BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26789_g1_i1 len=1234 path=[1212:0-1233]

Length=1234
                                                                      Score     E

ref|XP_009615877.1|  PREDICTED: 21 kDa protein-like                     242   2e-74   
ref|XP_009790824.1|  PREDICTED: 21 kDa protein-like                     235   1e-71   
ref|XP_004244511.2|  PREDICTED: 21 kDa protein-like                     232   2e-70   
ref|XP_006357078.1|  PREDICTED: 21 kDa protein-like                     229   2e-69   
gb|EYU46665.1|  hypothetical protein MIMGU_mgv1a014078mg                210   5e-62   
ref|XP_002321006.1|  hypothetical protein POPTR_0014s12390g             204   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_011033536.1|  PREDICTED: 21 kDa protein                          204   1e-59   
ref|XP_003625921.1|  Pectinesterase/pectinesterase inhibitor            199   1e-57   
gb|AFK38286.1|  unknown                                                 199   1e-57   
ref|XP_011079662.1|  PREDICTED: LOW QUALITY PROTEIN: 21 kDa protein     198   2e-57   
gb|KDP28163.1|  hypothetical protein JCGZ_13934                         197   6e-57   
ref|XP_002267786.1|  PREDICTED: 21 kDa protein                          196   9e-57   Vitis vinifera
ref|XP_002523085.1|  21 kDa protein precursor, putative                 195   4e-56   Ricinus communis
ref|XP_006444353.1|  hypothetical protein CICLE_v10022355mg             193   1e-55   
ref|XP_008451567.1|  PREDICTED: 21 kDa protein                          192   4e-55   
ref|XP_007163112.1|  hypothetical protein PHAVU_001G207300g             189   6e-54   
ref|XP_007050926.1|  Plant invertase/pectin methylesterase inhibi...    188   1e-53   
ref|XP_010259553.1|  PREDICTED: 21 kDa protein-like                     187   4e-53   
ref|XP_004160554.1|  PREDICTED: 21 kDa protein-like                     187   5e-53   
ref|XP_004495957.1|  PREDICTED: 21 kDa protein-like                     186   6e-53   
ref|XP_008350094.1|  PREDICTED: 21 kDa protein-like                     183   1e-51   
ref|XP_010069915.1|  PREDICTED: 21 kDa protein                          178   9e-50   
ref|XP_009335740.1|  PREDICTED: 21 kDa protein                          177   1e-49   
ref|XP_010545015.1|  PREDICTED: 21 kDa protein-like                     177   1e-49   
ref|XP_003591526.1|  21 kDa protein                                     178   2e-49   
ref|XP_009335681.1|  PREDICTED: 21 kDa protein-like                     177   2e-49   
ref|XP_003521571.1|  PREDICTED: 21 kDa protein-like                     176   5e-49   
ref|XP_008369014.1|  PREDICTED: 21 kDa protein                          174   2e-48   
ref|XP_008355483.1|  PREDICTED: 21 kDa protein-like                     174   3e-48   
ref|XP_004494376.1|  PREDICTED: 21 kDa protein-like                     169   2e-46   
ref|XP_010106384.1|  21 kDa protein                                     167   9e-46   
ref|XP_010519346.1|  PREDICTED: 21 kDa protein-like                     163   4e-44   
ref|XP_008235094.1|  PREDICTED: 21 kDa protein-like                     160   5e-43   
gb|AES61777.2|  plant invertase/pectin methylesterase inhibitor         158   6e-43   
emb|CDY11451.1|  BnaA09g40170D                                          155   3e-41   
ref|XP_006402338.1|  hypothetical protein EUTSA_v10006253mg             155   4e-41   
ref|NP_191841.1|  plant invertase/pectin methylesterase inhibitor...    154   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116944.1|  PREDICTED: 21 kDa protein                          153   2e-40   
ref|XP_004290794.1|  PREDICTED: 21 kDa protein-like                     153   2e-40   
ref|XP_002876691.1|  invertase/pectin methylesterase inhibitor fa...    153   3e-40   
emb|CDX76665.1|  BnaC08g32510D                                          152   3e-40   
ref|XP_006291882.1|  hypothetical protein CARUB_v10018059mg             152   7e-40   
ref|XP_009142512.1|  PREDICTED: 21 kDa protein                          152   1e-39   
ref|XP_010468917.1|  PREDICTED: 21 kDa protein-like                     151   1e-39   
ref|XP_010512677.1|  PREDICTED: 21 kDa protein-like                     150   1e-39   
ref|XP_010413236.1|  PREDICTED: 21 kDa protein-like                     150   2e-39   
gb|KFK35462.1|  hypothetical protein AALP_AA5G287100                    150   3e-39   
emb|CDY53010.1|  BnaC04g00200D                                          149   1e-38   
ref|XP_010921671.1|  PREDICTED: 21 kDa protein-like                     147   5e-38   
