 5/463 (1%)
 Frame = -3

Query  1650  PIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEI  1471
             P+F         SS    S   GI YG++G++LP   E++  + ++   +VK+YD++  I
Sbjct  8     PLFLSSILLFPISSATTFSPQPGICYGQLGDNLPPPRESVSLITSVHAKRVKLYDANPSI  67

Query  1470  LKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL  1291
             L  L  T ++V+IMV N+ I    + +     + +WV DNV+ + P T+IR +LVGNEV 
Sbjct  68    LHALQDTRLQVSIMVPNDLI---LNISTNQTLSDQWVSDNVVPYHPRTLIRYLLVGNEVT  124

Query  1290  SDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             S ++A + W  +VPAM+ IK++L  H I  IKVGT  AMD+L+TSFPPS+G FR D+   
Sbjct  125   STTAATATWPHLVPAMRRIKRSLKSHGIRKIKVGTSSAMDVLQTSFPPSNGAFRKDL-TA  183

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              V+ P+L FLNRT+S+FFLDVYP+F+WS +P N++LD+ALF     TV  D  +GLVYTN
Sbjct  184   PVMKPMLKFLNRTKSFFFLDVYPFFTWSADPLNINLDYALFESKTVTVK-DPVSGLVYTN  242

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             L DQM+D+V FAM+ LGF  VRI I+ETGWPN GDLDQ GA+ +NAA YNRN + K+ + 
Sbjct  243   LFDQMVDAVYFAMKRLGFPGVRIFIAETGWPNGGDLDQIGANTYNAATYNRNFIKKVTKK  302

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP  571
             P +GTPARPG A+P+F+F+L++EN+K GP TERH+G+L P G  VY+++L+   PE E+ 
Sbjct  303   PRVGTPARPGSALPSFLFALFNENQKPGPSTERHFGLLHPNGSRVYDVDLSGETPEAEFR  362

Query  570   PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
             PLP P+NN  ++G +WCV A       L  AL +AC+ GNGTCD +   G C++P S+  
Sbjct  363   PLPVPENNEKFKGRIWCVAARRDNATALTAALAYACSQGNGTCDPIQSKGKCFKPDSVFW  422

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             HA+YAFS++WA++R  G +CYFNGLAT T  DPS+G+CK PSV
Sbjct  423   HASYAFSAYWAQFRKVGGTCYFNGLATQTAKDPSYGSCKFPSV  465



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   464 bits (1194),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 225/444 (51%), Positives = 316/444 (71%), Gaps = 13/444 (3%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  +++  +K++   +VK+YD++ +IL  L+GT I V++MV NE I  
Sbjct  25    GVNYGQLGNNLPSPADSVNLIKSLNAKRVKLYDANPKILTALNGTDITVSVMVPNELI--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS--DSSAQSLWLQMVPAMKNIK  1231
               + +   + +  W+  N+L F P T IR +LVGNE+LS  DS  +S    +VPAM+ I+
Sbjct  83    -VNISKSESLSDDWIRSNILPFYPTTKIRYLLVGNEILSFPDSELKS---SLVPAMRKIQ  138

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             ++L    +  +KVGT +A+D+L++SFPPSSG FR+DI    V+ P+L FLNRT+S+ F+D
Sbjct  139   RSLKSLGVKKVKVGTTLAVDVLQSSFPPSSGEFRSDI-SGLVMKPMLQFLNRTKSFLFVD  197

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
             VYPYF+W+++P +V LD+A+F   N TV  D  T L Y NL DQM+D+ VFAM+ LG+ D
Sbjct  198   VYPYFAWAQDPTHVDLDYAIFESSNVTVT-DPVTNLTYHNLFDQMIDAFVFAMKRLGYPD  256

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             +RI ++ETGWPN GD DQ GA+++NAA YNRN+V K+  DPP+GTPARPG  +P F+F+L
Sbjct  257   LRIWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFAL  316

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVV  514
             Y+EN+K GPGTERH+G+L P G  VY ++L+     TEY   LP P+NN  Y+G +WCVV
Sbjct  317   YNENQKTGPGTERHFGLLHPNGTQVYGIDLSGKT--TEYKESLPAPENNEFYKGKIWCVV  374

Query  513   ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGAS  334
             A G     LG AL +AC+ GN TCD +  GG C++P   + HA+YAFSS+WA++R TG +
Sbjct  375   AKGANWTQLGDALSYACSQGNNTCDPIQRGGPCHKPDLTVLHASYAFSSYWAQFRKTGGT  434

Query  333   CYFNGLATMTTVDPSHGACKVPSV  262
             C FNGLAT T  DPS+G C+ PSV
Sbjct  435   CSFNGLATQTIKDPSYGRCEFPSV  458



>ref|XP_006830552.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
 gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   463 bits (1192),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/457 (50%), Positives = 324/457 (71%), Gaps = 8/457 (2%)
 Frame = -3

Query  1629  FTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAM-RVSQVKIYDSDHEILKLLSG  1453
             F ++AS      + IGINYG +G++LPS  ++I  ++++ +V +VK+Y+   +IL+ LS 
Sbjct  12    FAIMASLGASIHNPIGINYGLLGDNLPSTSQSIYLVQSLLKVPRVKLYEPRPDILQALSN  71

Query  1452  TYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ  1273
             T I+VTIMV N+ IP ++ + N S     WV  N+L F P T I+ +LVGNEVLSD S +
Sbjct  72    TNIQVTIMVPNQAIPNISLSQNVS---DSWVKINLLPFYPKTRIQTLLVGNEVLSDPSIK  128

Query  1272  SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPL  1093
             + W  +VPAM+N+K +L   ++ +IKVGT +AMD LE+SFPPS+G FR+DI    V+ PL
Sbjct  129   TTWSMLVPAMRNLKYSLRALDVGSIKVGTTLAMDTLESSFPPSNGTFRSDIAVP-VIKPL  187

Query  1092  LNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQML  913
             L FLN+T+S++F+DVYPYF+W+ N  +++L++ LF  G+     D  +GLVYTNLLDQ L
Sbjct  188   LQFLNKTKSFYFVDVYPYFAWAANYKSINLNYTLFMNGSAGYK-DPFSGLVYTNLLDQQL  246

Query  912   DSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTP  733
             D+V  AM  LG+ ++RI I+ETGWPN GDLDQ GA+V+NAA YNRN V K+  +  +GTP
Sbjct  247   DAVASAMAKLGYPNIRITIAETGWPNAGDLDQIGANVYNAAHYNRNFVRKLRSN--MGTP  304

Query  732   ARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPD  553
              RP   I  +IFSLY+EN K GPGTERHWG+L P G  VYE++LT   P ++Y PLPEP 
Sbjct  305   MRPNQTIFAYIFSLYNENLKGGPGTERHWGLLYPNGSRVYEVDLTGRTPNSKYAPLPEPK  364

Query  552   NNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAF  373
             NN  Y+G +WCVV  G  +  LGPAL +AC+  N TC+ +  G  C+ P ++++HA+YAF
Sbjct  365   NNEQYKGKIWCVVVPGANVTALGPALSYACSQANDTCNAIQRGKKCFMPNTLVSHASYAF  424

Query  372   SSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +S+W  +R TG +C+FNGLA  T ++PS+G+CK P++
Sbjct  425   NSYWQMFRGTGGTCFFNGLAVQTAINPSYGSCKFPTL  461



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   462 bits (1190),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 314/442 (71%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  +++  +K++   +VK+YD++ +IL  L+ T I V++MV NE +  
Sbjct  26    GVNYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNATDITVSVMVPNELL--  83

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +     +  W+  N+L F P T IR +LVGNE+LS + ++ L   +VPAM+ I+++
Sbjct  84    -VNISKSETLSDDWIRSNILPFYPTTKIRYLLVGNEILSFTDSE-LKASLVPAMRKIQRS  141

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L+TSFPPSSG FR DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  142   LKSLGVKKVKVGTSLAVDVLKTSFPPSSGEFREDI-SGLVMKPMLQFLNRTKSFLFVDVY  200

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W ++P ++ LD+ALF   N TV  D  T L Y NL DQM+D+ VFAM+ +G+ DVR
Sbjct  201   PYFAWVQDPTHMDLDYALFESTNVTVT-DPVTNLTYHNLFDQMIDAFVFAMKRIGYPDVR  259

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+V+NAA YNRN+V K+  +PP+GTPARPG  +P+F+F+LY+
Sbjct  260   IWVAETGWPNNGDYDQIGANVYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYN  319

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-PPLPEPDNNRPYEGNLWCVVAT  508
             EN+K GPGTERH+G+L P G  VY ++L+     TEY   LP P+NN  Y+G +WCVVA 
Sbjct  320   ENQKTGPGTERHFGLLHPNGTQVYGIDLSGKT--TEYGGALPVPENNEVYKGKIWCVVAK  377

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     LG AL +AC+ GN TCD + PGG C++P   + HA+YAFSS+WA++R +G +C 
Sbjct  378   GANWTQLGEALSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCS  437

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DPS+G C+ PSV
Sbjct  438   FNGLATQTIKDPSYGRCEFPSV  459



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   462 bits (1189),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 220/442 (50%), Positives = 311/442 (70%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  +++  +K++    VK+YD++  IL  L+ T I V++MV NE I  
Sbjct  25    GVNYGQLGNNLPSPSDSVSLIKSLNAKSVKLYDANPSILAALNATDIVVSVMVPNELI--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               +       +  W+  NVL F P T IR +LVGNE+LS   ++ L   +VPAM+ I+++
Sbjct  83    -VNITKSKTLSDDWIKSNVLPFYPSTKIRYLLVGNEILSSPDSE-LKSALVPAMRKIQRS  140

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L +S+PPSSG FR+DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  141   LKTLGVKKVKVGTTLAVDVLNSSYPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVY  199

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             P+ +W+++P +++LD+A+F   N TVV D  T L Y NL DQM+D+ VFAM+ LG+ D+R
Sbjct  200   PFCAWAQDPAHINLDYAIFESTNVTVV-DPVTNLTYHNLFDQMIDAFVFAMKRLGYPDLR  258

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+++NAA YNRN+V K+  +PP+G+PARPG  +P+FIF+LY+
Sbjct  259   IWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAAEPPVGSPARPGKVLPSFIFALYN  318

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVVAT  508
             EN+K GPGTERH+G+L P G  VYE+ L+     TEY   LP P+NN  Y+G +WCVVA 
Sbjct  319   ENQKTGPGTERHFGLLHPNGSQVYEIELSGKT--TEYKESLPAPENNEVYKGKIWCVVAK  376

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     LG AL +AC+ GN TCD + PGG C++P  ++ HA+YAFSS+WA +R  G +CY
Sbjct  377   GANWTQLGDALSYACSQGNNTCDPIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCY  436

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DP +G C+ PSV
Sbjct  437   FNGLATQTIKDPGYGRCEFPSV  458



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   462 bits (1188),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 219/442 (50%), Positives = 313/442 (71%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  +++  +K++   +VK+YD++ +IL  L+ T I V++MV NE +  
Sbjct  26    GVNYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILSALNATDITVSVMVPNELL--  83

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +     +  W+  N+L F P T IR +LVGNE+LS + ++ L   +VPAM+ I+++
Sbjct  84    -VNISKSETLSDDWIRSNILPFYPTTKIRYLLVGNEILSSTDSE-LKASLVPAMRKIQRS  141

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L+TSFPPSSG F+ DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  142   LKSLGVKKVKVGTSLAVDVLKTSFPPSSGEFKEDI-SGSVMKPMLQFLNRTKSFLFIDVY  200

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W ++P ++ L +ALF   N TV  D  T L Y NL DQM+D+ VFAM+ +G+ DVR
Sbjct  201   PYFAWVQDPTHMDLGYALFESTNVTVA-DPVTNLAYHNLFDQMIDAFVFAMKRIGYPDVR  259

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+++NAA YNRN+V K+  +PP+GTPARPG  +P+F+F+LY+
Sbjct  260   IWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYN  319

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-PPLPEPDNNRPYEGNLWCVVAT  508
             EN+K GPGTERH+G+L P G  VY ++L+     TEY   LP P+NN  Y+G +WCVVA 
Sbjct  320   ENQKTGPGTERHFGLLHPNGTQVYGIDLSGKT--TEYGGALPAPENNEVYKGKIWCVVAK  377

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     LG AL +AC+ GN TCD + PGG C++P   + HA+YAFSS+WA++R +G +C 
Sbjct  378   GANWTQLGEALSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCS  437

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DPS+G C+ PSV
Sbjct  438   FNGLATQTIKDPSYGRCEFPSV  459



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   462 bits (1188),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 237/463 (51%), Positives = 323/463 (70%), Gaps = 7/463 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             I   IF  L++ S  + SS +GINYG++GN+LPS   ++E +K+++  +VKIYD++ +IL
Sbjct  7     IHVFIFALLISISGAVISSEVGINYGQLGNNLPSPSRSVELIKSLKAKRVKIYDANPDIL  66

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             K L  T I+V+IMV N  IP ++ +   S    +WV  NV+ +     IR +LVGNE+L+
Sbjct  67    KSLKNTDIQVSIMVPNALIPNISKSQYFS---DQWVKTNVVPYYSDVKIRYLLVGNEILT  123

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
             +    + W  +VPAM+ IK +L  HNI  IKVGTP A+++LE+SFPPS+G FR DI    
Sbjct  124   NPDTGT-WFNLVPAMRRIKISLTRHNIRKIKVGTPSAINVLESSFPPSNGTFRPDI-SGT  181

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L FLNRT+S+FF+D YP+F+WSEN +N+SLD+ALF   N T   D  T L YTNL
Sbjct  182   VIKPMLQFLNRTKSFFFIDFYPFFAWSENAHNISLDYALFNAQNVTYT-DPGTNLTYTNL  240

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              DQM D+VVFAM+ LG+  +R+ I+ETGWPN GD +Q GA+++N+A YNRN+V K+   P
Sbjct  241   FDQMFDAVVFAMKRLGYPGIRVFIAETGWPNGGDFEQLGANIYNSATYNRNVVKKLTTIP  300

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-P  571
              +GTPA+PGV IP FIFSLY+EN+K GPGTER +G+  P G  V+E++L+   P + Y  
Sbjct  301   AIGTPAQPGVVIPAFIFSLYNENQKPGPGTERQFGLYYPNGTEVFEIDLSGKTPLSGYKK  360

Query  570   PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
             PLP P NN PY+G LWC+VA       +  AL +AC+ GN TCD++ PG  CY+PVS+  
Sbjct  361   PLPLPTNNEPYKGKLWCIVAKEANRSAVKDALAWACSQGNKTCDEIQPGKGCYKPVSLFW  420

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             HA+YAFSS+WA+++  G  C FNGLAT T  DPS G CK PSV
Sbjct  421   HASYAFSSYWAEFKKIGGVCSFNGLATTTVKDPSFGQCKFPSV  463



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   462 bits (1188),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 220/442 (50%), Positives = 313/442 (71%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  +++  +K++   +VK+YD++ +IL  L+ T I V++MV NE +  
Sbjct  26    GVNYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILTALNSTDITVSVMVPNELL--  83

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +     +  W+  N+L F P T IR +LVGNE+LS + ++ L   +VPAM+ I+++
Sbjct  84    -VNISKSETLSDDWIRSNILPFYPTTKIRYLLVGNEILSSTDSE-LKASLVPAMRKIQRS  141

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L+TSFPPSSG F+ DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  142   LKSLGVKKVKVGTSLAVDVLKTSFPPSSGEFKEDI-SGLVMKPMLQFLNRTKSFLFVDVY  200

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W ++P ++ LD+ALF   N TV  D  T L Y NL DQM+D+ VFAM+ +G+ DVR
Sbjct  201   PYFAWVQDPTHMDLDYALFESTNVTVT-DPVTNLTYHNLFDQMIDAFVFAMKRIGYPDVR  259

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA++ NAA YNRN+V K+  +PP+GTPARPG  +P+F+F+LY+
Sbjct  260   IWVAETGWPNNGDYDQIGANIFNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYN  319

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-PPLPEPDNNRPYEGNLWCVVAT  508
             EN+K GPGTERH+G+L P G  VY ++L+     TEY   LP P+NN  Y+G +WCVVA 
Sbjct  320   ENQKTGPGTERHFGLLHPNGTQVYGIDLSGKT--TEYGGELPAPENNEVYKGKIWCVVAK  377

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     LG AL +AC+ GN TCD + PGG C++P   + HA+YAFSS+WA++R +G +C 
Sbjct  378   GANWTQLGEALSYACSQGNNTCDPIQPGGSCHKPDLAVLHASYAFSSYWAQFRKSGGTCS  437

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DPS+G C+ PSV
Sbjct  438   FNGLATQTIKDPSYGRCEFPSV  459



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   485 bits (1249),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 231/445 (52%), Positives = 320/445 (72%), Gaps = 9/445 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             ++ +G+NYG++GN+LP+   +I  +K ++  +VKIYD++ +ILK L  T ++V+IM+ N+
Sbjct  802   ANEVGVNYGQLGNNLPTPKTSISLIKNLKAKRVKIYDANPQILKALENTGLQVSIMIPNQ  861

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              I      +     + +WV  N++ F P T+IR +LVGNE++S ++ Q+ W  +VPAM  
Sbjct  862   LI---TDISLNQTLSNQWVQSNLVPFYPKTLIRYLLVGNELISSTTNQT-WPHIVPAMHR  917

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             IK +L    +H +KVGTP+AMDIL+TSFPPS+G FR DI    V+ P+L FLN T S+FF
Sbjct  918   IKNSLTNFGLHKVKVGTPLAMDILQTSFPPSNGIFRNDIAF-TVIKPMLEFLNITNSFFF  976

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             LDVYP+FSW+ +P N++L++A+F   N TV  D  TGLVYTNL DQM+D+V FAM+ LGF
Sbjct  977   LDVYPFFSWASDPININLNYAIFESDNITVT-DPNTGLVYTNLFDQMVDAVYFAMERLGF  1035

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
             +D+RI I+ETGWPN GDLDQ GA+++NAA YNRN V K+ + P +GTPARPG  IP+FIF
Sbjct  1036  SDIRIFIAETGWPNGGDLDQIGANIYNAATYNRNFVKKVTKKPSVGTPARPGSIIPSFIF  1095

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCV  517
             SLY+EN K G GTERH+G+L P G  VYE++L+     +E+ PLP P+N   Y+G  WCV
Sbjct  1096  SLYNENLKPGLGTERHFGLLYPNGSSVYEIDLSGKTLASEFKPLPPPEN---YKGKAWCV  1152

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
             VA G     +  AL +AC+ GN TCD + PG  C+EPVS++ HA+YAFSS+WA++R+ G 
Sbjct  1153  VAEGANETAVAEALSYACSQGNRTCDPVQPGKPCFEPVSVIGHASYAFSSYWAQFRNVGG  1212

Query  336   SCYFNGLATMTTVDPSHGACKVPSV  262
             +C FNGLA     DPS+G+CK PSV
Sbjct  1213  TCQFNGLAIQIAKDPSYGSCKYPSV  1237



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   461 bits (1187),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/442 (50%), Positives = 313/442 (71%), Gaps = 8/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             GINYG++GN+LPS  ++++ +K++   +VK+YD++  IL  L+ T I V++MV N+ I  
Sbjct  34    GINYGQLGNNLPSPSDSVKLIKSLNAKRVKLYDANPTILAALNATDIAVSVMVPNQLI--  91

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +   + +  W+  N+L F P T IR +LVGNE+LS + ++ L   +VPAM+ I+++
Sbjct  92    -VNISKSDSLSDDWIRSNILPFYPDTKIRYLLVGNEILSSTDSE-LKSALVPAMRKIQRS  149

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L++SFPPSSG FR+DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  150   LKTLGVKKVKVGTSLAVDVLQSSFPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVY  208

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W+++P +V L +A+F   N TV  D  T L Y NL DQM+DS VFAM+ LG+ D+R
Sbjct  209   PYFAWAQDPTHVDLGYAIFESSNVTVT-DPVTNLTYHNLFDQMIDSFVFAMKRLGYPDLR  267

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+++NAA YNRN++ K   +PP+GTPARPG  +P FIF+LY+
Sbjct  268   IWVAETGWPNNGDYDQIGANIYNAATYNRNVIKKFAAEPPVGTPARPGEVLPAFIFALYN  327

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATG  505
             EN+K GPGTERH+G+L P G  VYE+ L+    E +   LP P+NN  Y+G +WCVVA G
Sbjct  328   ENQKTGPGTERHFGLLHPNGTQVYEIELSGKTTEFK-ESLPAPENNEVYKGKIWCVVAKG  386

Query  504   IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYF  325
                  LG AL +AC+ GN TCD + PGG C++P   + HA+YAFSS+WA +R TGA+C F
Sbjct  387   ANWTQLGDALSYACSQGNNTCDPIKPGGPCHKPDLTILHASYAFSSYWASFRKTGATCSF  446

Query  324   NGLATMTTVDPS-HGACKVPSV  262
             NGLAT T  DP+ +G C+ PSV
Sbjct  447   NGLATQTIKDPTGYGRCEFPSV  468



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   460 bits (1184),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 233/448 (52%), Positives = 314/448 (70%), Gaps = 15/448 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYGRV +D+PS   +++ L+A     VKIYD++  +L+ L+GT I V+IMV NE IP
Sbjct  35    LGVNYGRVADDIPSPRRSVQLLRAAGAGSVKIYDANPAVLRALAGTRIPVSIMVPNEIIP  94

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
              LA++  ++     WV  N+L +L  T ++ +LVGNEVLSD S A S W ++VPAM+N+ 
Sbjct  95    DLAASAAKA---DEWVVQNLLPYLAKTRVKFLLVGNEVLSDRSIATSTWPRIVPAMENLH  151

Query  1230  KALNLHNIHNIKVGTPVAMDILETSF---PPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             ++L    + ++K+GT +AMD L +     PPS+  FRADI  + V+ PLL FLN T SY+
Sbjct  152   RSLRARRVSSVKLGTTLAMDALVSGAFPRPPSAAVFRADIA-EAVVRPLLRFLNGTNSYY  210

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
             F+D YPYF+W+ N   V LD+ALF+GG+    VD  TGL YTNLLD+MLD+V  AM  LG
Sbjct  211   FVDAYPYFAWAGNNETVPLDYALFQGGSR--YVDPGTGLTYTNLLDEMLDAVGAAMSKLG  268

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
               +VR+AI+ETGWPN GD DQ G +  NAA YNRNL ++M ++P  GTPARPG  +P F+
Sbjct  269   HGEVRLAIAETGWPNGGDYDQIGGNARNAAVYNRNLAARMARNP--GTPARPGAKMPVFV  326

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWC  520
             FSLY+EN K GPGTERHWG+  P G  VY+++LT   P   YPPLP P+NN PY+G +WC
Sbjct  327   FSLYNENLKPGPGTERHWGLYYPDGTEVYQIDLTGRRPLWAYPPLPAPENNTPYKGPIWC  386

Query  519   VVATGIRILD---LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYR  349
             V+AT  R L+   +G AL +AC  GNGTCD + PGG+C++P +  AHA+YAF+S+W ++R
Sbjct  387   VLATHGRKLNETAVGDALTYACGQGNGTCDAVQPGGECFQPNTGEAHASYAFNSYWQQFR  446

Query  348   STGASCYFNGLATMTTVDPSHGACKVPS  265
               GA+CYFN LA  T  DPSHG+CK  S
Sbjct  447   KIGATCYFNNLAEQTIKDPSHGSCKFHS  474



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   459 bits (1181),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 222/457 (49%), Positives = 320/457 (70%), Gaps = 7/457 (2%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             LI   L++ S+   ++ +G+N+G++GN+LPS  E+++ +++++  +VKIYD++ +IL+ L
Sbjct  9     LILCFLVSISSAELAAKVGVNFGQLGNNLPSPSESVKLIQSLKAKRVKIYDANPKILEAL  68

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
               T ++V++MV NE I    + ++    A +WVH NV+ F P T+IR +LVGNE+LS   
Sbjct  69    RNTDLQVSMMVPNELI---NNISSNQTLADQWVHANVVPFYPETLIRYLLVGNEILSQPD  125

Query  1278  AQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLL  1099
              +++W  +VPAM+ IK AL  H I  +KVGTP+AMD+LE+SFPPS+G FR+D     V+ 
Sbjct  126   -KTIWFNLVPAMRKIKAALKTHGIAKVKVGTPLAMDVLESSFPPSNGTFRSDF-SASVIK  183

Query  1098  PLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQ  919
             PLL F+N+T+S+FF+DVY  F             ALF   N TV  D  +GL Y NL DQ
Sbjct  184   PLLQFVNKTKSFFFVDVYTSFX-XXXXXXXXXXXALFESKNITVK-DPVSGLTYHNLFDQ  241

Query  918   MLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLG  739
             M+D+++FAM+ LG+ D+RI I+ETGWP+ GD DQ GA++ NAA YNRN+V K    PP+G
Sbjct  242   MVDALIFAMKRLGYPDIRIWIAETGWPSGGDYDQIGANIRNAATYNRNVVKKFNAKPPVG  301

Query  738   TPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPE  559
             TPARPG  +P+F+F+LY+EN+K GP TER++G+L P G  VY ++L+   PE+EY PLP 
Sbjct  302   TPARPGSVLPSFLFALYNENKKPGPSTERNFGLLYPNGSNVYPIDLSGKTPESEYGPLPA  361

Query  558   PDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANY  379
               NN PY+G +WC+VA G     +  AL +AC+ GN TCD + PGG C++P S++ HA+Y
Sbjct  362   ATNNVPYKGPIWCLVAKGANRSAVASALSYACSQGNKTCDPIQPGGKCFKPDSLVWHASY  421

Query  378   AFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             AFS++WA++R+ G SCYF GLAT T  DPS G+CK P
Sbjct  422   AFSAYWAQFRNVGGSCYFGGLATQTIKDPSFGSCKFP  458



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   459 bits (1181),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 237/463 (51%), Positives = 322/463 (70%), Gaps = 7/463 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             I   IF  L++ S  + SS +GINYG++GN+LPS   ++E +K+++  +VKIYD++ +IL
Sbjct  7     IHVFIFALLISISGAVISSEVGINYGQLGNNLPSPSRSVELIKSLKAKRVKIYDANPDIL  66

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             K L  T I+V+IMV N  IP ++ +   S    +WV  NV+ +     IR +LVGNE+L+
Sbjct  67    KSLKNTDIQVSIMVPNALIPNISKSQYFS---DQWVKTNVVPYYSDVKIRYLLVGNEILT  123

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
             +    + W  +VPAM+ IK +L  HNI  IKVGTP A+++LE+SFPPS+G FR+DI    
Sbjct  124   NPDTGT-WFNLVPAMRRIKISLTRHNIRKIKVGTPSAINVLESSFPPSNGTFRSDI-SGT  181

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L FLNRT+S+FF+D YP+F+WSEN +N+SLD+ALF   N T   D  T L YTNL
Sbjct  182   VIKPMLQFLNRTKSFFFIDFYPFFAWSENAHNISLDYALFNAQNVTYT-DPGTNLTYTNL  240

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              DQM D+VVFAM+ LG+  +R+ I+ETGWPN GD +Q GA+++N+A YNRN+V K+   P
Sbjct  241   FDQMFDAVVFAMKRLGYPGIRVFIAETGWPNGGDFEQFGANIYNSATYNRNVVKKLATIP  300

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-P  571
              +GTPA+PGV IP FIFSLY+EN+K GPGTER +G+  P G  V E++L+   P + Y  
Sbjct  301   VIGTPAQPGVVIPAFIFSLYNENQKPGPGTERQFGLYYPNGTEVLEIDLSGKTPLSGYKK  360

Query  570   PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
             PLP P NN PY+G LWC+VA       +  AL +AC+ GN TCD + PG  CY+PVS+  
Sbjct  361   PLPLPTNNEPYKGKLWCIVAKEANRSAVKDALAWACSQGNTTCDKIQPGKGCYKPVSLFW  420

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             HA+YAFSS+WA+++  G  C FNGLAT T  DPS G CK PSV
Sbjct  421   HASYAFSSYWAEFKKIGGVCSFNGLATTTVKDPSFGQCKFPSV  463



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   456 bits (1174),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 211/369 (57%), Positives = 277/369 (75%), Gaps = 3/369 (1%)
 Frame = -3

Query  1368  RWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVG  1189
             +W+  N+L + P T+IR +LVGNE++S S+  S WL +VPAM+ IK +L    +  IKVG
Sbjct  19    QWIKSNILPYYPQTLIRYLLVGNEIIS-STPNSTWLHLVPAMRRIKHSLKKFRVKRIKVG  77

Query  1188  TPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNV  1009
             T  AMD+LETSFPPS+  FR DI   QV+ P+L FLNRT+S+FFLDVYP+F WS +P NV
Sbjct  78    TSSAMDVLETSFPPSNAAFRKDIAV-QVIKPMLRFLNRTKSFFFLDVYPFFPWSSDPVNV  136

Query  1008  SLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTG  829
             +LD+ALFR  N TV  D  +GLVYTNL DQM+D+V FAM+ LGF D+RI I+ETGWPN G
Sbjct  137   NLDYALFRESNVTVK-DPGSGLVYTNLFDQMVDAVYFAMEKLGFPDIRIFIAETGWPNGG  195

Query  828   DLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERH  649
             D+DQ GA+V NAA YNRN V K+M+ P +GTPARPG+ +P+F+F+L++EN K GPGTERH
Sbjct  196   DVDQIGANVFNAATYNRNFVKKVMKKPIVGTPARPGLILPSFLFALFNENIKPGPGTERH  255

Query  648   WGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDF  469
             +G+L P G  VY+++L+   PE E+P LP P+NN PY+G +WCV   G  +  LG AL +
Sbjct  256   FGLLYPNGSRVYDIDLSGKTPEVEFPALPPPENNEPYKGKIWCVAVRGSNVTALGEALTY  315

Query  468   ACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPS  289
             AC+ GN TCD + PG  C++P S+  HA+YAFSS+WA+++  G +CYFNGLAT T  DPS
Sbjct  316   ACSQGNRTCDPVQPGKKCFKPDSVFWHASYAFSSYWAQFKKIGGTCYFNGLATQTAKDPS  375

Query  288   HGACKVPSV  262
             +G+CK PSV
Sbjct  376   YGSCKFPSV  384



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   459 bits (1180),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 311/443 (70%), Gaps = 12/443 (3%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             GINYG++GN+LPS  +++  +K++   +VK+YD++ +IL  L+GT I V++MV NE +  
Sbjct  26    GINYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELL--  83

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS--DSSAQSLWLQMVPAMKNIK  1231
               + +  ++ +  W+  N+L F P T IR +LVGNE+LS  DS  +S    +VPAM+ I+
Sbjct  84    -VNISKSASLSDDWIRSNILPFYPTTKIRYLLVGNEILSLPDSELKS---SLVPAMRKIQ  139

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
              +L    +  +KVGT +A D+L++SFPPSSG FR DI    ++ P+L FLNRT+S+ F+D
Sbjct  140   HSLKSLGVKKVKVGTTLATDVLQSSFPPSSGEFREDI-SGLIMKPMLQFLNRTKSFLFVD  198

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
             VYPYF+W+++P +V LD+A+F   N TV  D  T L Y NL DQM+D+ VFAM+ LG+ D
Sbjct  199   VYPYFAWAQDPTHVDLDYAIFESTNVTVT-DPVTNLTYHNLFDQMIDAFVFAMKRLGYPD  257

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             +RI ++ETGWPN GD DQ GA+++NAA YNRN+V K+  DPP+GTPARPG  +P F+F+L
Sbjct  258   LRIWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFAL  317

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVA  511
             Y+EN+K GPGTERH+G+L P G  VY ++L+  +   E   LP PDNN  Y+G +WCVVA
Sbjct  318   YNENQKTGPGTERHFGLLHPNGTQVYGIDLSGKMEYKE--SLPAPDNNELYKGKIWCVVA  375

Query  510   TGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASC  331
              G     LG AL +AC+ GN TCD +  GG C +P   + HA+YAFSS+WA++R  G +C
Sbjct  376   KGANWTQLGDALSYACSQGNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGTC  435

Query  330   YFNGLATMTTVDPSHGACKVPSV  262
              FNGLAT T  DPS+G C+ PSV
Sbjct  436   SFNGLATQTIKDPSYGRCEFPSV  458



>dbj|BAE80092.1| glycosyl hydrolase family 17 [Silene latifolia]
Length=439

 Score =   457 bits (1177),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 226/440 (51%), Positives = 303/440 (69%), Gaps = 10/440 (2%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
              I  +LL  SN      IGINYG+ G++LP+ Y++I+T+  M+   V++YD+D E L+L+
Sbjct  8     FILSSLLKFSNAQRVDRIGINYGKQGSNLPTPYQSIDTIANMKAGMVRLYDTDSETLRLV  67

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             +GT + V I V N+DI        + + A +WVHDN+  + P TMIR ++VGNEV S+  
Sbjct  68    AGTSLHVVITVSNDDI---VDLARKESLASKWVHDNIFAYYPRTMIRYIMVGNEVYSNRV  124

Query  1278  A-QSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
                  W  +V AM +I K L  H IHNIKVGTP+ MDIL  +FPPS+G F+ D      +
Sbjct  125   VVPDQWDNLVLAMTHIMKVLKSHEIHNIKVGTPLGMDILSATFPPSNGTFKVDTL--TTM  182

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
             +PLL  L+R+ SYF L+VYPYF WS++  +++L+F LF GGN T   D  +GLVY N+LD
Sbjct  183   VPLLQLLHRSNSYFCLNVYPYFPWSKDTTHMNLNFTLFEGGNLTYK-DPYSGLVYNNVLD  241

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
             QMLDSV  AM  +GF +V IAISETGWP+ GDLDQPGA+V+NAA YNRNL+ K++ +PPL
Sbjct  242   QMLDSVYSAMSKIGFPNVPIAISETGWPSKGDLDQPGANVYNAATYNRNLIKKIVAEPPL  301

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLP  562
             GTPARPG  IP F+FSLYDEN K GP TERHWG+++P G PVY+++LT    +TE+ PLP
Sbjct  302   GTPARPGTIIPAFLFSLYDENLKDGPETERHWGLVKPNGTPVYQIDLTGT--QTEFDPLP  359

Query  561   EPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCD-DLAPGGDCYEPVSILAHA  385
                NN PY+G +WCVV     + +LG  +   C+  NGTC+  + PG DCY+PVSIL HA
Sbjct  360   NATNNMPYKGEVWCVVQRSANMTELGSMVTNLCSRLNGTCEAAIGPGNDCYQPVSILWHA  419

Query  384   NYAFSSFWAKYRSTGASCYF  325
             +Y FS++WA++R  G  C F
Sbjct  420   SYTFSAYWAQFRRHGTYCQF  439



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   459 bits (1180),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 230/449 (51%), Positives = 314/449 (70%), Gaps = 15/449 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYGRV +D+PS + ++E L+A     VKIYD++  +L+ L+GT   V+IMV N+ IP
Sbjct  33    LGVNYGRVADDIPSPWRSVELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIP  92

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD-SSAQSLWLQMVPAMKNIK  1231
              LA++   +    RWV +N++ + P T ++ +LVGNE+LSD S A S W  +VPAM+NI 
Sbjct  93    DLAASAAAA---DRWVAENLVPYYPATRVKFLLVGNEILSDLSIANSTWPHLVPAMENIH  149

Query  1230  KALNLHNIHNIKVGTPVAMDIL-ETSFP--PSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             ++L   +I ++K+GT +AMD L + +FP  PS+  FRADI  + V+ PLL+FLN T SY+
Sbjct  150   RSLRKRSISSVKIGTTLAMDALADGAFPRPPSAAAFRADI-AEAVVRPLLHFLNGTNSYY  208

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
             F+D YPYF W++N   VSLD+ALF+GG  T  VD  TGL YTNLLD+MLD+VV AM  LG
Sbjct  209   FVDAYPYFVWADNNLTVSLDYALFQGGR-TRYVDPGTGLTYTNLLDEMLDAVVIAMAKLG  267

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             +  V++AI+ETGWPN  D +Q G +VHNAA YNRNL ++M ++P  GTP RPG  +P F+
Sbjct  268   YGHVKLAIAETGWPNGCDYNQIGGNVHNAAIYNRNLAARMAKNP--GTPVRPGAKMPVFV  325

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWC  520
             FSLY+E+ K GPGTERHWG+    G  VYE++LT   P   YPPLP P+NN PY+G +WC
Sbjct  326   FSLYNEDLKPGPGTERHWGLYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYKGPIWC  385

Query  519   VVATG----IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
             V++      +    +G AL +AC  GNGTCD + PG  CY P +  AHA+YAF+S+W ++
Sbjct  386   VLSAAASNKLNETAVGNALSYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNSYWQQF  445

Query  351   RSTGASCYFNGLATMTTVDPSHGACKVPS  265
               TGA+CYFN LA  T  DPSHG+C+ PS
Sbjct  446   EKTGATCYFNNLAEQTIKDPSHGSCRFPS  474



>ref|XP_008792941.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X3 [Phoenix dactylifera]
Length=389

 Score =   455 bits (1171),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 269/370 (73%), Gaps = 4/370 (1%)
 Frame = -3

Query  1365  WVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGT  1186
             W+  N+L F P   IR +LVGNEVLSD S +S W  +VPAM N+ +AL   +I ++KVGT
Sbjct  20    WLAANLLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRALRARSIRDVKVGT  79

Query  1185  PVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVS  1006
              +AMD L+TSFPPS+G FR DI    V+ PLL F NRTRS++F+DVYPYF+W+ +P  VS
Sbjct  80    TLAMDSLKTSFPPSAGEFRDDIA-GTVIRPLLRFANRTRSFYFVDVYPYFAWASSPSTVS  138

Query  1005  LDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGD  826
             LD+ALFRG + T  +D  T L YTNLLDQMLDSVV AM  LGF  VR+AI+ETGWPN GD
Sbjct  139   LDYALFRGNSATNYLDPGTHLTYTNLLDQMLDSVVAAMAKLGFGGVRLAIAETGWPNAGD  198

Query  825   LDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHW  646
             LDQ GA+++NAA YNRNL  ++ + P LGTPARPG  +P F+F+LY+EN+K GPGTERHW
Sbjct  199   LDQIGANIYNAATYNRNLARRLSKRPALGTPARPGAVMPVFVFALYNENQKPGPGTERHW  258

Query  645   GILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIR---ILDLGPAL  475
             G+L P    VYE++LT   P+  Y PLP P+NN PY+G +WCV   G +     ++G A+
Sbjct  259   GLLYPNATRVYEVDLTGRRPDASYGPLPAPENNEPYKGKIWCVFGGGKKGANATEVGAAI  318

Query  474   DFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVD  295
              +AC  G GTCD + PGG CY P S  AHA+YAF+S+W ++R +G +CYFNGLA  T  D
Sbjct  319   AYACGQGKGTCDAIQPGGPCYRPASPTAHASYAFNSYWQQFRRSGGTCYFNGLAVQTAQD  378