ref|XP_006397964.1|  hypothetical protein EUTSA_v10001636mg             147   6e-38   
ref|XP_007200177.1|  hypothetical protein PRUPE_ppa016389mg             145   2e-37   
ref|XP_006295007.1|  hypothetical protein CARUB_v10024078mg             143   2e-36   
ref|XP_010506807.1|  PREDICTED: 21 kDa protein-like                     142   5e-36   
ref|XP_010518481.1|  PREDICTED: 21 kDa protein-like                     141   7e-36   
ref|XP_010507863.1|  PREDICTED: 21 kDa protein-like                     140   2e-35   
ref|XP_002882126.1|  hypothetical protein ARALYDRAFT_904242             139   3e-35   
gb|KFK37505.1|  hypothetical protein AALP_AA4G266100                    139   7e-35   
ref|XP_008784876.1|  PREDICTED: 21 kDa protein-like                     134   2e-33   
ref|XP_006855615.1|  hypothetical protein AMTR_s00044p00081280          128   3e-31   
ref|XP_009118264.1|  PREDICTED: 21 kDa protein-like                     126   2e-30   
ref|NP_182289.1|  pectin methylesterase inhibitor 6                     124   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63611.1|  putative pectinesterase                                 124   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595798.1|  PREDICTED: 21 kDa protein-like                     122   1e-28   
ref|XP_006362112.1|  PREDICTED: 21 kDa protein-like                     120   4e-28   
ref|XP_004234936.1|  PREDICTED: 21 kDa protein-like                     120   4e-28   
ref|XP_009779184.1|  PREDICTED: 21 kDa protein-like                     117   3e-27   
ref|XP_007039951.1|  Plant invertase/pectin methylesterase inhibi...    117   5e-27   
ref|XP_004298672.1|  PREDICTED: 21 kDa protein-like                     116   5e-27   
ref|XP_006440385.1|  hypothetical protein CICLE_v10023344mg             113   8e-26   
ref|XP_008238630.1|  PREDICTED: 21 kDa protein                          112   1e-25   
ref|XP_007039937.1|  Plant invertase/pectin methylesterase inhibi...    112   1e-25   
ref|XP_004503384.1|  PREDICTED: 21 kDa protein-like                     113   2e-25   
ref|XP_002264799.1|  PREDICTED: 21 kDa protein-like                     112   2e-25   Vitis vinifera
gb|ABK22631.1|  unknown                                                 112   2e-25   Picea sitchensis
gb|KDP22408.1|  hypothetical protein JCGZ_26239                         111   3e-25   
ref|XP_006362111.1|  PREDICTED: 21 kDa protein-like isoform X2          111   3e-25   
ref|XP_002312451.2|  hypothetical protein POPTR_0008s13190g             111   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008389193.1|  PREDICTED: 21 kDa protein-like                     111   4e-25   
ref|XP_006362110.1|  PREDICTED: 21 kDa protein-like isoform X1          111   5e-25   
emb|CDP05319.1|  unnamed protein product                                111   5e-25   
ref|XP_002264167.1|  PREDICTED: 21 kDa protein                          110   6e-25   Vitis vinifera
ref|XP_010035020.1|  PREDICTED: 21 kDa protein-like                     111   7e-25   
ref|XP_004136168.1|  PREDICTED: 21 kDa protein-like                     109   8e-25   
ref|XP_002314795.2|  hypothetical protein POPTR_0010s11950g             111   8e-25   Populus trichocarpa [western balsam poplar]
ref|XP_002284784.1|  PREDICTED: 21 kDa protein                          110   1e-24   Vitis vinifera
ref|XP_006367638.1|  PREDICTED: 21 kDa protein-like                     109   1e-24   
ref|XP_009385222.1|  PREDICTED: 21 kDa protein-like                     109   1e-24   
gb|ABG49144.1|  pectin methylesterase inhibitor isoform                 109   1e-24   Solanum phureja [chaucha]
ref|XP_006490092.1|  PREDICTED: 21 kDa protein-like                     109   2e-24   
ref|XP_006440386.1|  hypothetical protein CICLE_v10022313mg             109   3e-24   
gb|KDO65436.1|  hypothetical protein CISIN_1g028434mg                   109   3e-24   
ref|XP_006421708.1|  hypothetical protein CICLE_v10007178mg             109   3e-24   
ref|XP_006838616.1|  hypothetical protein AMTR_s00002p00229990          108   3e-24   
gb|KDP25617.1|  hypothetical protein JCGZ_20773                         108   4e-24   
ref|XP_009594970.1|  PREDICTED: 21 kDa protein-like                     108   4e-24   
ref|XP_009351520.1|  PREDICTED: 21 kDa protein-like                     108   4e-24   
ref|XP_009779202.1|  PREDICTED: 21 kDa protein-like                     108   5e-24   
ref|XP_006367807.1|  PREDICTED: 21 kDa protein-like                     108   5e-24   