Query  294   PSHGACKVPS  265
             PSHG+CK PS
Sbjct  379   PSHGSCKYPS  388



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   457 bits (1175),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 218/442 (49%), Positives = 312/442 (71%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++GN+LPS  +++  +K++   +VK+YD++ +IL  L+ T I V++MV NE +  
Sbjct  25    GVNYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNATDITVSVMVPNELL--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +   + +  W+  N+L F P T IR +LVGNE+LS   ++ L   +VPAM+ I+++
Sbjct  83    -VNISKSESLSDDWIRSNILPFYPTTKIRYLLVGNEILSSPDSE-LKASLVPAMRKIQRS  140

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L+TSFPPS G FR DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  141   LKSLGVKKVKVGTSLAVDVLQTSFPPSKGEFREDI-SGLVMKPMLQFLNRTKSFLFVDVY  199

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF+W+++  +V LD+ALF   N+  V D  T L Y NL DQM+D+ VFAM+ LG+ DVR
Sbjct  200   PYFAWAQDQTHVDLDYALFES-NNVTVTDPGTNLTYHNLFDQMIDAFVFAMKRLGYPDVR  258

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+++NAA YNRN+V K+  +PP+GTPARPG  +P+F+F+LY+
Sbjct  259   IWVAETGWPNGGDYDQIGANIYNAATYNRNVVKKLAAEPPVGTPARPGKVLPSFVFALYN  318

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVVAT  508
             EN+K G GTERH+G+L P G  VY ++L+     TEY   LP P+NN  Y+G +WCVVA 
Sbjct  319   ENQKTGQGTERHFGLLHPNGTQVYGIDLSGKT--TEYKESLPAPENNEVYKGKIWCVVAK  376

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G    +LG AL +AC+ GN TCD +  GG C++P   + HA+YAFSS+WA++R +G +C 
Sbjct  377   GANWTELGEALSYACSQGNKTCDPIQSGGPCHKPDLAVLHASYAFSSYWAQFRKSGGTCS  436

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DPS+G C+ PSV
Sbjct  437   FNGLATQTIKDPSYGRCEFPSV  458



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   457 bits (1177),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 230/449 (51%), Positives = 313/449 (70%), Gaps = 15/449 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYGRV +D+PS   ++E L+A     VKIYD++  +L+ L+GT   V+IMV NE IP
Sbjct  37    LGVNYGRVADDIPSPRRSVELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNEIIP  96

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
              LA++   +    RWV  N++ + P T ++ +LVGNE+LSD S A S W ++VPAM+NI 
Sbjct  97    DLAASVAAA---DRWVAKNLVPYYPATRVKFLLVGNEILSDHSIANSTWPRLVPAMENIH  153

Query  1230  KALNLHNIHNIKVGTPVAMDIL-ETSFP--PSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             ++L    I ++K+GT +AMD L + +FP  PS+  FRADI  + V+ PLL+FLN T SY+
Sbjct  154   RSLRKRGISSVKIGTTLAMDALADGAFPRPPSAATFRADI-AEAVVRPLLHFLNGTNSYY  212

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
             F+D YPYF W++N   VSLD+ALF+GG     VD  T L YTNLLD+MLD+VV AM  LG
Sbjct  213   FVDAYPYFVWADNNLTVSLDYALFQGGR-LRYVDPGTRLTYTNLLDEMLDAVVIAMAKLG  271

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             +  V++AI+ETGWPN  D DQ G +VHNAA YNRNL ++M+++P  GTP RPG  +P F+
Sbjct  272   YGHVKLAIAETGWPNGCDYDQIGGNVHNAAIYNRNLAARMVKNP--GTPVRPGAKMPVFV  329

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWC  520
             FSLY+E+ K GPGTERHWG+    G  VYE++LT   P   YPPLP P+NN PY+G +WC
Sbjct  330   FSLYNEDLKPGPGTERHWGLYYANGTAVYEIDLTGRRPLWSYPPLPAPENNTPYKGPIWC  389

Query  519   VVATG----IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
             +++      +    +G AL +AC  GNGTCD + PG +CY P + +AHA+YAF+S+W ++
Sbjct  390   LLSAAASNKLNETAVGNALTYACGQGNGTCDAIQPGKNCYMPNTTVAHASYAFNSYWQQF  449

Query  351   RSTGASCYFNGLATMTTVDPSHGACKVPS  265
             R  GA+CYFN LA  T  DPSHG+CK PS
Sbjct  450   RKIGATCYFNNLAEQTIKDPSHGSCKFPS  478



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   456 bits (1174),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 221/444 (50%), Positives = 314/444 (71%), Gaps = 14/444 (3%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             GINYG++GN+LPS  +++  +K++   +VK+YD++ +IL  L+GT I V++MV NE +  
Sbjct  26    GINYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELL--  83

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS--DSSAQSLWLQMVPAMKNIK  1231
               + +  ++ +  W+  N+L F P T IR +LVGNE+LS  DS  +S    +VPAM+ I+
Sbjct  84    -VNISKSASLSDDWIRSNILPFYPTTKIRYLLVGNEILSLPDSELKS---SLVPAMRKIQ  139

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             ++L    +  +KVGT +A D+L++SFPPSSG FR DI    ++ P+L FLNRT+S+ F+D
Sbjct  140   RSLKSLGVKKVKVGTTLATDVLQSSFPPSSGEFREDI-SGLIMKPMLQFLNRTKSFLFVD  198

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
             VYPYF+W+++P +V LD+A+F   N TV  D  + L Y NL DQM+D+ VFAM+ +G+ D
Sbjct  199   VYPYFAWAQDPTHVDLDYAIFESTNVTVT-DPVSNLTYHNLFDQMIDAFVFAMKRVGYPD  257

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             +RI ++ETGWPN GD DQ GA+++NAA YNRN+V K+  DPP+GTPARPG  +P F+F+L
Sbjct  258   IRIWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFAL  317

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVV  514
             Y+EN+K GPGTERH+G+L P G  VY ++L+    +TEY   LP P+NN  Y+G +WCVV
Sbjct  318   YNENQKTGPGTERHFGLLHPNGTQVYGIDLSG---KTEYKESLPAPENNDLYKGKIWCVV  374

Query  513   ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGAS  334
             A G     LG AL +AC+ GN TCD +  GG C +P   + HA+YAFSS+WA++R  G +
Sbjct  375   AKGANWTQLGDALSYACSQGNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGT  434

Query  333   CYFNGLATMTTVDPSHGACKVPSV  262
             C FNGLAT T  DPS+G C+ PSV
Sbjct  435   CSFNGLATQTIKDPSYGRCEFPSV  458



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   457 bits (1175),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 238/463 (51%), Positives = 323/463 (70%), Gaps = 7/463 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             IFAL+       +    SS +GINYGR+GNDLPS  +++E +K+++  +VKIYD++ +IL
Sbjct  20    IFALLISISGKFAGAEISSEVGINYGRLGNDLPSPSKSVELIKSLKAKRVKIYDANPDIL  79

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             K L  T I+V+IMV N  IP ++++ + S    +WV  NV+ + P   IR +LVGNE+L+
Sbjct  80    KSLKNTDIQVSIMVPNALIPNMSTSQHFS---DQWVETNVVPYYPDVKIRYLLVGNEILT  136

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
             +    + W  +VPAM+ IK +L   N   IKVGTP A+++LE+S PPS+G FR+D+    
Sbjct  137   NPDTGT-WFNLVPAMRRIKISLTRRNFRKIKVGTPSAINVLESSSPPSNGTFRSDV-SGP  194

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L FLNRT+S+FF+D YP+F+WSEN  N+SLD+AL    N T   D  T L YTNL
Sbjct  195   VIKPMLQFLNRTKSFFFIDFYPFFAWSENAPNISLDYALSNAQNVTYT-DPGTNLTYTNL  253

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              DQM D+VVFAM+ LG+  +R+ I+ETGWPN GD +Q GA+ +N+A YNRN+V K+   P
Sbjct  254   FDQMFDAVVFAMKRLGYPGIRVFIAETGWPNGGDFEQFGANTYNSATYNRNVVKKLTTIP  313

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY-P  571
              +GTPARPGVAIP FIFSLY+EN+K GPGTERH+G+  P G  V+E++L+   P + Y  
Sbjct  314   AIGTPARPGVAIPAFIFSLYNENQKPGPGTERHFGLYYPNGTEVFEIDLSGKTPLSGYKK  373

Query  570   PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
             PLP P NN PY+G LWCVVA       +  AL +AC+ GN TCD++ PG +CY+PVS+  
Sbjct  374   PLPLPTNNEPYKGKLWCVVAKEANRSAVKDALAWACSQGNKTCDEIQPGKECYKPVSLFR  433

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             HA+YAFSS+WA+++  G  C FNGLAT T  DPS G CK PSV
Sbjct  434   HASYAFSSYWAEFKKIGGVCSFNGLATTTFKDPSFGQCKFPSV  476



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   447 bits (1151),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/464 (48%), Positives = 318/464 (69%), Gaps = 16/464 (3%)
 Frame = -3

Query  1641  ALIFFTLLAS----SNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHE  1474
             A I   LLAS    S G     +G+ YG +GN+LPS  ++I+ ++ +   ++KIY ++ +
Sbjct  6     AFIALFLLASPATFSYGEMQPKMGVCYGELGNNLPSPEKSIQLIQKLNAKRIKIYGANPK  65

Query  1473  ILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEV  1294
             ILK + GT ++++IMV N+ I   ++  N    A  WV  NV+ F P + IR +LVGNE+
Sbjct  66    ILKSIQGTDLQISIMVPNQLI---SAIYNNQTLADDWVKTNVVPFYPQSKIRYLLVGNEI  122

Query  1293  LSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPR  1114
             LS S   S W Q+VPA++ I+ A+  + +  +KVGTP+AMD+LE+S+PPS+G FR+D+  
Sbjct  123   LS-SQPNSTWFQLVPAIRRIRNAVKKYGLKKVKVGTPLAMDVLESSYPPSNGTFRSDV-S  180

Query  1113  DQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYT  934
             + V+ PLL+FLNRT+S+FF+DVY YF+W+  P  +SLD+AL +  N T   D  TGL+YT
Sbjct  181   ETVVEPLLHFLNRTKSFFFVDVYTYFAWASLPLQISLDYALLQPTNITYT-DPGTGLLYT  239

Query  933   NLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQ  754
             NLLDQMLD+ VFAM  LG+  +R+ ++ETGWP+ GD +Q GA++HNAA YNRN+V K M 
Sbjct  240   NLLDQMLDAHVFAMARLGYPYIRLFVAETGWPSGGDPNQIGANIHNAATYNRNVVKKFMA  299

Query  753   DPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY  574
              PP GTPARP   IP+ IF+LY+EN+K G GTER++G+L P G  VY ++L+    ++ Y
Sbjct  300   KPPYGTPARPYTVIPSMIFALYNENQKPGQGTERNFGLLYPNGSNVYPIDLSGKTRDSRY  359

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
             PPLP P+        LWCV   G  +  +G A+ +AC+ GN TCD + PGG C+ P S+ 
Sbjct  360   PPLPNPNR------KLWCVAVKGANLRAMGGAMSYACSQGNRTCDPIQPGGKCFNPNSLA  413

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
              HA+YAFSS+WA+    GA+C+F+GLA MT+ DPS G+CK PS+
Sbjct  414   VHASYAFSSYWAQLWKEGATCFFDGLAFMTSKDPSFGSCKFPSI  457



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   448 bits (1153),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 227/449 (51%), Positives = 306/449 (68%), Gaps = 14/449 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYGRV +D+P+   +++ L+A     VKIYD++  +L+ L+GT + V+IMV N+ IP
Sbjct  43    LGVNYGRVADDIPTPRRSVQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIP  102

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
              LA++   +    RWV  N+L +LP T ++ +LVGNEVLSD S A S W ++VPAM+N+ 
Sbjct  103   DLAASYAAA---DRWVAANLLPYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLH  159

Query  1230  KALNLHNIHNIKVGTPVAMDILETSF---PPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             ++L    +  +K+GT +AMD L       PPS+  FR DI  + VL PLL FL  T SY+
Sbjct  160   RSLRARRVSRVKLGTTLAMDALVAGAFPRPPSAAAFRPDIA-ESVLRPLLRFLEGTNSYY  218

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
             F+D Y YF W+ +   V+LD+AL +       VD  TGL YTNLLD+MLD+V  AM  LG
Sbjct  219   FVDAYTYFVWAGSNGTVTLDYALLQPATRARYVDPGTGLTYTNLLDEMLDAVGAAMSKLG  278

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
                VRIA++ETGWPN GD DQ GA+V NAA YNRNL ++M ++P  GTPARPG  +P F+
Sbjct  279   HGGVRIAVAETGWPNGGDYDQIGANVRNAAVYNRNLAARMARNP--GTPARPGARMPVFV  336

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWC  520
             FSLY+EN K GPGTERHWG+  P G  VY ++LT   P   YPPLP P+N+ PY+G +WC
Sbjct  337   FSLYNENLKPGPGTERHWGLYYPNGTAVYRVDLTGRRPLWAYPPLPAPENDTPYKGQIWC  396

Query  519   VVATGI-RILD---LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
             V+A    R L+   +G AL +AC  GNGTCD + PGG+C++P +  AHA+YAF+S+W ++
Sbjct  397   VLAAHAGRKLNETAVGDALTYACGQGNGTCDAVQPGGECFQPNTGAAHASYAFNSYWQQF  456

Query  351   RSTGASCYFNGLATMTTVDPSHGACKVPS  265
             R TGA+CYFN LA  T  DPSHG+CK  S
Sbjct  457   RKTGATCYFNNLAEQTIKDPSHGSCKFRS  485



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   446 bits (1147),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 312/442 (71%), Gaps = 9/442 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++G++LPS  ++++ ++++   +VK+YD++  IL  L+ T I V++MV NE I  
Sbjct  25    GVNYGQLGDNLPSPSDSVKLIQSLNAKRVKLYDANPAILAALNATDITVSVMVPNELI--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +  S+ +  W+  N+L F P T IR +LVGNE+L+ + ++ L   +VPAM+ I+++
Sbjct  83    -VNISKSSSLSDEWIRSNILPFHPSTKIRYLLVGNEILTSADSE-LKSALVPAMRKIQRS  140

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+L+TSFPPSSG FR+DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  141   LKKLGVKKVKVGTTLAVDVLKTSFPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVY  199

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF W+++P +V L +ALF   N TV  D  T L Y NL DQM+D+ VFA   LG+ D+R
Sbjct  200   PYFPWAQDPAHVDLGYALFESTNVTVT-DPATNLTYHNLFDQMIDAFVFATSRLGYPDLR  258

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+V+NAA YNRN+V K+  +PP+GTPARPG  +P+FIF+L++
Sbjct  259   IWVAETGWPNNGDYDQIGANVYNAATYNRNVVKKLSAEPPVGTPARPGKVLPSFIFALFN  318

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVVAT  508
             EN+K GPGTERH+G+L P G  VYE+ L+     TEY   LP P+NN  Y+G +WCVVA 
Sbjct  319   ENQKTGPGTERHFGLLHPNGSRVYEIELSGET--TEYKETLPAPENNEVYKGKIWCVVAK  376

Query  507   GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCY  328
             G     LG AL +AC+ GN TCD + PGG C++P   + HA+YAFSS+WA +R TG +C 
Sbjct  377   GANWTQLGEALSYACSQGNNTCDPIKPGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCS  436

Query  327   FNGLATMTTVDPSHGACKVPSV  262
             FNGLAT T  DPS G C+ PSV
Sbjct  437   FNGLATQTIKDPSFGRCEFPSV  458



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   439 bits (1130),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 202/367 (55%), Positives = 272/367 (74%), Gaps = 3/367 (1%)
 Frame = -3

Query  1368  RWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVG  1189
             +WVH NV+ F P T+IR +LVGNE+LS    +++W  +VPAM+ IK AL  H I  +KVG
Sbjct  20    QWVHANVVPFYPETLIRYLLVGNEILSQPD-KTIWFNLVPAMRKIKAALKTHGITKVKVG  78

Query  1188  TPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNV  1009
             TP+AMD+LE+SFPPS+G FR+DI    V+ PLL F+N+T+S+FF+DVY YF WS +P N+
Sbjct  79    TPLAMDVLESSFPPSNGTFRSDI-STSVIKPLLQFVNKTKSFFFVDVYTYFPWSSDPTNI  137

Query  1008  SLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTG  829
             +LD+ALF   N TV  D  +GL Y NL DQM+D+++FAM+ LGF D+RI I+ETGWP+ G
Sbjct  138   NLDYALFESKNITVK-DPVSGLTYHNLFDQMVDALIFAMKRLGFPDIRIWIAETGWPSGG  196

Query  828   DLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERH  649
             D DQ GA++ NAA YNRN+V K    PP+GTPARPG  +P+F+F+LY+EN+K GP TER+
Sbjct  197   DYDQIGANIRNAATYNRNVVKKFNAKPPVGTPARPGSVLPSFLFALYNENKKPGPSTERN  256

Query  648   WGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDF  469
             +G+L P G  VY ++L+   PE+EY PLP   NN PY+G +WC+VA G     +  AL +
Sbjct  257   FGLLYPNGSNVYPIDLSGKTPESEYGPLPVATNNVPYKGPIWCLVAKGANRSAVASALSY  316

Query  468   ACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPS  289
             AC+ GN TCD + PGG C++P S++ HA+YAFS++WA++R  G SCYF GLAT T  DPS
Sbjct  317   ACSQGNKTCDPIQPGGKCFKPDSLVWHASYAFSAYWAQFRKVGGSCYFGGLATQTIKDPS  376

Query  288   HGACKVP  268
             +G+CK P
Sbjct  377   YGSCKFP  383



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score =   437 bits (1124),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 217/403 (54%), Positives = 284/403 (70%), Gaps = 7/403 (2%)
 Frame = -3

Query  1554  LPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaa  1375
             LPS Y++I  +K ++   VK+YD+D E L LLS T + VTI V N  I    S +     
Sbjct  1     LPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQI---TSLSANQTT  57

Query  1374  AKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIK  1195
             A  WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ I  +L  H IHNIK
Sbjct  58    ADDWVKTNILPYYPQTQIRFVLVGNEILSVQD-RNITANVVPAMRKIVNSLRAHGIHNIK  116

Query  1194  VGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPY  1015
             VGTP+AMD L ++FPPS+  FR DI    ++LPLL FLN T SYFF+++ PYF WS+NP 
Sbjct  117   VGTPLAMDSLRSTFPPSNSTFREDIALP-LMLPLLKFLNGTNSYFFINLQPYFRWSKNPN  175

Query  1014  NVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPN  835
             + +LDFALF+G  ++   D  TGLVY NL+DQMLDSV+FAM  LG+  +RIAISETGWP+
Sbjct  176   HTTLDFALFQG--NSTYTDPHTGLVYHNLVDQMLDSVIFAMTKLGYPYIRIAISETGWPH  233

Query  834   TGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTE  655
             +GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG  IPTF+FSL++EN+K G GT+
Sbjct  234   SGDIDETGANVFNAATYNRNLIKKMTAIPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQ  293

Query  654   RHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPAL  475
             RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV+  G    +L  AL
Sbjct  294   RHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVLVEGANEAELEEAL  353

Query  474   DFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRS  346
               ACA  N TC  LAPG +CYEPVS+ +HA+YA +S+WA++RS
Sbjct  354   RMACARSNTTCAALAPGRECYEPVSVYSHASYALNSYWAQFRS  396



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   439 bits (1129),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 219/441 (50%), Positives = 308/441 (70%), Gaps = 7/441 (2%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             G+NYG++G++LPS  ++++ ++++   +VK+YD++  IL  L+ T I V++M  NE +  
Sbjct  25    GVNYGQLGDNLPSPSDSVKLIQSLNAKRVKLYDANPAILAALNATDITVSVMDPNELL--  82

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKA  1225
               + +  S+ +  W+  N+L F P T IR +LVGNE+LS + ++ L   +VPAM+ I+++
Sbjct  83    -VNISKSSSLSDEWITSNILPFHPTTKIRYLLVGNEILSSTDSE-LKSALVPAMRKIQRS  140

Query  1224  LNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVY  1045
             L    +  +KVGT +A+D+LETSFPPSSG FR+DI    V+ P+L FLNRT+S+ F+DVY
Sbjct  141   LKKLGVKKVKVGTTLAVDVLETSFPPSSGEFRSDI-SGSVMKPMLQFLNRTKSFLFVDVY  199

Query  1044  PYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVR  865
             PYF W+++P +V L +ALF   N TV  D  T L Y NL DQM+D+ VFA   LG+ D+R
Sbjct  200   PYFPWAQDPAHVDLAYALFESTNVTVT-DPATNLTYHNLFDQMIDAFVFATSRLGYPDLR  258

Query  864   IAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYD  685
             I ++ETGWPN GD DQ GA+V+NAA YNRN+V K+   PP+GTPARPG  +P+FIF+L++
Sbjct  259   IWVAETGWPNNGDYDQIGANVYNAATYNRNVVKKLSAVPPVGTPARPGKVLPSFIFALFN  318

Query  684   ENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATG  505
             EN+K GPGTERH+G+L P G  VYE+ L+    E +   LP P+NN  Y+G +WCVVA G
Sbjct  319   ENQKTGPGTERHFGLLHPNGSRVYEIELSGETTEFK-EKLPAPENNEVYKGKIWCVVAKG  377

Query  504   IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYF  325
                  LG AL +AC+ GN TCD +  GG C++P   + HA+YAFSS+WA +R TG +C F
Sbjct  378   ANWTQLGEALSYACSQGNNTCDPIKSGGPCHKPDLTVLHASYAFSSYWASFRKTGGTCSF  437

Query  324   NGLATMTTVDPSHGACKVPSV  262
             NGLAT T  DPS G C+ PSV
Sbjct  438   NGLATQTIKDPSFGRCEFPSV  458



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score =   436 bits (1120),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 272/370 (74%), Gaps = 4/370 (1%)
 Frame = -3

Query  1368  RWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVG  1189
             +WV+ NV+ F P   IR +L+GNE+L++    + W  +VPAM+ IK +L  H IH IKV 
Sbjct  19    QWVNSNVVPFYPDVKIRYLLIGNEILTNPDTGT-WFNLVPAMRRIKSSLRTHKIHKIKVS  77

Query  1188  TPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNV  1009
             TP AM++LE+SFPPS+G FR+DI    ++ P+L FLNRT+S+FFLDVYPYF+W++N  N+
Sbjct  78    TPHAMNVLESSFPPSNGTFRSDI-SGPIIKPMLQFLNRTKSFFFLDVYPYFAWADNWQNI  136

Query  1008  SLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTG  829
             +LD+AL    N T   D  T L+YTNLLDQMLD+ +FAM+ LG+ D+RI I+ETGWP+ G
Sbjct  137   NLDYALLESKNVTYT-DPVTNLIYTNLLDQMLDATIFAMKRLGYPDIRIFIAETGWPSNG  195

Query  828   DLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERH  649
             D DQ GA+++NAA YNRN+V ++   P +GTPARPG  +PTFIF+LY+EN+K GPGTERH
Sbjct  196   DFDQIGANIYNAATYNRNVVKRLTTKPAIGTPARPGSGLPTFIFALYNENQKPGPGTERH  255

Query  648   WGILRPTGMPVYELNLTTAVPETEYP-PLPEPDNNRPYEGNLWCVVATGIRILDLGPALD  472
             +G+L P G  +YE++L+    ++EY  PLP P NN PY+G +WCVVA G     +  AL 
Sbjct  256   FGLLYPNGSNIYEIDLSGETLDSEYKEPLPVPTNNEPYKGKIWCVVAKGANKTAVAGALT  315

Query  471   FACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDP  292
             +AC+ GN TCD + PG  C++P S+  HA+YAFSS+WA+++  G +C FNGLAT T +DP
Sbjct  316   YACSQGNKTCDPIQPGKQCFKPESLYWHASYAFSSYWAQFKKIGGTCQFNGLATQTVMDP  375

Query  291   SHGACKVPSV  262
             S G CK+PSV
Sbjct  376   SFGHCKLPSV  385



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   437 bits (1124),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 228/453 (50%), Positives = 311/453 (69%), Gaps = 15/453 (3%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +  IG+NYGRV +D+P    ++E L+A+    VKIYD++  +L+ L+GT +RV+IMV NE
Sbjct  31    AHGIGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLRALAGTRMRVSIMVPNE  90

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMK  1240
              IP LA++   +    RWV +N++ + P T ++ +LVGNE+LSD S A S W ++VPAM+
Sbjct  91    IIPGLAASAAAA---DRWVAENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAME  147

Query  1239  NIKKALNLHNIHNIKVGTPVAMDILET-SFP--PSSGRFRADIPRDQVLLPLLNFLNRTR  1069
             N+  +L    I ++K+ T +AMD L + SFP  PS+  FR DI  D V+ PLL FLN T 
Sbjct  148   NLHVSLRRRRISSVKISTTLAMDALTSGSFPRPPSAAAFRPDIAGD-VVRPLLRFLNGTN  206

Query  1068  SYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTV-VVDSETGLVYTNLLDQMLDSVVFAM  892
             SY+F+D YPYF W+ N   V L++ALF+GG      VD  TGL YTN+LD+MLD+VV AM
Sbjct  207   SYYFVDAYPYFVWAGNNDTVPLEYALFQGGGGGGRYVDPGTGLTYTNMLDEMLDAVVHAM  266

Query  891   QYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAI  712
               LG+  V++ I+ETGWPN GD +Q G + HNAA YNRNL ++M + P  GTPARPG  +
Sbjct  267   AKLGYGGVKLGIAETGWPNGGDYEQIGCNAHNAAIYNRNLAARMARSP--GTPARPGAKM  324

Query  711   PTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEG  532
             P F+FSLY+E+ K GPGTERHWG+    G  VY ++L  A P   YP LP P+N+ PY+G
Sbjct  325   PVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYPVDLAGARPLRSYPLLPPPENDAPYKG  384

Query  531   NLWCVVA--TGIRILD--LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSF  364
              +WCV+A   G ++ +  +G AL +AC  GNGTCD + PGG+C+ P +  AHA+YAF+S+
Sbjct  385   PVWCVLAGRRGEKLNETAVGDALAYACGQGNGTCDAIQPGGECFRPNTTAAHASYAFNSY  444

Query  363   WAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             W + R TGA+CYFN LA  TT DPSHG+CK  S
Sbjct  445   WQQLRKTGATCYFNNLAEETTKDPSHGSCKFHS  477



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   437 bits (1124),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 228/453 (50%), Positives = 311/453 (69%), Gaps = 15/453 (3%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             +  IG+NYGRV +D+P    ++E L+A+    VKIYD++  +L+ L+GT +RV+IMV NE
Sbjct  28    AHGIGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLRALAGTRMRVSIMVPNE  87

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMK  1240
              IP LA++   +    RWV +N++ + P T ++ +LVGNE+LSD S A S W ++VPAM+
Sbjct  88    IIPGLAASAAAA---DRWVAENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAME  144

Query  1239  NIKKALNLHNIHNIKVGTPVAMDILET-SFP--PSSGRFRADIPRDQVLLPLLNFLNRTR  1069
             N+  +L    I ++K+ T +AMD L + SFP  PS+  FR DI  D V+ PLL FLN T 
Sbjct  145   NLHVSLRRRRISSVKISTTLAMDALTSGSFPRPPSAAAFRPDIAGD-VVRPLLRFLNGTN  203

Query  1068  SYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTV-VVDSETGLVYTNLLDQMLDSVVFAM  892
             SY+F+D YPYF W+ N   V L++ALF+GG      VD  TGL YTN+LD+MLD+VV AM
Sbjct  204   SYYFVDAYPYFVWAGNNDTVPLEYALFQGGGGGGRYVDPGTGLTYTNMLDEMLDAVVHAM  263

Query  891   QYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAI  712
               LG+  V++ I+ETGWPN GD +Q G + HNAA YNRNL ++M + P  GTPARPG  +
Sbjct  264   AKLGYGGVKLGIAETGWPNGGDYEQIGCNAHNAAIYNRNLAARMARSP--GTPARPGAKM  321

Query  711   PTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEG  532
             P F+FSLY+E+ K GPGTERHWG+    G  VY ++L  A P   YP LP P+N+ PY+G
Sbjct  322   PVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYPVDLAGARPLRSYPLLPPPENDAPYKG  381

Query  531   NLWCVVA--TGIRILD--LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSF  364
              +WCV+A   G ++ +  +G AL +AC  GNGTCD + PGG+C+ P +  AHA+YAF+S+
Sbjct  382   PVWCVLAGRRGEKLNETAVGDALAYACGQGNGTCDAIQPGGECFRPNTTAAHASYAFNSY  441

Query  363   WAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             W + R TGA+CYFN LA  TT DPSHG+CK  S
Sbjct  442   WQQLRKTGATCYFNNLAEETTKDPSHGSCKFHS  474



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   435 bits (1119),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 222/468 (47%), Positives = 315/468 (67%), Gaps = 32/468 (7%)
 Frame = -3

Query  1647  IFALIFFTLLA----SSNGLPSSN-IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDS  1483
               A+  F LLA    SSN     N +G+ YG++GN+LP+  ++++ L+ +  +QVK+YD+
Sbjct  3     FLAVYLFYLLAFGSSSSNAAAQINQVGVCYGQLGNNLPAPSQSVQLLQKLNATQVKLYDA  62

Query  1482  DHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVG  1303
             + +IL  L G+ + +T+MV NE I    + ++    A +WV +NV+ + P  MIR +LVG
Sbjct  63    NPKILNALIGSKLYITVMVPNELI---INISSNQTLANQWVQNNVIPYYPRAMIRYILVG  119

Query  1302  NEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETS-FPPSSGRFRA  1126
             NEVLS    + LW  +VPA+K I +++    + N+KVGTP+A+D+LE+S   PS+G FR+
Sbjct  120   NEVLS-YYFKPLWFYLVPAVKRIHQSVKTFGLSNVKVGTPLAIDMLESSVLLPSNGTFRS  178

Query  1125  DIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETG  946
             DI   +V+ PLL FLN+T S+FF+D+YPYF W   P  +SL +AL    N T   D  +G
Sbjct  179   DI-AGKVVKPLLQFLNQTNSFFFVDLYPYFEWVSKPNTISLGYALLAAQNKTFK-DPVSG  236

Query  945   LVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVS  766
             LVY NLLDQMLDSVVFAM+ LG+  + + I+ETGWPN GD+DQ GA+++NAA YNRN+V 
Sbjct  237   LVYNNLLDQMLDSVVFAMKKLGYPSIPLFIAETGWPNGGDIDQIGANIYNAATYNRNVVK  296

Query  765   KMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVP  586
             K    P  GTPARPGV I   IF+LY+EN+K G GTERH+G+L P G  VY+++L+   P
Sbjct  297   KFTAMPSAGTPARPGVNISVNIFALYNENQKPGAGTERHFGLLYPNGTSVYDIDLSGHTP  356

Query  585   ETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEP  406
             ++ Y PLP+P NN+PY+G LWCV                     N TC+ + PGG CY+P
Sbjct  357   DSTYSPLPQPTNNKPYKGKLWCV--------------------DNRTCEAIRPGGKCYKP  396

Query  405   VSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
               ++ HA+YAFS++WA++RS+GA+C+FNGLA  TT DPS+ +C+ PSV
Sbjct  397   NWLVLHASYAFSAYWAQFRSSGATCFFNGLAVQTTKDPSYLSCQFPSV  444



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score =   432 bits (1110),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 202/371 (54%), Positives = 273/371 (74%), Gaps = 6/371 (2%)
 Frame = -3

Query  1368  RWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVG  1189
             +WV  N++ F   T+IR +LVGNE++S ++ Q+ W  +VPAM  +K +L +  +H +KVG
Sbjct  19    QWVQTNLVPFYSKTLIRYLLVGNELISSTTNQT-WPHIVPAMYRMKHSLTIFGLHKVKVG  77

Query  1188  TPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNV  1009
             TP+AMD+L+TSFPPS+G FR DI    V+ P+L FL+ T S+FFLDVYP+F+W+ +P N+
Sbjct  78    TPLAMDVLQTSFPPSNGTFRNDIAL-SVMKPMLEFLHVTNSFFFLDVYPFFAWTSDPINI  136

Query  1008  SLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTG  829
             +LD+ALF   N TV  DS TGLVYTNL DQM+D+V FAM+ LG+ D++I I+ETGWPN G
Sbjct  137   NLDYALFESDNITVT-DSGTGLVYTNLFDQMVDAVYFAMERLGYPDIQIFIAETGWPNDG  195

Query  828   DLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERH  649
             DLDQ GA++HNA  YNRN V K+ + PP+GTPARPG  +P+FIF+LY+EN K G GTERH
Sbjct  196   DLDQIGANIHNAGTYNRNFVKKVTKKPPVGTPARPGSILPSFIFALYNENLKTGLGTERH  255

Query  648   WGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDF  469
             +G+L P G  +YE++L+   PE EY PLP PD+   Y+G  WCVVA G     +  AL +
Sbjct  256   FGLLYPNGSRIYEIDLSGKTPEYEYKPLPPPDD---YKGKAWCVVAEGANKTAVVEALSY  312

Query  468   ACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPS  289
             AC+ GN TC+ + PG  C+EP S++ HA+YAFSS+WA++R  G +C FNGLAT    DPS
Sbjct  313   ACSQGNRTCELVQPGKPCFEPDSVVGHASYAFSSYWAQFRRVGGTCNFNGLATQIAEDPS  372

Query  288   HGACKVPSVFV  256
             +G+CK PSV +
Sbjct  373   YGSCKYPSVIL  383



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score =   431 bits (1108),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 216/403 (54%), Positives = 280/403 (69%), Gaps = 7/403 (2%)
 Frame = -3

Query  1554  LPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaa  1375
             LPS Y++I  +K ++   VK+YD+D E L LLS T + VTI V    I    S +     
Sbjct  1     LPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQI---TSLSANQTT  57

Query  1374  AKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHNIK  1195
             A+ WV  N+L + P T IR VLVGNE+LS    +++   +VPAM+ I  +L  H IHNIK
Sbjct  58    AEDWVKTNILPYYPQTQIRFVLVGNEILSVKD-RNITGNVVPAMRKIVNSLRAHGIHNIK  116

Query  1194  VGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPY  1015
             VGTP+AMD L ++FPPS+  FR DI    ++LPLL FLN T SYFF+++ PYF WS NP 
Sbjct  117   VGTPLAMDSLRSTFPPSNSTFRGDIALP-LMLPLLKFLNGTNSYFFINLQPYFRWSRNPN  175

Query  1014  NVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPN  835
             + +LDFALF+G  ++   D  TGLVY NL+DQMLDSV+FAM  LG+  +RIAISETGWPN
Sbjct  176   HTTLDFALFQG--NSTYTDPHTGLVYHNLVDQMLDSVIFAMTKLGYPYIRIAISETGWPN  233

Query  834   TGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTE  655
             +GD+D+ GA+V NAA YNRNL+ KM   PP+GTPARPG  IPTF+FSL++EN+K G GT+
Sbjct  234   SGDIDEIGANVFNAATYNRNLIKKMTATPPIGTPARPGSPIPTFVFSLFNENKKPGSGTQ  293

Query  654   RHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPAL  475
             RHWGIL P G P+Y+++ T   P T + PLP+P NN PY+G +WCV   G    +L  AL
Sbjct  294   RHWGILHPDGTPIYDIDFTGQKPLTGFNPLPKPTNNVPYKGQVWCVPVEGANETELEEAL  353

Query  474   DFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRS  346
               ACA  N TC  L PG +CYEPVS+  HA+YA +S+WA++RS
Sbjct  354   RMACARSNTTCAALVPGRECYEPVSVYWHASYALNSYWAQFRS  396



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   436 bits (1122),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 223/444 (50%), Positives = 301/444 (68%), Gaps = 14/444 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYGRV +D+P+   +++ L+A     VKIYD++  +L+ L+GT + V+IMV N+ IP
Sbjct  91    LGVNYGRVADDIPTPRRSVQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIP  150

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
              LA++   +    RWV  N+L +LP T ++ +LVGNEVLSD S A S W ++VPAM+N+ 
Sbjct  151   DLAASYAAA---DRWVAANLLPYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLH  207

Query  1230  KALNLHNIHNIKVGTPVAMDILETSF---PPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             ++L    +  +K+GT +AMD L       PPS+  FR DI  + VL PLL FL  T SY+
Sbjct  208   RSLRARRVSRVKLGTTLAMDALVAGAFPRPPSAAAFRPDIA-ESVLRPLLRFLEGTNSYY  266

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
             F+D Y YF W+ +   V+LD+AL +       VD  TGL YTNLLD+MLD+V  AM  LG
Sbjct  267   FVDAYTYFVWAGSNGTVTLDYALLQPATRARYVDPGTGLTYTNLLDEMLDAVGAAMSKLG  326

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
                VRIA++ETGWPN GD DQ GA+V NAA YNRNL ++M ++P  GTPARPG  +P F+
Sbjct  327   HGGVRIAVAETGWPNGGDYDQIGANVRNAAVYNRNLAARMARNP--GTPARPGARMPVFV  384

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWC  520
             FSLY+EN K GPGTERHWG+  P G  VY ++LT   P   YPPLP P+N+ PY+G +WC
Sbjct  385   FSLYNENLKPGPGTERHWGLYYPNGTAVYRVDLTGRRPLWAYPPLPAPENDTPYKGQIWC  444

Query  519   VVATGI-RILD---LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
             V+A    R L+   +G AL +AC  GNGTCD + PGG+C++P +  AHA+YAF+S+W ++
Sbjct  445   VLAAHAGRKLNETAVGDALTYACGQGNGTCDAVQPGGECFQPNTGAAHASYAFNSYWQQF  504

Query  351   RSTGASCYFNGLATMTTVDPSHGA  280
             R TGA+CYFN LA  T  DPS  A
Sbjct  505   RKTGATCYFNNLAEQTIKDPSKHA  528



>emb|CAN60692.1| hypothetical protein VITISV_007558 [Vitis vinifera]
Length=404

 Score =   430 bits (1106),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 219/396 (55%), Positives = 293/396 (74%), Gaps = 8/396 (2%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             + AL FF+ LA ++    S IG+NYG++G++LPS  ++IE +K+M+  +VK+YD++ EIL
Sbjct  3     LLALSFFSFLAFTHAEIPSKIGVNYGQLGDNLPSPSQSIELIKSMKAGRVKLYDANPEIL  62

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
              LLSGT I+V+IMV N++I   ++ ++    A +WV DNVL + P TMIR ++VGNEVLS
Sbjct  63    NLLSGTKIQVSIMVPNQEI---SNISSNQTLADQWVRDNVLSYYPQTMIRFIVVGNEVLS  119

Query  1287  DSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPR  1114
               S +    W  +VPAM+ IKK+L  +NI NIKVGT VAMD++E+SFPPSSG FR+DI  
Sbjct  120   YYSDRDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVAMDVMESSFPPSSGMFRSDI-L  178

Query  1113  DQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYT  934
             D V++PLL FL+ T S+FFLDVYPY +WS NP N+SLD+ALFR GN     D  + L YT
Sbjct  179   DTVMVPLLEFLSGTNSFFFLDVYPYLAWSANPSNISLDYALFRDGNLNYT-DPISNLTYT  237

Query  933   NLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQ  754
             NLLD+MLDSV+FAM+ LG+ ++R+ ISETGWPN GD+DQPGA+V+NAA YN+NL+ KM  
Sbjct  238   NLLDEMLDSVIFAMEKLGYPNIRLLISETGWPNAGDVDQPGANVYNAALYNQNLIKKMTA  297

Query  753   DPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY  574
              P +GTPARPG+ IPTFIF+LY+EN+K GPGTERHWG+L   G PVY ++L T   E+  
Sbjct  298   KPAVGTPARPGMTIPTFIFALYNENQKRGPGTERHWGLLDCNGKPVYGVDL-TGEQESND  356

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFA  466
               LP P NN+P +G +WCVVA+ +    L  AL +A
Sbjct  357   DQLPMPQNNKPXQGKIWCVVASEVNPEQLVSALXYA  392



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   432 bits (1112),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 223/452 (49%), Positives = 305/452 (67%), Gaps = 13/452 (3%)
 Frame = -3

Query  1611  SNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTI  1432
             +NG     +GINYG V +DLPSA  +++ L+A     VKIYD++ +IL+ L+GT + V+I
Sbjct  40    ANGNGCRGLGINYGTVADDLPSASRSVQLLRATGAGAVKIYDANADILRALAGTGMPVSI  99

Query  1431  MVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQM  1255
             MV N  IP+LAS+   +   + WV  N+   +P T +  +LVGNEVLS+ + A S W  +
Sbjct  100   MVPNSAIPSLASSRAAA---EDWVAANLAPHIPATRVAYLLVGNEVLSNRAIAGSTWRSV  156

Query  1254  VPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNR  1075
             VPAM N+ +AL  H I  +K+GT +AMD L  S+PPS+G FR DI  D V+ PLL FLN 
Sbjct  157   VPAMANLHRALRAHGIRKVKIGTTLAMDALSASYPPSAGAFRDDIAED-VVRPLLRFLNA  215

Query  1074  TRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFA  895
             T SY+F+D YPYF+WS N   +SLD+ALF+G   +  VD   GLVYTNLLDQMLD+VV A
Sbjct  216   TGSYYFVDAYPYFAWSGNRNAISLDYALFQGAASSRYVDPGNGLVYTNLLDQMLDAVVAA  275

Query  894   MQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVA  715
             M  LG+ DV++A+SETGWP+ GD  + GA+V NAA YNRNL ++M ++P  GTPARPG  
Sbjct  276   MGRLGYGDVKLAVSETGWPSGGDAGEAGANVRNAATYNRNLAARMSKNP--GTPARPGAK  333

Query  714   IPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYE  535
             +P F+FSLY+E++K G G+ERHWG+  P G  VYE++LT     + YPPLP  D+     
Sbjct  334   VPVFLFSLYNEDQKPGAGSERHWGLYYPNGSRVYEVDLTGR--RSSYPPLPPADDTD--S  389

Query  534   GNLWCVVAT--GIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFW  361
                WCV+ +        +  A+ +AC  G+GTC  + PGG C+EP  + AHA+YAF+++W
Sbjct  390   APAWCVLGSKAAANETAVAAAVAYACQQGSGTCAAIQPGGACHEPDMMDAHASYAFNAYW  449

Query  360   AKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
              ++R  G +C+F+GLA  TT DPSHG+CK  S
Sbjct  450   QQFRGAGGTCFFDGLAVTTTKDPSHGSCKFAS  481



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   432 bits (1112),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 223/446 (50%), Positives = 303/446 (68%), Gaps = 15/446 (3%)
 Frame = -3

Query  1578  NYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPala  1399
             NYGRV +D+PS   ++E L+A     VKIYD++  +L+ L+GT   V+IMV N+ IP +A
Sbjct  41    NYGRVADDIPSPRRSVELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIPDIA  100

Query  1398  snnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIKKAL  1222
             ++   +    RWV +N++ + P T ++ +LVGNE+LSD S A S WL++VPAM+NI  +L
Sbjct  101   ASAAAA---DRWVAENLVPYYPATRVKFLLVGNEILSDYSIANSTWLRLVPAMENIHLSL  157

Query  1221  NLHNIHNIKVGTPVAMDILETS---FPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
                 I ++K+GT +AMD L       PPS+  FR DI    V+ PLL+FLN T SY+F+D
Sbjct  158   RKRGISSVKIGTTLAMDALADGDFPRPPSAAAFRPDI-AASVVRPLLHFLNGTNSYYFVD  216

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
              YPYF W+ +   V LD+ALF+GG+ T  VD  TGL YTNLLD+MLD+V  AM  LG+  
Sbjct  217   AYPYFVWAGHNLTVPLDYALFQGGH-TRYVDPVTGLTYTNLLDEMLDAVTIAMAKLGYGR  275

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             V++A++ETGWPN  D DQ G +VHNAA YNRNL ++M ++P  GTP RPG  +P F+FSL
Sbjct  276   VKLAVAETGWPNGCDYDQIGGNVHNAAIYNRNLAARMAKNP--GTPLRPGAKMPVFVFSL  333

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVV-  514
             Y+E+ K GPGTERHWG+    G  VY ++LT   P   YPPLP  +NN PY+G +WCV+ 
Sbjct  334   YNEDLKGGPGTERHWGLYYANGTAVYPIDLTGRRPLWSYPPLPALENNTPYKGPIWCVLS  393

Query  513   ATGIRILD---LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             A   + L+   +G AL +AC  GNGTC  + PG  CY P + +AHA+YAF+S+W ++R T
Sbjct  394   AAASKKLNETAVGNALAYACGQGNGTCAAIQPGEKCYLPNTTVAHASYAFNSYWQQFRKT  453

Query  342   GASCYFNGLATMTTVDPSHGACKVPS  265
             GA+CYFN LA  T  +PSHG+CK  S
Sbjct  454   GATCYFNNLAEQTIKNPSHGSCKFRS  479



>dbj|BAK05423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   430 bits (1106),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/446 (50%), Positives = 302/446 (68%), Gaps = 15/446 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             IG+NYG + +DLP+A  +++ L+      VK+Y++D  IL  L+GT I V++MV N+ IP
Sbjct  34    IGVNYGSLADDLPTATRSVKLLRKANAGAVKLYNADQRILHALAGTGIPVSVMVPNDLIP  93

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
             +LA +   +   ++WV +N L+  P   +  +LVGNE+LS  + A S W ++VPAMKN++
Sbjct  94    SLADSRAAA---RKWVANN-LKRHPRVRVMYLLVGNELLSYPAIAASTWGKIVPAMKNLR  149

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
              AL    +  +K+GTP+AMD L  S+PPS+G FR DI    V+ PLL+FLN TRSY+F+D
Sbjct  150   YALRAIGLGRVKLGTPLAMDALAASYPPSAGAFREDIA-GTVMRPLLHFLNYTRSYYFVD  208

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
              YPYF W+ N  ++SLD+ALF G   +  VD  T L YTNLLDQMLD+ V AM+ LG+  
Sbjct  209   AYPYFPWAANQKDISLDYALFEGNASSHYVDPATRLTYTNLLDQMLDACVAAMRKLGYGG  268

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             V++AISETGWPN GD  Q GA+V NAA YNR+L  +M  +  +GTPARP   +P F+FSL
Sbjct  269   VKLAISETGWPNAGDPGQAGANVRNAALYNRHLARRMHNN--VGTPARPRSNMPVFVFSL  326

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNL-WCVV  514
             Y+EN K G GTERHWG+  P G  VY+++LT       YPPLP PDN       L WCV+
Sbjct  327   YNENLKPGAGTERHWGMFYPNGTWVYQIDLTGRRTARSYPPLPPPDNK---TAKLEWCVL  383

Query  513   ATGIRILD---LGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             A G + ++   +  AL++AC  G GTC  + PGG CYEP ++ AHA+YAF+++W +++ T
Sbjct  384   AGGGKPVNETAVADALNYACQQGTGTCAAIQPGGACYEPNTLDAHASYAFNAYWQQFKGT  443

Query  342   GASCYFNGLATMTTVDPSHGACKVPS  265
             G SCYFNGLA  T  DPS+G+CK PS
Sbjct  444   GGSCYFNGLAVKTNKDPSYGSCKFPS  469



>ref|XP_003541516.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=391

 Score =   427 bits (1097),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 204/372 (55%), Positives = 281/372 (76%), Gaps = 7/372 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SSNIG+NYG++GN+LPS + +IE L  M+  +VKIYD++ EIL+LLS T ++V+IM+ N 
Sbjct  20    SSNIGVNYGQLGNNLPSPHRSIELLTTMKAGRVKIYDANPEILRLLSNTKLKVSIMIPNN  79

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
             +I   +      + A  WV +NVL + P TMIR +L+GNEVLS +S Q   +W  +VPAM
Sbjct  80    EI---SGIAANQSIADEWVRNNVLPYYPNTMIRYLLMGNEVLSYNSEQGHQMWRDLVPAM  136

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
             ++I+++L   NI +IK+GTP+AMD+L+++FPPSS  FR+DI RD V++P+L FL++T+S+
Sbjct  137   RSIERSLRAQNIRDIKIGTPLAMDVLQSTFPPSSSAFRSDI-RDSVMVPMLKFLDQTKSF  195

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FF+DVYPYF WS N YN+SL+FALFRG N +   D  +GLVYTNLLDQMLDS++FAM  L
Sbjct  196   FFIDVYPYFPWSMNSYNISLEFALFRG-NSSRTRDPGSGLVYTNLLDQMLDSLIFAMAKL  254

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G+ D+ + ISETGWPN+GD ++ GA+  NAA YNRNL+ +M   PP+GTPARPGVAIPTF
Sbjct  255   GYPDINLVISETGWPNSGDREELGANTINAATYNRNLIQRMTTKPPIGTPARPGVAIPTF  314

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLW  523
             IFSL+DEN+K GPGTERHWG+L P G P+Y+++LT   P  ++  LP  +NN+P++G + 
Sbjct  315   IFSLFDENQKPGPGTERHWGLLHPDGTPIYDIDLTGKQPMKDFAALPASNNNKPFKGKML  374

Query  522   CVVATGIRILDL  487
              V A  +   DL
Sbjct  375   GVAAREVEETDL  386



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   431 bits (1109),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 227/466 (49%), Positives = 312/466 (67%), Gaps = 18/466 (4%)
 Frame = -3

Query  1638  LIFF-TLLASSNGLPSSN-IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             L FF   +  +NG  +++ +G+NYGRV +D+P    ++E L+A+    VKIYD +  +L+
Sbjct  63    LCFFPVCVVVANGRSAAHGVGVNYGRVADDIPPPRRSVELLRAVGAGSVKIYDGNSSVLR  122

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
              L+GT +RV+IMV NE IP LA++   +    RWV +N++ + P T ++ +LVGNE+LSD
Sbjct  123   ALAGTGMRVSIMVPNEIIPGLAASAAAA---DRWVAENLVPYYPETRVKYLLVGNELLSD  179

Query  1284  SS-AQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILET-SFP-PSSGRFRADIPR  1114
              S A S W ++VPAM+N+  +L    I ++K+ T +AMD L + SFP P S         
Sbjct  180   YSIANSTWPRIVPAMENLHASLRRRRISSVKISTTLAMDALSSGSFPRPPSAAGVXAGAV  239

Query  1113  DQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYT  934
              +   PLL FLN T SY+F+D YPYF W+ N   V L++ALF+GG     VD  TGL YT
Sbjct  240   VR---PLLRFLNGTNSYYFVDAYPYFVWAGNNETVPLEYALFQGGGR--YVDPGTGLTYT  294

Query  933   NLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQ  754
             N+LD+MLD+VV AM  LG+  V++ I+ETGWPN GD +Q G +VHNAA YNRNL ++M +
Sbjct  295   NMLDEMLDAVVVAMAKLGYGGVKLGIAETGWPNGGDYEQIGGNVHNAAIYNRNLAARMAK  354

Query  753   DPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY  574
             +P  GTPARPG  +P F+FSLY+E+ K GPGTERHWG+    G  VY ++LT A P   Y
Sbjct  355   NP--GTPARPGAKMPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYPIDLTGARPLWSY  412

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDL---GPALDFACAAGNGTCDDLAPGGDCYEPV  403
             PPLP P+N+ PY+G +WCV+A     L+L   G AL +AC  GNGTC  + PG +C++P 
Sbjct  413   PPLPPPENDTPYKGPVWCVLADRGGKLNLTAVGDALAYACGQGNGTCATIQPGRECFQPN  472

Query  402   SILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +  AHA+YAF+S+W + R  GA+CYFN LA  TT DPSHG+CK  S
Sbjct  473   TTAAHASYAFNSYWQQLRKNGATCYFNNLAEETTKDPSHGSCKFHS  518



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   428 bits (1100),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 212/444 (48%), Positives = 303/444 (68%), Gaps = 34/444 (8%)
 Frame = -3

Query  1584  GINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPa  1405
             GINYG++GN+LPS  +++  +K++   +VK+YD++ +IL  L+GT I V++MV NE +  
Sbjct  26    GINYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNGTDITVSVMVPNELL--  83

Query  1404  lasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS--DSSAQSLWLQMVPAMKNIK  1231
               + +  ++ +  W+  N+L F P T IR +LVGNE+LS  DS  +S    +VPAM+ I+
Sbjct  84    -VNISKSASLSDDWIRSNILPFYPTTKIRYLLVGNEILSLPDSELKS---SLVPAMRKIQ  139

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             ++L    +  +KVGT +A D+L++SFPPSSG FR DI    ++ P+L FLNRT+S+ F+D
Sbjct  140   RSLKSLGVKKVKVGTTLATDVLQSSFPPSSGEFREDI-SGLIMKPMLQFLNRTKSFLFVD  198

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
             VYPYF+W+++P +V LD+A+F   N TV  D  + L Y NL DQM+D+ VFAM+ +G+ D
Sbjct  199   VYPYFAWAQDPTHVDLDYAIFESTNVTVT-DPVSNLTYHNLFDQMIDAFVFAMKRVGYPD  257

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             +RI ++ETGWPN GD DQ GA+++NAA YNRN+V K+  DPP+GTPARPG  +P F+F+L
Sbjct  258   IRIWVAETGWPNNGDYDQIGANIYNAATYNRNVVKKLAADPPVGTPARPGKVLPAFVFAL  317

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP-LPEPDNNRPYEGNLWCVV  514
             Y+EN+K GPGTERH+G+L P G  VY ++L+    +TEY   LP P+NN  Y+G +WCV 
Sbjct  318   YNENQKTGPGTERHFGLLHPNGTQVYGIDLSG---KTEYKESLPAPENNDLYKGKIWCV-  373

Query  513   ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGAS  334
                                GN TCD +  GG C +P   + HA+YAFSS+WA++R  G +
Sbjct  374   -------------------GNNTCDPIQRGGPCQKPDLTVLHASYAFSSYWAQFRKIGGT  414

Query  333   CYFNGLATMTTVDPSHGACKVPSV  262
             C FNGLAT T  DPS+G C+ PSV
Sbjct  415   CSFNGLATQTIKDPSYGRCEFPSV  438



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   432 bits (1110),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 218/444 (49%), Positives = 307/444 (69%), Gaps = 7/444 (2%)
 Frame = -3

Query  1620  LASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIR  1441
             +A S    S   G+NYG++G++LPS  ++++ ++++   +VK+YD++  IL  L+ T I 
Sbjct  13    VAVSGAKFSGRPGVNYGQLGDNLPSPSDSVKLIQSLNAKRVKLYDANPAILAALNATDIT  72

Query  1440  VTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWL  1261
             V++MV NE I    + +  S  +  W+  N+L F P T IR +LVGNE+LS + ++ L  
Sbjct  73    VSVMVPNELI---VNISKSSTLSDEWIRSNILPFHPTTKIRYLLVGNEILSSADSE-LKS  128

Query  1260  QMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFL  1081
              +VPAM+ I+++L   ++  +KVGT +A+D+L+TSFPPSSG FR+DI    V+ P+L FL
Sbjct  129   ALVPAMRKIQRSLKKLSVKKVKVGTTLAVDVLKTSFPPSSGEFRSDI-SGSVMKPMLQFL  187

Query  1080  NRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVV  901
             NRT+S+ F+DVYPYF W+++P +V L +ALF   N TV  D  T L Y NL DQM+D+ V
Sbjct  188   NRTKSFLFVDVYPYFPWAQDPAHVDLGYALFESTNVTVT-DPATNLTYHNLFDQMIDAFV  246

Query  900   FAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPG  721
             FA   LG+ D+RI ++ETGWPN GD DQ GA+V+NAA YNRN+V K+   PP+GTPARPG
Sbjct  247   FATSRLGYPDLRIWVAETGWPNNGDYDQIGANVYNAATYNRNVVKKLSAVPPVGTPARPG  306

Query  720   VAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRP  541
               +P+FIF+L++EN+K GPGTERH+G+L P G  VYE+ L+    E +   LP P+NN  
Sbjct  307   KVLPSFIFALFNENQKTGPGTERHFGLLHPNGSRVYEIELSGETTEFK-EKLPAPENNEV  365

Query  540   YEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFW  361
             Y+G +WCVVA G     LG AL +AC+ GN TCD +  GG C++P   + HA+YAFSS+W
Sbjct  366   YKGKIWCVVAKGANWTQLGEALSYACSQGNNTCDPIKSGGPCHKPDLTVLHASYAFSSYW  425

Query  360   AKYRSTGASCYFNGLATMTTVDPS  289
             A +R TG +C FNGLAT T  DPS
Sbjct  426   ASFRKTGGTCSFNGLATQTIKDPS  449



>ref|XP_008643986.1| PREDICTED: uncharacterized protein LOC100382447 isoform X1 [Zea 
mays]
 tpg|DAA48156.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=482

 Score =   424 bits (1091),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 223/444 (50%), Positives = 301/444 (68%), Gaps = 18/444 (4%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
              +GINYG V +DLPSA  +++ L+A   S VKIYD++ +IL+ L+GT + V+IMV N  I
Sbjct  46    GLGINYGTVADDLPSASRSVQLLRAAGASAVKIYDANADILRALAGTGVPVSIMVPNSAI  105

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNI  1234
             P+LAS+   + A       N+   +P T +  +LVGNEVLS+ + A S W  +VPAM N+
Sbjct  106   PSLASSRAAAEAWVA---ANLAPHIPATRVAHLLVGNEVLSNRAIAASTWRGVVPAMANL  162

Query  1233  KKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             ++AL    +  +K+GT +AMD L  S+PPS+G FR DI  D V+LPLL FLN TRSY+F+
Sbjct  163   RRALRARGLRGVKLGTTLAMDALSASYPPSAGAFRGDIAED-VVLPLLRFLNATRSYYFV  221

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             D YPYF+W+ N   +SLD+ALF+G   +  VD   GL YTNLLDQMLD+VV AM  LG+ 
Sbjct  222   DAYPYFAWAGNRDAISLDYALFQGAAGSRYVDPGNGLTYTNLLDQMLDAVVAAMGRLGYG  281

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
             +VR+A+SETGWP+ GD  + GA+V NAA YNRNL  +M   P  GTPARPG  +P F+FS
Sbjct  282   NVRLAVSETGWPSGGDAGEAGANVRNAATYNRNLALRMSNSP--GTPARPGAEVPVFLFS  339

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVV  514
             LY+E+RK GPG+ERHWG+  P G  VYEL+LT     + YPPLP  D+        WCV+
Sbjct  340   LYNEDRKPGPGSERHWGLYYPNGSMVYELDLTGR--RSSYPPLPSADS-----APAWCVL  392

Query  513   ATG----IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRS  346
             A+G         +  A+ +AC  G+ TC  + PGG C+EP ++ AHA+YAF+++W ++RS
Sbjct  393   ASGGGKAANETAVSAAVAYACQHGSRTCAAIQPGGACHEPDALDAHASYAFNAYWQQFRS  452

Query  345   TGASCYFNGLATMTTVDPSHGACK  274
              G +C+F+GLA  TT DPSHG CK
Sbjct  453   AGGTCFFDGLAETTTEDPSHGLCK  476



>ref|XP_007049652.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX93809.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=328

 Score =   409 bits (1052),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 183/328 (56%), Positives = 251/328 (77%), Gaps = 2/328 (1%)
 Frame = -3

Query  1245  MKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRS  1066
             M+ +K +L +H+++ IKVGT +AMD+LE+SFPPS+G FR+DI    ++ P+L FL+RT+S
Sbjct  1     MRKLKNSLKIHSLNKIKVGTSMAMDVLESSFPPSNGTFRSDI-AGPIVKPMLQFLSRTKS  59

Query  1065  YFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQY  886
             ++FLDVYPYF WS  P N++LD+ALF     T   D  + L YTN+ DQM+DSVVFAM+ 
Sbjct  60    FYFLDVYPYFPWSSEPKNINLDYALFESRTITYT-DPVSNLTYTNMFDQMVDSVVFAMKK  118

Query  885   LGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPT  706
             LG+ DVRI I+ETGWPN GD+DQ GA+++NAA YNRN + K+   P +GTPARPG  +P+
Sbjct  119   LGYPDVRIWIAETGWPNAGDIDQIGANIYNAATYNRNAIKKLTAKPAIGTPARPGWVLPS  178

Query  705   FIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNL  526
             FIF+LY+EN+K GPGTERH+G+L P G  VY ++L+   P++++ PLP+PDNN PY+G +
Sbjct  179   FIFALYNENQKPGPGTERHFGLLYPNGSNVYGIDLSGETPDSDFEPLPKPDNNEPYKGKI  238

Query  525   WCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRS  346
             WCV A G+   +LG AL +AC+ GN TCD + PG +C++P S++ HA+YAFSS+W++ + 
Sbjct  239   WCVAARGVNASELGSALSYACSQGNKTCDPIQPGKECFKPDSLVWHASYAFSSYWSQLKQ  298

Query  345   TGASCYFNGLATMTTVDPSHGACKVPSV  262
             TGA+CYFNGLAT T  DPS G CK PSV
Sbjct  299   TGATCYFNGLATQTAKDPSFGHCKFPSV  326



>ref|NP_001062294.2| Os08g0525800 [Oryza sativa Japonica Group]
 dbj|BAF24208.2| Os08g0525800 [Oryza sativa Japonica Group]
Length=471

 Score =   411 bits (1056),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 212/441 (48%), Positives = 293/441 (66%), Gaps = 10/441 (2%)
 Frame = -3

Query  1593  SNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNED  1414
               +G+NYG V +DLP+A  ++E L+A     V+IYD++ +IL+ L+GT + V++ V N+ 
Sbjct  31    GGLGVNYGTVADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTGVPVSVTVPNDA  90

Query  1413  IPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD-SSAQSLWLQMVPAMKN  1237
             I    +     AA   WV  N+   +P   +  +LVGNEVLSD ++A + W  +VPAM N
Sbjct  91    I-PSLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTAWPSLVPAMAN  149

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             +++AL+   +  +KVGT +AMD L TS+PPS+G FR DI    V+ PLL FLN T SY+F
Sbjct  150   LRRALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIA-GAVVRPLLEFLNATGSYYF  208

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +D YPYF+W+ N  ++SLD+ALF+G   T  VD  TGL YTNL DQMLD+VV AM  LG+
Sbjct  209   VDAYPYFAWAANHRSISLDYALFQGEASTHYVDPGTGLTYTNLFDQMLDAVVAAMARLGY  268

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
              +V++A+SETGWP  GD D+ GA+VHNAA YNRNL ++M ++P  GTPARPG  IP F+F
Sbjct  269   GNVKLAVSETGWPTAGDADELGANVHNAATYNRNLAARMAKNP--GTPARPGAEIPVFLF  326

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGN-LWC  520
             SLY+ENRK GPGTERHWG+  P    VYE++L    P   YPPL         +G  +WC
Sbjct  327   SLYNENRKPGPGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWC  386

Query  519   VVATG----IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
             V+A G         +  A+++AC   +GTC  +  GG+C +P ++ AHA+YAF+++W  +
Sbjct  387   VLAGGGGEAANETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLF  446

Query  351   RSTGASCYFNGLATMTTVDPS  289
             R  G +CYFNGLA  TT+DPS
Sbjct  447   RKAGGTCYFNGLAEKTTIDPS  467



>ref|XP_007153895.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
 gb|ESW25889.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
Length=368

 Score =   407 bits (1046),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/349 (56%), Positives = 267/349 (77%), Gaps = 8/349 (2%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SSNIG+NYG++GN+LPS   +IE L +M+   VK+YD++ EIL+LLS T ++V+IM+ N 
Sbjct  20    SSNIGVNYGQLGNNLPSPQRSIELLTSMKAGLVKLYDANPEILRLLSTTKLKVSIMIPNN  79

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAM  1243
             +I   A      + A  WV +NVL + P T+IR +LVGNEVLS +S Q   +W  +VPAM
Sbjct  80    EI---AGIATNQSMADEWVRNNVLPYYPKTLIRYLLVGNEVLSYNSEQGHQMWNDLVPAM  136

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
             +NI+++L   NI +IK+GTP+AMD+L+++FPPSSG FR D+ RD V+ P+L FLNRT+S+
Sbjct  137   RNIERSLKGQNIRDIKIGTPLAMDVLQSTFPPSSGTFRPDV-RDSVMAPMLKFLNRTKSF  195

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYL  883
             FF+D+YPYF WS+NP+N+S+DFAL RG  ++ + D  TGL+YTNLLDQMLDS++FAM  L
Sbjct  196   FFIDIYPYFPWSQNPHNISIDFALLRG--NSSIRDPATGLLYTNLLDQMLDSLIFAMSKL  253

Query  882   GFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTF  703
             G+ ++ + +SETGWPN+GD ++ GA+  NAA YNRNL+ KM   PP+GTPARPGVAIPTF
Sbjct  254   GYPNINLVVSETGWPNSGDEEELGANTFNAATYNRNLILKMSTKPPIGTPARPGVAIPTF  313

Query  702   IFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEP  556
             IFSL+DEN+K G GTERHWG+L P G P+Y+++LT   P T   PLP P
Sbjct  314   IFSLFDENQKPGSGTERHWGLLHPDGTPIYDIDLTGKHPITNPAPLPAP  362



>dbj|BAC75423.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=482

 Score =   410 bits (1054),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 211/442 (48%), Positives = 294/442 (67%), Gaps = 10/442 (2%)
 Frame = -3

Query  1593  SNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNED  1414
               +G+NYG V +DLP+A  ++E L+A     V+IYD++ +IL+ L+GT + V++ V N+ 
Sbjct  31    GGLGVNYGTVADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTGVPVSVTVPNDA  90

Query  1413  IPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD-SSAQSLWLQMVPAMKN  1237
             I    +     AA   WV  N+   +P   +  +LVGNEVLSD ++A + W  +VPAM N
Sbjct  91    I-PSLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTAWPSLVPAMAN  149

Query  1236  IKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             +++AL+   +  +KVGT +AMD L TS+PPS+G FR DI    V+ PLL FLN T SY+F
Sbjct  150   LRRALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIA-GAVVRPLLEFLNATGSYYF  208

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +D YPYF+W+ N  ++SLD+ALF+G   T  VD  TGL YTNL DQMLD+VV AM  LG+
Sbjct  209   VDAYPYFAWAANHRSISLDYALFQGEASTHYVDPGTGLTYTNLFDQMLDAVVAAMARLGY  268

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
              +V++A+SETGWP  GD D+ GA+VHNAA YNRNL ++M ++P  GTPARPG  IP F+F
Sbjct  269   GNVKLAVSETGWPTAGDADELGANVHNAATYNRNLAARMAKNP--GTPARPGAEIPVFLF  326

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGN-LWC  520
             SLY+ENRK GPGTERHWG+  P    VYE++L    P   YPPL         +G  +WC
Sbjct  327   SLYNENRKPGPGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWC  386

Query  519   VVATG----IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
             V+A G         +  A+++AC   +GTC  +  GG+C +P ++ AHA+YAF+++W  +
Sbjct  387   VLAGGGGEAANETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLF  446

Query  351   RSTGASCYFNGLATMTTVDPSH  286
             R  G +CYFNGLA  TT+DP++
Sbjct  447   RKAGGTCYFNGLAEKTTIDPTN  468



>ref|XP_004298215.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like, 
partial [Fragaria vesca subsp. vesca]
Length=366

 Score =   400 bits (1028),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 201/352 (57%), Positives = 263/352 (75%), Gaps = 10/352 (3%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             SS IGINYG++GN+LPS   ++E +K+M++ +VK+YD++ EIL+LLSGT I V+IMV N 
Sbjct  7     SSKIGINYGQIGNNLPSPNRSVELIKSMKIGRVKLYDANPEILRLLSGTNISVSIMVPNN  66

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQS--LWLQMVPAM  1243
             +I       +  + A  W+ +NVL + P TMIR +LVGNE+LS  S Q   LW  +VPAM
Sbjct  67    EI---TGIASDQSKADEWIRNNVLPYYPETMIRYLLVGNEILSYFSDQDRRLWHDVVPAM  123

Query  1242  KNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSY  1063
               IK +L   NI NIK+GTP+AMD+L+TSFPPSSG FR+D+  + V++PLL FLNRT+S+
Sbjct  124   TKIKHSLRAKNITNIKIGTPLAMDVLQTSFPPSSGAFRSDV-SETVIVPLLRFLNRTKSF  182

Query  1062  FFLDVYPYFSWSENPYNVSLDFALFRG---GNDTVVVDSETGLVYTNLLDQMLDSVVFAM  892
             FF+DVYP+F WS NP  +SLDFAL +     +  +  D  +GLVYTNLLDQMLDS++FAM
Sbjct  183   FFIDVYPFFPWSSNPKEISLDFALLKNISNNSSLLYTDPGSGLVYTNLLDQMLDSLIFAM  242

Query  891   QYLGFNDVRIAISETGWPNTG-DLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVA  715
               LG+  +R+ I+ETGWPN+G + +QPGA+V NAA YNRNLV K++  P +GTPARPGV 
Sbjct  243   TKLGYPHIRLLIAETGWPNSGGEQNQPGANVQNAATYNRNLVQKIVTKPTIGTPARPGVV  302

Query  714   IPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPE  559
             IPTFIFSLYDEN+K GPGTERHWG+L   G PVY+++LT   P  +Y PLPE
Sbjct  303   IPTFIFSLYDENQKGGPGTERHWGLLYADGNPVYDIDLTGKRPVNDYKPLPE  354



>ref|XP_004973968.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=389

 Score =   400 bits (1027),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/394 (50%), Positives = 270/394 (69%), Gaps = 13/394 (3%)
 Frame = -3

Query  1431  MVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD-SSAQSLWLQM  1255
             MV NE IP+LAS+   +   + WV  N+   +P   +  +LVGNEVLS+ ++A S W  +
Sbjct  1     MVPNEAIPSLASSRAAA---EGWVAANLAPHVPAARVMYLLVGNEVLSNRAAAGSTWRAI  57

Query  1254  VPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNR  1075
             VPAM N+ +AL  H I  +K+GT +AMD L  S+PPS+G FR D+  + V+ PLL FLN 
Sbjct  58    VPAMANLHRALRAHGIRKVKLGTTLAMDALSASYPPSAGAFRGDVA-EAVIRPLLRFLNA  116

Query  1074  TRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFA  895
             TRS++F+D YPYF+W+ N   +SLD+ALF+G   +  VD  TGL YTNLLDQMLD+VV A
Sbjct  117   TRSFYFVDAYPYFAWAANRDTISLDYALFQGAASSHYVDPGTGLTYTNLLDQMLDAVVAA  176

Query  894   MQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVA  715
             M  LG+ +V++A+SETGWP+ GD  + GA+V NAA YNRNL ++M ++P  GTPARPG  
Sbjct  177   MGKLGYGNVKLAVSETGWPSAGDAGESGANVRNAATYNRNLAARMSKNP--GTPARPGAK  234

Query  714   IPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYE  535
             +P F+FSLY+E++K GPGTERHWG+  P    VYE++LT   P   YPPLP   +     
Sbjct  235   MPVFLFSLYNEDQKPGPGTERHWGLYYPNQTRVYEVDLTGQRPSRSYPPLPPAGDTD--S  292

Query  534   GNLWCVVATG----IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
                WCV+A+G         +  AL++AC  G+GTC  + PGG C+EP ++ AHA+YAF+S
Sbjct  293   SPAWCVLASGEGKAANETAVQAALEYACQQGSGTCAAIQPGGACHEPDTLDAHASYAFNS  352

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +W ++R+ G +C+FNGLA  TT DPSHG+CK  S
Sbjct  353   YWQQFRNAGGTCFFNGLAEATTKDPSHGSCKFQS  386



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   405 bits (1041),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 299/453 (66%), Gaps = 17/453 (4%)
 Frame = -3

Query  1608  NGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIM  1429
             +G  +  +G+NYG +G++LP+   ++  L+      VKIYD++ EIL   +GT I V+ M
Sbjct  37    HGKRAHGLGVNYGTLGDNLPTPTRSVRLLRDAGAGAVKIYDANPEILSAFAGTGIPVSAM  96

Query  1428  VRNEDIPalasnnnqsaaAKRWVHDNVLE-FLPGTMIRGVLVGNEVLSDSSAQ-SLWLQM  1255
             V NE IP++A++   +    +WV +N+ +    G  I  +LVGNE+LS+ + + S W  +
Sbjct  97    VPNEIIPSIAASRAAA---HKWVVNNLPKPSSHGPKIVYLLVGNELLSNQAIKDSTWGAI  153

Query  1254  VPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNR  1075
             VPAM+N++ AL  H +  +K+GTP+AMD L  S+PPSS  FR DI   +V+ PLL FLN 
Sbjct  154   VPAMRNLRHALRKHGMGRVKLGTPLAMDALSASYPPSSSLFRDDI-ELKVMRPLLRFLNL  212

Query  1074  TRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFA  895
             T+SY+F+D YPYF+W+ N   +SLD+ALF+G +    VD +TGL YTNLLDQMLD+ V A
Sbjct  213   TKSYYFVDAYPYFAWAGNQDTISLDYALFQGKSGAFHVDPQTGLKYTNLLDQMLDACVAA  272

Query  894   MQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVA  715
             M  LGF  +++AI+ETGWPN G    PGASV NAA YNRNL ++M   P  GTP RPG  
Sbjct  273   MAKLGFGKIKMAIAETGWPNGGG---PGASVGNAAIYNRNLAARMATSP--GTPLRPGEK  327

Query  714   IPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNL------TTAVPETEYPPLPEPD  553
             +P F+FSLY+E++K G GTERHWG+  P G  VY+++L         +P     P P   
Sbjct  328   MPVFVFSLYNEDKKPGAGTERHWGLFYPNGTAVYQVDLGGRRRSYPPLPSPPPSPSPSTP  387

Query  552   NNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAF  373
              + P E  LWCV+  G     +  AL++AC  G+GTC  + PG  C+EP ++ AHA+YAF
Sbjct  388   PSPPAEQGLWCVLLPGKDEKAVAAALNYACGQGSGTCAAIQPGAVCFEPNTLDAHASYAF  447

Query  372   SSFWAKYRSTGASCYFNGLATMTTVDPSHGACK  274
             +S+W ++R +GASC FNGLAT TT DPSHG+CK
Sbjct  448   NSYWQQFRKSGASCSFNGLATTTTTDPSHGSCK  480


 Score =   112 bits (281),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -3

Query  537  EGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWA  358
            E  +WCV+A G     +  AL++AC  G GTC  + PGG C+EP ++ AHA+YAF+S+W 
Sbjct  497  ELGVWCVLAPGKDEKAVEAALNYACGQGQGTCAAIQPGGACFEPNTLDAHASYAFNSYWQ  556

Query  357  KYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
            ++R TG SC FNGLA  TT DPSHG+CK PS
Sbjct  557  QFRKTGGSCSFNGLAVTTTADPSHGSCKFPS  587



>ref|XP_007134153.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
 gb|ESW06147.1| hypothetical protein PHAVU_010G0238001g, partial [Phaseolus vulgaris]
Length=335

 Score =   392 bits (1007),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 247/335 (74%), Gaps = 5/335 (1%)
 Frame = -3

Query  1266  WLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLN  1087
             W  +VPAM  I  +L +  +H +K+GTP AMD+L++SFPPS+G FR DI    ++ P+L+
Sbjct  4     WAHIVPAMHRISHSLKVFGLHKVKIGTPHAMDVLQSSFPPSNGTFRNDIAF-HIMKPMLH  62

Query  1086  FLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDS  907
             FL++TRS+FFLDVYP+F+W+ +P  ++L + LF   N TV  D  TG +YTNL DQM+D+
Sbjct  63    FLHKTRSFFFLDVYPFFAWASDPAQINLSYTLFESRNITVT-DPLTGSIYTNLFDQMVDA  121

Query  906   VVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPAR  727
             V FAM+ LG+  +RI I+ETGWPN GDLDQ GA+VHNAA YNRN+V ++ ++P LGTPAR
Sbjct  122   VYFAMKRLGYPGIRIFIAETGWPNGGDLDQVGANVHNAATYNRNIVKRLTRNPVLGTPAR  181

Query  726   PGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNN  547
             PG  +P FIFSLY+EN K G G+ERH+G+L P G  VY+++L+   PE+E  P+P   + 
Sbjct  182   PGSVLPAFIFSLYNENLKPGLGSERHFGLLYPNGSRVYDIDLSGNTPESELAPVPPAMD-  240

Query  546   RPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
               Y+G  WCVVA G  + ++  AL ++C+ GNGTCD + PG  C++P S+ +HA+YAFS+
Sbjct  241   --YKGKAWCVVAEGANVTEVAAALSYSCSQGNGTCDPIQPGHPCFKPDSVTSHADYAFSA  298

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             +WA++R  G +CYFNGLAT T  DPS+G+CK PSV
Sbjct  299   YWAQFRRVGGTCYFNGLATQTAKDPSYGSCKFPSV  333



>gb|EAZ07710.1| hypothetical protein OsI_29967 [Oryza sativa Indica Group]
Length=1020

 Score =   412 bits (1060),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 213/439 (49%), Positives = 299/439 (68%), Gaps = 10/439 (2%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYG V +DLP+A  ++E L+A     V+IYD++ +IL+ L+GT + V++ V N+ IP
Sbjct  33    LGVNYGTVADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTGVPVSVTVPNDAIP  92

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD-SSAQSLWLQMVPAMKNIK  1231
             +LA+  + +A  + WV  N+   +P   +  +LVGNEVLSD ++A + W  +VPAM N++
Sbjct  93    SLAAAASPAAVDE-WVARNLAPHIPAARVLCLLVGNEVLSDRATAGTAWPSLVPAMANLR  151

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             +AL+   +  +KVGT +AMD L TS+PPS+G FR DI    V+ PLL FLN T SY+F+D
Sbjct  152   RALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIA-GAVVRPLLEFLNATGSYYFVD  210

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
              YPYF+W+ N  ++SLD+ALF+G   T  VD  TGL YTNL DQMLD+VV AM  LG+ +
Sbjct  211   AYPYFAWAANHRSISLDYALFQGEASTHYVDPGTGLTYTNLFDQMLDAVVAAMARLGYGN  270

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             V++A+SETGWP  GD D+ GA+VHNAA YNRNL ++M ++P  GTPARPG  IP F+FSL
Sbjct  271   VKLAVSETGWPTAGDADELGANVHNAATYNRNLAARMAKNP--GTPARPGAEIPVFLFSL  328

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGN-LWCVV  514
             Y+ENRK GPGTERHWG+  P    VYE++L    P   YPPL         +G  +WCV+
Sbjct  329   YNENRKPGPGTERHWGLYYPNATWVYEVDLAGRRPAASYPPLAPTPPAPDQDGTPVWCVL  388

Query  513   ATG----IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRS  346
             A G         +  A+++AC   +GTC  +  GG+C +P ++ AHA+YAF+++W  +R 
Sbjct  389   AGGGGEAANETAVAAAVEYACRQRSGTCAAIEAGGECNQPDTLAAHASYAFNAYWQLFRK  448

Query  345   TGASCYFNGLATMTTVDPS  289
              G +CYFNGLA  TT+DP+
Sbjct  449   AGGTCYFNGLAEKTTIDPT  467



>gb|KHN47213.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=345

 Score =   391 bits (1005),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 188/345 (54%), Positives = 259/345 (75%), Gaps = 7/345 (2%)
 Frame = -3

Query  1515  MRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFL  1336
             M+  +VKIYD++ EIL+LLS T ++V+IM+ N +I   +      + A  WV +NVL + 
Sbjct  1     MKAGRVKIYDANPEILRLLSNTKLKVSIMIPNNEI---SGIAANQSIADEWVRNNVLPYY  57

Query  1335  PGTMIRGVLVGNEVLSDSSAQ--SLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILE  1162
             P TMIR +L+GNEVLS +S Q   +W  +VPAM++I+++L   NI +IK+GTP+AMD+L+
Sbjct  58    PNTMIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSIERSLRAQNIRDIKIGTPLAMDVLQ  117

Query  1161  TSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRG  982
             ++FPPSS  FR+DI RD V++P+L FL++T+S+FF+DVYPYF WS N YN+SL+FALFRG
Sbjct  118   STFPPSSSAFRSDI-RDSVMVPMLKFLDQTKSFFFIDVYPYFPWSMNSYNISLEFALFRG  176

Query  981   GNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASV  802
              N +   D  +GLVYTNLLDQMLDS++FAM  LG+ D+ + ISETGWPN+GD ++ GA+ 
Sbjct  177   -NSSRTRDPGSGLVYTNLLDQMLDSLIFAMAKLGYPDINLVISETGWPNSGDREELGANT  235

Query  801   HNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGM  622
              NAA YNRNL+ +M   PP+GTPARPGVAIPTFIFSL+DEN+K GPGTERHWG+L P G 
Sbjct  236   INAATYNRNLIQRMTTKPPIGTPARPGVAIPTFIFSLFDENQKPGPGTERHWGLLHPDGT  295

Query  621   PVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDL  487
             P+Y+++LT   P  ++  LP  +NN+P++G +  V A  +   DL
Sbjct  296   PIYDIDLTGKQPMKDFAALPASNNNKPFKGKMLGVAAREVEETDL  340



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score =   393 bits (1009),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 209/468 (45%), Positives = 293/468 (63%), Gaps = 20/468 (4%)
 Frame = -3

Query  1638  LIFFTLLASSNGLP---SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             L+  +  A S   P   +  +GINYGRV ++LPS    +  +K ++   VKIYD+D ++L
Sbjct  28    LVILSAAADSGVFPPFYTRALGINYGRVADNLPSPSSAVALIKNLQAGYVKIYDADPQVL  87

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
               LS T ++VTI VRN+DI   ++ ++    A++WV  NVL   P T+I  ++VGNEVLS
Sbjct  88    SALSNTALQVTITVRNQDI---SNISSSPTVAEQWVQANVLPHYPSTLITAIMVGNEVLS  144

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             D   Q+ WL M+PAM NI  +L  H + + IKV T +AMD+L +S+PPS G FR D+   
Sbjct  145   DYQNQATWLLMLPAMPNIHASLLNHGLADSIKVTTSLAMDVLSSSYPPSEGTFRNDV-AS  203

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              VL PLL+F+NRT S+ FLD+YP+F+WS NP NV+LD+A F         D + GL Y+N
Sbjct  204   PVLQPLLDFVNRTGSFVFLDIYPFFAWSANPANVTLDYATFSLDRTAAEFD-DAGLSYSN  262

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             +LD  LD+V+ AM  LGF  V + + ETGWP  GD +Q G +V NA  YN+ LV K++ D
Sbjct  263   MLDAQLDAVLAAMGRLGFPGVNVVVGETGWPTKGDENQQGTNVPNATRYNQQLVQKVLAD  322

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP  571
             PP GTP RPG  IPTFIFSL++E++K GP TER+WG+  P G PVY + L+   P   + 
Sbjct  323   PPRGTPRRPGAFIPTFIFSLFNEDQKPGPNTERNWGLFYPDGTPVYPIVLSNDAPALSHI  382

Query  570   PLPEPDNNRPYEGNL------WCVVA-TGIRILD---LGPALDFACAAGNGTCDDLAPGG  421
              +P  +N              WCVV+   +  +D   L  ALD+AC AG   C  + PG 
Sbjct  383   SVPSQNNGPLPASPPSPVSPQWCVVSPVAVAQVDETSLQAALDYACGAG-ADCSLIEPGE  441

Query  420   DCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGAC  277
              CY P ++++HA+YAF+S+W K ++  A+C F+G A +T+ DPS G C
Sbjct  442   PCYLPNTLVSHASYAFNSYWQKTKAADATCDFHGAAVLTSSDPSVGDC  489



>ref|XP_001777261.1| predicted protein [Physcomitrella patens]
 gb|EDQ57916.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   380 bits (975),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/454 (43%), Positives = 289/454 (64%), Gaps = 20/454 (4%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +GINYGR+ NDLP+  E I+ ++ M++ +VKI++SD  +L  L+ T + V   + NEDIP
Sbjct  6     MGINYGRIANDLPAPDEAIQQIRTMKIGRVKIFNSDATVLSALANTGLEVVSGLPNEDIP  65

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
             ++A +   +    +WV  NVL + P T I  ++VGNE+ S  S +S W +++PA+ N+  
Sbjct  66    SVAQSQWAA---DQWVKKNVLSYYPATNIVSIVVGNELFSYPSMKSTWDKLIPAINNLHT  122

Query  1227  ALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             +L  + +  +IK+ T VA+D+L +S+PPS G F+ ++     L PLL +L  ++S+ +++
Sbjct  123   SLAKNKLTDHIKLSTAVALDVLASSYPPSGGAFKEEL-VGPYLKPLLKYLYNSQSHLYVN  181

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
             VYPYF+W+ +P ++ L++ALF G +   VVD+  G  Y NLLD  LD+V  A + +G+  
Sbjct  182   VYPYFAWASDPDHIPLNYALF-GASTPGVVDN--GKAYYNLLDSQLDAVNAATEKVGYGQ  238

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             VR+A+SETGWP+ GD +Q G ++ NAA YNR LV KM+    +GTP +PGV IPTFIF+L
Sbjct  239   VRLALSETGWPSAGDANQLGCNLANAATYNRRLVRKMVSTSKVGTPLKPGVYIPTFIFAL  298

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPE------------PDNN  547
             ++EN+K G GTE+HWG+L P G  VY +++T  + + +Y PL +            P  N
Sbjct  299   FNENQKTGQGTEKHWGLLYPNGTNVYSIDMTGTLSDGQYTPLSDNPIFTTAPPPTLPPGN  358

Query  546   RPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
              P     WCV   G+    L  ALDFAC  G   C  L  GG CY P +IL H++YAF+S
Sbjct  359   VPSTTGTWCVAKPGMNPPMLQAALDFACGPGGADCQPLQVGGSCYNPDTILDHSSYAFNS  418

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             ++ + ++ G SC F G AT+TT DPSH  CK P+
Sbjct  419   YYQRTKAAGGSCNFGGAATLTTTDPSHDTCKFPT  452



>ref|XP_001780045.1| predicted protein [Physcomitrella patens]
 gb|EDQ55148.1| predicted protein [Physcomitrella patens]
Length=453

 Score =   377 bits (967),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 194/453 (43%), Positives = 287/453 (63%), Gaps = 20/453 (4%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +GINYGR+ ++LPS  E I+ +  +++ +VKI++SD  +L  L+ T + V   + NEDIP
Sbjct  6     MGINYGRIADNLPSPDEAIQRIMDLKIGRVKIFNSDATVLSALANTGLEVVSALPNEDIP  65

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
              +A +   +    +WV  NVL + P T I  ++VGNE+ S  S +  W +++ A+ N+  
Sbjct  66    GVAQSQWAA---DQWVKKNVLAYYPATNIVSIVVGNELFSYPSMKPTWDKLMTAINNVHT  122

Query  1227  ALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             +L   N+ + IK+ + VA+D+L +S+PPS+G FR ++     L PLL FL  ++S+F+++
Sbjct  123   SLAKDNLTSRIKLSSAVALDVLASSYPPSAGSFREEL-VGPYLQPLLKFLYNSQSHFYVN  181

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
             VYPYF+W+ +P N+ L++ALF G +   VVD+  G  Y N+LD  LD+V  A+Q +G+  
Sbjct  182   VYPYFAWASDPNNIPLNYALF-GASTPGVVDN--GKAYYNMLDGQLDAVNAALQKVGYGQ  238

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             VR+AISETGWP  GD +Q G ++ NAA YNR LV KM+    +GTP RPGV IPTFIF+L
Sbjct  239   VRLAISETGWPTAGDANQAGCNLANAATYNRRLVRKMVSPTNVGTPMRPGVYIPTFIFAL  298

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPL---------PEPDNN---  547
             ++E++K G GTE+HWG+L P G  VY +++T  + + +Y PL         P P  +   
Sbjct  299   FNEDQKTGQGTEKHWGLLYPNGTNVYSIDMTGMLSDGQYSPLSDNPVFTSAPPPTFSPGL  358

Query  546   RPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
              P     WCV  +GI    L  ALDFAC AG   C  L  GG C+ P +I  H++YAF+S
Sbjct  359   VPSTSGTWCVAKSGIGQEMLQGALDFACGAGGADCQPLQAGGSCFNPNTIHDHSSYAFNS  418

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             ++ K ++ G SC F G A ++T DPSHG CK P
Sbjct  419   YYQKTKAAGGSCNFGGAAMLSTTDPSHGTCKFP  451



>ref|NP_001168659.1| uncharacterized protein LOC100382447 [Zea mays]
 gb|ACN29077.1| unknown [Zea mays]
Length=384

 Score =   371 bits (953),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 188/365 (52%), Positives = 250/365 (68%), Gaps = 15/365 (4%)
 Frame = -3

Query  1353  NVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVA  1177
             N+   +P T +  +LVGNEVLS+ + A S W  +VPAM N+++AL    +  +K+GT +A
Sbjct  24    NLAPHIPATRVAHLLVGNEVLSNRAIAASTWRGVVPAMANLRRALRARGLRGVKLGTTLA  83

Query  1176  MDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDF  997
             MD L  S+PPS+G FR DI  D V+LPLL FLN TRSY+F+D YPYF+W+ N   +SLD+
Sbjct  84    MDALSASYPPSAGAFRGDIAED-VVLPLLRFLNATRSYYFVDAYPYFAWAGNRDAISLDY  142

Query  996   ALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQ  817
             ALF+G   +  VD   GL YTNLLDQMLD+VV AM  LG+ +VR+A+SETGWP+ GD  +
Sbjct  143   ALFQGAAGSRYVDPGNGLTYTNLLDQMLDAVVAAMGRLGYGNVRLAVSETGWPSGGDAGE  202

Query  816   PGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGIL  637
              GA+V NAA YNRNL  +M   P  GTPARPG  +P F+FSLY+E+RK GPG+ERHWG+ 
Sbjct  203   AGANVRNAATYNRNLALRMSNSP--GTPARPGAEVPVFLFSLYNEDRKPGPGSERHWGLY  260

Query  636   RPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVATG----IRILDLGPALDF  469
              P G  VYEL+LT     + YPPLP  D+        WCV+A+G         +  A+ +
Sbjct  261   YPNGSMVYELDLTGR--RSSYPPLPSADS-----APAWCVLASGGGKAANETAVSAAVAY  313

Query  468   ACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPS  289
             AC  G+ TC  + PGG C+EP ++ AHA+YAF+++W ++RS G +C+F+GLA  TT DPS
Sbjct  314   ACQHGSRTCAAIQPGGACHEPDALDAHASYAFNAYWQQFRSAGGTCFFDGLAETTTEDPS  373

Query  288   HGACK  274
             HG CK
Sbjct  374   HGLCK  378



>gb|ACN28576.1| unknown [Zea mays]
Length=335

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/334 (54%), Positives = 236/334 (71%), Gaps = 11/334 (3%)
 Frame = -3

Query  1245  MKNIKKALNLHNIHNIKVGTPVAMDIL-ETSFP--PSSGRFRADIPRDQVLLPLLNFLNR  1075
             M+NI ++L   +I ++K+GT +AMD L + +FP  PS+  FRADI  + V+ PLL+FLN 
Sbjct  1     MENIHRSLRKRSISSVKIGTTLAMDALADGAFPRPPSAAAFRADI-AEAVVRPLLHFLNG  59

Query  1074  TRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFA  895
             T SY+F+D YPYF W++N   VSLD+ALF+GG  T  VD  TGL YTNLLD+MLD+VV A
Sbjct  60    TNSYYFVDAYPYFVWADNNLTVSLDYALFQGGR-TRYVDPGTGLTYTNLLDEMLDAVVIA  118

Query  894   MQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVA  715
             M  LG+  V++AI+ETGWPN  D +Q G +VHNAA YNRNL ++M ++P  GTP RPG  
Sbjct  119   MAKLGYGHVKLAIAETGWPNGCDYNQIGGNVHNAAIYNRNLAARMAKNP--GTPVRPGAK  176

Query  714   IPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYE  535
             +P F+FSLY+E+ K GPGTERHWG+    G  VYE++LT   P   YPPLP P+NN PY+
Sbjct  177   MPVFVFSLYNEDLKPGPGTERHWGLYYANGTAVYEIDLTGRRPLGSYPPLPAPENNTPYK  236

Query  534   GNLWCVVATG----IRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
             G +WCV++      +    +G AL +AC  GNGTCD + PG  CY P +  AHA+YAF+S
Sbjct  237   GPIWCVLSAAASNKLNETAVGNALSYACGQGNGTCDAIQPGKTCYTPNTTAAHASYAFNS  296

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +W ++  TGA+CYFN LA  T  DPSHG+C+ PS
Sbjct  297   YWQQFEKTGATCYFNNLAEQTIKDPSHGSCRFPS  330



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score =   373 bits (957),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 202/456 (44%), Positives = 287/456 (63%), Gaps = 18/456 (4%)
 Frame = -3

Query  1617  ASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRV  1438
             +S+ G     IG+NYGR+ +++PS  +T+  LK+M V  VK++D++ ++L  LS + IRV
Sbjct  20    SSTPGSGLDQIGVNYGRISDNIPSPNQTVALLKSMNVRLVKLFDANPQVLTALSNSSIRV  79

Query  1437  TIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQ  1258
             TIMV NE I    +  +  ++A  W+  +VL + P T I  ++VGNE+ S  +    W Q
Sbjct  80    TIMVPNEII---GAVASSQSSADDWIAQSVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQ  136

Query  1257  MVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFL  1081
             ++PA++N+ +AL  HN+ + IK+ T VA D+L  S+PPS GRFR DI RD VL PLL FL
Sbjct  137   LMPAIENLHRALQSHNLDDRIKITTSVAGDVLAASYPPSVGRFRPDI-RDTVLKPLLGFL  195

Query  1080  NRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVV  901
               TR+ F++++YPYF+W+ NP N+SL +ALF     TVV D +  L YTNLLD M D+  
Sbjct  196   RTTRAPFYINLYPYFAWAGNPVNISLGYALFDPAA-TVVPDGK--LRYTNLLDAMTDATF  252

Query  900   FAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPG  721
              AM+ LGF+DV + ISETGWPN GD ++ GA+  NAA YNR LV K+++    GTP RP 
Sbjct  253   SAMEDLGFDDVELGISETGWPNAGDENERGATRSNAATYNRRLVRKVIEG--RGTPKRPN  310

Query  720   VAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDN---  550
              AI TFIF+LY+EN K GPGTERHWG+L P G PVY ++LT  + +++Y  +PEP +   
Sbjct  311   SAIATFIFALYNENLKPGPGTERHWGLLYPDGRPVYSIDLTGRLSDSQYEAVPEPMSVAV  370

Query  549   -NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAF  373
              N     + WCV         L   LD  C+     C  +  G  C+ P +I+AHA+YAF
Sbjct  371   VNSSSSSSSWCVARPDADTSSLQRELDRICSQNPSDCAAIQDGQSCFYPNTIIAHASYAF  430

Query  372   SSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +  W +       C F+  A +T ++PS+G+C  PS
Sbjct  431   NRRWIREN----QCSFSSTAALTKINPSYGSCIFPS  462



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score =   372 bits (956),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 202/456 (44%), Positives = 287/456 (63%), Gaps = 18/456 (4%)
 Frame = -3

Query  1617  ASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRV  1438
             +S+ G     IG+NYGRV +++PS  +T+E LK+M V  VK++D++ ++L  LS + IRV
Sbjct  20    SSTPGSGLDQIGVNYGRVSDNIPSPNQTVELLKSMNVRLVKLFDANPQVLTALSNSSIRV  79

Query  1437  TIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQ  1258
             TIMV NE I    +  +  ++A  W+  +VL + P T I  ++VGNE+ S  +    W Q
Sbjct  80    TIMVPNEII---GAVASSQSSADDWIAQSVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQ  136

Query  1257  MVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFL  1081
             ++PA++N+ ++L  HN+ + IK+ T VA D+L  S+PPS GRFR DI RD VL PLL FL
Sbjct  137   LMPAIENLHRSLQSHNLDDRIKITTSVAGDVLAASYPPSVGRFRPDI-RDTVLKPLLGFL  195

Query  1080  NRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVV  901
               TR+ F++++YPYF+W+ NP N+SL +ALF     TVV D +  L YTNLLD M D+  
Sbjct  196   RTTRAPFYINLYPYFAWAGNPVNISLGYALFDPAA-TVVRDGK--LRYTNLLDAMTDATF  252

Query  900   FAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPG  721
              AM+ LGF+DV + ISETGWPN GD ++ GA+  NAA YNR LV K+++    GTP RP 
Sbjct  253   SAMEDLGFDDVELGISETGWPNAGDENERGATRSNAATYNRRLVRKVVEG--RGTPKRPN  310

Query  720   VAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDN---  550
              AI TFIF+LY+EN K GPG ERHWG+L P G PVY ++LT  + +++Y  +PEP +   
Sbjct  311   SAIETFIFALYNENLKPGPGIERHWGLLYPDGRPVYSIDLTGRLSDSQYEAVPEPMSVAV  370

Query  549   -NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAF  373
              N     + WCV         L   LD  C+     C  +  G  C+ P +I+AHA+YAF
Sbjct  371   VNSSSSSSSWCVARPDADTSSLQRELDRICSQNPSDCAAIQDGQSCFYPNTIIAHASYAF  430

Query  372   SSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +  W +       C F+  A +T ++PS+G+C  PS
Sbjct  431   NRRWIREN----QCSFSSTAALTKINPSYGSCIFPS  462



>ref|XP_002972033.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
 gb|EFJ26950.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
Length=459

 Score =   362 bits (928),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 191/445 (43%), Positives = 278/445 (62%), Gaps = 20/445 (4%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             IGINYGRV ++LP     +E L+++++  VKIYD++ ++LK L  T +RV IMV N++I 
Sbjct  1     IGINYGRVADNLPPPARVVELLQSLKIRSVKIYDANPDVLKALQSTNLRVAIMVTNQEI-  59

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
                     S  + +WV  NV  + P T I   +VGNE+LSD S  Q++W ++VPAM+N+ 
Sbjct  60    --EQMAASSNFSDQWVQQNVAAY-PATKIETAIVGNEILSDLSLRQTVWSKLVPAMENLH  116

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
              +L       IKV T +A+D L+ SFPPS G FR D+  D ++ P+L FL  T+S FF++
Sbjct  117   SSLQRLGHGKIKVTTSLAIDCLKVSFPPSEGAFRDDV-SDTIIQPMLKFLETTQSPFFIN  175

Query  1050  VYPYFSWSENPYNVSLDFALFRG-GNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             VYPYF+W ++   +SLD+ALFRG  ++    +  +G+ Y NLLD  LD++V AM  LG+ 
Sbjct  176   VYPYFAWLDDQLTISLDYALFRGPSSNASQAEDPSGMHYDNLLDAQLDALVVAMTKLGYG  235

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMM----QDPPLGTPARPGVAIPT  706
              V+++ISETGWP+ G +   GAS+ NAA YNR LV +++    ++   GTP RPG  I T
Sbjct  236   GVQVSISETGWPSRGSV---GASLANAADYNRRLVLRILGKNRKNKNHGTPRRPGRLIDT  292

Query  705   FIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDN----NRPY  538
             +IF+L++E++K G  TER+WG+L P G  VY+++LT   P    P    P N    N   
Sbjct  293   YIFALFNEDQKPGAATERNWGLLYPNGSKVYDIDLTGKTPVPALPQAAIPGNFSTGNSSR  352

Query  537   EGNLWCVV-ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFW  361
             +G  WCV  A  +   D+  A+D+AC  G   C  + PG  CY P  +  HA+YAF+S+W
Sbjct  353   QGQ-WCVAKADYVSTADVQDAIDYACGGGKADCAAIQPGQACYLPNLVRLHASYAFNSYW  411

Query  360   AKYRSTGASCYFNGLATMTTVDPSH  286
              K + +G +C FNG A +T+VDPS 
Sbjct  412   QKMKRSGGTCAFNGFAKLTSVDPSK  436



>ref|XP_002972579.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
 gb|EFJ26665.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
Length=460

 Score =   362 bits (928),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 192/445 (43%), Positives = 278/445 (62%), Gaps = 20/445 (4%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             IGINYGRV ++LP     +E L+++++  VKIYD++ ++LK L  T +RV IMV N++I 
Sbjct  1     IGINYGRVADNLPPPARVVELLQSLKIRSVKIYDANPDVLKALQSTNLRVAIMVTNQEI-  59

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
                     S  + +WV  NV  + P T I   +VGNE+LSD S  Q++W ++VPAM+N+ 
Sbjct  60    --EQMAASSNFSDQWVQQNVAAY-PATKIETAIVGNEILSDLSLRQTVWSKLVPAMENLH  116

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
              +L       IKV T +A+D L+ SFPPS G FR DI  D ++ P+L FL  T+S FF++
Sbjct  117   SSLQRLGHGKIKVTTSLAIDCLKVSFPPSDGVFRDDIS-DAIIQPMLKFLETTQSPFFIN  175

Query  1050  VYPYFSWSENPYNVSLDFALFRG-GNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             VYPYF+W ++   +SLD+ALFRG  ++    +  +G+ Y NLLD  LD++V AM  LG+ 
Sbjct  176   VYPYFAWLDDQQTISLDYALFRGPSSNASQAEDPSGMHYDNLLDAQLDALVVAMTKLGYG  235

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMM----QDPPLGTPARPGVAIPT  706
              V+++ISETGWP+ G +   GAS+ NAA YNR LV +++    ++   GTP RPG  I T
Sbjct  236   GVQVSISETGWPSRGSV---GASLANAADYNRRLVLRILGKNRKNKNHGTPRRPGRLIDT  292

Query  705   FIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDN----NRPY  538
             +IF+L++E++K G  TER+WG+L P G  VY+++LT   P    P    P N    N   
Sbjct  293   YIFALFNEDQKPGAATERNWGLLYPNGSKVYDIDLTGKTPVPALPQAAIPGNFSTGNSSR  352

Query  537   EGNLWCVV-ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFW  361
             +G  WCV  A  +   D+  A+D+AC  G   C  + PG  CY P  +  HA+YAF+S+W
Sbjct  353   QGQ-WCVAKADYVSTADVQDAIDYACGGGKADCAAIQPGQACYLPNLVRLHASYAFNSYW  411

Query  360   AKYRSTGASCYFNGLATMTTVDPSH  286
              K + +G +C FNG A +T+VDPS 
Sbjct  412   QKMKRSGGTCAFNGFAKLTSVDPSK  436



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   359 bits (922),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 201/451 (45%), Positives = 267/451 (59%), Gaps = 15/451 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYGR+G+DLP  +  +E  ++   + V+ YDS+   L   + + +     V NE IP
Sbjct  27    LGVNYGRLGDDLPPPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIP  86

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
             +LA++   +     WV   +L F     +R + VGNEVLSD + +S W Q+VPAM N+++
Sbjct  87    SLAASRRAA---DEWVAATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVPAMANLER  143

Query  1227  ALNLHNIHNIKVGTPVAMDILETS--FPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             AL  H +  +KV T + MD L+    FPPS+G FR DI  D V+ PLL FL RT SY F+
Sbjct  144   ALRRHGMRRVKVSTTLGMDALDGQNVFPPSAGVFRPDIA-DAVVRPLLAFLERTDSYLFV  202

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVV----DSETGLVYTNLLDQMLDSVVFAMQY  886
             D Y YF+WS N   V L +AL              D  TGL YTNLLD MLD+VV AM  
Sbjct  203   DAYTYFTWSANHTIVPLHYALLEPSPSPSPAYQYHDPGTGLSYTNLLDHMLDAVVAAMCR  262

Query  885   LGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPT  706
              G   VR+A++ETGWPN GDLDQ GA+  NAA YNRN+   +      GTP RPG+ +P 
Sbjct  263   AGHCGVRMALAETGWPNAGDLDQFGANARNAATYNRNMARHLASG--AGTPRRPGMRMPA  320

Query  705   FIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT-TAVPETEYPPLPEPDNNRPYEGN  529
             F+F+L++E+ K GP TERHWG+  P G  VYE++LT    P +  P  P   N+ PY G 
Sbjct  321   FVFALFNEDLKTGPATERHWGLFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGK  380

Query  528   LWCVV-ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
             LWCVV A       +   ++ ACA     C  +  GG+CY P ++ AHA+Y FS+ W K+
Sbjct  381   LWCVVGAAAANETAVREQMEAACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKF  440

Query  351   RST-GASCYFNGLATMTTVDPSHGACKVPSV  262
                 G  CYF GLA  TT DPSHG+CK PSV
Sbjct  441   SKVYGGWCYFAGLAMETTTDPSHGSCKFPSV  471



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score =   358 bits (919),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 195/452 (43%), Positives = 271/452 (60%), Gaps = 12/452 (3%)
 Frame = -3

Query  1599  PSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRN  1420
             P+  +G++YG +G+DLP  +  +E  ++   + V+ YDS+  +L   S + +     V N
Sbjct  27    PAHFLGVSYGTLGDDLPPPHVALELARSAGAAAVRFYDSNATLLAAASSSGLGFVPGVPN  86

Query  1419  EDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMK  1240
             E IP+L+++   + A   WV   +L F     +R + VGNEVLSD + +S W Q+VPAM 
Sbjct  87    ELIPSLSASRRAADA---WVASTLLPFRRNPRLRYLFVGNEVLSDPTTKSRWSQLVPAMA  143

Query  1239  NIKKALNLHNIHNIKVGTPVAMDIL--ETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRS  1066
             N+ +AL  H +  +KV T + MD L  +  FPPS+G FR DI  D  + PLL FL RT S
Sbjct  144   NLHRALRRHGLGRVKVSTTLGMDALVGQNVFPPSAGVFRPDI-VDVAVRPLLAFLERTES  202

Query  1065  YFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQY  886
             Y F+D Y YF+W+ N   V L +AL    +     D  TGL YTNLLD MLD+VV AM  
Sbjct  203   YLFVDTYTYFTWTANHTVVPLPYALLEA-SKFRYHDPGTGLSYTNLLDHMLDAVVAAMCG  261

Query  885   LGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVA-IP  709
              G   V++A++ETGWPN GDLDQ GA+V NAA YNRN+   +      GTP RPG+  +P
Sbjct  262   AGHCGVKLALAETGWPNAGDLDQFGANVRNAATYNRNVARHLASG--AGTPRRPGMMRMP  319

Query  708   TFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT-TAVPETEYPPLPEPDNNRPYEG  532
              F+F+L++E+ K GPGTERHWG+  P    VYE++L+      + YPPLP   N+ PY G
Sbjct  320   AFVFALFNEDLKGGPGTERHWGLFYPNSSAVYEVDLSGRRTAASSYPPLPPATNDAPYPG  379

Query  531   NLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
              LWC+         +   +  AC      CD + PGG C+ P ++ AHA+Y FS+ W ++
Sbjct  380   KLWCMTKKLANGTAVREQVAAACKDEAALCDPVRPGGRCHLPDTVAAHASYVFSAHWNRF  439

Query  351   -RSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
              +  G  CYF GLA  TT+DPSHG+C+ PSV 
Sbjct  440   SKQYGGWCYFAGLAVETTIDPSHGSCRYPSVI  471



>ref|XP_002976500.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
 gb|EFJ22169.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
Length=461

 Score =   357 bits (915),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 194/446 (43%), Positives = 278/446 (62%), Gaps = 21/446 (5%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             IG+NYG++GN+LP+  +++E ++ +++ +VKIYD++  IL  L+ T ++VT+MV N+ IP
Sbjct  1     IGVNYGQLGNNLPAPPKSVELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIP  60

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
             ++AS+ + +     WV  NV  + P T IR VL+GNE+LSD S  QS W ++VPAMKNI 
Sbjct  61    SVASSQSFA---DEWVKSNVTAYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIH  117

Query  1230  KALNLHNIH-NIKVGTPVAMDILET-SFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFF  1057
             ++L    +H  IKV TP A+ +L+   FPPS+G FR DI  + ++ P+L FL+ T S FF
Sbjct  118   RSLAKLGLHRKIKVSTPHALLVLQGYVFPPSNGTFRDDI-AEPIIRPMLEFLHSTNSPFF  176

Query  1056  LDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGF  877
             +D YP+F+W  N   V +DFALF G + T   D   GLVY NLLD  LDS+  AM  LG 
Sbjct  177   VDAYPFFTWEFNRATVPIDFALFNG-SGTPYRDPGNGLVYDNLLDIQLDSITAAMAKLGH  235

Query  876   NDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIF  697
               V++ ++ETGWP  G +D+ GA+ +NAA YNR L  K+   PPLGTP RP   IP FIF
Sbjct  236   ESVKLGLAETGWPTKGGIDERGANFYNAALYNRRLAKKLATKPPLGTPKRPHQQIPAFIF  295

Query  696   SLYDENRKVGPGTERHWGILR-----PTGMPVYELNLTTAVPETEYPPL----PEPDNNR  544
             +L++EN K GP TER+WG+        T +  YE++LT  + + +Y P+    PEP    
Sbjct  296   ALFNENLKPGPVTERNWGLFAIADNGSTAIQKYEIDLTGRLSDGDYKPMALPPPEP---L  352

Query  543   PYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLA-PGGDCYEPVSILAHANYAFSS  367
             P    LWCV         L   +DFAC  G   C  +  PG  C+ P + ++HA+  F++
Sbjct  353   PGTAKLWCVANQSASTSQLQGGIDFACGPGGVNCSSITDPGQPCFLPNTTISHASIVFNA  412

Query  366   FWAKYRSTGASCYFNGLATMTTVDPS  289
             ++   R+ G SC FNG A +T+ DPS
Sbjct  413   YYFFQRTNGGSCVFNGAAFLTSSDPS  438



>ref|XP_001784285.1| predicted protein [Physcomitrella patens]
 gb|EDQ50891.1| predicted protein [Physcomitrella patens]
Length=437

 Score =   355 bits (912),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 276/445 (62%), Gaps = 14/445 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +GINYG +G++LPS  +T+  +KAM+  +VK+++ + +IL  L+ T + V + + NE+I 
Sbjct  1     MGINYGTLGDNLPSVADTVTAIKAMKFGRVKLFNPNPDILGALANTGLEVVVTLPNEEI-  59

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
                       + + WV  ++  + P   I  +L+GNE+ +    QS W  +VPA +NI  
Sbjct  60    --VEVGASLVSGESWVERHIAPYYPAANIVTILIGNEIFTSDKFQSTWTSLVPATQNIHA  117

Query  1227  ALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             AL       +IK+ T VA+D+L TSFPPS+G FRADI    VL P L+FL  T SY F++
Sbjct  118   ALRSRGWSGHIKISTAVALDVLATSFPPSAGTFRADIAI-SVLQPFLSFLTTTNSYLFVN  176

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
             VYP+ +++ +  ++SL +A+F   N T V D   G  YTNL+D  +D+V  A  +LGF +
Sbjct  177   VYPFLTYTIST-DISLGYAMFS--NTTEVNDG--GRTYTNLMDAQIDAVYAASTHLGFPN  231

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             +RIA+ ETGWP  GD++Q GA+V NAA YNR LV K++    +GTPARPGV IPT+IFSL
Sbjct  232   LRIAVGETGWPTAGDVNQTGATVDNAALYNRRLVLKVLSTTHVGTPARPGVIIPTYIFSL  291

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP----LPEPDNNRPYEGNLW  523
             ++EN K G G+ER+WG+L P   PVY ++LT  + + +Y P       P +        W
Sbjct  292   FNENLKPGVGSERNWGLLYPDLTPVYAVDLTGQLLDHQYAPNSVSTGPPSSPSSAGSGSW  351

Query  522   CVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             CV +     + L   L++AC A    C  L PG  C+ P ++ +HA++AF+S+W KYRS 
Sbjct  352   CVSSAAADPVTLENGLNYACNANEEFCAALQPGQSCHLPNTVASHASWAFNSYWQKYRSA  411

Query  342   GASCYFNGLATMTTVDPSHGACKVP  268
             G SC F+G AT+T++DPS G C  P
Sbjct  412   GGSCSFDGAATLTSIDPSFGTCLFP  436



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score =   356 bits (914),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 200/451 (44%), Positives = 266/451 (59%), Gaps = 15/451 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYGR+G+DLP  +  +E  ++   + V+ YDS+   L   + + +     V NE IP
Sbjct  27    LGVNYGRLGDDLPPPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPGVPNELIP  86

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
             +LA++   +     WV   +L F     +R + VGNEVLSD + +S W Q+V AM N+++
Sbjct  87    SLAASRRAA---DEWVAATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVSAMANLER  143

Query  1227  ALNLHNIHNIKVGTPVAMDILETS--FPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             AL  H +  +KV T + MD L+    FPPS+G FR DI  D V+ PLL FL RT SY F+
Sbjct  144   ALRRHGMRRVKVSTTLGMDALDGQNVFPPSAGVFRPDIA-DAVVRPLLAFLERTDSYLFV  202

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVV----DSETGLVYTNLLDQMLDSVVFAMQY  886
             D Y YF+WS N   V L +AL              D  TGL YTNLLD MLD+VV AM  
Sbjct  203   DAYTYFTWSANHTIVPLHYALLEPSPSPSPAYQYHDPGTGLSYTNLLDHMLDAVVAAMCR  262

Query  885   LGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPT  706
              G   VR+A++ETGWPN GDLDQ GA+  NAA YNRN+   +      GTP RPG+ +P 
Sbjct  263   AGHCGVRLALAETGWPNAGDLDQFGANARNAATYNRNMARHLASG--AGTPRRPGMRMPA  320

Query  705   FIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT-TAVPETEYPPLPEPDNNRPYEGN  529
             F+F+L++E+ K GP TERHWG+  P G  VYE++LT    P +  P  P   N+ PY G 
Sbjct  321   FVFALFNEDLKTGPATERHWGLFHPNGSAVYEVDLTGRRPPASYPPLPPPATNDAPYPGK  380

Query  528   LWCVV-ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKY  352
             LWCVV A       +   ++ ACA     C  +  GG+CY P ++ AHA+Y FS+ W K+
Sbjct  381   LWCVVGAAAANETAVREQMEAACADEAALCAPVRAGGECYLPNTVAAHASYVFSAHWNKF  440

Query  351   RST-GASCYFNGLATMTTVDPSHGACKVPSV  262
                 G  CYF GLA  TT DPSHG+CK PSV
Sbjct  441   SKVYGGWCYFAGLAMETTTDPSHGSCKFPSV  471



>emb|CAB71021.1| putative beta-1,3-glucanase [Hieracium piloselloides]
Length=379

 Score =   352 bits (904),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/372 (50%), Positives = 253/372 (68%), Gaps = 15/372 (4%)
 Frame = -3

Query  1677  MFKAKEMQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQV  1498
             M   K  +  +  L FF L+ASS    S+ IGINYGR+GN+LPS  ++IE L++M   +V
Sbjct  10    MQNHKLTKMALVFLSFFFLVASSRAAISNRIGINYGRLGNNLPSPAKSIELLESMNAGRV  69

Query  1497  KIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIR  1318
             K+YD+DHEIL LLSG  I V I V N++I   ++       A +WV+++VL   P T IR
Sbjct  70    KLYDADHEILHLLSGKDIEVAITVANDEI---SAIAANQHLADQWVYEHVLAHYPNTKIR  126

Query  1317  GVLVGNEVLSDSS-AQSLWL--QMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPP  1147
              +LVGNEV S ++  Q + +   +VPAM+ IK  +    I NIKVGTP+AMD++ET+FPP
Sbjct  127   FILVGNEVFSSTNNVQDMQIARDLVPAMRRIKNTIKAQGIRNIKVGTPLAMDMMETTFPP  186

Query  1146  SSGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYF------SWSENPYNVSLDFALFR  985
             S+G F+ DI   ++++PLL +LN TRS+  +DVYPYF      + + +   + L FAL R
Sbjct  187   SNGSFKPDI--RELMIPLLKYLNGTRSFVLVDVYPYFRVVRQVARNNSDTGIDLGFALLR  244