emb|CDX87244.1|  BnaC09g05590D                                          108   5e-24   
ref|XP_010259038.1|  PREDICTED: 21 kDa protein-like                     108   5e-24   
ref|XP_002263991.1|  PREDICTED: 21 kDa protein                          108   6e-24   Vitis vinifera
ref|XP_010919458.1|  PREDICTED: 21 kDa protein                          108   7e-24   
emb|CAN70288.1|  hypothetical protein VITISV_015784                     107   8e-24   Vitis vinifera
emb|CBA10126.1|  PME inhibitor                                          107   9e-24   Nicotiana benthamiana
ref|XP_010473498.1|  PREDICTED: 21 kDa protein-like                     108   1e-23   
ref|XP_011070592.1|  PREDICTED: 21 kDa protein-like                     107   1e-23   
ref|XP_007209621.1|  hypothetical protein PRUPE_ppa011699mg             107   1e-23   
ref|XP_010062118.1|  PREDICTED: 21 kDa protein-like                     107   1e-23   
ref|XP_002510934.1|  21 kDa protein precursor, putative                 106   2e-23   Ricinus communis
ref|XP_006826919.1|  hypothetical protein AMTR_s00010p00168350          106   2e-23   
ref|XP_007225804.1|  hypothetical protein PRUPE_ppa011318mg             107   2e-23   
ref|XP_006381574.1|  hypothetical protein POPTR_0006s14010g             106   2e-23   
ref|XP_007160400.1|  hypothetical protein PHAVU_002G318700g             107   2e-23   
gb|ABK22757.1|  unknown                                                 106   2e-23   Picea sitchensis
ref|XP_009779211.1|  PREDICTED: 21 kDa protein-like                     106   2e-23   
gb|ACN40648.1|  unknown                                                 106   2e-23   Picea sitchensis
gb|ABG47806.1|  pectin methlyesterase inhibitor protein 1               106   2e-23   Capsicum annuum
gb|KFK27963.1|  hypothetical protein AALP_AA8G454300                    106   2e-23   
gb|KEH32318.1|  plant invertase/pectin methylesterase inhibitor         106   3e-23   
ref|XP_003530773.1|  PREDICTED: 21 kDa protein-like                     106   3e-23   
gb|KEH21383.1|  plant invertase/pectin methylesterase inhibitor         106   4e-23   
ref|XP_010259039.1|  PREDICTED: 21 kDa protein-like                     105   4e-23   
gb|KFK40568.1|  hypothetical protein AALP_AA2G013000                    105   5e-23   
gb|EYU24972.1|  hypothetical protein MIMGU_mgv1a023170mg                105   5e-23   
ref|NP_176463.2|  plant invertase/pectin methylesterase inhibitor...    107   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009362111.1|  PREDICTED: 21 kDa protein-like                     105   5e-23   
ref|XP_009597893.1|  PREDICTED: 21 kDa protein-like                     105   6e-23   
ref|XP_011038600.1|  PREDICTED: 21 kDa protein-like                     105   6e-23   
ref|XP_003590138.1|  Pectinesterase inhibitor                           105   7e-23   
ref|XP_008791710.1|  PREDICTED: 21 kDa protein                          105   7e-23   
gb|AFK34211.1|  unknown                                                 105   8e-23   
ref|XP_009112019.1|  PREDICTED: 21 kDa protein-like                     104   9e-23   
gb|AFK49039.1|  unknown                                                 104   1e-22   
emb|CDX86901.1|  BnaC03g51710D                                          104   1e-22   
ref|XP_006826916.1|  hypothetical protein AMTR_s00010p00166600          104   1e-22   
ref|XP_009401795.1|  PREDICTED: 21 kDa protein-like                     104   1e-22   
ref|XP_010418274.1|  PREDICTED: 21 kDa protein-like                     105   1e-22   
ref|XP_006385730.1|  hypothetical protein POPTR_0003s11310g             103   1e-22   
ref|XP_004234934.1|  PREDICTED: 21 kDa protein-like                     103   1e-22   
ref|XP_010553774.1|  PREDICTED: 21 kDa protein                          104   2e-22   
ref|XP_002886456.1|  hypothetical protein ARALYDRAFT_893206             103   2e-22   
ref|XP_006421706.1|  hypothetical protein CICLE_v10005926mg             103   2e-22   
ref|XP_006490094.1|  PREDICTED: 21 kDa protein-like                     104   2e-22   
ref|XP_003635233.1|  PREDICTED: 21 kDa protein-like                     103   2e-22   
ref|XP_002264028.1|  PREDICTED: 21 kDa protein                          103   2e-22   Vitis vinifera
gb|AFK35257.1|  unknown                                                 103   2e-22   
gb|AAX20046.1|  DC1.2-like                                              103   2e-22   Capsicum annuum
ref|XP_006394407.1|  hypothetical protein EUTSA_v10004950mg             103   2e-22   