Query  984   GGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGAS  805
               N T   D ++GLVYT+LLDQMLDSVV+AM  LG++D+ +A++ETGWP+ GD+D+ GA+
Sbjct  245   TSNMTYT-DPQSGLVYTDLLDQMLDSVVYAMAKLGYDDIMLALAETGWPHDGDVDEIGAN  303

Query  804   VHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTG  625
               NAA YN NL+ KM   P  GTPARPG  +PTFIFS+YDEN+K GP TERHWG++ P G
Sbjct  304   RENAAEYNNNLIKKMAAVPSNGTPARPGQIVPTFIFSMYDENQKYGPATERHWGLMNPDG  363

Query  624   MPVYELNLTTAV  589
               VY +N+T  V
Sbjct  364   SAVYAVNITGKV  375



>ref|XP_002973407.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
 gb|EFJ25781.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
Length=541

 Score =   348 bits (894),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 194/454 (43%), Positives = 281/454 (62%), Gaps = 24/454 (5%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             IG+NYG++GN+LP   +++E ++ +++ +VKIYD++  IL  L+ T ++VT+MV N+ IP
Sbjct  93    IGVNYGQLGNNLPVPLKSVELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIP  152

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS-AQSLWLQMVPAMKNIK  1231
             ++AS+ + +     WV  NV  + P T IR VL+GNE+LSD S  QS W ++VPAMKNI 
Sbjct  153   SVASSQSFA---DEWVKSNVTAYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIH  209

Query  1230  KALNLHNIH-NIKVGTPVAM-DILET-SFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             ++L    +H  IKV TP A+ ++L+   FPPS+G FR DI  + ++ P+L FL+ T S F
Sbjct  210   RSLAKLGLHRKIKVSTPHALLNVLQGYVFPPSNGTFRDDI-AEPIIRPMLEFLHSTNSPF  268

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
             F+D YP+F+W  N   V ++FALF G + T   D   GLVY NLLD  LDS+  AM  LG
Sbjct  269   FVDAYPFFTWEFNRATVPINFALFNG-SGTPYRDPGNGLVYDNLLDIQLDSITAAMAKLG  327

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
                V++ ++ETGWP  G +D+ GA+ +NAA YNR L  K+   PPLGTP RP   IP FI
Sbjct  328   HESVKLGLAETGWPTKGGIDERGANFYNAALYNRRLAKKLATKPPLGTPKRPHQQIPAFI  387

Query  699   FSLYDENRKVGPGTERHWGILR-----PTGMPVYELNLTTAVPETEYPPL----PEPDNN  547
             F+L++EN K GP TER+WG+        T +  YE++LT  + + +Y P+    PEP   
Sbjct  388   FALFNENLKPGPVTERNWGLFAIADNGSTAIQKYEIDLTGRLSDGDYKPMALPPPEP---  444

Query  546   RPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLA-PGGDCYEPVSILAHANYAFS  370
              P    +WCV         L   +DFAC  G   C  +  PG  C+ P + ++HA+  F+
Sbjct  445   LPGTAKIWCVANQSASTSQLQGGIDFACGPGGVNCSLITDPGQPCFLPNTTISHASIVFN  504

Query  369   SFWAKYRSTGASCYFNGLATMTTVDPS--HGACK  274
             +++   R+ G SC FNG A +T+ DPS  H + K
Sbjct  505   AYYFLQRTNGGSCVFNGAAFLTSSDPSVLHASVK  538



>emb|CDP14397.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/459 (39%), Positives = 275/459 (60%), Gaps = 25/459 (5%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             +I INYGRV NDLPS    ++ LKA  +++VK+YD+D  +L  LSG+ I VT+ + NE +
Sbjct  42    SIAINYGRVANDLPSPPHVVQLLKAQGLTKVKLYDTDSTVLSALSGSGISVTVALPNELL  101

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                +S     +    WV  N+  + P T+I  + VGNEV  D    + +L  VPAMKN+ 
Sbjct  102   ---SSAAAGQSYTDSWVQSNIFAYYPKTLIEAIAVGNEVFVDPKNTTPFL--VPAMKNVY  156

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
              +L  +N+ +IK+ +P+A+  L+TS+P SSG F+ ++  + V+ P+LNFL +T SY  ++
Sbjct  157   SSLVKYNVSSIKISSPIALSALQTSYPSSSGSFQPEL-VEPVIKPMLNFLKQTGSYVMVN  215

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
              YP+F+++ N   +SLD+ALFR  +D  V D   GLVY +L +  LD+V  AM  LGFND
Sbjct  216   AYPFFAYTANTDTISLDYALFR--DDKGVTDPNNGLVYKSLFEAQLDAVFAAMNTLGFND  273

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             V++ +SETGWP+ GD ++ GAS  NAAAYN NLV +++     GTP RP   +  ++F+L
Sbjct  274   VKVVVSETGWPSKGDENEVGASQQNAAAYNGNLVRRVLTSG--GTPLRPDEPLNVYLFAL  331

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLT--------TAVPETEYPPLPEPDNNR---  544
             ++EN+K GP +ER++G+  P+   VY++ LT        TA P      + +P +     
Sbjct  332   FNENQKTGPTSERNYGLFYPSEQKVYDVPLTLEALASAPTASPSNTSRVVTKPPSTSSSG  391

Query  543   ----PYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYA  376
                    G  WCV +  +    L  ALD+AC  G   C  + PG  CY P +++AHA+YA
Sbjct  392   DFFPSTAGQTWCVASGDVGEEKLKAALDYACGEGAADCRPIQPGATCYNPNTLVAHASYA  451

Query  375   FSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             F+S++ K      SCYF G A + +  P +G+C  P+ +
Sbjct  452   FNSYYQKNARRSGSCYFGGAAYVVSQLPKYGSCDYPTGY  490



>ref|XP_006575581.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=472

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 188/479 (39%), Positives = 283/479 (59%), Gaps = 29/479 (6%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
              I  T+L S       +IG+NYGR+ N+LPSA + +  LK+  +++VK+YD+D  +L+ L
Sbjct  4     FIVLTILLSLTLADGGSIGVNYGRIANNLPSAVKVVHLLKSQGLTRVKVYDTDPAVLRAL  63

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             SG+ IRVT+ + N+ +    +     + A  WV  NV  + P T I  + VGNEV  D  
Sbjct  64    SGSGIRVTVDLPNQQL---FAAAKAPSFASSWVERNVAAYYPHTQIEAIAVGNEVFVDPH  120

Query  1278  AQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  VPAMKNI+KAL  HN+  +IKV +P+A+  L  S+P S+G FR ++  + V 
Sbjct  121   NTTKFL--VPAMKNIQKALTKHNLDKDIKVSSPIALSALANSYPSSAGSFRPEL-VEPVF  177

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L+FL  T SY  ++VYP+F++  N   +SLD+ALFR  ++  VVD   GL Y NL D
Sbjct  178   KPMLDFLRETGSYLMVNVYPFFAYESNADVISLDYALFR--DNPGVVDPGNGLRYYNLFD  235

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               +D+V  A+  L ++DV+I ++ETGWP+ GD ++ GASV NAAAYN NLV K++     
Sbjct  236   AQIDAVFSALSALKYDDVKIVVTETGWPSKGDSNEVGASVDNAAAYNGNLVRKILTAG--  293

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT-----------  595
             GTP RP   +  F+F+L++EN+K GP +ER++G+  P    VY + LTT           
Sbjct  294   GTPLRPKADLIVFLFALFNENQKPGPTSERNFGLFYPDERRVYNVPLTTEELKDYHDRPA  353

Query  594   ---AVPETEYPPLPEP----DNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDD  436
                   + +  P P P      ++   GN WCV       + L  ALDFAC  G   C  
Sbjct  354   PVSGGGQQKGTPAPAPVVSGGVSKSTTGNTWCVANPDADKVKLQAALDFACGEGGADCRP  413

Query  435   LAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             +  G  CY+P +++AHA++AF+S++ K    G SCYF G + + T +P +G+C+ P+ +
Sbjct  414   IQRGSTCYDPNTLVAHASFAFNSYYQKQSRKGGSCYFGGTSYVVTQEPKYGSCEFPTGY  472



>ref|XP_002463526.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
 gb|EER90524.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Length=483

 Score =   343 bits (880),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 204/456 (45%), Positives = 272/456 (60%), Gaps = 23/456 (5%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYG +G++LP     +E  ++   S V+ YD++  +L   + + +     V NE IP
Sbjct  38    LGVNYGTLGDNLPLPQRGLELARSAGASAVRFYDANATMLAAAAASGLEFVPSVPNELIP  97

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
             +LA++   +     WV   +L F     +R + VGNEVLSD +A+S W ++VPAM N+ +
Sbjct  98    SLAASQRAA---DAWVATTLLPFRGNPRLRYLFVGNEVLSDPTARSRWPRLVPAMANVHR  154

Query  1227  ALNLHNIHNIKVGTPVAMDILETS--FPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             AL+ H + ++KV T  +M  LE    FPPS+G FR DI    V+ PLL FL+RT S  F+
Sbjct  155   ALHRHGLGSVKVSTTFSMHELEGQNVFPPSAGAFRPDI-AGAVVRPLLAFLDRTGSPLFV  213

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             D Y YF+WS N   V L +AL    +  V  D  TGL YTNLLDQMLD+VV AM   G  
Sbjct  214   DAYTYFTWSANHTVVPLPYALLAPASGYVYRDPGTGLSYTNLLDQMLDAVVAAMCRAGHC  273

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAI-PTFIF  697
              V +A++ETGWP  GDLDQ GA+V NAA YNRNL   +      GTP RP   + P  +F
Sbjct  274   GVGLALAETGWPTAGDLDQFGANVRNAATYNRNLARHLASG--AGTPRRPRARVAPAMVF  331

Query  696   SLYDENRKVGPGTERHWGILRPTGMPVYELNLT-TAVPETEYPPLPEPDNNRPYEGNLWC  520
             +L++E+ K GPGTERHWG+  P G  VYE++LT        YPPLP   N+RPY G LWC
Sbjct  332   ALFNEDLKWGPGTERHWGLFYPNGSAVYEVDLTGRRRSLPSYPPLPPASNDRPYPGPLWC  391

Query  519   VVATGIRILDLGPA--------LDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSF  364
             VVAT     D GP         +  ACA   G CD + PGG C+ P ++ AHA+Y FS+ 
Sbjct  392   VVAT-----DKGPVNETAVRAQVAAACADVPGLCDPVRPGGACFLPDTVSAHASYVFSAH  446

Query  363   WAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVFV  256
             W ++      CYF G A  TTVDPSHG+CK PS+ +
Sbjct  447   WNRFSEDYGGCYFAGFAVETTVDPSHGSCKFPSILL  482



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   339 bits (870),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 191/461 (41%), Positives = 268/461 (58%), Gaps = 81/461 (18%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQ-VKIYDSDHEILKLLSGTYIRVTIMVRN  1420
             +S + +NYG++ N+LPS+ + +  +K    S+ VK+YD++ +IL  L  T + V  MV N
Sbjct  21    TSALRVNYGQLCNNLPSSPDAVRLIKKRLSSKSVKLYDANPQILLALRNTGLEVCAMVPN  80

Query  1419  EDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMK  1240
             E I   A+ +   A +  WV  N++ F P T IR +LVGNE+LSD               
Sbjct  81    ELI---ANISADQALSDHWVGSNIIPFYPDTKIRHLLVGNEILSDPG-------------  124

Query  1239  NIKKALNLHNIHNIKVGTPVAMDILETS--FPPSSGRFRADIPRDQVLLPLLNFLNRTRS  1066
                   N H I N+KVG  +AM+ LE S  +PPS+G FR+DI    V+ P+L FL+ T+S
Sbjct  125   ------NRHRIRNVKVGISMAMETLEGSSVYPPSNGSFRSDI-SGSVMKPMLQFLSETKS  177

Query  1065  -------------YFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLL  925
                          Y + D YPYF W++ P  ++LD+ALF   + T   D  TGLVYTNL 
Sbjct  178   DLHFFFFFFGRESYLYFDAYPYFHWAKVPEKINLDYALFESKSITYK-DPGTGLVYTNLF  236

Query  924   DQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPP  745
             DQM+DS+VFAM+ LG+ +V+I ++ETGWP                      + K+   PP
Sbjct  237   DQMVDSMVFAMKKLGYPNVQILMAETGWP----------------------IKKLTARPP  274

Query  744   LGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPL  565
             +GTPARP  A+  FIF+L++EN+K GP TERH+G+L P G  VY+++L      + Y PL
Sbjct  275   VGTPARPRRAMQGFIFALFNENQKPGPTTERHFGLLYPNGSKVYQIDLRGKTTSSGYEPL  334

Query  564   PEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHA  385
             PEP NN+ Y+G ++C                   + GN TC+ + PG  C+ P   L HA
Sbjct  335   PEPTNNKQYKGPMYC-------------------SQGNNTCEAIRPGKACHNPDLSLFHA  375

Query  384   NYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSV  262
             NYAFSS+WA++R++GASC+ NGLAT T  DPSHG+CK PSV
Sbjct  376   NYAFSSYWAEFRNSGASCFLNGLATQTIKDPSHGSCKFPSV  416



>ref|XP_001781801.1| predicted protein [Physcomitrella patens]
 gb|EDQ53355.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   340 bits (872),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 177/447 (40%), Positives = 271/447 (61%), Gaps = 14/447 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +GINYG +G++LPS  + +  +KAM++ +VK++  + +IL  L+ T + V + V NE+I 
Sbjct  1     LGINYGTLGDNLPSPADAVAAIKAMKIGRVKLFSPNADILTALANTGMEVVVAVPNEEI-  59

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
                +     AAA  WV  ++  + P   I  +LVGNE+ + ++ QS W  ++PA +N+  
Sbjct  60    --VAVGASPAAATAWVRLHISPYHPEANIVVILVGNEIFTGTTFQSTWTSLLPATQNLHA  117

Query  1227  ALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             A+        I++ T VA+D+L +SFPPS+G FR+DI    V  PLL+FL +T SY F++
Sbjct  118   AIESFGWSGQIRISTAVALDVLASSFPPSAGTFRSDIATSFVR-PLLSFLTKTNSYLFVN  176

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
             VYP+ ++S +  +++L +A+F    D VV   + GL YTNL+D  LD+V  A   LGF  
Sbjct  177   VYPFLTYSSSS-DINLSYAMFASTTDNVV---DGGLTYTNLMDAQLDAVYAAATKLGFTS  232

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             +RIAI ETGWP+ GD  +  A++ NAA YNR LV K++    +GTPARPGV IPT+IF+L
Sbjct  233   LRIAIGETGWPSAGDSTEVAATIDNAANYNRRLVRKILSTTQIGTPARPGVFIPTYIFAL  292

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYE--GNLWCV  517
             ++EN K G  +ER+WG+L P   PVY ++LT  + +++Y P     N+ P +     WC+
Sbjct  293   FNENLKPGVSSERNWGLLHPNLSPVYAIDLTGQIYDSQYSP---NSNSSPLQTGSGTWCI  349

Query  516   VATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGA  337
                    + L   L+FAC A    C  + P   CY P +I++HA +AF+++W KY+  G 
Sbjct  350   SNENSDPVTLENGLNFACGADVEFCKAIQPSASCYLPSTIVSHAAWAFNNYWQKYKGAGG  409

Query  336   SCYFNGLATMTTVDPSHGACKVPSVFV  256
             SC F+G   +T+ DPS         F+
Sbjct  410   SCSFSGAGVLTSTDPSKSLSSTSEFFL  436



>ref|XP_006595830.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   340 bits (873),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 186/478 (39%), Positives = 285/478 (60%), Gaps = 28/478 (6%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
              I  T+L S       +IG+NYGR+ N+LPSA + ++ LK+  +++VK+YD+D  +L+ L
Sbjct  4     FIILTILLSLALADGGSIGVNYGRIANNLPSAVKVVQLLKSQGLTRVKVYDTDPAVLRAL  63

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             SG+ I+VT+ + N+ +    +     + A  WV  NV  + P T I  + VGNEV  D  
Sbjct  64    SGSGIKVTVDLPNQQL---FAAAKAPSFASSWVERNVAAYYPHTQIESIAVGNEVFVDPH  120

Query  1278  AQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  VPAMKNI+KAL  HN+  +IKV +P+A+  L  S+P S+G FR ++  + V 
Sbjct  121   NTTKFL--VPAMKNIQKALTKHNLDKDIKVSSPIALSALANSYPSSAGSFRPEL-VEPVF  177

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L+FL  T SY  ++VYP+F++  N   +SLD+ALFR  ++  VVD   GL Y NL D
Sbjct  178   KPMLDFLRETGSYLMVNVYPFFAYESNADVISLDYALFR--DNPGVVDPGNGLRYYNLFD  235

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               +D+V  A+  L ++DV+I ++ETGWP+ GD ++ GASV NAAAYN NLV K++     
Sbjct  236   AQIDAVFSALSALKYDDVKIVVTETGWPSKGDSNEVGASVENAAAYNGNLVRKILT--AA  293

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT----------A  592
             GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY + LT           +
Sbjct  294   GTPLRPKADLTVYLFALFNENQKPGPTSERNFGLFYPDERRVYNVPLTVEELKDYHDRPS  353

Query  591   VP------ETEYP-PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDL  433
              P      + E P P+     ++   GN WCV       + L  ALDFAC  G   C  +
Sbjct  354   APVNGGGQKKETPAPVVSGGVSKSTTGNTWCVANPDADKVKLQAALDFACGEGGSDCGPI  413

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
               G  CY+P +++AHA++AF+S++ K    G SCYF G + + T +P +G+C+ P+ +
Sbjct  414   QRGATCYDPNTLVAHASFAFNSYYQKQSRKGGSCYFGGTSYVVTQEPRYGSCEFPTGY  471



>ref|XP_008669802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Zea 
mays]
 tpg|DAA38972.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=472

 Score =   340 bits (871),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 188/449 (42%), Positives = 264/449 (59%), Gaps = 11/449 (2%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYG +G++LP  +  +E  ++     V+ YD++  +L   + + +       NE IP
Sbjct  29    LGVNYGTLGDNLPPPHRGMELARSAGAVSVRFYDANATLLAAAAASGLDFVPSFPNELIP  88

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
             +LA +   + A    V   +L F     +R + VGNE LS+ +A+  W  +VPAM N  +
Sbjct  89    SLAGSQRAADAL---VAATLLPFRGNPRLRYLFVGNEFLSNPTAKPNWALIVPAMTNAAR  145

Query  1227  ALNLHNIHNIKVGTPVAM-DILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             AL  H + ++KV T ++M D+  T  PPS+G FR +I  + V+ P+L FL RT S  FLD
Sbjct  146   ALRRHGLAHVKVSTTLSMNDLGNTVLPPSAGAFRPEI-AEAVMGPMLAFLQRTGSCLFLD  204

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
              Y YF+WS N     L +AL          D  TGL Y NLLDQMLD+   AM  LG+  
Sbjct  205   AYTYFTWSANHTIFPLPYALLEPSPGFAYHDPGTGLSYANLLDQMLDTAAAAMCRLGYCG  264

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             V +A++ETGWP  GDLDQ GA+V NAA YNRNL  ++      GTP RPGV +P  +F+L
Sbjct  265   VGLALAETGWPTAGDLDQFGANVRNAATYNRNLARRLASG--AGTPRRPGVPVPAMVFAL  322

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYEGNLWCVVA  511
             ++E+ K GP TERHWG+  P G  VYE++LT   P   YPPLP   N++PY G LWCVV 
Sbjct  323   FNEDLKWGPDTERHWGLFYPNGSAVYEVDLTGRRPLASYPPLPPATNDQPYRGPLWCVVR  382

Query  510   T-GIRILDLGPALDFAC---AAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRST  343
             T GI    +   +   C    A +  CD + PGG C+ P ++ AHA+Y FS+ W ++   
Sbjct  383   TAGINETAVREQVAAVCDDDEAEDALCDPVRPGGACFLPNTVAAHASYVFSAHWNRFSED  442

Query  342   GASCYFNGLATMTTVDPSHGACKVPSVFV  256
               +CYF+G    TT+DPSHG+CK PS+ +
Sbjct  443   YGACYFDGWGMETTIDPSHGSCKFPSIHL  471



>ref|XP_003616906.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES99864.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=470

 Score =   340 bits (871),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/460 (39%), Positives = 276/460 (60%), Gaps = 25/460 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + NIGINYGR+ N+LPSA + ++ LK+  ++ VKIYD+D  +L+ LSG+ I++T+ + N+
Sbjct  22    AGNIGINYGRIANNLPSATKVVQLLKSQGITHVKIYDTDPSVLRALSGSKIKLTVDLPNQ  81

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    +     + A  WV  N++ + P T+I  + VGNEV  D +  + +L  VPAMKN
Sbjct  82    QL---FAAAKSQSFALSWVERNIVAYQPNTIIEAIAVGNEVFVDPNNSTKYL--VPAMKN  136

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I ++L  HN+HN IKV +P+A+  L  S+P SSG FR ++ +  V  P+L+FL  T SY 
Sbjct  137   IYRSLQKHNLHNDIKVSSPIALSALGNSYPSSSGSFRPELIQ-PVFKPMLDFLRETGSYL  195

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++VYP+F++  N   +SLD+ALFR   +   VD+  GL Y NL D  +D+V  A+  L 
Sbjct  196   MVNVYPFFAYESNADVISLDYALFR--ENPGQVDAGNGLRYLNLFDAQIDAVFAALSRLK  253

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+ + +SETGWP+ GD ++ GASV NAAAYN NLV K++     GTP RP   +  F+
Sbjct  254   YDDINVVVSETGWPSKGDGNEVGASVENAAAYNANLVRKILTSK--GTPLRPKADLTVFL  311

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDN----------  550
             F+L++EN+K GP +ER++G+  P    VY + LT    +  Y   P P +          
Sbjct  312   FALFNENQKPGPTSERNFGLFYPDEKKVYNVPLTVEALKN-YHDDPSPASPVSGGGGSGG  370

Query  549   ---NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANY  379
                ++   GN WCV         L  ALDFAC  G   C  +     C++P +++AHA++
Sbjct  371   GGVSKSTTGNTWCVANPYADKNKLQDALDFACGEGGADCRPIQNNATCFDPNTLVAHASF  430

Query  378   AFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             AF+S++ K    G SCYF G + + T +P +G C+ P+ +
Sbjct  431   AFNSYYQKQARAGGSCYFGGTSYVVTQEPKYGKCEFPTGY  470



>ref|XP_004140121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 ref|XP_004156096.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 2 
[Cucumis sativus]
 gb|KGN47963.1| hypothetical protein Csa_6G421570 [Cucumis sativus]
Length=476

 Score =   339 bits (869),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 183/464 (39%), Positives = 278/464 (60%), Gaps = 28/464 (6%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S +IG+NYGR+GNDLPSA + ++ LK+  + +VK+YD+D  +LK LSG+ I+VT+ + NE
Sbjct  23    SGSIGVNYGRIGNDLPSAVKVVKLLKSHGLQRVKVYDTDPAVLKALSGSGIKVTVDLPNE  82

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    +   +   A  WV  NV  + P T I  + VGNEV  D    + +L  VPAMKN
Sbjct  83    LL---FAAAKRLTFAYTWVEKNVAAYYPSTEIEAIAVGNEVFVDPHNTTSFL--VPAMKN  137

Query  1236  IKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I +AL  +N+H NIKV +P+A+  L+ S+P S+G FR ++  + V  P+L FL +T SY 
Sbjct  138   IHQALVKYNLHSNIKVSSPIALSALQNSYPSSAGSFRPEL-VETVFRPMLEFLRQTGSYL  196

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR  ++  VVD+ +G  Y NL D  +D+V  AM  L 
Sbjct  197   MVNAYPFFAYESNTDVISLDYALFR--DNPGVVDAGSGYRYFNLFDAQIDAVFAAMSALK  254

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+++ ++ETGWP+ GD ++ GASV NAAAYN NLV +++     GTP RP   +  ++
Sbjct  255   YDDIKMVVTETGWPSKGDENEIGASVENAAAYNGNLVRRILSGG--GTPLRPKADLTVYL  312

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT-AVPETEYPPLPEP--DNNRP----  541
             F+L++EN+K GP +ER++G+  P    VY++  TT  + + E  P P+P    N P    
Sbjct  313   FALFNENKKNGPTSERNYGLFYPNEEKVYDIPFTTEGLKDFEDKPSPKPVSGGNAPTAPP  372

Query  540   ----------YEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
                         GN WCV +       L   LD+AC  G   C  +  G  CY P ++ A
Sbjct  373   ASGDGGVSKSQTGNTWCVASGEAGKEKLQSGLDYACGEGGADCRPIQVGATCYNPNTLEA  432

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             HA+YAF+S++ K      +CYF G A + T  P +G+C+ P+ +
Sbjct  433   HASYAFNSYYQKNSRKVGTCYFGGAAYVVTQPPKYGSCEFPTGY  476



>emb|CDP13790.1| unnamed protein product [Coffea canephora]
Length=564

 Score =   342 bits (877),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 180/459 (39%), Positives = 273/459 (59%), Gaps = 25/459 (5%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             ++ INYGRV NDLPS  + ++ LKA  +++VK+YD+D  +L  LSG+ I VT+ + NE +
Sbjct  116   SVAINYGRVANDLPSPPQVVQLLKAQGLTKVKLYDTDSNVLSALSGSGISVTVALPNEQL  175

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                +S     +    WV  NVL + P T+I  + VGNEV  D    + +L  VPAMKN+ 
Sbjct  176   ---SSAAGGQSYTDSWVQSNVLAYYPKTLIEAIAVGNEVFVDPKNTTPFL--VPAMKNVY  230

Query  1230  KALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
              +L  +N+  IK+ +P+A+  L+TS+P SSG F++++  + V+ P+LNFL +T SY  ++
Sbjct  231   SSLVKYNVSAIKISSPIALSALQTSYPSSSGSFKSEL-IEPVIKPMLNFLKQTGSYVMVN  289

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
              YP+F+++ N   +SLD+ALF  GN   V D   GLVY +L +  LD+V  AM  +GF D
Sbjct  290   AYPFFAYTANTDTISLDYALF--GNSKGVTDPNNGLVYKSLFEAQLDAVFAAMNAVGFKD  347

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             V++A+SETGWP+ GD ++ GAS  NAA+YN NLV +++     GTP RP   +  ++F+L
Sbjct  348   VKVAVSETGWPSKGDENEAGASQQNAASYNGNLVRRVLTGG--GTPLRPDEPLNVYLFAL  405

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLT--------TAVPETEYPPLPEP-------  556
             ++EN+K GP +ER++G+  P+   VY++ LT        TA P        +P       
Sbjct  406   FNENQKTGPTSERNYGLFYPSEQKVYDVPLTLEALARAPTASPSNTSRVATKPPSTSSGG  465

Query  555   DNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYA  376
             D +    G  WCV +       L  ALD+AC  G   C  +  G  CY P +++AHA+YA
Sbjct  466   DFSPSTAGQTWCVASGDAGEEKLKDALDYACGEGAADCRPIQRGATCYSPNTLVAHASYA  525

Query  375   FSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             F+S++ K      SCYF G A + +  P +G C  P+ +
Sbjct  526   FNSYYQKNARRSGSCYFGGAAYVVSQSPKYGRCNYPTGY  564



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score =   338 bits (868),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 174/466 (37%), Positives = 281/466 (60%), Gaps = 14/466 (3%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             F+  F  +   S+   + +IGINYGR+ NDLP+  + +E LK+  +++VK+YD+D  +L 
Sbjct  6     FSFFFILISYISSSSEAGSIGINYGRIANDLPTPAKVVELLKSQGLNRVKLYDTDATVLT  65

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
               + + ++V + + NE +   A+   + +    WV  N+  + P T I  + VGNEV  D
Sbjct  66    AFANSGMKVVVAMPNELL---ANAAAEQSFTDAWVQANISSYYPATQIEAIAVGNEVFVD  122

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
              +  + +L  VPAMKN+  +L  +++  NIK+ +P+A+  L+ SFP SSG F+ ++  + 
Sbjct  123   PNNTTKFL--VPAMKNVHASLVKYSLDKNIKISSPIALSALQNSFPASSGSFKTEL-LEP  179

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L+FL +T SY  ++ YP+F+++ N   +SLD+ALF+   +  VVDS  GL YTNL
Sbjct  180   VIKPMLDFLRQTGSYLMVNAYPFFAYAANSDKISLDYALFK--ENPGVVDSGNGLKYTNL  237

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              D  +D+V  AM  + ++DV+IA+SETGWP+ GD ++ GAS  NAA+YN NLV +++   
Sbjct  238   FDAQIDAVFAAMSAVKYDDVKIAVSETGWPSAGDSNEIGASPDNAASYNGNLVKRVLSGS  297

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
               GTP +P  ++  F+F+L++EN+K GP +ER++G+  P+   VY++ LT   P +    
Sbjct  298   --GTPLKPNESLDVFLFALFNENQKTGPTSERNYGLFYPSQKKVYDIQLTAEAPPSGVGK  355

Query  567   LPEP---DNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSI  397
                P   D     +G  WCV   G     L  AL++AC  G   C  + PG  CY+P ++
Sbjct  356   SQVPVSGDVTTSSKGQTWCVANGGSSEKKLQNALNYACGEGGADCTPIQPGATCYDPNTL  415

Query  396   LAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
              AHA+YAF+S++ K      +CYF G A + T  P +G C+ P+ +
Sbjct  416   EAHASYAFNSYYQKMARASGTCYFGGTAYVVTQPPKYGNCEFPTGY  461



>ref|XP_006837267.1| hypothetical protein AMTR_s00112p00108890 [Amborella trichopoda]
 gb|ERN00121.1| hypothetical protein AMTR_s00112p00108890 [Amborella trichopoda]
Length=464

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 183/465 (39%), Positives = 279/465 (60%), Gaps = 12/465 (3%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             +F L F +    S      ++GINYGRV N+LPSA + +  LK   + +VKIYDSD  +L
Sbjct  10    LFELCFVSGFMLSAVAAGGSVGINYGRVANNLPSAVKVVTLLKKQGIDKVKIYDSDPAVL  69

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
             + LSG+ I V I + NE +    +   + +AA+ WV  NV ++LP T I  + VGNEV  
Sbjct  70    QALSGSGISVVIGLPNEQL---FATARRQSAAEEWVSKNVAKYLPNTKITTIAVGNEVFV  126

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             D    + +L  + AM+N+  AL ++ I + +KV +P+A+  L+TS+P S+G F+ D+  +
Sbjct  127   DPHNTTRYL--ITAMQNVHSALVMYKIDDKVKVSSPIALSALQTSYPSSAGVFKQDLA-E  183

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTN  931
              V+ P+L FL +T SY  ++ YP+F++ +N   +SLD+ALF+   +  VVDS +GL YTN
Sbjct  184   VVMKPMLEFLRQTGSYLMVNAYPFFAYKDNADVISLDYALFK--PNAGVVDSGSGLQYTN  241

Query  930   LLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQD  751
             LLD  LD+V  AM  L + DVR  ++ETGWP+ GD ++ GAS+ NAAAYN NLV +++  
Sbjct  242   LLDAQLDAVNAAMAALKYGDVRTVVTETGWPSKGDENETGASLANAAAYNSNLVRRVLSG  301

Query  750   PPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYP  571
                GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY + L  A    ++ 
Sbjct  302   K--GTPLRPQTPLEVYLFALFNENKKNGPTSERNYGLFFPDEEKVYNVPLLMAKSGDDHK  359

Query  570   PLPEP-DNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
                 P D      G  WCV +       L  ALD+AC  G   C ++ PG  CY+P ++ 
Sbjct  360   GSSPPVDVGSAAGGQSWCVASEEASEDQLQAALDYACGEGGADCKEIQPGASCYDPDTLK  419

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             AHA++AF+S++ K   T  +C F+G A + +  P  G C +P+ F
Sbjct  420   AHASFAFNSYYQKNARTTGTCDFHGAAYVVSQLPKFGKCALPTGF  464



>gb|KDP30806.1| hypothetical protein JCGZ_13749 [Jatropha curcas]
Length=469

 Score =   337 bits (864),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 179/475 (38%), Positives = 282/475 (59%), Gaps = 23/475 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             F   FF LL       + +IG+NYGR+ N+LPSA + ++ LK+  + +VK++D+D  +LK
Sbjct  5     FIFCFFLLLCIFCIADAGSIGVNYGRIANNLPSAVKVVQLLKSQGLQRVKVFDADPAVLK  64

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
              LSG+ I+VT+ + NE +    S   + + A  WV  N+  + P T I  + VGNEV  D
Sbjct  65    ALSGSSIKVTVDLPNELL---YSAAKRQSFALSWVQRNIAAYYPSTQIEAIAVGNEVFVD  121

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
                 + +L  +PAMKNI +AL   N+H +IK+ +P+A+  L++S+P S+G FR+++  + 
Sbjct  122   PHNTTKFL--IPAMKNIHQALEKLNLHSDIKISSPIALSALQSSYPSSAGAFRSEL-IEP  178

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V  PLL+FL +T SY  ++ YP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L
Sbjct  179   VFKPLLDFLRQTGSYLMVNAYPFFAYESNSDVISLDYALFR--ENPGVVDAGNGLRYFSL  236

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              D  +D+V  AM  L ++D+R+ ++ETGWP+ GD ++ GAS+ NAAAYN NL+ +++   
Sbjct  237   FDAQIDAVFAAMSALKYDDIRMVVTETGWPSKGDENELGASLQNAAAYNGNLIRRILTGG  296

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA--------  592
               GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY++  T          
Sbjct  297   --GTPLRPKADLTVYLFALFNENQKNGPTSERNYGLFYPNEQKVYDIPFTVEGLKNYKDN  354

Query  591   -VPETEYPPLPEPDN---NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPG  424
               P +    +  P N   ++   GN WCV  + +    L   LDFAC  G   C  + PG
Sbjct  355   PSPASGGQQVTNPVNGGVSKSTTGNTWCVANSEVGKEKLQAGLDFACGEGGADCRPIQPG  414

Query  423   GDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
               CY P +I AHA++AF+S++ K      +CYF G A + T  P +G C+ P+ +
Sbjct  415   ASCYNPNTIEAHASFAFNSYYQKNGRKAGTCYFGGSALVVTQAPKYGECEFPTGY  469



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   336 bits (862),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 181/470 (39%), Positives = 278/470 (59%), Gaps = 23/470 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             F  I  T  +SS+   + ++GINYGRV NDLP+  + +E LKA  +++VK+YD+D  +L 
Sbjct  14    FFFILITFFSSSS--EAGSVGINYGRVANDLPTPAKVVELLKAQGLNRVKLYDTDATVLT  71

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
               + + I+V + + NE +   A+     +    WV  N+  + P T I  + VGNEV  D
Sbjct  72    AFANSGIKVVVAMPNELL---ANAAADQSFTDAWVQANISTYYPATQIEAIAVGNEVFVD  128

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
              +  + +L  VPAMKN+  +L  +N+  NIK+ +P+A+  L+ SFP SSG F+ ++  + 
Sbjct  129   PNNTTKFL--VPAMKNVHASLTKYNLDKNIKISSPIALSALQNSFPASSGSFKTEL-VEP  185

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L+ L +T SY  ++ YP+F+++ N   +SLD+ALF+   +  VVDS  GL YTNL
Sbjct  186   VIKPMLDLLRQTGSYLMVNAYPFFAYAANSDKISLDYALFK--ENPGVVDSGNGLKYTNL  243

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              D  +D+V  AM  L + DV+IA+SETGWP+ GD ++ GAS  NAA+YN NLV ++M   
Sbjct  244   FDAQIDAVFAAMSALKYEDVKIAVSETGWPSAGDSNEIGASPDNAASYNGNLVKRVMSGS  303

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
               GTP +   ++  F+F+L++EN+K GP +ER++G+  PT   VY++ L TA    E PP
Sbjct  304   --GTPLKQNESLDVFLFALFNENQKTGPTSERNYGLFYPTEKKVYDIPL-TAEEIKEAPP  360

Query  567   LPEPDNNRPYEGNL---------WCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDC  415
                  +  P  G +         WCV + G     L  AL++AC  G   C  + PG  C
Sbjct  361   SGVGKSQVPVSGEVSTTTSKGQTWCVASGGSSEKKLQNALNYACGEGGADCTPIQPGATC  420

Query  414   YEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             Y P ++ AHA+YAF+S++ K      +C F G A + T  P +G C+ P+
Sbjct  421   YNPNTLEAHASYAFNSYYQKKARASGTCDFGGTAYVVTQPPKYGNCEFPT  470



>gb|ACN39797.1| unknown [Picea sitchensis]
Length=474

 Score =   334 bits (857),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 178/461 (39%), Positives = 276/461 (60%), Gaps = 31/461 (7%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +GINYGRV ++LPSA++ ++ +K+  + ++K+YD+D   L+  SGT +++TI + NE + 
Sbjct  27    VGINYGRVADNLPSAFKVVQLIKSQGIDKLKLYDADPSALRAFSGTGVKITIALPNEQL-  85

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
                    + + A  WV  NV+ ++PGT I  + VGNEV  + +  + +L  VPAM N+ +
Sbjct  86    --FYVARRLSRAYAWVKQNVVAYVPGTQITAIAVGNEVFVNPNNITSYL--VPAMTNLHR  141

Query  1227  ALNLHNIHNI-KVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             AL  +N+  I K+ +PVA+  L++S+P SSG F+ ++  +  + P+L+FL +T SY  ++
Sbjct  142   ALVKYNLDGIVKISSPVALSALQSSYPASSGAFKNEL-VESTIKPMLDFLRQTGSYLMVN  200

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
              YP+F++ +N   +SLD+ALFR   +  V D  TGL+YTNL D  LD+V  AM  LG+ D
Sbjct  201   AYPFFAYKDNADVISLDYALFR--PNAGVPDGNTGLLYTNLFDAQLDAVFSAMSALGYKD  258

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             + I +SETGWP+ GD D+ G  + NAAAYN NLV  +M +   GTP RP  ++ TF+F+L
Sbjct  259   LDIVVSETGWPSKGDEDETGVGLDNAAAYNGNLVKHVMSNS--GTPLRPKASLDTFLFAL  316

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNR-----------  544
             ++EN+K GP +ER++G+  P+   VY++ LT   P     P P   N+            
Sbjct  317   FNENKKPGPTSERNYGLFYPSEQRVYDIALT---PSAVNNPAPASGNSSSSTPAVSAHHH  373

Query  543   -----PYEGN-LWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHAN  382
                  P  G+  WCV  +      L  ALD+AC  G+  C  + PG  CY P ++ AHA+
Sbjct  374   SSGTTPAGGSETWCVANSKSDTSKLQAALDYACGEGDADCQQIQPGAPCYNPNTLEAHAS  433

Query  381   YAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             YAF+S++ K      +C F G A + T  P +G CK P+ +
Sbjct  434   YAFNSYYQKNSRKIGTCDFAGAAYVVTQSPKYGDCKFPTGY  474



>ref|XP_007141644.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
 gb|ESW13638.1| hypothetical protein PHAVU_008G213400g [Phaseolus vulgaris]
Length=473

 Score =   333 bits (855),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 180/461 (39%), Positives = 275/461 (60%), Gaps = 27/461 (6%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             +IG+NYGR+ N+LPSA + ++ LK+  +++VK+YD+D  +L+ LSG+ I+VT+ + N  +
Sbjct  23    SIGVNYGRIANNLPSAVKVVQLLKSQGLNRVKVYDTDPAVLRALSGSGIKVTVDLPNMQL  82

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                 +     + A  WV  NV+ + P T I  + VGNEV  D+   + +L  VPAMKNI 
Sbjct  83    ---FAAAKAPSFASSWVERNVVAYYPHTQIEAIAVGNEVFVDTHNTTKFL--VPAMKNIH  137

Query  1230  KALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             KAL  HN+  +IKV +P+A+  L  S+P SSG FR D+  + V  P+L+FL  + SY  +
Sbjct  138   KALVKHNLDSDIKVSSPIALSALANSYPSSSGSFRPDL-VEPVFKPMLDFLRESGSYLMV  196

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             +VYP+F++  N   +SLD+ALFR  ++  V D   GL Y NL D  +D+V  A+  L ++
Sbjct  197   NVYPFFAYESNADVISLDYALFR--DNPGVTDPGNGLRYYNLFDAQIDAVFSALSALKYD  254

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
             DV+I ++ETGWP+ GD ++ GASV NAAA+N NLV K++     GTP RP   +  ++F+
Sbjct  255   DVKIVVTETGWPSKGDNNEVGASVENAAAFNGNLVRKILTGG--GTPLRPKADLTVYLFA  312

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTT--------------AVPETEYPPLPEP  556
             L++EN+K GP +ER++G+  P    VY +  T               +  +T   P P  
Sbjct  313   LFNENQKSGPTSERNFGLFYPDEKRVYNVPFTAEELKDYHDSPVKGGSHNQTTQAPAPNV  372

Query  555   DN--NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHAN  382
                 ++   GN WCV       + L  ALDFAC  G   C  +  G  CY+P +I+AHA+
Sbjct  373   SGGVSKSTTGNTWCVANPDADKVKLQAALDFACGEGGADCAPIQHGATCYDPNTIVAHAS  432

Query  381   YAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             +AF+S++ K    G SCYF G + + T +P +G C+ P+ +
Sbjct  433   FAFNSYYQKQARKGGSCYFGGTSYVVTQEPRYGNCEFPTGY  473



>ref|XP_004491104.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Cicer arietinum]
Length=475

 Score =   333 bits (854),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 180/464 (39%), Positives = 279/464 (60%), Gaps = 31/464 (7%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             +IG+NYGR+ N+LPSA + +  LK+  + +VK+YD+D  +L+ LSG+ I+VT+ + N+ +
Sbjct  23    SIGVNYGRIANNLPSAVKVVHLLKSQGIDRVKVYDTDPSVLRSLSGSKIKVTVDLPNQQL  82

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                 +    S+ A +WV  N++ + P T I  + VGNEV  D +  + +L  VPAMKNI 
Sbjct  83    ---FAAAKSSSFALQWVQRNIVAYYPHTQIEAIAVGNEVFVDPNNSTKFL--VPAMKNIY  137

Query  1230  KALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             +AL  +N+H +IKV +P+A+  L  S+P SSG FR ++ +  V  P+L FL +T SY  +
Sbjct  138   QALLKYNLHSDIKVSSPIALSALGNSYPSSSGSFRPELIK-PVFKPMLEFLRKTGSYLMV  196

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             +VYP+F++  N   + LD+ALFR   +  VVD   GL Y NL D  +D+V  A+  + ++
Sbjct  197   NVYPFFAYESNADVIPLDYALFR--ENPGVVDPGNGLRYLNLFDAQIDAVFSALSAMKYD  254

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
             DV I ++ETGWP+ GD ++ GASV NAAAYN NLV K++     GTP RP   +  ++F+
Sbjct  255   DVNIVVTETGWPSKGDNNEVGASVENAAAYNGNLVRKILTGS--GTPLRPKADLTVYLFA  312

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEP------DNNRPY--  538
             L++EN+K GP +ER++G+  P+   VY++ LT    +  Y   P P      + N+P   
Sbjct  313   LFNENQKPGPTSERNFGLFYPSEEKVYDIPLTVEALK-NYHDNPSPVAPVSGNTNQPTPA  371

Query  537   -----------EGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
                         G+ WCV         L  ALDFAC  G   C  + PG  CY P +++A
Sbjct  372   VSPVGGVSKSTTGDTWCVANPDADKNKLQLALDFACGEGGADCRTIQPGATCYNPNTLVA  431

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             HA++AF+S++ K    G SC+F G + + T +P +G+C+ P+ +
Sbjct  432   HASFAFNSYYQKQARAGGSCFFGGTSYVVTQEPKYGSCEFPTGY  475



>ref|XP_011097840.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Sesamum indicum]
Length=467

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/453 (39%), Positives = 273/453 (60%), Gaps = 22/453 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S  +G+NYGR+GNDLPS  + ++ LKA  +++VK+YD+D  +L  LSG+ I V + + N 
Sbjct  25    SGTVGVNYGRLGNDLPSPPQVVQLLKAQGITKVKLYDTDSTVLSALSGSGISVVVALPNN  84

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +   +S     +    W+  N+L + P T++  + VGNEV  D    + +L  VPAMKN
Sbjct  85    QL---SSAAASQSFTDSWIQSNILPYHPNTLVEAIAVGNEVFVDPQNTTSFL--VPAMKN  139

Query  1236  IKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             +  +L  +++  +IKV +PVA+  L+TS+P SSG F++D+  + V+ P+LNFL +T SY 
Sbjct  140   VYASLVKYDVASSIKVTSPVALSALQTSYPSSSGSFKSDL-VEPVITPMLNFLKQTGSYL  198

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++S N   +SLD+AL R  N++  VD   GLVY +L D  +D+V  AM  LG
Sbjct  199   MVNAYPFFAYSANTDKISLDYALLR--NNSGNVDPNNGLVYKSLFDAQIDAVFAAMNALG  256

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             FNDV+I +SETGWP+ GD ++ GAS  NAAAYN NLV +++     GTP R    +  ++
Sbjct  257   FNDVKIVVSETGWPSKGDENEVGASEANAAAYNGNLVRRVLTGG--GTPLRRNEPLNVYL  314

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLT--------TAVPETEYPPLPEPDNNR  544
             F+L++EN K GP +ER++G+  P    VY + LT        + +  ++   + +P ++ 
Sbjct  315   FALFNENEKPGPTSERNYGLFYPNEQKVYNIPLTAEGLAGSPSMMNGSKSQVVAQPPSSV  374

Query  543   PYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSF  364
                G  WCV   G     L  ALD+AC  G   C  + PG  CY+P ++ AHA+YAF+S+
Sbjct  375   ---GQTWCVANAGAGEEKLQQALDYACGEGGADCGAIQPGATCYDPNTVEAHASYAFNSY  431

Query  363   WAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             + +      +C F G A + T  P  G+C+ P+
Sbjct  432   YQRNARGSGTCDFAGAAYVVTQSPKFGSCEFPT  464



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 173/465 (37%), Positives = 281/465 (60%), Gaps = 15/465 (3%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             F+  F  +   S+   + +IGINYGR+ NDLP+  + +E LK+  +++VK+YD+D  +L 
Sbjct  6     FSFFFILISYISSSSEAGSIGINYGRIANDLPTPAKVVELLKSQGLNRVKLYDTDATVLT  65

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
               + + ++V + + NE +   A+   + +    WV  N+  + P T I  + VGNEV  D
Sbjct  66    AFANSGMKVVVAMPNELL---ANAAAEQSFTDAWVQANISSYYPATQIEAIAVGNEVFVD  122

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
              +  + +L  VPAMKN+  +L  +++  NIK+ +P+A+  L+ SFP SSG F+ ++  + 
Sbjct  123   PNNTTKFL--VPAMKNVHASLVKYSLDKNIKISSPIALSALQNSFPASSGSFKTEL-LEP  179

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L+FL +T SY  ++ YP+F+++ N   +SLD+ALF+   +  VVDS  GL YTNL
Sbjct  180   VIKPMLDFLRQTGSYLMVNAYPFFAYAANSDKISLDYALFK--ENPGVVDSGNGLKYTNL  237

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              D  +D+V  AM  + ++DV+IA+SETGWP+ GD ++ GAS  NAA+YN NLV +++   
Sbjct  238   FDAQIDAVFAAMSAVKYDDVKIAVSETGWPSAGDSNEIGASPDNAASYNGNLVKRVLSGS  297

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT--TAVPETEY  574
               GTP +P  ++  F+F+L++EN+K GP +ER++G+  PT   VY+      + V +++ 
Sbjct  298   --GTPLKPNESLDVFLFALFNENQKTGPTSERNYGLFYPTEKKVYDTAEAPPSGVGKSQV  355

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
             P     D     +G  WCV   G     L  AL++AC  G   C  + PG  CY+P ++ 
Sbjct  356   PV--SGDVTTSSKGQTWCVANGGSSEKKLQNALNYACGEGGADCTPIQPGATCYDPNTLE  413

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             AHA+YAF+S++ K      +CYF G A + T  P +G C+ P+ +
Sbjct  414   AHASYAFNSYYQKMARASGTCYFGGTAYVVTQPPKYGNCEFPTGY  458



>gb|KHG05496.1| hypothetical protein F383_30989 [Gossypium arboreum]
Length=469

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 178/456 (39%), Positives = 273/456 (60%), Gaps = 22/456 (5%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             +IG+NYGR+ N+LPSA + +E LK+  +++VK+YD+D  +L  LSG+ I+VT+ + NE +
Sbjct  24    SIGVNYGRIANNLPSATKVVELLKSHGLNRVKVYDTDPAVLHALSGSGIKVTVDLPNEQL  83

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                 +    ++ A  WV  NV  + P T I  + VGNEV  D    + +L  VPAMKNI 
Sbjct  84    ---FAAAKSTSFANSWVQRNVAAYYPHTEIEAIAVGNEVFVDPHNTTKFL--VPAMKNIH  138

Query  1230  KALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             +AL   N+H +IK+ +P+A+  L+ S+P S+G FR ++  + V  P+LNFL +T S+  +
Sbjct  139   QALVKSNLHSDIKISSPIALSALQNSYPSSAGSFRPEL-IEPVFKPMLNFLRQTGSFLMV  197

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             + YP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L D  +D+V  AM  L ++
Sbjct  198   NAYPFFAYESNTDVISLDYALFR--ENPGVVDAGNGLRYFSLFDAQIDAVFAAMSALKYD  255

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
             D+R+ ++ETGWP+ GD ++ GASV NAAAYN NLV +++     GTP RP   +  ++F+
Sbjct  256   DIRLVVTETGWPSKGDENEIGASVENAAAYNGNLVRRILTGG--GTPLRPKADLTVYLFA  313

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYE-------  535
             L++EN KVGP +ER++G+  PT   VY++  T    +  +        N+P         
Sbjct  314   LFNENNKVGPTSERNYGLFYPTEEKVYDIPFTVEGLKNYHDRRSPVAGNQPVNGGKGGVS  373

Query  534   ----GNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
                 GN WCV         L  ALDFAC  G   C  + PG  CY+P ++ AHA++AF+S
Sbjct  374   KSTTGNTWCVANGEAGKEKLQAALDFACGEGGADCHPIQPGATCYDPNTLEAHASFAFNS  433

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             ++ K      +CYF G A + T  P +G C+ P+ +
Sbjct  434   YYQKNGRHMGTCYFGGAAYVVTQPPKYGDCEFPTGY  469



>ref|XP_004304086.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=475

 Score =   330 bits (845),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 179/476 (38%), Positives = 280/476 (59%), Gaps = 31/476 (7%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             L+  ++LAS +   + ++G+NYGRV ++LPSAY+    +K+  + +VK++DSD  +L+ L
Sbjct  10    LVLLSVLASHS--DAGSVGVNYGRVADNLPSAYKVAALIKSQGLERVKVFDSDPAVLRAL  67

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             SG+ I+VT+ + NE +   +S       A  WV  NV+ + P T I  + VGNEV  D+ 
Sbjct  68    SGSGIKVTVDLPNELL---SSAAKTQMFATNWVQRNVVAYHPNTQIEAIAVGNEVFVDTH  124

Query  1278  AQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  + AMKNI  AL   N+  +IKV +P+A+  L+ S+P S+G FR ++ +  V 
Sbjct  125   NTTKYL--IAAMKNIHTALVKFNLASDIKVSSPIALSALQNSYPSSAGSFRPELIQ-PVF  181

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L+FL +T SY  ++ YPYF++  N   +SLD+ALFR   +  VVD+ +GL Y +L D
Sbjct  182   KPMLDFLRQTGSYLMVNAYPYFAYESNADVISLDYALFR--ENPGVVDAGSGLRYFSLFD  239

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               +D+V  AM  L +ND+ + +SETGWP+ GD ++ GAS+ NAAAYN NLV +++     
Sbjct  240   AQIDAVFAAMSALKYNDIEMVVSETGWPSKGDENEIGASIENAAAYNGNLVRRILTGG--  297

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT------------  598
             GTP RP   +  ++F+L++E+RK GP +ER++G+  P    VY++  T            
Sbjct  298   GTPLRPKADLTVYLFALFNEDRKFGPTSERNYGLFFPNEKKVYDIPFTVEGLKNYHDHKS  357

Query  597   -TAVPETEYPPLPEP-----DNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDD  436
               +    E  P+  P     D ++   GN WCV         L  ALD+AC  G   C  
Sbjct  358   PVSGNHHETAPVTAPVTGSGDVSKTLTGNTWCVANGEAGEEKLQAALDYACGEGGADCHQ  417

Query  435   LAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             + PG  CY+P ++ AHA+YAF+S++ K      +CYF G A + +  P +G C++P
Sbjct  418   IQPGSTCYDPNTLEAHASYAFNSYYQKKARGAGTCYFGGAAYVVSQLPKYGKCELP  473



>ref|XP_004140120.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 1 
[Cucumis sativus]
 ref|XP_004156095.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like isoform 1 
[Cucumis sativus]
Length=505

 Score =   330 bits (847),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 179/454 (39%), Positives = 272/454 (60%), Gaps = 28/454 (6%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S +IG+NYGR+GNDLPSA + ++ LK+  + +VK+YD+D  +LK LSG+ I+VT+ + NE
Sbjct  23    SGSIGVNYGRIGNDLPSAVKVVKLLKSHGLQRVKVYDTDPAVLKALSGSGIKVTVDLPNE  82

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    +   +   A  WV  NV  + P T I  + VGNEV  D    + +L  VPAMKN
Sbjct  83    LL---FAAAKRLTFAYTWVEKNVAAYYPSTEIEAIAVGNEVFVDPHNTTSFL--VPAMKN  137

Query  1236  IKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I +AL  +N+H NIKV +P+A+  L+ S+P S+G FR ++  + V  P+L FL +T SY 
Sbjct  138   IHQALVKYNLHSNIKVSSPIALSALQNSYPSSAGSFRPEL-VETVFRPMLEFLRQTGSYL  196

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR  ++  VVD+ +G  Y NL D  +D+V  AM  L 
Sbjct  197   MVNAYPFFAYESNTDVISLDYALFR--DNPGVVDAGSGYRYFNLFDAQIDAVFAAMSALK  254

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+++ ++ETGWP+ GD ++ GASV NAAAYN NLV +++     GTP RP   +  ++
Sbjct  255   YDDIKMVVTETGWPSKGDENEIGASVENAAAYNGNLVRRILSGG--GTPLRPKADLTVYL  312

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT-AVPETEYPPLPEPDN---------  550
             F+L++EN+K GP +ER++G+  P    VY++  TT  + + E  P P+P +         
Sbjct  313   FALFNENKKNGPTSERNYGLFYPNEEKVYDIPFTTEGLKDFEDKPSPKPVSGGNAPTAPP  372

Query  549   -------NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
                    ++   GN WCV +       L   LD+AC  G   C  +  G  CY P ++ A
Sbjct  373   ASGDGGVSKSQTGNTWCVASGEAGKEKLQSGLDYACGEGGADCRPIQVGATCYNPNTLEA  432

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPS  289
             HA+YAF+S++ K      +CYF G A + T  PS
Sbjct  433   HASYAFNSYYQKNSRKVGTCYFGGAAYVVTQPPS  466



>ref|XP_006447645.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
 gb|ESR60885.1| hypothetical protein CICLE_v10015086mg [Citrus clementina]
Length=480

 Score =   328 bits (842),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 175/461 (38%), Positives = 275/461 (60%), Gaps = 25/461 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + +IG+NYGR+ N+LPSA + ++ LK+  + +VK++D+D  +LK LSG+ I+VT+ + NE
Sbjct  30    AGSIGVNYGRIANNLPSASKVVQLLKSQGIERVKVFDTDAAVLKALSGSGIKVTVDLPNE  89

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    S   + + A  WV  NV  + P T I  + VGNEV  D    + +L  +PAMKN
Sbjct  90    LL---FSAAKRPSFAFSWVQKNVAAYHPHTQIEAIGVGNEVFVDPHNTTKFL--LPAMKN  144

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             + +AL  +N+H+ IKV +P+A+  L+ S+P S+G FR ++  + V  P+LNFL +T S+ 
Sbjct  145   VHEALVKYNLHSSIKVSSPIALSALQNSYPSSAGSFRPEL-IEPVFKPMLNFLRQTGSFL  203

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L D  +D+V  A+  L 
Sbjct  204   MVNAYPFFAYESNTDVISLDYALFR--ENPGVVDAGNGLRYFSLFDAQIDAVFAALSALK  261

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+R+ ++ETGWP+ GD ++ GASV NAAAYN NLV +++     GTP RP   +  ++
Sbjct  262   YDDIRMVVTETGWPSKGDENENGASVENAAAYNGNLVRRILTGG--GTPLRPKADLTVYL  319

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA---------VPETEYPPLPEPDN-  550
             F+L++E++K GP +ER++G+  P    VY +  T            P    P +  P N 
Sbjct  320   FALFNEDQKPGPTSERNYGLFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRSPTVRAPVNG  379

Query  549   ----NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHAN  382
                 ++   GN WCV    +    L   LD+AC  G   C  + PG  CY P ++ AHA+
Sbjct  380   GGGVSKSTSGNTWCVANAEVGKEKLQRGLDYACGEGGADCRPIQPGATCYSPNTLEAHAS  439

Query  381   YAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             +AF+S++ K    G SCYF G A + T  P +G C+ P+ +
Sbjct  440   FAFNSYYQKQSRAGGSCYFGGAAYVVTQPPRYGVCEFPTGY  480



>ref|XP_007215327.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
 gb|EMJ16526.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
Length=472

 Score =   328 bits (841),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 175/461 (38%), Positives = 277/461 (60%), Gaps = 25/461 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             ++++G+NYGR+ ++LPSAY  ++ LK+  + +VK++DSD  +L+ L+G+ I+VT+ V NE
Sbjct  22    AASVGVNYGRIADNLPSAYRVMQLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNE  81

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +   +S     + A  WV  NV+ + P T I  + VGNEV  D+   + +L  +PAMKN
Sbjct  82    LL---SSVAKSQSFATNWVQRNVVAYHPNTQIEAIAVGNEVFVDTHNTTKFL--IPAMKN  136

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I  AL   +IH+ IKV +P+A+  L+ S+P S+G FR ++  + V  P+L FL +T SY 
Sbjct  137   IHTALIHFDIHSAIKVSSPIALSALQNSYPASAGSFRPELV-ETVFKPMLEFLRQTGSYL  195

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YPYF++  N   +SLD+ALFR   +  VVD+  GL Y +L D  +D+V  AM  L 
Sbjct  196   MVNAYPYFAYESNADVISLDYALFR--QNPGVVDAGNGLRYLSLFDAQIDAVFAAMSALK  253

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+ + +SETGWP+ GD ++ GAS+ NAAAYN NLV +++     GTP RP   +  ++
Sbjct  254   YDDINMVVSETGWPSKGDENEVGASLENAAAYNGNLVRRILTGG--GTPLRPKADLTVYL  311

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLT-----------TAVPETEYPPLP---  562
             F+L++E+RK GP +ER++G+  P    VY++  T           + V   ++   P   
Sbjct  312   FALFNEDRKNGPTSERNYGLFFPNERKVYDIPFTFEGLKNYHDHRSPVAGNQHMTAPVNG  371

Query  561   EPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHAN  382
               D ++   GN WCV         L  ALD+AC  G   C  + PG  CY+P ++ AHA+
Sbjct  372   GGDVSKSLTGNTWCVANGEAGKEKLQRALDYACGEGGADCHQIQPGSACYDPNTLEAHAS  431

Query  381   YAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             YAF+S++ K      +CYF G A + +  P +G C++P+ +
Sbjct  432   YAFNSYYQKKARGVGTCYFGGAAYVVSQPPKYGKCELPTGY  472



>ref|XP_010557676.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=484

 Score =   328 bits (840),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 186/486 (38%), Positives = 283/486 (58%), Gaps = 25/486 (5%)
 Frame = -3

Query  1674  FKAKEMQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVK  1495
             F  K+  K + A I   LL+  +   + +IG+NYGR+ +DLPSA + ++ LK+  + +VK
Sbjct  4     FLQKQSMKSLTAFISLLLLSIISRSDAGSIGVNYGRIADDLPSATKVVQLLKSQGIDRVK  63

Query  1494  IYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRG  1315
             IYDSD  +LK LSG+ IRVT+ + NE +    S   + + A  WV  NV+ + P T I  
Sbjct  64    IYDSDPAVLKALSGSGIRVTVDLPNELL---FSAAKRPSFAASWVQRNVVAYHPETQIEA  120

Query  1314  VLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSG  1138
             + VGNEV  D    + +L  +PAM+N+ KAL  +N+H+ IKV +P+A+  L+ S+P S+G
Sbjct  121   IAVGNEVFVDPHNTTKFL--IPAMRNVHKALVKNNLHSAIKVSSPIALSALQNSYPSSAG  178

Query  1137  RFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVD  958
              FR D+  + V+ P+L+FL  T S   ++VYP+F++  N   + LD+ALFR   +  VVD
Sbjct  179   SFRPDL-VEPVIKPMLDFLRETGSSLMINVYPFFAYEGNSDVIPLDYALFR--ENPGVVD  235

Query  957   SETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNR  778
             +  GL Y NL D  +D+V  AM  L ++D+ I ++ETGWP+ GD ++ GA+V NA AYN 
Sbjct  236   AGNGLRYFNLFDAQIDAVFAAMSRLKYDDIEIVVTETGWPSKGDENEVGATVENAPAYNG  295

Query  777   NLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT  598
             NLV +++     GTP R    +  ++F+L++EN+K GP +ER++G+  P    VY++ LT
Sbjct  296   NLVRRILTGG--GTPLRRKSDLTVYLFALFNENKKTGPTSERNYGLFYPDERKVYDVPLT  353

Query  597   TAVPETEYPPLPEPDN-------------NRPYEGNLWCVVATGIRILDLGPALDFACAA  457
              A     Y   P P               ++   GN WCV         L   LD+AC  
Sbjct  354   -AEQLKHYHDNPSPATGGRQVTSPVAGGVSKSLTGNTWCVANADAGKDRLQAGLDYACGE  412

Query  456   GNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGAC  277
             G   C  + PG  CY P ++ AHA++AF+S++ +    G SCYF G A + T  P +G C
Sbjct  413   GGADCRPIQPGATCYNPDTLEAHASFAFNSYYQRKARAGGSCYFGGAAYIVTQPPKYGRC  472

Query  276   KVPSVF  259
             + P+ +
Sbjct  473   EFPTGY  478



>ref|XP_010412737.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 176/474 (37%), Positives = 281/474 (59%), Gaps = 27/474 (6%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             L+F  LL+  +   + +IG+NYGR+ ++LPSA++ ++ LK+  +++VKI+D+D  +LK L
Sbjct  7     LVFLILLSPISLSDAGSIGVNYGRISDELPSAFKVVQLLKSQGINRVKIFDADPSVLKAL  66

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             SG+ I+VT+ V NE +    S   +++ A  WV  NV  + P T I  + VGNEV  D  
Sbjct  67    SGSGIKVTVDVPNEIL---FSAAKRASFAASWVKRNVAAYHPSTQIESIAVGNEVFVDPH  123

Query  1278  AQSLWLQMVPAMKNIKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               +++L  +PAM+NI KAL   N+H +IK+ +P+A+  L+ S+P SSG FR ++  D V+
Sbjct  124   NTTIYL--IPAMRNIHKALISFNLHSDIKISSPLALSALQNSYPSSSGSFRPEL-VDTVI  180

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L+FL  T S   ++VYP+F++  N   + LD+AL R   +  +VDS  GL Y NL D
Sbjct  181   KPMLDFLRETGSRLMINVYPFFAYDGNSDVIPLDYALLR--ENPGMVDSGNGLRYFNLFD  238

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               +D+V  AM  L ++D+ I ++ETGWP+ GD ++ GA++ NAA+YN NL+ +++     
Sbjct  239   AQIDAVFAAMSALKYDDIEIIVTETGWPSKGDENEVGATIANAASYNGNLIRRILTRG--  296

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT-----------  595
             GTP RP   +  ++F+L++EN+K+GP +ER++G+  P    VY++  TT           
Sbjct  297   GTPLRPKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGH  356

Query  594   ----AVPETEYPPLPEPDN-NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLA  430
                    +   PP+      ++   G  WCV         L   LD+AC  G   C  + 
Sbjct  357   TPVTGDHQVTTPPMSGGGGVSKSLNGQSWCVANGDAGEERLQKGLDYACGEGGADCRPIQ  416

Query  429   PGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             PG +CY P ++ AHA++AF+S++ K    G SCYF G A + +  P +G C+ P
Sbjct  417   PGANCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFP  470



>ref|XP_009137621.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=465

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 178/466 (38%), Positives = 271/466 (58%), Gaps = 24/466 (5%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             L FF+ ++ +    S  IG+NYGR+ N+LPS    +  LK+  ++++KIYD+D  +L  L
Sbjct  18    LSFFSTISITQA-SSGMIGVNYGRIANNLPSPENVVNLLKSQGINRIKIYDTDKNVLTAL  76

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             + + I+V + + NE +   +   +  +   +WV  NV +  P T +  + VGNEV  D  
Sbjct  77    AHSRIKVVVCLPNELL---SRTASDQSFTDKWVRHNVRKHFPATEVEAIAVGNEVFVDPK  133

Query  1278  AQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  V AMKNI  +L  +N+  +IK+ +P+A+  L  S+PPSSG F+ D+  + V+
Sbjct  134   NTTPYL--VRAMKNIHASLVKYNLDKSIKISSPIALSALANSYPPSSGSFKPDL-VEPVI  190

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L+ L +T SY  ++ YP+F++S N   +SLD+ALFR    TV  DS  GL Y +L D
Sbjct  191   KPMLDLLRKTSSYLMVNAYPFFAYSGNADKISLDYALFRDNAGTV--DSGNGLRYNSLFD  248

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               LD+V  AM  +GFNDV++ ++ETGWP+ GD ++ GAS  NAAAYN  LV +++     
Sbjct  249   AQLDAVYAAMSAVGFNDVKVMVTETGWPSAGDGNEIGASESNAAAYNGGLVKRVLNGN--  306

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNL--TTAVP---ETE  577
             GTP RP   +  F+F+L++EN+K GP +ER++G+  P    VY +    TT+ P     E
Sbjct  307   GTPLRPKEPLNVFLFALFNENQKPGPTSERNYGLFYPNERKVYAVPFAATTSTPVNRNKE  366

Query  576   YPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSI  397
               P+        +EG  WCV         L  ALD+AC  G   C  + PG  CY P S+
Sbjct  367   QAPV-------AHEGETWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATCYHPKSL  419

Query  396   LAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
              AHA++AF+S++ K      +CYF G A + T  P +G CK P+ +
Sbjct  420   EAHASFAFNSYYQKNARRDGTCYFGGTAHVVTQHPRYGKCKFPTEY  465



>gb|EPS73917.1| hypothetical protein M569_00835, partial [Genlisea aurea]
Length=445

 Score =   325 bits (834),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 177/450 (39%), Positives = 269/450 (60%), Gaps = 18/450 (4%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             +IG+NYGRV NDLPSA + +  LK+  + +VK+YD+D  +LK L+G+ IRVT+ + NE +
Sbjct  6     SIGVNYGRVANDLPSATKVVRLLKSQGLKRVKVYDADPAVLKALAGSGIRVTVNLPNELL  65

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                +S   + + A  WV +NV  + P T I  V VGNEV  D+   + +L  +PAM N+ 
Sbjct  66    ---SSAARRRSFADDWVRNNVAAYHPATAIEAVAVGNEVFVDAHDTTRFL--LPAMYNVY  120

Query  1230  KALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             +AL   N+ + I+V +P+A+  L +S+PPS+G FRA++  + V  P+L FL +T S   +
Sbjct  121   EALVKRNLQDEIRVSSPIALSALRSSYPPSAGAFRAELV-ESVFRPMLEFLRKTGSALMV  179

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             +VYP+F++  N   + LD+ALFR   +  VVD   GL Y +L D  LD+V  AM  L ++
Sbjct  180   NVYPFFAYESNAAVIPLDYALFR--ENPGVVDPGNGLRYFSLFDAQLDAVFAAMSALKYD  237

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
             D+ I +SETGWP+ GD  + GA+V NAAAYN NL+ ++++    GTP RP   +  F+F+
Sbjct  238   DLPIVVSETGWPSKGDSKEVGAAVENAAAYNGNLIRRVLRGG--GTPRRPSADLTVFLFA  295

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYEL-----NLTTAVPETEYPPLPEPDNNRPYEGN  529
             L++EN+K GP +ER++G+  P    VY++      L         PP  +    R   G+
Sbjct  296   LFNENKKPGPTSERNFGLFYPDETRVYDVPFTAEGLKNVNNNNNNPPAMDHGEQRISTGS  355

Query  528   --LWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAK  355
                WCV         L   LD+AC  G   C  + PG  C++P ++ AHA++AF+S++ K
Sbjct  356   GPSWCVANAAAGRKKLQAGLDYACGEGGADCRSIQPGSTCFDPNTVEAHASFAFNSYFQK  415

Query  354   YRSTGASCYFNGLATMTTVDPSHGACKVPS  265
                   +CYF G A + T  P +GAC++PS
Sbjct  416   NGRRIGTCYFGGAAYVVTQQPKYGACELPS  445



>ref|XP_011085458.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3 [Sesamum indicum]
Length=464

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 176/462 (38%), Positives = 271/462 (59%), Gaps = 15/462 (3%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             L+F   + S   +   ++G+NYGRV N+LPSA + ++ LK+  V +VK+YDSD  +LK L
Sbjct  10    LLFLICVVSIAAVDGGSVGVNYGRVANNLPSATKVVDLLKSQGVDRVKVYDSDPAVLKAL  69

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             SG+ I+VT+ + NE + + A   + +     WV  NV  + P T++  + VGNEV  D+ 
Sbjct  70    SGSGIKVTVNLPNELLSSTARRPSFAYT---WVMKNVAAYHPSTVVEAIAVGNEVFVDTH  126

Query  1278  AQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  +PAM N++KAL  +N+   IKV +P+A+  L+ S+P S+G FR D+  + V 
Sbjct  127   NTTRYL--IPAMYNVQKALVKYNLEKVIKVSSPIALSALQNSYPSSAGSFRPDL-VEPVF  183

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L FL +T S   ++VYP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L D
Sbjct  184   KPMLEFLRQTGSSLMINVYPFFAYESNADVISLDYALFR--ENPGVVDAGNGLRYFSLFD  241

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               +D+V  AM  L ++DV I +SETGWP+ GD ++ GASV NAAAYN NLV +++     
Sbjct  242   AQIDAVFAAMSALKYDDVPIIVSETGWPSKGDSNEVGASVENAAAYNGNLVRRVLAGG--  299

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT----AVPETEY  574
             GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY++ LT     +  + + 
Sbjct  300   GTPLRPHANLTVYLFALFNENKKPGPTSERNFGLFYPNQKKVYDIPLTAEGLKSYRDIQS  359

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
             P            G  WCV             LD+AC  G   C  + PG  C++P ++ 
Sbjct  360   PVTGGEQRVSTANGQTWCVAKEEAGKEKQSSGLDYACGEGGADCHPIQPGSTCFDPNTLE  419

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVP  268
             AHA++AF+S++ K      +CYF G A + T  P +G C  P
Sbjct  420   AHASFAFNSYYQKKGRAIGTCYFGGAAYIVTQQPKYGKCDFP  461



>ref|XP_008449478.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Cucumis melo]
Length=474

 Score =   326 bits (836),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 176/462 (38%), Positives = 277/462 (60%), Gaps = 26/462 (6%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S +IG+NYGR+ NDLPSA + ++ LK+  + +VK+YD+D  +L+ LSG+ I+VT+ + NE
Sbjct  23    SGSIGVNYGRIANDLPSAVQVVKLLKSNGLQRVKVYDTDPAVLRALSGSGIKVTVDLPNE  82

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    + + + + A  WV  NV  + P T I  + VGNEV  D    + +L  VPAMKN
Sbjct  83    LL---FAASQRLSFAYNWVQKNVAAYYPSTEIEAIAVGNEVFVDPHNTTSYL--VPAMKN  137

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I +AL  +N+ + IKV +P+A+  L+ S+P S+G FR ++  + V  P+L+FL RT SY 
Sbjct  138   IHQALVKNNLDSKIKVSSPIALSALQNSYPASAGSFRPEL-VETVFRPMLDFLRRTGSYL  196

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR  ++  VVD+ +G  Y +L D  +D+V  AM  L 
Sbjct  197   MVNAYPFFAYESNTDVISLDYALFR--DNPGVVDTGSGYRYFSLFDAQIDAVFAAMSALK  254

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+ + +SETGWP+ GD ++ GASV NAAAYN NLV +++     GTP RP   +  ++
Sbjct  255   YDDINMVVSETGWPSKGDENEIGASVENAAAYNGNLVHRILSGG--GTPLRPKADLTVYL  312

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT-AVPETEYPPLPEPDN---------  550
             F+L++EN+K GP +ER++G+  P    VY++  T   + E +  P  +P +         
Sbjct  313   FALFNENKKNGPTSERNYGLFYPNEEKVYDIPFTAEGLKEYKDKPSRKPISAPTGAPVSG  372

Query  549   -----NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHA  385
                  ++   GN WCV +       L   LD+AC  G   C  +  G  CY P ++ AHA
Sbjct  373   GDGGVSKSQTGNTWCVASGEAGREKLQAGLDYACGEGGADCRPIQVGATCYNPNTLEAHA  432

Query  384   NYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             +YAF+S++ K      +CYF G A + T  P +G+C+ P+ +
Sbjct  433   SYAFNSYYQKNNRKVGTCYFGGAAYVVTQPPKYGSCEFPTGY  474



>ref|XP_006469612.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=540

 Score =   328 bits (841),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 175/459 (38%), Positives = 274/459 (60%), Gaps = 25/459 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + +IG+NYGR+ N+LPSA + ++ LK+  + +VK++D+D  +LK LSG+ I+VT+ + NE
Sbjct  90    AGSIGVNYGRIANNLPSASKVVQLLKSQGIERVKVFDTDAAVLKALSGSGIKVTVDLPNE  149

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    S   + + A  WV  NV  + P T I  + VGNEV  D    + +L  +PAMKN
Sbjct  150   LL---FSAAKRPSFAFSWVQKNVAAYHPHTQIEAIGVGNEVFVDPHNTTKFL--LPAMKN  204

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             + +AL  +N+H+ IKV +P+A+  L+ S+P S+G FR ++  + V  P+LNFL +T S+ 
Sbjct  205   VHEALVKYNLHSSIKVSSPIALSALQNSYPSSAGSFRPEL-IEPVFKPMLNFLRQTGSFL  263

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L D  +D+V  A+  L 
Sbjct  264   MVNAYPFFAYESNTDVISLDYALFR--ENPGVVDAGNGLRYFSLFDAQIDAVFAALSALK  321

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+R+ ++ETGWP+ GD ++ GASV NAAAYN NLV +++     GTP RP   +  ++
Sbjct  322   YDDIRMVVTETGWPSKGDENENGASVENAAAYNGNLVRRILTGG--GTPLRPKADLTVYL  379

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA---------VPETEYPPLPEPDN-  550
             F+L++E++K GP +ER++G+  P    VY +  T            P    P +  P N 
Sbjct  380   FALFNEDQKPGPTSERNYGLFYPNEEKVYNIPFTVEGLKNYHDHRSPVNRSPTVRAPVNG  439

Query  549   ----NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHAN  382
                 ++   GN WCV    +    L   LD+AC  G   C  + PG  CY P ++ AHA+
Sbjct  440   GGGVSKSTSGNTWCVANAEVGKEKLQRGLDYACGEGGADCRPIQPGATCYSPNTLEAHAS  499

Query  381   YAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +AF+S++ K    G SCYF G A + T  P +G C+ P+
Sbjct  500   FAFNSYYQKQSRAGGSCYFGGAAYVVTQPPRYGVCEFPT  538



>ref|XP_010264204.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=339

 Score =   321 bits (823),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 170/345 (49%), Positives = 229/345 (66%), Gaps = 19/345 (6%)
 Frame = -3

Query  1611  SNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTI  1432
             +N   S  +G+N G++GN+LPS   +I  +K+++   VK  + D  IL  L GT I+V+I
Sbjct  10    NNAEISRKMGVNCGQLGNNLPSPSRSIVLIKSLKAGHVKHANPD--ILNALEGTNIQVSI  67

Query  1431  MVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQ--SLWLQ  1258
             MV N+ I   ++ ++  + A  WV  N + F P T+   +LVGNE+ S SS Q    W  
Sbjct  68    MVPNQLI---SNISSSQSLANEWVRTNNVPFYPKTLTHYLLVGNEIFSFSSNQDRQTWYG  124

Query  1257  MVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLN  1078
             +V AM  +K +L +HNI NIK+GT +AMD+L++SFPPS+G FR+DI    V+ PLL FLN
Sbjct  125   LVQAMSRLKYSLKIHNIRNIKIGTTIAMDVLQSSFPPSNGMFRSDI-SIPVMKPLLQFLN  183

Query  1077  RTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVF  898
             RT+SY FLD YP F WS +P N++LD+A  +G              YTNLLDQMLDSV+F
Sbjct  184   RTKSYSFLDAYPNFPWSGDPTNINLDYAFLKGNQ-----------TYTNLLDQMLDSVIF  232