ref|XP_009370483.1|  PREDICTED: 21 kDa protein-like                     103   2e-22   
ref|XP_007045219.1|  Plant invertase/pectin methylesterase inhibi...    105   2e-22   
emb|CDY31839.1|  BnaC09g13100D                                          103   2e-22   
ref|XP_009372896.1|  PREDICTED: 21 kDa protein-like                     103   3e-22   
ref|XP_007012560.1|  Plant invertase/pectin methylesterase inhibi...    102   3e-22   
ref|XP_002322403.1|  ripening-related family protein                    103   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010264195.1|  PREDICTED: 21 kDa protein-like                     103   3e-22   
ref|XP_009151355.1|  PREDICTED: 21 kDa protein                          102   4e-22   
ref|XP_010261745.1|  PREDICTED: 21 kDa protein-like                     102   5e-22   
ref|XP_010933727.1|  PREDICTED: 21 kDa protein                          102   6e-22   
ref|XP_010483948.1|  PREDICTED: 21 kDa protein-like isoform X1          102   6e-22   
ref|XP_004506603.1|  PREDICTED: 21 kDa protein-like                     102   6e-22   
gb|KFK33383.1|  hypothetical protein AALP_AA5G006000                    102   6e-22   
ref|XP_011076332.1|  PREDICTED: 21 kDa protein                          102   6e-22   
gb|KDP22409.1|  hypothetical protein JCGZ_26240                         102   7e-22   
ref|XP_002304431.2|  hypothetical protein POPTR_0003s20640g             102   7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011023856.1|  PREDICTED: 21 kDa protein-like                     102   8e-22   
ref|XP_002264101.1|  PREDICTED: 21 kDa protein-like                     102   8e-22   Vitis vinifera
ref|XP_002263715.1|  PREDICTED: 21 kDa protein                          102   9e-22   Vitis vinifera
gb|KDP22406.1|  hypothetical protein JCGZ_26237                         101   9e-22   
ref|XP_004234935.1|  PREDICTED: 21 kDa protein-like                     102   9e-22   
ref|XP_010101980.1|  21 kDa protein                                     102   1e-21   
ref|XP_004307823.1|  PREDICTED: 21 kDa protein-like                     101   1e-21   
ref|XP_008242280.1|  PREDICTED: 21 kDa protein                          101   1e-21   
emb|CDY46918.1|  BnaA09g12760D                                          101   1e-21   
ref|XP_009611479.1|  PREDICTED: 21 kDa protein-like                     102   1e-21   
ref|XP_010264194.1|  PREDICTED: 21 kDa protein-like                     101   1e-21   
ref|XP_010458855.1|  PREDICTED: 21 kDa protein-like                     101   2e-21   
ref|XP_008387667.1|  PREDICTED: 21 kDa protein-like                     101   2e-21   
ref|XP_007038418.1|  DC1.2-like, putative                               101   2e-21   
gb|ABY81888.1|  pectin methylesterase inhibitor-like protein            101   2e-21   Capsicum annuum
gb|KEH29361.1|  plant invertase/pectin methylesterase inhibitor         101   2e-21   
ref|XP_009374503.1|  PREDICTED: 21 kDa protein-like                     101   2e-21   
gb|AFK44781.1|  unknown                                                 101   2e-21   
ref|XP_006349456.1|  PREDICTED: 21 kDa protein-like                     101   2e-21   
ref|XP_010550579.1|  PREDICTED: 21 kDa protein                          100   2e-21   
gb|KDP33962.1|  hypothetical protein JCGZ_07533                         100   2e-21   
ref|XP_008364822.1|  PREDICTED: 21 kDa protein-like                     101   2e-21   
ref|XP_009148876.1|  PREDICTED: 21 kDa protein-like                     100   2e-21   
ref|XP_006490093.1|  PREDICTED: 21 kDa protein-like                     100   2e-21   
ref|XP_007039938.1|  Plant invertase/pectin methylesterase inhibi...    100   2e-21   
emb|CDY00279.1|  BnaA06g21800D                                          100   2e-21   
gb|KDP38091.1|  hypothetical protein JCGZ_04734                         100   2e-21   
ref|XP_010273892.1|  PREDICTED: 21 kDa protein-like                     100   2e-21   
ref|XP_006357906.1|  PREDICTED: 21 kDa protein-like                     100   2e-21   
ref|XP_011039933.1|  PREDICTED: 21 kDa protein                          100   2e-21   
ref|XP_009801663.1|  PREDICTED: 21 kDa protein-like                     101   3e-21   
ref|XP_010444081.1|  PREDICTED: 21 kDa protein-like                     100   3e-21   
ref|XP_009370484.1|  PREDICTED: 21 kDa protein-like                     100   3e-21   
emb|CDP00817.1|  unnamed protein product                                101   3e-21   
ref|XP_004307821.1|  PREDICTED: 21 kDa protein-like                     100   3e-21   