Query  897   AMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGV  718
             AM  LGF +VR+ I+ETGWPN  D+DQ GA++ N A YNRNL+ +M     +GTPA P V
Sbjct  233   AMTKLGFPNVRLVIAETGWPNARDVDQIGANIFNTATYNRNLIRRMTSKLAIGTPAHPNV  292

Query  717   AIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPE  583
              IPTFIF+LY+EN+K GPGTERHWG+L   G  VYE++LT   P+
Sbjct  293   VIPTFIFALYNENQKGGPGTERHWGLLNSDGTSVYEVDLTEKRPK  337



>emb|CDP05678.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/469 (38%), Positives = 277/469 (59%), Gaps = 27/469 (6%)
 Frame = -3

Query  1626  TLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTY  1447
             ++ + S+G    +IG+NYGR+ ++LPSA +  E LK+  + +VK+YD+D  +LK L+G+ 
Sbjct  15    SIFSHSDG---GSIGVNYGRIADNLPSASKVAELLKSQGLDRVKVYDTDPAVLKALAGSG  71

Query  1446  IRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSL  1267
             ++VT+ + NE +    S   + + A  WV  NV  + P T I  + VGNEV  D    + 
Sbjct  72    VKVTVDLPNELL---FSAARRPSFAHSWVQRNVAAYHPATQIEAIAVGNEVFVDPHNTTR  128

Query  1266  WLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLL  1090
             +L  VPAMKNI  AL  +N H+ IKV +P+A+  L+ S+P S+G FR D+  + V  P+L
Sbjct  129   FL--VPAMKNIHSALEKYNFHDDIKVSSPIALSALQNSYPSSAGSFRPDL-IEPVFKPML  185

Query  1089  NFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLD  910
             +FL +T SY  ++ YP+F++  N   +SLD+ALFR   +  VVD+  G  Y +L D  +D
Sbjct  186   DFLRQTGSYLMVNAYPFFAYESNSDVISLDYALFR--ENPGVVDAGNGNHYFSLFDAQID  243

Query  909   SVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPA  730
             +V  AM  + ++DV I ++ETGWP+ GD ++ GASV NAAAYN NLV +++     GTP 
Sbjct  244   AVFAAMSAIKYDDVSIVVTETGWPSKGDPNEIGASVENAAAYNGNLVKRILTGG--GTPL  301

Query  729   RPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEP--  556
             RP   +  ++F+L++E++KVGP +ER++G+  P    VY++  T    +  Y   P P  
Sbjct  302   RPKENLTVYLFALFNEDKKVGPTSERNYGLFYPNEDKVYDVPFTVEGLK-HYHDNPTPVT  360

Query  555   ----------DNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEP  406
                        N+  Y G  WCV         L  ALDFAC  G   C  + PG  CY+P
Sbjct  361   GDRRNSKGTSGNSHSYSGQTWCVANGDEEREKLQVALDFACGEGGADCRPIQPGSTCYDP  420

Query  405   VSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
              ++ AHA++AF+S++ K      +CYF G A + ++ P +G C+ P+ +
Sbjct  421   NTLEAHASFAFNSYYQKKGRAIGTCYFGGAAYVVSIPPKYGKCEFPTGY  469



>ref|XP_004491103.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X1 
[Cicer arietinum]
Length=477

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 178/455 (39%), Positives = 272/455 (60%), Gaps = 31/455 (7%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             +IG+NYGR+ N+LPSA + +  LK+  + +VK+YD+D  +L+ LSG+ I+VT+ + N+ +
Sbjct  23    SIGVNYGRIANNLPSAVKVVHLLKSQGIDRVKVYDTDPSVLRSLSGSKIKVTVDLPNQQL  82

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                 +    S+ A +WV  N++ + P T I  + VGNEV  D +  + +L  VPAMKNI 
Sbjct  83    ---FAAAKSSSFALQWVQRNIVAYYPHTQIEAIAVGNEVFVDPNNSTKFL--VPAMKNIY  137

Query  1230  KALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             +AL  +N+H +IKV +P+A+  L  S+P SSG FR ++ +  V  P+L FL +T SY  +
Sbjct  138   QALLKYNLHSDIKVSSPIALSALGNSYPSSSGSFRPELIK-PVFKPMLEFLRKTGSYLMV  196

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             +VYP+F++  N   + LD+ALFR   +  VVD   GL Y NL D  +D+V  A+  + ++
Sbjct  197   NVYPFFAYESNADVIPLDYALFR--ENPGVVDPGNGLRYLNLFDAQIDAVFSALSAMKYD  254

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
             DV I ++ETGWP+ GD ++ GASV NAAAYN NLV K++     GTP RP   +  ++F+
Sbjct  255   DVNIVVTETGWPSKGDNNEVGASVENAAAYNGNLVRKILTGS--GTPLRPKADLTVYLFA  312

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEP------DNNRP---  541
             L++EN+K GP +ER++G+  P+   VY++ LT    +  Y   P P      + N+P   
Sbjct  313   LFNENQKPGPTSERNFGLFYPSEEKVYDIPLTVEALK-NYHDNPSPVAPVSGNTNQPTPA  371

Query  540   ----------YEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILA  391
                         G+ WCV         L  ALDFAC  G   C  + PG  CY P +++A
Sbjct  372   VSPVGGVSKSTTGDTWCVANPDADKNKLQLALDFACGEGGADCRTIQPGATCYNPNTLVA  431

Query  390   HANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSH  286
             HA++AF+S++ K    G SC+F G + + T +PS 
Sbjct  432   HASFAFNSYYQKQARAGGSCFFGGTSYVVTQEPSE  466



>ref|XP_010488778.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   325 bits (832),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/477 (37%), Positives = 281/477 (59%), Gaps = 27/477 (6%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             L+F  LL+  +   + +IG+NYGR+ ++LPSA++ ++ LK+  +++VKI+D+D  +LK L
Sbjct  7     LVFLILLSPISLSDAGSIGVNYGRISDELPSAFKVVQLLKSQGINRVKIFDADPSVLKAL  66

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             SG+ I+VT+ V NE +    S   +++ A  WV  NV  + P T I  + VGNEV  D  
Sbjct  67    SGSGIKVTVDVPNEIL---FSAAKRASFAASWVKRNVAAYHPSTQIESIAVGNEVFVDPH  123

Query  1278  AQSLWLQMVPAMKNIKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  +PAM+NI KAL   N+H +IK+ +P+A+  L+ S+P SSG FR ++  D V+
Sbjct  124   NTTNYL--IPAMRNIHKALVSFNLHSDIKISSPLALSALQNSYPSSSGSFRPEL-VDTVI  180

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L FL  T S   ++VYP+F++  N   + LD+AL R   +  +VDS  GL Y NL D
Sbjct  181   KPMLEFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLR--ENPGMVDSGNGLRYFNLFD  238

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               +D+V  AM  L ++D+ I ++ETGWP+ GD ++ GA++ NAA+YN NL+ +++     
Sbjct  239   AQIDAVFAAMSALKYDDIEIIVTETGWPSKGDENEVGATIANAASYNGNLIRRILTRG--  296

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT-----------  595
             GTP RP   +  ++F+L++EN+K+GP +ER++G+  P    VY++  TT           
Sbjct  297   GTPLRPKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGH  356

Query  594   ----AVPETEYPPLPEPDN-NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLA  430
                    +   PP+      ++   G  WCV         L   LD+AC  G   C  + 
Sbjct  357   TPVTGDHQVTTPPMSGGGGVSKSLNGQSWCVANGDAGEERLQGGLDYACGEGGADCRPIQ  416

Query  429   PGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             PG +CY P ++ AHA++AF+S++ K    G SCYF G A + +  P +G C+ P+ +
Sbjct  417   PGANCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  473



>ref|XP_009628415.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nicotiana tomentosiformis]
Length=471

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/455 (40%), Positives = 271/455 (60%), Gaps = 23/455 (5%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             +IG+NYGRV N+LPSA + +  LK+  V +VK+YD+D  +LK LSG+ I+VT+ + NE +
Sbjct  25    SIGVNYGRVANNLPSAVKAVALLKSQGVERVKVYDTDPAVLKALSGSGIKVTVNLPNELL  84

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                 +   + + A  WV  NV  + P T I  + VGNEV  D    + +L  VPAMKNI 
Sbjct  85    ---YNAAKRQSFAYSWVQRNVAAYYPSTQIESIAVGNEVFVDPHNTTRFL--VPAMKNIH  139

Query  1230  KALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             +AL  +N H+ IKV +PVA+  L+ S+P S+G FR+++  + V+ P+++FL +T SY  +
Sbjct  140   EALLKYNFHDKIKVSSPVALSALQNSYPSSAGSFRSELI-EPVIKPMMDFLRQTGSYLMV  198

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             + YP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L D  +D+V  A+  L ++
Sbjct  199   NCYPFFAYESNSDVISLDYALFR--ENPGVVDAGNGLRYFSLFDAQVDAVFAALSALKYD  256

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
             D+++ ++ETGWP+ GD  + GASV NAAAYN NLV +++     GTP RP   I  F+F+
Sbjct  257   DIKMVVTETGWPSKGDDIEVGASVDNAAAYNGNLVRRILTGG--GTPLRPKEDITVFLFA  314

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLT-----------TAVPETEYPPLPEPDNN  547
             L++EN+K GP +ER++G+  P    VY++ L            + V   E        N 
Sbjct  315   LFNENKKPGPTSERNFGLFYPNERKVYDIPLNMEGLKHYIDRQSPVAGGERMQKGGKGNV  374

Query  546   RP-YEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFS  370
              P   G  WCV +      +L  ALDFAC  G   C  + PG  CY P ++ AHA+YAF+
Sbjct  375   SPSVPGQTWCVASGEAGKDNLQAALDFACGEGGADCRSIQPGSTCYNPNTLEAHASYAFN  434

Query  369   SFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             S++ K      SCYF G A +    P +G C++P+
Sbjct  435   SYYQKKGRAMGSCYFGGAAYIVHQQPKYGNCELPT  469



>ref|XP_010467085.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=473

 Score =   323 bits (829),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 176/485 (36%), Positives = 286/485 (59%), Gaps = 30/485 (6%)
 Frame = -3

Query  1662  EMQKPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDS  1483
             ++  P+  LI F+ ++ S+   + +IG+NYGR+ ++LPSA++ ++ LK+  +++VKI+D+
Sbjct  2     DLLTPLVFLILFSPISLSD---AGSIGVNYGRISDELPSAFKVVQLLKSQGINRVKIFDA  58

Query  1482  DHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVG  1303
             D  +LK LSG+ I+VT+ V NE +    S   +++ A  WV  NV  + P T I  + VG
Sbjct  59    DPSVLKALSGSGIKVTVDVPNEIL---FSAAKRASFAASWVKRNVAAYHPSTQIESIAVG  115

Query  1302  NEVLSDSSAQSLWLQMVPAMKNIKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRA  1126
             NEV  D    + +L  +PAM+NI KAL   N+H +IK+ +P+A+  L+ S+P SSG FR 
Sbjct  116   NEVFVDPHNTTNYL--IPAMRNIHKALVSFNLHSDIKISSPLALSALQNSYPSSSGSFRP  173

Query  1125  DIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETG  946
             ++  D V+ P+L FL  T S   ++VYP+F++  N   + LD+AL R   +  +VD+  G
Sbjct  174   EL-VDTVIKPMLEFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLR--ENPGMVDAGNG  230

Query  945   LVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVS  766
             L Y NL D  +D+V  AM  L ++D+ I ++ETGWP+ GD ++ GA++ NAA+YN NL+ 
Sbjct  231   LRYFNLFDAQIDAVFAAMSALKYDDIEIIVTETGWPSKGDENEVGATIANAASYNGNLIR  290

Query  765   KMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT----  598
             +++     GTP RP   +  ++F+L++EN+K+GP +ER++G+  P    VY++  T    
Sbjct  291   RILTRG--GTPLRPKADLTVYLFALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTLEGL  348

Query  597   -----------TAVPETEYPPLPEPDN-NRPYEGNLWCVVATGIRILDLGPALDFACAAG  454
                        T   +   PP+      ++   G  WCV         L   LD+AC  G
Sbjct  349   KHYRDGSHTPVTGDHQVTTPPMSGGGGVSKSLNGQSWCVANGDAGEERLQGGLDYACGEG  408

Query  453   NGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACK  274
                C  + PG +CY P ++ AHA++AF+S++ K    G SCYF G A + +  P +G C+
Sbjct  409   GADCRPIQPGANCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCE  468

Query  273   VPSVF  259
              P+ +
Sbjct  469   FPTGY  473



>ref|XP_004294409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Fragaria 
vesca subsp. vesca]
Length=464

 Score =   323 bits (829),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 172/469 (37%), Positives = 281/469 (60%), Gaps = 18/469 (4%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             + A +  +  + +      NIGINYGR+ N+LP+  + ++ LK+  ++ VK+YD+D  +L
Sbjct  8     VLASLLLSFFSVAFAAEKGNIGINYGRIANNLPAPTKVVDLLKSQGITNVKLYDTDAAVL  67

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
               L+ + I V + + NE +   +S     + A +WV  N+  + P T I  + VGNEVL 
Sbjct  68    TALADSNISVIVCLPNELL---SSAAKDQSFADKWVQANISHYYPKTQIEAIAVGNEVLD  124

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRD  1111
             D +  + +L  VPAMKNI  +L  +N+  +IK+ +P+++  L++S+PPS+G F+ D+ + 
Sbjct  125   DKNNATDFL--VPAMKNIHASLKKYNLDSSIKLSSPISLTALQSSYPPSAGSFKPDLVQ-  181

Query  1110  QVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRG--GNDTVVVDSETGLVY  937
              V+ PLL+FL +T SY  ++ YP+F++++N   +SLD+AL +   GN    VDS  GL Y
Sbjct  182   PVIKPLLDFLQQTGSYLMVNAYPFFAYADNSDEISLDYALLKQNPGN----VDSGNGLRY  237

Query  936   TNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMM  757
              +LL+  LD+VV AM  +G  D+++ ++ETGWP+ GD ++ GA   NAAAYN NLV +++
Sbjct  238   MSLLEAQLDAVVSAMSAIGNEDLKMVVTETGWPSNGDENEVGAGKENAAAYNGNLVRRVL  297

Query  756   QDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA-VPET  580
                  GTP +P   +  ++F+L++EN+K GP +ER++G+  P  M VYE+ LT A + + 
Sbjct  298   TGG--GTPLKPQEPLNVYLFALFNENQKPGPTSERNYGLFYPDEMKVYEIPLTAAELSKD  355

Query  579   EYPPLPEPDNNRPYE--GNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEP  406
             +  P+ E     P +  GN WCV         L  ALD+AC  G   C  +  G  C+ P
Sbjct  356   QSTPVNESKTQVPTQPSGNTWCVANANAGEEKLQAALDYACGEGGADCRPITDGSTCFNP  415

Query  405   VSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
              ++ AHA+YAF+S++ K      +C F G A + +  P +G C+ P+ +
Sbjct  416   NTLEAHASYAFNSYYQKKARGTGTCNFGGAAYVVSQPPRYGTCEFPTGY  464



>ref|XP_002883709.1| hypothetical protein ARALYDRAFT_480193 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59968.1| hypothetical protein ARALYDRAFT_480193 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   323 bits (829),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 173/463 (37%), Positives = 276/463 (60%), Gaps = 28/463 (6%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + +IG+NYGR+ ++LPSA++ ++ LK+  + +VKI+D+D  +LK LSG+ I+VT+ + NE
Sbjct  22    AGSIGVNYGRISDELPSAFKVVQLLKSQGIDRVKIFDADPSVLKALSGSGIKVTVDLPNE  81

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    S   +++ A  WV  NV  + P T I  + VGNEV  D+   + +L  +PAM+N
Sbjct  82    LL---FSAAKRTSFAVSWVKRNVAAYHPSTQIESIAVGNEVFVDTHNTTSFL--IPAMRN  136

Query  1236  IKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I KAL   NIH +IK+ +P+A+  L+ S+P SSG FR ++  D V+ P+L+FL  T S  
Sbjct  137   IHKALMSFNIHSDIKISSPLALSALQNSYPSSSGSFRPEL-VDSVIKPMLDFLRETGSRL  195

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++VYP+F++  N   + LD+AL R   +  +VDS  GL Y NL D  +D+V  AM  L 
Sbjct  196   MINVYPFFAYEGNSDVIPLDYALLR--ENPGMVDSGNGLRYFNLFDAQIDAVFAAMSALK  253

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+ I ++ETGWP+ GD ++ GA++ NAA+YN NL+ +++     GTP RP   +  ++
Sbjct  254   YDDIEIIVTETGWPSKGDENEVGATLANAASYNGNLIRRILTRG--GTPLRPKADLTVYL  311

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT----------------AVPETEYPP  568
             F+L++EN+K+GP +ER++G+  P    VY++  TT                    T  PP
Sbjct  312   FALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTGGDQTTTKPP  371

Query  567   LPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
             +     ++   G+ WCV         L   LD+AC  G   C  + PG +CY P ++ AH
Sbjct  372   M-SGGVSKSLNGHSWCVANGDAGEEKLQGGLDYACGEGGADCSSIQPGANCYSPDTLEAH  430

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             A++AF+S++ K    G SCYF G A + +  P +G C+ P+ +
Sbjct  431   ASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  473



>ref|XP_002320484.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|ABK92452.1| unknown [Populus trichocarpa]
 gb|EEE98799.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=470

 Score =   323 bits (829),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 171/460 (37%), Positives = 271/460 (59%), Gaps = 24/460 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + ++G+NYGR+ N+LPSA + +  +K+  + +VK+YD+D  +LK LSG+ I+VT+ + N+
Sbjct  21    AGSVGVNYGRIANNLPSAVKVVNLVKSQGLERVKVYDTDPAVLKALSGSGIKVTVDLPNQ  80

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    S       A+ WV  N++ + P T I  + VGNEV  D    + +L  +PAMKN
Sbjct  81    LL---YSAAKYPNFARSWVQKNIVAYHPSTQIESIAVGNEVFVDPHNTTKFL--IPAMKN  135

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I +AL   N+H+ IKV +P+A+  L++S+P S+G FR ++  + V  P+L+FL +T SY 
Sbjct  136   IHQALVKFNLHSSIKVSSPIALSALQSSYPSSAGSFRPEL-IEPVFKPMLDFLRQTGSYL  194

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR   +  VVDS  GL Y NL D  +D+V  A+  L 
Sbjct  195   MVNAYPFFAYESNSDVISLDYALFR--ENPGVVDSGNGLKYFNLFDAQIDAVFAALSALK  252

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++DV++ ++ETGWP+ GD ++ GASV NAAAYN NLV +++     GTP +P   +  ++
Sbjct  253   YDDVKMVVTETGWPSKGDENEVGASVENAAAYNGNLVRRILTGG--GTPLKPQADLTVYL  310

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDN----------  550
             F+L++EN K GP +ER++G+  P    VY++  T    +    P   P +          
Sbjct  311   FALFNENEKDGPTSERNYGLFYPDQQKVYDIPFTVEGLKNYKAPSRSPVSGGQQVSAPVR  370

Query  549   ---NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANY  379
                ++   GN WCV         L  ALDFAC  G   C  + P   CY P +++AH+++
Sbjct  371   GGVSKSTTGNTWCVANPDAGKEKLQAALDFACGEGGADCRPIQPDATCYSPNTLVAHSSF  430

Query  378   AFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             AF+S++ K       CYF G A + T +P  G C+ P+ +
Sbjct  431   AFNSYYQKKGRGMGDCYFGGAAFVVTQEPKFGVCEFPTGY  470



>ref|XP_010433433.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=455

 Score =   323 bits (827),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 179/463 (39%), Positives = 265/463 (57%), Gaps = 17/463 (4%)
 Frame = -3

Query  1650  PIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEI  1471
             P F ++      S     S  IG+NYGR+ N+LPS    +  LK+  +S++KIYD+D  +
Sbjct  7     PCFLILCLFPTISFTHAESGMIGVNYGRIANNLPSPKNVVSLLKSQGISRIKIYDTDKNV  66

Query  1470  LKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL  1291
             L  L+ + I+V + + NE +   +S ++  + A RW+  NV    P T I  + VGNEV 
Sbjct  67    LAALANSGIKVIVALPNELL---SSASSNQSFADRWIQTNVASHFPATEIEAIAVGNEVF  123

Query  1290  SDSSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPR  1114
              D    + +L   PAMKNI  +L  HN+   IK+ +PVA+  L  S+PPSSG F+ D+  
Sbjct  124   VDPKNTTPYLD--PAMKNIHTSLVKHNLDKAIKISSPVALSALANSYPPSSGSFKPDL-I  180

Query  1113  DQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYT  934
             + V+ P+L+ L RT SY  ++ YP+F++S N   +SLD+ALF+  +  +  DS TGL Y 
Sbjct  181   EPVIKPMLDLLQRTSSYLMVNAYPFFAYSANADKISLDYALFQENSGNI--DSRTGLKYN  238

Query  933   NLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQ  754
             NL D  LD+V  AM  +GFNDV++ ++ETGWP+ GD ++ GAS   AAAYN  LV +++ 
Sbjct  239   NLFDAQLDAVYAAMSAVGFNDVKVMVTETGWPSVGDENEIGASEPYAAAYNVGLVKRVLT  298

Query  753   DPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEY  574
             D   GTP RP  ++  ++F+L +EN+K GP +ER++G+  P    VY+      VP T  
Sbjct  299   DN--GTPLRPRESLNVYLFALLNENQKPGPTSERNYGLFYPNEGKVYD------VPFTAR  350

Query  573   PPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSIL  394
                P          + WCV    +    L  ALD+AC  G   C  + PG  CY P ++ 
Sbjct  351   STFPVNGKGDEVPVSKWCVSNGEMARDRLQAALDYACGEGGADCRPIQPGATCYHPETLE  410

Query  393   AHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             AHA+YAF+S++ K      +CYF G A + T  P  G C+ P+
Sbjct  411   AHASYAFNSYYQKNARGVGTCYFGGAAHVVTQPPRFGKCEFPT  453



>ref|XP_009771279.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like, partial 
[Nicotiana sylvestris]
Length=455

 Score =   323 bits (827),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 179/455 (39%), Positives = 273/455 (60%), Gaps = 23/455 (5%)
 Frame = -3

Query  1590  NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDI  1411
             +IG+NYGRV N+LPSA + +  LK   V +VK+YD+D  +LK LSG+ I VT+ + NE +
Sbjct  9     SIGVNYGRVANNLPSAVKAVALLKFQGVERVKVYDTDPAVLKALSGSGIMVTVNLPNELL  68

Query  1410  PalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIK  1231
                 +   + + A  WV  NV+ + P T I  + VGNEV  D    + +L  VPAMKNI 
Sbjct  69    ---YNAAKRQSFAYSWVQRNVVAYYPSTQIESIAVGNEVFVDPHNTTRFL--VPAMKNIH  123

Query  1230  KALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFL  1054
             +AL  +NIH+ IKV +PVA+  L+ S+P S+G FR+++  + V+ P+L+FL +T S+  +
Sbjct  124   EALLKYNIHDKIKVSSPVALSALQNSYPSSAGSFRSELV-EPVIKPMLDFLRQTGSFLMV  182

Query  1053  DVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFN  874
             + YP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L D  +D+V  A+  L ++
Sbjct  183   NCYPFFAYESNSDVISLDYALFR--ENPGVVDAGNGLRYFSLFDAQVDAVFAALSALKYD  240

Query  873   DVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFS  694
             D+++ ++ETGWP+ GD  + GAS+ NAAAYN NLV +++     GTP RP   I  F+F+
Sbjct  241   DIKMVVTETGWPSKGDDIEVGASLDNAAAYNGNLVRRILTGG--GTPLRPKEDITVFLFA  298

Query  693   LYDENRKVGPGTERHWGILRPTGMPVYELNLTTA----VPETEYPPLPEPDNNRPYEGNL  526
             L++EN+K GP +ER++G+  P    VY++ L         + + P        +  +GN+
Sbjct  299   LFNENKKPGPTSERNFGLFYPNERKVYDIPLNMEGLKHYIDRQSPVAGGERMQKGGKGNV  358

Query  525   --------WCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFS  370
                     WCV +      +L  ALDFAC  G   C  + PG  CY P ++ AHA+YAF+
Sbjct  359   SAGVPGQTWCVASGEAGKDNLQAALDFACGEGGADCRSIQPGSTCYNPNTLEAHASYAFN  418

Query  369   SFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             S++ K      SCYF G A +    P +G C++P+
Sbjct  419   SYYQKKGRAMGSCYFGGAAYIVHQQPKYGNCELPT  453



>ref|XP_004243515.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Solanum lycopersicum]
Length=468

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/453 (39%), Positives = 268/453 (59%), Gaps = 19/453 (4%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + +IGINYGRV N+LPSA + I  LK+  V +VK+YD+D  +LK LSG+ I+VT+ + NE
Sbjct  24    AGSIGINYGRVANNLPSAVKVIALLKSQGVERVKVYDTDPAVLKALSGSDIKVTVNLPNE  83

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    +   + + A  WV  NV  + P T I  + VGNEV  D    + +L  V AMKN
Sbjct  84    LL---YNAAKRPSFAYSWVEKNVAAYYPSTQIESIAVGNEVFVDPHNTTRFL--VSAMKN  138

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             + +AL   N H+ IK+ +PVA+  L+ S+P S+G FR+++  + V+ P+L+FL +T SY 
Sbjct  139   VHQALVKFNFHDKIKISSPVALSALQNSYPSSAGSFRSELV-EPVIKPMLDFLRQTGSYL  197

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L D  +D+V  A+  L 
Sbjct  198   MVNCYPFFAYESNSDVISLDYALFR--ENPGVVDAGNGLRYFSLFDAQIDAVFAALSALK  255

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             +ND+++ ++ETGWP+ GD  + GASV NAA+YN NLV +++     GTP RP   +  F+
Sbjct  256   YNDIKMVVTETGWPSKGDDTEIGASVDNAASYNGNLVRRILIGG--GTPLRPKEDLTVFL  313

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA----VPETEYPPLPEPDNNRP---  541
             F+L++EN+K GP +ER++G+  P    VY + LT        +   P   E    +    
Sbjct  314   FALFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPSAGEQRTQKGGKV  373

Query  540   -YEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSF  364
                G  WCV +       L  ALD+AC  G   C  + PG  CY P ++ AHA++AF+S+
Sbjct  374   NVSGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSY  433

Query  363   WAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             + K      SCYF G A +    P +G C++P+
Sbjct  434   YQKKGRAMGSCYFGGAAFIVHQQPKYGHCELPT  466



>ref|XP_007142328.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
 gb|ESW14322.1| hypothetical protein PHAVU_008G271000g [Phaseolus vulgaris]
Length=466

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/456 (37%), Positives = 268/456 (59%), Gaps = 21/456 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + ++GINYGR+ NDLP+  + +E LK+  +S+VK+YD+D  +L   + + I+V + + NE
Sbjct  22    AGSVGINYGRIANDLPTPAKVVELLKSQGLSRVKLYDTDATVLSAFANSGIKVVVAMPNE  81

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +   ++     +    WV DN+    P T I  + VGNEV  D +  + +L  V AMKN
Sbjct  82    LL---SNAAADQSFTDAWVKDNIASHYPATQIEAIAVGNEVFVDPNNTTKFL--VAAMKN  136

Query  1236  IKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             +  +L   ++  NIK+ +P+A+  L++SFP SSG F+ ++  + V+ P+L+ L +T SY 
Sbjct  137   VHASLTKSSLDTNIKISSPIALSALQSSFPASSGSFKTEL-VEPVIKPMLDLLRQTGSYL  195

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++S N   +SL++ALF+   +  VVDS  GL YTNL D  +D+V  AM  L 
Sbjct  196   MVNAYPFFAYSANADKISLEYALFK--ENAGVVDSGNGLKYTNLFDAQIDAVFAAMSALQ  253

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             + DV+I +SETGWP+ GD ++ GA   NAA YN NLV +++     GTP RP  ++  F+
Sbjct  254   YTDVKITVSETGWPSAGDSNEIGAGPENAAEYNGNLVRRVLGQS--GTPLRPNDSLDVFL  311

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNL---------TTAVPETEYPPLPEPDNN  547
             F+L++EN+K GP +ER++G+  P+   VY++ L         ++ V +++ P   E    
Sbjct  312   FALFNENQKTGPTSERNYGLFYPSEKKVYDIPLKAEGVTEAPSSGVEKSQVPASGEVSTT  371

Query  546   RPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
                +G  WCV   G     L   L++AC  G   C  + P   CY P ++ AHA+YAF+S
Sbjct  372   S-RDGQTWCVANGGASEEKLQNGLNYACGEGGADCSAIQPDATCYNPNTLEAHASYAFNS  430

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             ++ K      +C F G A + T  P +G+C+ PS +
Sbjct  431   YYQKKARAAGTCDFGGTAYVVTHPPKYGSCEFPSGY  466



>emb|CDY18049.1| BnaC07g04210D [Brassica napus]
Length=442

 Score =   321 bits (823),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 177/463 (38%), Positives = 273/463 (59%), Gaps = 28/463 (6%)
 Frame = -3

Query  1641  ALIFFTLLASSNGLPSS-NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             A IF  L+ S+  L  + +IG+NYGR+ ++LPSA++ ++ LK+  + +VKI+D+D  +LK
Sbjct  6     AFIFLVLILSAISLSEAGSIGVNYGRISDELPSAFKVVQLLKSQGIDRVKIFDADPAVLK  65

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
              LSG+ IRVT+ + NE +    S   + + A  WV  NV  + P T I  V VGNEV  D
Sbjct  66    ALSGSGIRVTVDLPNEML---FSAAKRPSFAATWVKRNVAAYHPSTQIESVAVGNEVFVD  122

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
                 + +L  +PAM+NI KAL  +N+H+ IK+ +P+A+  L+ S+P SSG FR ++  D 
Sbjct  123   PHNTTKYL--IPAMRNIHKALVSYNLHSSIKISSPLALSALQNSYPSSSGSFRPEL-VDL  179

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L+FL  T S   ++VYP+F++  N   + LD+AL +   +  +VDS  GL Y NL
Sbjct  180   VIKPMLDFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLK--ENPGMVDSGNGLRYFNL  237

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              D  +D+V  AM  L ++D+ I ++ETGWP+ GD ++ GASV NAA+YN NL+ +++   
Sbjct  238   FDAQIDAVFAAMSALKYDDIEIIVTETGWPSKGDENEIGASVANAASYNGNLIRRILTGG  297

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
               GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY++             
Sbjct  298   --GTPLRPKADLTIYLFALFNENKKFGPTSERNYGLFFPDEKKVYDI-------------  342

Query  567   LPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
                P       G+ WCV         L   LD+AC  G   C  +  G  CY P ++ AH
Sbjct  343   ---PFTQEGLTGSTWCVANGDAGKDRLQGGLDYACGDGGADCRPIQRGAPCYSPDTLEAH  399

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             A++AF+S++ K    G SCYF G A + T  P +G C+ P+ +
Sbjct  400   ASFAFNSYYQKKGRAGGSCYFGGAAYVVTQPPKYGRCEFPTGY  442



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 181/484 (37%), Positives = 284/484 (59%), Gaps = 23/484 (5%)
 Frame = -3

Query  1677  MFKAKEMQKPIFALIFFTLLASSNGLP-SSNIGINYGRVGNDLPSAYETIETLKAMRVSQ  1501
              F+ + M    F+L+   LL S+ G   +S+IGINYGRV NDLPS  + +E LK++ V +
Sbjct  4     FFQVQSMAYQAFSLL--VLLLSAIGFSDASSIGINYGRVANDLPSPDKVVELLKSIGVEK  61

Query  1500  VKIYDSDHEILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMI  1321
             VK+YD+D  +L  L+ + I V + + NE +   AS     + A  WV  N+ +F P T I
Sbjct  62    VKLYDTDATVLTALANSGISVMVALPNELL---ASAAADQSFADNWVQSNISKFYPATKI  118

Query  1320  RGVLVGNEVLSDSSAQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPS  1144
               + VGNEV  D    + ++  VPAMKN+  +L   N+  NIK+ +P+A+  L+ S+P S
Sbjct  119   EAIAVGNEVFVDPKNTTSYV--VPAMKNVHASLVKFNLDSNIKISSPIALSALQNSYPSS  176

Query  1143  SGRFRADIPRDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVV  964
             +G F+ D+  + V+ P+L+FL +T SY  ++ YP+F++S N   +SLD+ALF+   +  V
Sbjct  177   AGSFKPDL-VEPVIKPMLDFLKQTDSYLMVNAYPFFAYSANSDQISLDYALFK--ENPGV  233

Query  963   VDSETGLVYTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAY  784
             VDS +GL Y +L +  +D+V  AM  L ++DV++ ++ETGWP+ GD ++ GAS  NAA+Y
Sbjct  234   VDSGSGLKYNSLFEAQIDAVFAAMSALKYDDVKMVVTETGWPSMGDENEIGASEANAASY  293

Query  783   NRNLVSKMMQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELN  604
             N NLV +++     GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY + 
Sbjct  294   NGNLVRRVLSGN--GTPLRPQDPLNVYLFALFNENQKSGPTSERNYGLFYPNEQKVYNIP  351

Query  603   LTTAVPET-EYPPLPEPDNNRPYEGNL--------WCVVATGIRILDLGPALDFACAAGN  451
             LT    E+ +  P+    +  P  G +        WCV         L  ALD+AC  G 
Sbjct  352   LTKEELESGQSTPVNGNTSQVPATGEVSKTSVGQTWCVANKNAGEKTLQAALDYACGEGG  411

Query  450   GTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKV  271
               C  + PG  CY P ++ AHA+YAF+S++ K      +C F G A + +  P +G C+ 
Sbjct  412   ADCKPIQPGATCYSPNTLDAHASYAFNSYYQKKTRGTGTCDFGGAAYVVSQPPRYGNCEF  471

Query  270   PSVF  259
             P+ +
Sbjct  472   PTGY  475



>ref|XP_009102359.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
 ref|XP_009102360.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Brassica rapa]
Length=473

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 180/478 (38%), Positives = 280/478 (59%), Gaps = 27/478 (6%)
 Frame = -3

Query  1641  ALIFFTLLASSNGLPSS-NIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             A  F  L+ S+  L  + +IG+NYGR+ ++LPSA++ ++ LK+  + +VKI+D+D  +LK
Sbjct  6     AFHFLVLILSAISLSEAGSIGVNYGRISDELPSAFKVVQLLKSQGIDRVKIFDADPAVLK  65

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
              LSG+ IRVT+ + NE +    S   + + A  WV  NV  + P T I  + VGNEV  D
Sbjct  66    ALSGSGIRVTVDLPNEML---FSAAKRPSFAATWVKRNVAAYHPSTQIESIAVGNEVFVD  122

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
                 + +L  +PAM+NI KAL  +N+H+ IK+ +P+A+  L+ S+P SSG FR ++  D 
Sbjct  123   PHNTTKYL--IPAMRNIHKALVSYNLHSSIKISSPLALSALQNSYPSSSGSFRPEL-VDL  179

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L+FL  T S   ++VYP+F++  N   + LD+AL R   +  +VDS  GL Y NL
Sbjct  180   VIKPMLDFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLR--ENPGMVDSGNGLRYFNL  237

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              D  +D+V  AM  L ++D+ I ++ETGWP+ GD ++ GASV NAA+YN NL+ +++   
Sbjct  238   FDAQIDAVFAAMSALKYDDIEIIVTETGWPSKGDENEVGASVANAASYNGNLIRRVLTGG  297

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA--------  592
               GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY++  T          
Sbjct  298   --GTPLRPKADLTVYLFALFNENKKFGPTSERNYGLFFPDEKKVYDIPFTQEGLKHYRDG  355

Query  591   ---VPETEYPPLPEPDN----NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDL  433
                 P T    +  P+N    ++   G+ WCV         L   LD+AC  G   C  +
Sbjct  356   GHNTPATGDQQVTPPNNGGGVSKSLTGSTWCVANGDAGKDRLQGGLDYACGDGGADCRPI  415

Query  432   APGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
               G  CY P ++ AHA++AF+S++ K    G SCYF G A + T  P +G C+ P+ +
Sbjct  416   QRGAPCYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVTQPPKYGRCEFPTGY  473



>ref|XP_002278044.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
 emb|CBI26687.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/476 (36%), Positives = 271/476 (57%), Gaps = 22/476 (5%)
 Frame = -3

Query  1647  IFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEIL  1468
             IFA +F  L  SS      ++ +NYGR+ NDLP   + +E LKA  +++VK++D+D  +L
Sbjct  5     IFAFLFL-LSFSSPSEGGGSVAVNYGRIANDLPQPAQVVELLKAQGINKVKLFDADSTVL  63

Query  1467  KLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLS  1288
               L+ + + V + + NE +   ++     + +++WV  N+ ++ P T I  + VGNEV  
Sbjct  64    TALANSGVSVVVALPNELL--SSAAATDGSFSEKWVQTNIAQYHPSTQIEAIAVGNEVFV  121

Query  1287  DSSAQSLWLQMVPAMKNIKKALNLHNIHNIKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
             D +  + +L  VPAM N+ K+L  HN+ +IK+ +PVA+  L +S+PPS+G F+ ++  + 
Sbjct  122   DPNNTTQFL--VPAMNNVYKSLVKHNLSSIKISSPVALSALNSSYPPSAGVFKPEL-IET  178

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L FL +T SY  ++ YP+F++S N   +SLD+ALFR  N  V  D   GL Y++L
Sbjct  179   VMKPMLEFLRKTSSYLMVNAYPFFAYSANSDVISLDYALFRAVNANVT-DPGNGLSYSSL  237

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              +  LD+V  AM  + +NDV + ++ETGWP+ GD ++ GAS  NAAAYN NL+ +++   
Sbjct  238   FEAQLDAVYAAMSNIQYNDVPVVVTETGWPSKGDENEIGASTDNAAAYNGNLIKRVLTGG  297

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTT-------AV  589
               GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY + LT        + 
Sbjct  298   --GTPLRPNEPLNVYLFALFNENQKTGPTSERNYGLFYPNKEKVYNIPLTMEALKATGST  355

Query  588   P------ETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAP  427
             P      +   PP    +      G  WCV         L   LD+AC  G   C  +  
Sbjct  356   PINGSKVQVTSPPTASEEVTTAAVGQTWCVANGEAGAEKLQAGLDYACGEGGADCRPIQE  415

Query  426   GGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             G  CY P ++ AHA+YAF+S++ K      +C F G A + T  P  G C+ P+ +
Sbjct  416   GSTCYNPNTLEAHASYAFNSYYQKNTRGAGTCNFGGAAHVVTQTPKFGNCEFPTGY  471



>ref|XP_010110627.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
 gb|EXC27249.1| Glucan endo-1,3-beta-glucosidase 13 [Morus notabilis]
Length=479

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/467 (38%), Positives = 275/467 (59%), Gaps = 28/467 (6%)
 Frame = -3