ref|XP_003525240.1|  PREDICTED: 21 kDa protein-like                     100   3e-21   
ref|XP_010424933.1|  PREDICTED: 21 kDa protein-like                     100   3e-21   
ref|XP_002516226.1|  21 kDa protein precursor, putative                 101   3e-21   Ricinus communis
ref|XP_010264393.1|  PREDICTED: 21 kDa protein-like                     100   4e-21   
ref|XP_006281048.1|  hypothetical protein CARUB_v10027064mg             100   4e-21   
ref|XP_009113052.1|  PREDICTED: 21 kDa protein                          100   4e-21   
gb|AFK47771.1|  unknown                                                 100   4e-21   
ref|XP_004249077.1|  PREDICTED: 21 kDa protein-like                     100   5e-21   
ref|XP_002276089.1|  PREDICTED: 21 kDa protein                        99.4    5e-21   Vitis vinifera
ref|XP_011033917.1|  PREDICTED: 21 kDa protein-like                   99.8    6e-21   
ref|XP_002890079.1|  invertase/pectin methylesterase inhibitor fa...  99.8    6e-21   
ref|XP_011075388.1|  PREDICTED: 21 kDa protein-like                   99.4    6e-21   
ref|XP_002867618.1|  invertase/pectin methylesterase inhibitor fa...  99.8    6e-21   
ref|XP_006395872.1|  hypothetical protein EUTSA_v10004939mg           99.8    6e-21   
ref|XP_010264193.1|  PREDICTED: 21 kDa protein-like                   99.8    6e-21   
gb|KDO65437.1|  hypothetical protein CISIN_1g029238mg                 99.4    6e-21   
gb|KDP25618.1|  hypothetical protein JCGZ_20774                       99.4    7e-21   
gb|KHN32444.1|  21 kDa protein                                        99.4    8e-21   
gb|AFK37116.1|  unknown                                               99.4    8e-21   
ref|XP_009372897.1|  PREDICTED: 21 kDa protein-like                   99.0    9e-21   
ref|XP_002322405.2|  ripening-related family protein                  99.0    9e-21   Populus trichocarpa [western balsam poplar]
ref|XP_006421715.1|  hypothetical protein CICLE_v10005928mg           99.0    1e-20   
ref|XP_008796852.1|  PREDICTED: 21 kDa protein-like                   99.4    1e-20   
gb|KDP25616.1|  hypothetical protein JCGZ_20772                       99.0    1e-20   
gb|KGN54954.1|  hypothetical protein Csa_4G615740                     97.4    1e-20   
ref|XP_009618650.1|  PREDICTED: 21 kDa protein-like                   98.6    1e-20   
ref|XP_006421707.1|  hypothetical protein CICLE_v10005946mg           99.0    1e-20   
ref|XP_002510935.1|  21 kDa protein precursor, putative               99.0    1e-20   Ricinus communis
gb|KDO65431.1|  hypothetical protein CISIN_1g029020mg                 99.0    1e-20   
ref|XP_010502142.1|  PREDICTED: 21 kDa protein-like                   99.4    1e-20   
ref|XP_002527780.1|  21 kDa protein precursor, putative               99.0    1e-20   Ricinus communis
ref|XP_010553474.1|  PREDICTED: 21 kDa protein-like                   99.0    1e-20   
emb|CDP05320.1|  unnamed protein product                              98.6    1e-20   
ref|XP_006353777.1|  PREDICTED: 21 kDa protein-like                   98.2    1e-20   
ref|XP_010271276.1|  PREDICTED: 21 kDa protein-like                   98.6    1e-20   
ref|XP_010513891.1|  PREDICTED: 21 kDa protein-like                   99.0    2e-20   
sp|P17407.1|21KD_DAUCA  RecName: Full=21 kDa protein; AltName: Fu...  98.2    2e-20   Daucus carota [carrots]
ref|XP_006362121.1|  PREDICTED: 21 kDa protein-like                   98.6    2e-20   
ref|XP_003541070.2|  PREDICTED: 21 kDa protein-like                   99.4    2e-20   
ref|XP_009796710.1|  PREDICTED: 21 kDa protein-like                   97.8    2e-20   
ref|XP_011010939.1|  PREDICTED: 21 kDa protein-like                   98.2    2e-20   
ref|XP_010091300.1|  21 kDa protein                                   98.2    2e-20   
gb|ACU13418.1|  unknown                                               98.2    2e-20   Glycine max [soybeans]
ref|XP_009608759.1|  PREDICTED: 21 kDa protein-like                   98.2    2e-20   
ref|XP_002263511.1|  PREDICTED: 21 kDa protein                        98.2    2e-20   Vitis vinifera
emb|CAN79278.1|  hypothetical protein VITISV_005236                   98.2    2e-20   Vitis vinifera
ref|XP_011029961.1|  PREDICTED: 21 kDa protein                        97.8    2e-20   
emb|CDY17457.1|  BnaC09g20800D                                        97.8    3e-20   
ref|XP_002280585.1|  PREDICTED: 21 kDa protein                        97.8    3e-20   Vitis vinifera
gb|ABS01356.1|  unknown                                               97.4    3e-20   Carica papaya [mamon]