Query  1635  IFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLS  1456
             +FF L++        +IG+NYGR+ N+LPSA + ++ L++  + +VK+YD+D  +LK LS
Sbjct  6     VFFFLISIVAFADGGSIGVNYGRIANNLPSARKVVQLLRSQGLERVKVYDTDPAVLKSLS  65

Query  1455  GTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSA  1276
             G+ I+VT+ + NE +   +S     + A  WV  NV+ + P T I  + VGNEV  D   
Sbjct  66    GSGIKVTVDLPNELL---SSAARHQSFANSWVQRNVVAYHPATQIEAIAVGNEVFVDPHN  122

Query  1275  QSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLL  1099
              + +L  VPAMKNI  AL  +N+  +IK+ +P+A+  L+ S+P S+G FR ++  + V  
Sbjct  123   TTTFL--VPAMKNIHAALVKNNLDSSIKISSPIALSALQNSYPASAGSFRPELV-ELVFK  179

Query  1098  PLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQ  919
             PLL+FL +T S+  ++ YP+F++  N   +SLD+ALFR   +  VVD+  GL Y NL D 
Sbjct  180   PLLDFLRQTGSFLMVNAYPFFAYESNSDVISLDYALFR--ENPGVVDAGNGLRYFNLFDA  237

Query  918   MLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLG  739
              +D+V  AM  L ++D+++ ++ETGWP+ GD ++ GASV NAAAYN NL+ +++     G
Sbjct  238   QIDAVFAAMSALKYDDIKMVVTETGWPSKGDENEIGASVENAAAYNGNLIRRILTGG--G  295

Query  738   TPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT-------------  598
             TP RP   +  ++F+L++EN+K GP +ER++G+  P    VY +  T             
Sbjct  296   TPRRPKEELTVYLFALFNENQKNGPTSERNYGLFYPDEKKVYNIPFTVEGLKDYHDDRSP  355

Query  597   -TAVPETEYP---PLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLA  430
              T   + + P     P    ++   GN WCV    +  + L  ALD+AC  G   C  + 
Sbjct  356   VTGGRQVKAPVEGGSPRGSVSKSLTGNTWCVANGEMGKVKLQAALDYACGEGGADCRGIQ  415

Query  429   PGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPS  289
             PG  CY+P +I AHA++AF+S++ K      SCYF G A + T  PS
Sbjct  416   PGATCYDPNTIEAHASFAFNSYYQKKARQMGSCYFGGTAYVVTQPPS  462



>emb|CDX92794.1| BnaC07g40520D [Brassica napus]
Length=451

 Score =   321 bits (822),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 174/461 (38%), Positives = 267/461 (58%), Gaps = 26/461 (6%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             L FF+ ++ +    S  IG+NYGR+ N+LP     +  LK+  ++++KIYD+D  +L  L
Sbjct  12    LSFFSAISITQA-SSGMIGVNYGRIANNLPPPENVVNLLKSQGINRIKIYDTDKNVLTAL  70

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             + + I+V + + NE +   +   +  + A +WV  N+ +  P T I  + VGNEV  D  
Sbjct  71    AHSRIKVVVCLPNELL---SRTASDQSFADKWVRRNIRKHFPATEIEAIAVGNEVFVDPK  127

Query  1278  AQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  VPAMKNI  +L  +N+  +IK+ +P+A+  L  S+PPSSG F+ D+  + V+
Sbjct  128   NTTPYL--VPAMKNIHTSLVKYNLDKSIKISSPIALSALANSYPPSSGSFKPDL-VEPVI  184

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L+ L +T SY  ++ YP+F++S N   +SLD+ALFR  ++   +D   GL Y +L D
Sbjct  185   KPMLDLLRKTSSYLMVNAYPFFAYSGNADKISLDYALFR--DNVGTLDPGNGLRYNSLFD  242

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               LD+V  AM  +GFNDV++ ++ETGWP+ GD+++ GAS  NAAAYN  LV +++     
Sbjct  243   AQLDAVYAAMSAVGFNDVKVMVTETGWPSAGDVNEIGASEANAAAYNGGLVKRVLNGN--  300

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLP  562
             GTP R    +  F+FSL++EN+K GP +ER++G+  P    VY +            P P
Sbjct  301   GTPLRRNEPLNVFLFSLFNENQKPGPTSERNYGLFYPNERRVYAV------------PFP  348

Query  561   EPDNNRP--YEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
                   P  +EG  WCV         L  ALD+AC  G   C  + PG  CY P S+ AH
Sbjct  349   ATTEQAPVAHEGESWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATCYNPKSLEAH  408

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             A++AF+S++ K      +CYF G A + T  P +G CK P+
Sbjct  409   ASFAFNSYYQKNARRVGTCYFGGTAHVVTQHPRYGKCKFPT  449



>ref|XP_010252551.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Nelumbo 
nucifera]
Length=477

 Score =   322 bits (824),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 172/474 (36%), Positives = 280/474 (59%), Gaps = 25/474 (5%)
 Frame = -3

Query  1644  FALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILK  1465
             F L+  ++LA+++   +  IGINYGRV N+LPSA + ++ LK+ R+++VK+YD+D  +LK
Sbjct  17    FFLLILSMLATAD---AGTIGINYGRVANNLPSAMKVVQLLKSQRLTRVKLYDTDPAVLK  73

Query  1464  LLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSD  1285
               +G+ I V + + NE +    +   + + A  WV  N+  + P T I  + VGNEV  D
Sbjct  74    AFAGSGIDVVVALPNEQL---YAAAKRRSFADTWVQKNIAAYHPDTQIHAIAVGNEVFVD  130

Query  1284  SSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQ  1108
                 + +L  VPAM+N+  AL  +N+ + IKV +P+A+  L++S+P S+G F+ ++  + 
Sbjct  131   PHNTTEFL--VPAMRNVHAALVKYNLDSAIKVSSPIALSALQSSYPSSAGSFKTEL-VEP  187

Query  1107  VLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNL  928
             V+ P+L+F  +T SY  ++ YP+F+++ N   +SLD+ALFR  N+  VVDS  GL Y +L
Sbjct  188   VIKPMLDFFRQTGSYLMVNAYPFFAYAANSDVISLDYALFR--NNPGVVDSGNGLRYFSL  245

Query  927   LDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDP  748
              +  +D+V  AM  L ++D+++ ++ETGWP+ GD ++ GA+  NAAAYN NLV +++   
Sbjct  246   FEAQIDAVFAAMSALKYDDIKMVVTETGWPSKGDENETGANEENAAAYNGNLVRRVLAGG  305

Query  747   PLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPP  568
               GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY++ LT+     + P 
Sbjct  306   --GTPLRPQEDLDVYLFALFNENKKPGPTSERNYGLFYPNEQKVYDIPLTSEEARQKVPV  363

Query  567   LPEPDNNRPYEGNL-----------WCVVATGIRILDLGPALDFACAAGNGTCDDLAPGG  421
                  N      N            WCV         L  ALD+AC  G   C  + PG 
Sbjct  364   NGGKKNQMTPVNNGGSVSTSSSGQTWCVANGKAGEQKLQAALDYACGEGGADCHQIQPGS  423

Query  420   DCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
              CY+P ++ AHA++AF+S++ K R    +C F G A + T  P  G C+ P+ +
Sbjct  424   TCYDPNTLEAHASFAFNSYYQKMRRGMGTCDFEGAAYVVTQPPKFGNCEFPTGY  477



>ref|XP_006386788.1| hypothetical protein POPTR_0002s21700g [Populus trichocarpa]
 gb|ERP64585.1| hypothetical protein POPTR_0002s21700g [Populus trichocarpa]
Length=453

 Score =   321 bits (822),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/464 (37%), Positives = 270/464 (58%), Gaps = 15/464 (3%)
 Frame = -3

Query  1653  KPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHE  1474
             +P F   F  L+       + +IG+NYGR+ N+LP+A + ++ +K+  + ++K+YD+D  
Sbjct  2     EPYFLSSFLVLVCIFTSADAGSIGVNYGRIANNLPAAAKVVQLVKSQGLERIKVYDTDPI  61

Query  1473  ILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEV  1294
             +LK LSG  I+VT+ + NE +    S       A+ WV  NV+ + P T I  + VGNEV
Sbjct  62    VLKALSGCGIKVTVDLPNELL---YSAAKNPYFARTWVQKNVVAYHPSTQIEAIAVGNEV  118

Query  1293  LSDSSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIP  1117
               D    + +L  +PAM+NI +AL   N+H+ IK+ +PVA+  L++S+P S+G FR ++ 
Sbjct  119   FVDPHNTTKFL--IPAMRNIHQALVKFNLHSSIKISSPVALSALQSSYPSSAGSFRPEL-  175

Query  1116  RDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVY  937
              + V  P+L+FL +T SY  ++ YP+F++  N   +SLD+AL R   +  VVDS  GL Y
Sbjct  176   IEPVFKPMLDFLRQTGSYLMVNAYPFFAYESNSDVISLDYALLR--ENPGVVDSGNGLRY  233

Query  936   TNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMM  757
              +L D  +D+V  A+  L ++D++I ++ETGWP+ GD ++ G+ V NAAAYN NLV +++
Sbjct  234   FSLFDAQIDAVFAALSALKYDDIKIVVTETGWPSKGDENEIGSGVENAAAYNGNLVRRIL  293

Query  756   QDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETE  577
                  GTP RP   +  ++F+L++EN K GP +ER++G   P    VY++  T    ++ 
Sbjct  294   TGG--GTPLRPQADLTVYLFALFNENEKDGPTSERNYGFFYPDEQKVYDIPFTVEGLKSY  351

Query  576   YPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSI  397
                    D  R      WCV         L   LDFAC  G   C  + PG  CY+P ++
Sbjct  352   KDSNRSSDTGR----KTWCVANPDAGKQKLQAGLDFACGEGGADCRPIQPGATCYDPNTL  407

Query  396   LAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +AH+++AF+S++ K       CYF G A + T +P  G C+ P+
Sbjct  408   VAHSSFAFNSYYQKQGRGMGDCYFGGAAYVVTQEPKFGQCEFPT  451



>ref|XP_002274828.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
Length=471

 Score =   321 bits (823),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 175/459 (38%), Positives = 267/459 (58%), Gaps = 25/459 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + +IG+NYGR+ N+LPSA + ++ LK+  + +VK++D+D  +LK L  + I+VT+ + NE
Sbjct  21    AGSIGVNYGRIANNLPSAVKVVQLLKSQGIERVKVFDTDPAVLKALGESGIKVTVDLPNE  80

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    S   + + A  WV  NV ++ P T I  + VGNEV  D    +  L +VPA+KN
Sbjct  81    LL---ISAAKRQSFANTWVQKNVADYFPATKIEAIAVGNEVFVDP--HNTTLSLVPALKN  135

Query  1236  IKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I KAL  +N+H +IKV +PVA+  L++S+P S+G FR ++  + V  P+L FL +T SY 
Sbjct  136   IHKALVKYNLHSHIKVSSPVALSALQSSYPSSAGSFRQELI-EPVFKPMLEFLRQTGSYL  194

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR   +  VVD+  GL Y NL D  +D+V  AM  L 
Sbjct  195   MVNAYPFFAYEANSDVISLDYALFR--ENPGVVDAGNGLRYFNLFDAQIDAVFAAMSALK  252

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             +ND+++ ++ETGWP+ GD ++ GASV NAAAYN NLV +++     GTP RP   +  F+
Sbjct  253   YNDIKMVVTETGWPSKGDENEIGASVANAAAYNGNLVRRILTGG--GTPLRPKADLVVFL  310

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLT--------------TAVPETEYPPLP  562
             F+L++EN+K GP +ER++G+  P+   VY +  T              T       P   
Sbjct  311   FALFNENKKPGPSSERNYGLFYPSEEKVYNIPFTVEGLKNYRDIQSPVTGGVRVSTPVTR  370

Query  561   EPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHAN  382
                 +    G  WCV         L  ALD+AC  G   C  + PG  CY+P ++ AHA+
Sbjct  371   GGSVSPSSSGQTWCVANGETGKEKLQAALDYACGEGQADCHPIQPGATCYDPNTLEAHAS  430

Query  381   YAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             +AF+S++ K      +C F G A + T  P  G C+ P+
Sbjct  431   FAFNSYYQKKGRVIGTCDFQGAAYVVTQAPRFGKCEFPT  469



>ref|XP_006396136.1| hypothetical protein EUTSA_v10002515mg [Eutrema salsugineum]
 gb|ESQ36915.1| hypothetical protein EUTSA_v10002515mg [Eutrema salsugineum]
Length=469

 Score =   321 bits (823),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 177/473 (37%), Positives = 279/473 (59%), Gaps = 22/473 (5%)
 Frame = -3

Query  1641  ALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKL  1462
             + IF  LL+  +   + +IG+NYGR+ ++LPSA + ++ LK+  + +VKI+D+D  +LK 
Sbjct  7     SFIFLLLLSPISLSDAGSIGVNYGRISDELPSAVKVVQLLKSQGIDRVKIFDADPAVLKA  66

Query  1461  LSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDS  1282
             LSG+ IRVT+ + NE +    S   +++ A  WV  NV  + P T I  + VGNEV  D 
Sbjct  67    LSGSGIRVTVDLPNEIL---FSAAKRASFAASWVKRNVAAYHPSTQIESIAVGNEVFVDP  123

Query  1281  SAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQV  1105
                + +L  +PAM+NI KAL   N+H+ IK+ +P+A+  L+ S+P SSG FR ++  D V
Sbjct  124   HNTTKFL--IPAMRNIHKALISFNLHSSIKISSPLALSALQNSYPSSSGSFRPEL-VDLV  180

Query  1104  LLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLL  925
             + P+L+FL  T S   ++VYP+F++  N   + LD+AL R   +  +VDS  GL Y NL 
Sbjct  181   IKPMLDFLRETGSRLMINVYPFFAYEGNSDVIPLDYALLR--ENPGMVDSGNGLRYFNLF  238

Query  924   DQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPP  745
             D  +D+V  AM  L ++D+ I ++ETGWP+ GD ++ GA+V NAA+YN NL+ +++    
Sbjct  239   DAQIDAVFAAMSALKYDDIEIIVTETGWPSKGDENEVGATVANAASYNGNLIRRILTGG-  297

Query  744   LGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYEL-----------NLT  598
              GTP RP   +  ++F+L++EN+K GP +ER++G+  P    VY++           N  
Sbjct  298   -GTPLRPKADLTVYLFALFNENKKFGPTSERNYGLFFPDEKKVYDVPFTQEGLKHFRNTP  356

Query  597   TAVPETEYPPLPEPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGD  418
              A  +   PP+     ++   G+ WCV         L   LD+AC  G   C  + PG  
Sbjct  357   VAGDQRVSPPINGGGVSKSLTGSSWCVANGDAGADRLQRGLDYACGEGGADCRPIQPGAT  416

Query  417   CYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             CY P ++ AHA++AF+S++ K    G SCYF G A + +  P +G C+ P+ +
Sbjct  417   CYSPDTLEAHASFAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  469



>ref|NP_178637.2| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AEC05971.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=472

 Score =   321 bits (822),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 171/461 (37%), Positives = 277/461 (60%), Gaps = 25/461 (5%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + +IG+NYGR+ ++LPSA++ ++ LK+  +++VKI+D+D  +LK LSG+ I+VT+ + NE
Sbjct  22    AGSIGVNYGRISDELPSAFKVVQLLKSQGITRVKIFDADPSVLKALSGSGIKVTVDLPNE  81

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    S   +++ A  WV  NV  + P T I  + VGNEV  D+   + +L  +PAM+N
Sbjct  82    LL---FSAAKRTSFAVSWVKRNVAAYHPSTQIESIAVGNEVFVDTHNTTSFL--IPAMRN  136

Query  1236  IKKALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I KAL   N+H +IK+ +P+A+  L+ S+P SSG FR ++  D V+ P+L+FL  T S  
Sbjct  137   IHKALMSFNLHSDIKISSPLALSALQNSYPSSSGSFRPEL-IDSVIKPMLDFLRETGSRL  195

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++VYP+F++  N   + LD+AL R   +  +VDS  GL Y NL D  +D+V  AM  L 
Sbjct  196   MINVYPFFAYEGNSDVIPLDYALLR--ENPGMVDSGNGLRYFNLFDAQIDAVFAAMSALK  253

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++D+ I ++ETGWP+ GD ++ GA++ NAA+YN NL+ +++     GTP RP   +  ++
Sbjct  254   YDDIEIIVTETGWPSKGDENEVGATLANAASYNGNLIRRILTRG--GTPLRPKADLTVYL  311

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA----VPETEYPPLPEPDN------  550
             F+L++EN+K+GP +ER++G+  P    VY++  TT       +  + P+   D       
Sbjct  312   FALFNENKKLGPTSERNYGLFFPDEKKVYDIPFTTEGLKHYRDGGHTPVTGGDQVTKPPM  371

Query  549   ----NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHAN  382
                 ++   G  WCV         L   LD+AC  G   C  + PG +CY P ++ AHA+
Sbjct  372   SGGVSKSLNGYTWCVANGDAGEERLQGGLDYACGEGGADCRPIQPGANCYSPDTLEAHAS  431

Query  381   YAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             +AF+S++ K    G SCYF G A + +  P +G C+ P+ +
Sbjct  432   FAFNSYYQKKGRAGGSCYFGGAAYVVSQPPKYGRCEFPTGY  472



>ref|XP_006413135.1| hypothetical protein EUTSA_v10026799mg [Eutrema salsugineum]
 gb|ESQ54588.1| hypothetical protein EUTSA_v10026799mg [Eutrema salsugineum]
Length=462

 Score =   320 bits (820),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 179/469 (38%), Positives = 271/469 (58%), Gaps = 19/469 (4%)
 Frame = -3

Query  1650  PIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEI  1471
             P F +  F    S     S  IG+NYGR+ N+LPS    +  LK+  ++++KI+D+DH +
Sbjct  7     PYFLIPSFFSAISLTQADSGMIGVNYGRIANNLPSPENVVNLLKSQGINRIKIFDTDHTV  66

Query  1470  LKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVL  1291
             L  L+ + I+V + + NE +   +S  +  + A  WV  N+ +  P T I  + VGNEV 
Sbjct  67    LASLANSGIKVVVALPNELL---SSAASDQSFADNWVQANITKHFPATEIEAIAVGNEVF  123

Query  1290  SDSSAQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPR  1114
              D S  + +L  VPAMKNI  +L   N+  +IK+ +P+A+  L  S+PPSSGRF+ D+  
Sbjct  124   VDPSNTTPYL--VPAMKNIHSSLVKFNLDESIKISSPIALSSLANSYPPSSGRFKPDL-V  180

Query  1113  DQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFR--GGNDTVVVDSETGLV  940
             + V+ P+L+ L +T SY  ++ YP+F++S N   +SLD+ALFR   GN    VD  TGL 
Sbjct  181   EPVIKPMLDLLRQTSSYLMVNAYPFFAYSANADKISLDYALFRENAGN----VDPGTGLR  236

Query  939   YTNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKM  760
             Y +L D  +D+V  AM  +GF  V++ ++ETGWP+ GD ++ GAS  NAAAYN  LV ++
Sbjct  237   YNSLFDAQIDAVFAAMSAVGFGGVKVMVTETGWPSAGDENEIGASESNAAAYNGGLVKRV  296

Query  759   MQDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPET  580
             +     GTP RP   +  ++F+L++EN+K GP +ER++G+  P+   VY++       E 
Sbjct  297   LTGN--GTPLRPRDPLNVYLFALFNENQKPGPTSERNYGLFYPSEGKVYDVPFVAG--EV  352

Query  579   EYPPLPEPDNNRP--YEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEP  406
                P+       P  +EG  WCV         L  ALD+AC  G   C  + PG  CY P
Sbjct  353   RSTPVNGDGAQFPVAHEGQSWCVSNGNAGKEKLQAALDYACGEGGADCRPIQPGATCYHP  412

Query  405   VSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
              S+ AHA++AF+S++ K      +CYF G A + T  P +G C+ P+ F
Sbjct  413   ESLEAHASFAFNSYYQKNARRVGTCYFGGAAHVVTQPPRYGECEFPTGF  461



>ref|XP_011009684.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Populus 
euphratica]
Length=470

 Score =   320 bits (821),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 174/477 (36%), Positives = 275/477 (58%), Gaps = 24/477 (5%)
 Frame = -3

Query  1653  KPIFALIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHE  1474
             +P F   F  L+       + +IG+NYGR+ N+LP+A + ++ +K   + ++K+YD+D  
Sbjct  2     EPYFLSSFLLLVCIFTSADAGSIGVNYGRIANNLPAAVKVVQLVKFQGLERIKVYDTDPV  61

Query  1473  ILKLLSGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEV  1294
             +LK LSG  I+VT+ + NE +    S     + A+ WV  NV+ + P T I  + VGNEV
Sbjct  62    VLKALSGCGIKVTVDLPNELL---YSAAKNPSFARTWVQKNVVAYHPSTQIEAIAVGNEV  118

Query  1293  LSDSSAQSLWLQMVPAMKNIKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIP  1117
               D    + +L  +PAM+NI +AL   N+H+ IKV +PVA+  L++S+P S+G FR ++ 
Sbjct  119   FVDPHNTTKFL--IPAMRNIHQALVKFNLHSSIKVSSPVALSALQSSYPSSAGSFRPEL-  175

Query  1116  RDQVLLPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVY  937
              + V  P+L+FL +T SY  ++ YP+F++  N   +SLD+AL R   +  VVDS  GL Y
Sbjct  176   IEPVFKPMLDFLRQTGSYVMVNAYPFFAYESNSDVISLDYALLR--ENPGVVDSGNGLRY  233

Query  936   TNLLDQMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMM  757
              +L D  +D+V  AM  L ++D++I ++ETGWP+ GD ++ G+ V NAAAYN NLV +++
Sbjct  234   FSLFDAQIDAVFAAMSALKYDDIKIVVTETGWPSKGDENEIGSGVENAAAYNGNLVRRIL  293

Query  756   QDPPLGTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTA-----  592
                  GTP RP   +  ++F+L++EN K GP +ER++G+  P    VY++  T       
Sbjct  294   TGG--GTPLRPKADLTVYLFALFNENEKDGPTSERNYGLFYPDEQKVYDIPFTVEGLKSY  351

Query  591   -----VPETEYPPLPEPDN---NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDD  436
                    +T    +  P N   ++   G  WCV         L   LDFAC  G   C  
Sbjct  352   KDSNRSSDTGSHQVAAPVNGGVSKSTTGKTWCVANPDAGKQKLQAGLDFACGEGGADCRP  411

Query  435   LAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             + PG  CY+P +++AH+++AF+S++ K       CYF G A + T +P  G C+ P+
Sbjct  412   IQPGATCYDPNTLVAHSSFAFNSYYQKQGRGMGDCYFGGAAYVVTQEPKFGQCEFPT  468



>ref|XP_006357966.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like isoform X2 
[Solanum tuberosum]
Length=468

 Score =   320 bits (821),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 176/453 (39%), Positives = 269/453 (59%), Gaps = 19/453 (4%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             + +IGINYGRV N+LPSA + I  LK+  V +VK+YD+D  +LK LSG+ I+VT+ + NE
Sbjct  24    AGSIGINYGRVANNLPSAVKVIALLKSQGVERVKVYDTDPAVLKALSGSDIKVTVDLPNE  83

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +    +   + + A  WV  NV  + P T I  + VGNEV  D    + +L  V AMKN
Sbjct  84    LL---YNAAKRPSFAYSWVEKNVAAYYPSTQIESIAVGNEVFVDPHNTTRFL--VSAMKN  138

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             + +AL   N H+ IK+ +PVA+  L+ S+P S+G FR+++  + V+ P+L+FL +T SY 
Sbjct  139   VHQALVKFNFHDKIKISSPVALSALQNSYPSSAGSFRSELV-EPVIKPMLDFLRQTGSYL  197

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++  N   +SLD+ALFR   +  VVD+  GL Y +L D  +D+V  A+  L 
Sbjct  198   MVNCYPFFAYESNSDVISLDYALFR--ENPGVVDAGNGLRYFSLFDAQIDAVFAALSALK  255

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             +ND+++ ++ETGWP+ GD  + GA+V NAA+YN NLV +++     GTP RP   +  F+
Sbjct  256   YNDIKMVVTETGWPSKGDDTEIGATVDNAASYNGNLVRRILIGG--GTPLRPKEDLTVFL  313

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLT-TAVPETEYPPLPEPDNNRPYEG---  532
             F+L++EN+K GP +ER++G+  P    VY + LT   +        P   + R  +G   
Sbjct  314   FALFNENKKPGPTSERNFGLFYPNERKVYNIPLTMEGLKHYVDRRSPVAGDQRTQKGGKV  373

Query  531   ----NLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSF  364
                   WCV +       L  ALD+AC  G   C  + PG  CY P ++ AHA++AF+S+
Sbjct  374   NVSGQTWCVASGEAEKDHLQAALDYACGEGGADCRSIQPGSTCYNPNTLEAHASFAFNSY  433

Query  363   WAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             + K      SCYF G A +    P +G C++P+
Sbjct  434   YQKKSRAMGSCYFGGAAFIVHQQPKYGHCELPT  466



>ref|XP_004304085.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=485

 Score =   321 bits (822),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 177/469 (38%), Positives = 275/469 (59%), Gaps = 31/469 (7%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             L+  ++LAS +   + ++G+NYGRV ++LPSAY+    +K+  + +VK++DSD  +L+ L
Sbjct  10    LVLLSVLASHS--DAGSVGVNYGRVADNLPSAYKVAALIKSQGLERVKVFDSDPAVLRAL  67

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             SG+ I+VT+ + NE +   +S       A  WV  NV+ + P T I  + VGNEV  D+ 
Sbjct  68    SGSGIKVTVDLPNELL---SSAAKTQMFATNWVQRNVVAYHPNTQIEAIAVGNEVFVDTH  124

Query  1278  AQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  + AMKNI  AL   N+  +IKV +P+A+  L+ S+P S+G FR ++ +  V 
Sbjct  125   NTTKYL--IAAMKNIHTALVKFNLASDIKVSSPIALSALQNSYPSSAGSFRPELIQ-PVF  181

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L+FL +T SY  ++ YPYF++  N   +SLD+ALFR   +  VVD+ +GL Y +L D
Sbjct  182   KPMLDFLRQTGSYLMVNAYPYFAYESNADVISLDYALFR--ENPGVVDAGSGLRYFSLFD  239

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               +D+V  AM  L +ND+ + +SETGWP+ GD ++ GAS+ NAAAYN NLV +++     
Sbjct  240   AQIDAVFAAMSALKYNDIEMVVSETGWPSKGDENEIGASIENAAAYNGNLVRRILTGG--  297

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLT------------  598
             GTP RP   +  ++F+L++E+RK GP +ER++G+  P    VY++  T            
Sbjct  298   GTPLRPKADLTVYLFALFNEDRKFGPTSERNYGLFFPNEKKVYDIPFTVEGLKNYHDHKS  357

Query  597   -TAVPETEYPPLPEP-----DNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDD  436
               +    E  P+  P     D ++   GN WCV         L  ALD+AC  G   C  
Sbjct  358   PVSGNHHETAPVTAPVTGSGDVSKTLTGNTWCVANGEAGEEKLQAALDYACGEGGADCHQ  417

Query  435   LAPGGDCYEPVSILAHANYAFSSFWAKYRSTGASCYFNGLATMTTVDPS  289
             + PG  CY+P ++ AHA+YAF+S++ K      +CYF G A + +  PS
Sbjct  418   IQPGSTCYDPNTLEAHASYAFNSYYQKKARGAGTCYFGGAAYVVSQLPS  466



>emb|CDY46679.1| BnaA03g48290D [Brassica napus]
Length=446

 Score =   319 bits (817),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 176/461 (38%), Positives = 266/461 (58%), Gaps = 27/461 (6%)
 Frame = -3

Query  1638  LIFFTLLASSNGLPSSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLL  1459
             L FF+ ++ +    S  IG+NYGR+ N+LPS    +  LK+  ++++KIYD+D  +L  L
Sbjct  12    LSFFSTISITQA-SSGMIGVNYGRIANNLPSPENVVNLLKSQGINRIKIYDTDKNVLTAL  70

Query  1458  SGTYIRVTIMVRNEDIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSS  1279
             + + I+V + + NE +   +   +  + A +WV  NV +  P T +  + VGNEV  D  
Sbjct  71    AHSRIKVVVCLPNELL---SRTASDQSFADKWVRHNVRKHFPATEVEAIAVGNEVFVDPK  127

Query  1278  AQSLWLQMVPAMKNIKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVL  1102
               + +L  V AMKNI  +L  +++  +IK+ +P+A+  L  S+PPSSG F+ D+  + V+
Sbjct  128   NTTPYL--VLAMKNIHASLVKYSLGKSIKISSPIALSALANSYPPSSGSFKPDL-VEPVI  184

Query  1101  LPLLNFLNRTRSYFFLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLD  922
              P+L+ L +T SY  ++ YP+F++S N   +SLD+ALFR    TV  DS  GL Y +L D
Sbjct  185   KPMLDLLRKTSSYLMVNAYPFFAYSGNADKISLDYALFRDNAGTV--DSGNGLRYNSLFD  242

Query  921   QMLDSVVFAMQYLGFNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPL  742
               LD+V  AM  +GFNDV++ ++ETGWP+ GD ++ GAS  NAAAYN  LV +++     
Sbjct  243   AQLDAVYAAMSAVGFNDVKVMVTETGWPSAGDGNEIGASESNAAAYNGGLVQRVLNGN--  300

Query  741   GTPARPGVAIPTFIFSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLP  562
             GTP RP   +  F+F+L++EN+K GP +ER++G+  P    VY      AVP       P
Sbjct  301   GTPLRPKEPLNVFLFALFNENQKPGPTSERNYGLFYPNERKVY------AVPFAATTSTP  354

Query  561   EPDNNRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHAN  382
                      G  WCV         L  ALD+AC  G   C  + PG  CY P S+ AHA+
Sbjct  355   ---------GETWCVSNGDAAKEKLQAALDYACGEGGADCRPIQPGATCYHPKSLEAHAS  405

Query  381   YAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             +AF+S++ K      +CYF G A + T  P +G CK P+ +
Sbjct  406   FAFNSYYQKNARRDGTCYFGGTAHVVTQHPRYGKCKFPTEY  446



>ref|XP_006344866.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=518

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/463 (37%), Positives = 273/463 (59%), Gaps = 27/463 (6%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S +IG+NYGR+ N+LP+  E ++ LK+  +++VK+YD+D  +L  LSG+ I VT+ + NE
Sbjct  66    SGSIGVNYGRIANNLPTPEEVVQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNE  125

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +   +   ++ +    WV  N++ + P T I  + VGNEV  D    + +L  VPAMKN
Sbjct  126   QL---SDAASKQSFTDSWVQSNIIRYYPKTNIESIAVGNEVFVDPKNTTKFL--VPAMKN  180

Query  1236  IKKALNLHNI-HNIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             +  +L  + +  +IKV +PVA+  L+ S+P SSG F+ D+  + V+ P+L+FL ++ S+ 
Sbjct  181   VYASLVKYGVASSIKVSSPVALSALQNSYPSSSGSFKTDL-IEPVIKPMLSFLKQSGSFL  239

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              +++YP+F++  N   +SLD+ALFR  ++  V D   GLVY +L +  +D+V  AM+ L 
Sbjct  240   AVNIYPFFAYVANTDTISLDYALFR--DNKGVTDPNNGLVYKSLFEAQIDAVYAAMKALN  297

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             F+DV++ I+ETGWP+ GD ++ GAS  NAAAYN NLV +++     GTP +P   +  ++
Sbjct  298   FDDVKMEITETGWPSKGDENETGASADNAAAYNGNLVKRVLTGS--GTPLKPDEPLNVYL  355

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETE----------YPPLPEPDN  550
             F+L++EN+K GP +ER++G+  P+   VY++ L     E +            P+P P +
Sbjct  356   FALFNENQKPGPVSERNYGLFYPSKEKVYDITLIREGLEADPNNGSKSQVVKTPVPSPAS  415

Query  549   ------NRPYEGNLWCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAH  388
                         N WCV         L  ALD+AC  G   C  + PG  C+ P ++ AH
Sbjct  416   VVGGGVEESKVVNTWCVANEKAGTEQLQAALDYACGEGGADCRPIQPGATCHNPDTLAAH  475

Query  387   ANYAFSSFWAKYRSTGASCYFNGLATMTTVDPSHGACKVPSVF  259
             A+YAF+S++ K      +C F G A + T  P +G+CK P+ +
Sbjct  476   ASYAFNSYYQKKARGTGTCDFKGAAYVVTQHPKYGSCKFPTGY  518



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 171/454 (38%), Positives = 273/454 (60%), Gaps = 20/454 (4%)
 Frame = -3

Query  1596  SSNIGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNE  1417
             S ++GINYGRV N+LPS  + +E LK+  +++VK+YD+D  +L  L+ + I V + + NE
Sbjct  24    SGSVGINYGRVANNLPSPEKVVELLKSQGINKVKLYDTDATVLTALADSGITVVVALPNE  83

Query  1416  DIPalasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKN  1237
              +   +S     + A  WV  N+ +F P T I  + VGNEV  D +  + +L  VPAMKN
Sbjct  84    LL---SSTAADQSFADNWVEANITKFYPKTKIEAIAVGNEVFVDPANTTKYL--VPAMKN  138

Query  1236  IKKALNLHNIHN-IKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYF  1060
             I  +L    + + IK+ +P+A   L+TS+P S+G F+ ++  + V+ P+L+FL +T SY 
Sbjct  139   IHASLVKSKLDSAIKISSPIAFSALKTSYPSSAGSFKPEL-IEPVIKPMLDFLKQTGSYL  197

Query  1059  FLDVYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLG  880
              ++ YP+F++S N   +SLD+ALF+  ++  VVDS  GL Y++LL+  +D+V  AM  + 
Sbjct  198   MVNAYPFFAYSANSDQISLDYALFK--DNPGVVDSGNGLKYSSLLEAQIDAVFAAMSAIK  255

Query  879   FNDVRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFI  700
             ++DV++ ++ETGWP+ GD D+ GAS  NAA+YN NLV K++     GTP RP   +  ++
Sbjct  256   YDDVKMVVTETGWPSMGDEDEIGASESNAASYNGNLVRKVLTGN--GTPLRPQDPLNVYL  313

Query  699   FSLYDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPET-EYPPLPEPDNNRPYEGNL-  526
             F+L++EN+K GP +ER++G+  P    VY + LT    +T +  P+    +  P  G + 
Sbjct  314   FALFNENKKPGPTSERNYGLFYPNEQKVYNIPLTKEEAKTGQSTPVNSNTSQVPVAGEVS  373

Query  525   -------WCVVATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSS  367
                    WCV         L  ALD+AC  G   C  + PG  CY P ++ AHA+YAF+S
Sbjct  374   KAKVGQTWCVANGKADEKKLQAALDYACGEGKADCSPIQPGATCYNPNTLEAHASYAFNS  433

Query  366   FWAKYRSTGASCYFNGLATMTTVDPSHGACKVPS  265
             ++ K      +C F G A + +  P++G+C+ P+
Sbjct  434   YYQKNTRVTGTCEFGGAAYVVSQRPTYGSCEFPT  467



>ref|XP_004149346.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Cucumis 
sativus]
 gb|KGN56102.1| hypothetical protein Csa_3G073920 [Cucumis sativus]
Length=458

 Score =   319 bits (817),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/445 (37%), Positives = 267/445 (60%), Gaps = 12/445 (3%)
 Frame = -3

Query  1587  IGINYGRVGNDLPSAYETIETLKAMRVSQVKIYDSDHEILKLLSGTYIRVTIMVRNEDIP  1408
             +G+NYGR+ +DLPS  + ++ LK   + ++K++D++  +L  LS + I V + + NE + 
Sbjct  24    VGVNYGRIADDLPSPDDVVKLLKTHGIDRIKLFDTESTVLTALSNSNISVVVSLPNEYL-  82

Query  1407  alasnnnqsaaAKRWVHDNVLEFLPGTMIRGVLVGNEVLSDSSAQSLWLQMVPAMKNIKK  1228
               +S  +  +    WV  N+  F P T I  + VGNEV  D +  + +L  VPAMKN+  
Sbjct  83    --SSAASDPSFTDNWVQSNISHFYPSTKIDAIAVGNEVFVDPNNTTNFL--VPAMKNVYA  138

Query  1227  ALNLHNIH-NIKVGTPVAMDILETSFPPSSGRFRADIPRDQVLLPLLNFLNRTRSYFFLD  1051
             +L   N+H NIKV TP+A   L +S+P SSG F+ D+  + V+ P+L+ + +++S+  ++
Sbjct  139   SLQKFNLHTNIKVSTPLAFSALASSYPTSSGSFKPDL-IEPVMKPMLDLIRQSQSHLMVN  197

Query  1050  VYPYFSWSENPYNVSLDFALFRGGNDTVVVDSETGLVYTNLLDQMLDSVVFAMQYLGFND  871
              YP+F++  N   +S+D+ALFR   +  V+DS  GL Y+NLL+  +D+V  A+  + F D
Sbjct  198   AYPFFAYIGNADKISIDYALFR--ENAGVIDSGNGLKYSNLLEAQVDAVFAALSAIKFED  255

Query  870   VRIAISETGWPNTGDLDQPGASVHNAAAYNRNLVSKMMQDPPLGTPARPGVAIPTFIFSL  691
             + + ++ETGWP+ GD ++ GAS+ NAAAYN NLV +++     GTP RP   +  ++F+L
Sbjct  256   IPVVVTETGWPSKGDENEIGASIENAAAYNGNLVKRVLTGS--GTPLRPKEPLNAYLFAL  313

Query  690   YDENRKVGPGTERHWGILRPTGMPVYELNLTTAVPETEYPPLPEPDNNRPYE-GNLWCVV  514
             ++EN+K GP +ER++G+  P    VYE+ LT+A  E      P  + ++  + G  WCV 
Sbjct  314   FNENKKQGPTSERNYGLFYPNEEKVYEIPLTSADVEGGVGSTPAVNGSKVIKNGQTWCVA  373

Query  513   ATGIRILDLGPALDFACAAGNGTCDDLAPGGDCYEPVSILAHANYAFSSFWAKYRSTGAS  334
                +    L   LD+AC  G   C  + PG  CY P S+ AHA+YAF+S++ K +    +
Sbjct  374   NGKVAPEKLQAGLDYACGEGGADCSSIQPGATCYNPNSLEAHASYAFNSYYQKMKRAVGT  433

Query  333   CYFNGLATMTTVDPSHGACKVPSVF  259
             C F G A + T  P +G C+ P+ +
Sbjct  434   CDFGGAAYVVTQPPQYGQCEFPTEY  458



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5060635304340