ref|XP_009595722.1|  PREDICTED: 21 kDa protein-like                   98.2    3e-20   
emb|CDY09429.1|  BnaA02g25810D                                        97.8    3e-20   
ref|XP_010552689.1|  PREDICTED: 21 kDa protein-like                   97.4    3e-20   
emb|CDX83999.1|  BnaC08g16460D                                        97.4    3e-20   
ref|XP_010259198.1|  PREDICTED: 21 kDa protein-like                   97.8    3e-20   
gb|EYU33115.1|  hypothetical protein MIMGU_mgv1a026685mg              97.4    3e-20   
ref|XP_002509585.1|  21 kDa protein precursor, putative               97.4    3e-20   Ricinus communis
ref|XP_002876765.1|  invertase/pectin methylesterase inhibitor fa...  97.8    4e-20   
ref|XP_007131335.1|  hypothetical protein PHAVU_011G005200g           97.4    4e-20   
ref|XP_004243686.1|  PREDICTED: 21 kDa protein                        97.1    4e-20   
ref|NP_178270.1|  invertase/pectin methylesterase inhibitor-like ...  97.8    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292770.1|  hypothetical protein CARUB_v10019019mg           97.8    4e-20   
ref|XP_010438899.1|  PREDICTED: 21 kDa protein-like                   97.1    4e-20   
ref|NP_001236761.1|  uncharacterized protein LOC100305537 precursor   97.4    4e-20   
ref|XP_006448207.1|  hypothetical protein CICLE_v10016684mg           97.4    5e-20   
ref|XP_006469216.1|  PREDICTED: 21 kDa protein-like                   97.4    5e-20   
ref|XP_009767771.1|  PREDICTED: 21 kDa protein                        97.1    5e-20   
ref|XP_011101127.1|  PREDICTED: 21 kDa protein-like                   97.1    5e-20   
ref|XP_008376261.1|  PREDICTED: 21 kDa protein                        96.7    5e-20   
ref|NP_001238450.1|  uncharacterized protein LOC100305900 precursor   96.7    5e-20   
ref|XP_003598239.1|  21 kDa protein                                   96.7    5e-20   
ref|XP_008234382.1|  PREDICTED: 21 kDa protein                        96.7    6e-20   
ref|XP_006305566.1|  hypothetical protein CARUB_v10010160mg           97.8    6e-20   
emb|CDP09903.1|  unnamed protein product                              97.1    6e-20   
gb|KFK29033.1|  hypothetical protein AALP_AA7G080100                  96.7    6e-20   
gb|AAF79226.1|AC006917_11  F10B6.30                                   96.7    6e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32950.1|  hypothetical protein AALP_AA6G310500                  96.7    6e-20   
emb|CAA72315.1|  putative 21kD protein precursor                      96.3    6e-20   Medicago sativa [alfalfa]
ref|XP_009110513.1|  PREDICTED: 21 kDa protein-like                   96.7    7e-20   
ref|XP_002318880.1|  invertase/pectin methylesterase inhibitor fa...  96.7    7e-20   Populus trichocarpa [western balsam poplar]
gb|KFK40567.1|  hypothetical protein AALP_AA2G012900                  96.7    7e-20   
ref|XP_009370516.1|  PREDICTED: 21 kDa protein-like                   96.7    7e-20   
ref|XP_011041730.1|  PREDICTED: 21 kDa protein-like                   96.7    8e-20   
ref|XP_006477257.1|  PREDICTED: 21 kDa protein-like                   96.7    8e-20   
ref|XP_009610995.1|  PREDICTED: 21 kDa protein                        96.7    9e-20   
ref|NP_563960.2|  plant invertase/pectin methylesterase inhibitor...  96.7    9e-20   
ref|XP_002864788.1|  invertase/pectin methylesterase inhibitor fa...  96.3    9e-20   
gb|AAM67138.1|  ripening-related protein-like                         96.3    9e-20   
ref|XP_006416112.1|  hypothetical protein EUTSA_v10008638mg           97.1    1e-19   
ref|XP_002321835.2|  hypothetical protein POPTR_0015s14670g           96.3    1e-19   
ref|XP_009129219.1|  PREDICTED: 21 kDa protein-like                   96.3    1e-19   
emb|CDY48809.1|  BnaC02g34050D                                        96.3    1e-19   
ref|XP_006421710.1|  hypothetical protein CICLE_v10005968mg           95.9    1e-19   
ref|XP_007131336.1|  hypothetical protein PHAVU_011G005300g           95.9    1e-19   
gb|ABK21023.1|  unknown                                               96.3    1e-19   
emb|CDX89429.1|  BnaA01g14640D                                        95.9    1e-19   
ref|XP_008221461.1|  PREDICTED: 21 kDa protein-like                   97.1    1e-19   
ref|XP_010430352.1|  PREDICTED: 21 kDa protein-like                   97.1    1e-19   
emb|CDY52024.1|  BnaA08g31370D                                        95.9    1e-19   
ref|XP_007220475.1|  hypothetical protein PRUPE_ppa011831mg           95.5    2e-19   
emb|CDY04097.1|  BnaA09g18750D                                        95.5    2e-19   
emb|CDX86904.1|  BnaC03g51740D                                        95.5    2e-19   
emb|CDY31841.1|  BnaC09g13080D                                        95.5    2e-19   
ref|XP_010093661.1|  21 kDa protein                                   95.9    2e-19   
ref|XP_008366993.1|  PREDICTED: 21 kDa protein-like                   95.5    2e-19   
ref|XP_010433659.1|  PREDICTED: 21 kDa protein-like                   95.5    2e-19   
ref|XP_009114225.1|  PREDICTED: 21 kDa protein-like                   95.5    2e-19   
ref|XP_009603391.1|  PREDICTED: 21 kDa protein-like                   95.1    2e-19   
ref|XP_004147584.1|  PREDICTED: 21 kDa protein-like                   95.1    2e-19   
ref|XP_002510932.1|  21 kDa protein precursor, putative               95.1    2e-19   
emb|CDX94463.1|  BnaC01g17210D                                        95.1    2e-19   
gb|AIT42255.1|  pectinmethylesterase inhibitor                        95.1    2e-19   
ref|NP_201042.2|  plant invertase/pectin methylesterase inhibitor...  95.1    2e-19   
ref|XP_009362113.1|  PREDICTED: 21 kDa protein-like                   95.1    2e-19   
ref|XP_010444080.1|  PREDICTED: 21 kDa protein-like                   95.1    3e-19   
ref|XP_004297460.1|  PREDICTED: 21 kDa protein-like                   95.1    3e-19   
ref|XP_002864786.1|  hypothetical protein ARALYDRAFT_496412           95.1    3e-19   
ref|XP_006416961.1|  hypothetical protein EUTSA_v10008807mg           95.1    3e-19   
ref|XP_009113050.1|  PREDICTED: 21 kDa protein                        95.1    3e-19   
ref|NP_201041.1|  plant invertase/pectin methylesterase inhibitor...  94.7    3e-19   
ref|XP_008366992.1|  PREDICTED: 21 kDa protein-like                   95.1    3e-19   
ref|XP_009151354.1|  PREDICTED: 21 kDa protein                        95.1    3e-19   
ref|XP_010533759.1|  PREDICTED: 21 kDa protein-like                   95.1    3e-19   
ref|XP_010458832.1|  PREDICTED: 21 kDa protein-like                   94.7    3e-19   
gb|AAN60276.1|  unknown                                               94.7    3e-19   
ref|XP_009374505.1|  PREDICTED: 21 kDa protein                        94.7    3e-19   
ref|XP_004309057.1|  PREDICTED: 21 kDa protein-like                   94.4    3e-19   
ref|XP_008784634.1|  PREDICTED: 21 kDa protein-like                   94.7    3e-19   
ref|XP_006368687.1|  invertase/pectin methylesterase inhibitor fa...  94.7    4e-19   
ref|XP_008376217.1|  PREDICTED: 21 kDa protein-like                   94.7    4e-19   
ref|XP_006490090.1|  PREDICTED: 21 kDa protein-like                   94.4    4e-19   
ref|XP_006302816.1|  hypothetical protein CARUB_v10020941mg           94.7    4e-19   
emb|CAN77093.1|  hypothetical protein VITISV_026597                   94.7    4e-19   
ref|XP_010483947.1|  PREDICTED: 21 kDa protein-like                   94.4    4e-19   
gb|AAM63352.1|  unknown                                               94.4    4e-19   
ref|XP_010089668.1|  21 kDa protein                                   94.4    5e-19   
gb|AGJ76633.1|  PMEI/InvI                                             94.4    5e-19   
ref|XP_003534960.1|  PREDICTED: 21 kDa protein-like                   94.7    5e-19   
gb|EYU43527.1|  hypothetical protein MIMGU_mgv1a024700mg              94.0    5e-19   
ref|XP_010476566.1|  PREDICTED: 21 kDa protein-like                   94.4    5e-19   
ref|XP_002264891.1|  PREDICTED: 21 kDa protein                        94.4    5e-19   
emb|CDY46921.1|  BnaA09g12730D                                        94.4    5e-19   
ref|XP_006421712.1|  hypothetical protein CICLE_v10007113mg           94.0    5e-19   
ref|XP_002887326.1|  hypothetical protein ARALYDRAFT_476202           94.0    5e-19   
ref|XP_008437134.1|  PREDICTED: 21 kDa protein-like                   94.0    5e-19   
ref|XP_007039952.1|  Plant invertase/pectin methylesterase inhibi...  94.4    5e-19   
ref|XP_009799203.1|  PREDICTED: pectinesterase 1-like                 97.4    5e-19   
ref|XP_009767669.1|  PREDICTED: 21 kDa protein                        94.4    6e-19   
ref|XP_010266694.1|  PREDICTED: 21 kDa protein-like                   94.4    6e-19   
ref|XP_010035021.1|  PREDICTED: 21 kDa protein-like                   94.0    6e-19   
ref|XP_011018248.1|  PREDICTED: 21 kDa protein                        94.0    7e-19   
gb|AIT42253.1|  pectinmethylesterase inhibitor                        93.6    7e-19   
ref|XP_004234937.1|  PREDICTED: 21 kDa protein-like                   93.6    7e-19   
ref|XP_010093663.1|  21 kDa protein                                   94.4    7e-19   
ref|XP_008467116.1|  PREDICTED: 21 kDa protein                        94.0    8e-19   
ref|XP_004307822.1|  PREDICTED: 21 kDa protein-like                   93.6    8e-19   
ref|XP_004240754.1|  PREDICTED: 21 kDa protein-like                   93.2    9e-19   
ref|XP_006281134.1|  hypothetical protein CARUB_v10027165mg           93.6    9e-19   
ref|NP_001235143.1|  uncharacterized protein LOC100527116 precursor   93.6    1e-18   
ref|XP_010459004.1|  PREDICTED: 21 kDa protein-like                   93.6    1e-18   
ref|XP_004150119.1|  PREDICTED: 21 kDa protein-like                   93.6    1e-18   
emb|CDP05316.1|  unnamed protein product                              93.2    1e-18   
ref|XP_008391723.1|  PREDICTED: 21 kDa protein-like                   93.2    1e-18   
gb|KGN57276.1|  hypothetical protein Csa_3G176245                     93.2    1e-18   
ref|XP_009139088.1|  PREDICTED: 21 kDa protein                        93.2    1e-18   
ref|XP_007038423.1|  Plant invertase/pectin methylesterase inhibi...  94.0    1e-18   
ref|XP_010066596.1|  PREDICTED: 21 kDa protein                        93.6    1e-18   
ref|XP_010471074.1|  PREDICTED: 21 kDa protein-like                   93.2    1e-18   
ref|XP_010418275.1|  PREDICTED: 21 kDa protein-like                   93.2    1e-18   
ref|NP_197574.1|  plant invertase/pectin methylesterase inhibitor...  93.2    1e-18   
ref|XP_008238631.1|  PREDICTED: 21 kDa protein                        93.2    1e-18   
ref|XP_010473499.1|  PREDICTED: 21 kDa protein-like                   93.2    1e-18   
gb|AFK45022.1|  unknown                                               92.8    1e-18   
ref|XP_010496621.1|  PREDICTED: 21 kDa protein-like                   93.6    2e-18   
ref|XP_004297461.1|  PREDICTED: 21 kDa protein-like                   92.8    2e-18   
ref|XP_004148138.1|  PREDICTED: 21 kDa protein-like                   92.8    2e-18   
ref|XP_010062095.1|  PREDICTED: 21 kDa protein-like                   92.8    2e-18   
ref|XP_004499663.1|  PREDICTED: 21 kDa protein-like                   92.4    2e-18   
ref|XP_006362116.1|  PREDICTED: 21 kDa protein-like                   92.4    2e-18   
ref|XP_006391825.1|  hypothetical protein EUTSA_v10023696mg           92.8    2e-18   
gb|AIT42252.1|  pectinmethylesterase inhibitor                        92.4    2e-18   
ref|XP_011010938.1|  PREDICTED: 21 kDa protein-like                   92.8    2e-18   
ref|XP_008376226.1|  PREDICTED: 21 kDa protein-like                   92.4    2e-18   
ref|XP_008369524.1|  PREDICTED: 21 kDa protein                        92.8    2e-18   
emb|CBI24572.3|  unnamed protein product                              92.0    2e-18   
gb|EPS64095.1|  hypothetical protein M569_10687                       91.3    2e-18   
ref|XP_004160872.1|  PREDICTED: 21 kDa protein-like                   92.4    2e-18   
ref|XP_009587354.1|  PREDICTED: 21 kDa protein-like                   92.0    2e-18   
ref|NP_564802.1|  plant invertase/pectin methylesterase inhibitor...  92.4    2e-18   
gb|ABK96280.1|  unknown                                               92.0    2e-18   
ref|XP_004147611.1|  PREDICTED: 21 kDa protein-like                   92.4    3e-18   
ref|XP_010430353.1|  PREDICTED: 21 kDa protein-like                   92.4    3e-18   
ref|XP_006355502.1|  PREDICTED: 21 kDa protein-like                   92.4    3e-18   
gb|AAM67063.1|  putative ripening-related protein                     92.4    3e-18   
ref|XP_011010937.1|  PREDICTED: 21 kDa protein-like isoform X2        91.7    3e-18   
ref|XP_003546521.1|  PREDICTED: 21 kDa protein                        92.4    3e-18   
ref|XP_002322406.1|  21K protein precursor                            92.0    3e-18   
ref|NP_001268141.1|  ripening-related protein-like precursor          92.0    3e-18   
gb|AAM62905.1|  ripening-related protein-like                         92.0    3e-18   
gb|ACE97307.1|  pectinesterase inhibitor                              91.3    4e-18   
ref|XP_004148136.1|  PREDICTED: 21 kDa protein-like                   91.7    4e-18   
ref|XP_004148163.1|  PREDICTED: 21 kDa protein-like                   91.3    4e-18   
ref|XP_011041732.1|  PREDICTED: 21 kDa protein-like                   92.0    4e-18   
ref|XP_004162668.1|  PREDICTED: 21 kDa protein-like                   92.4    4e-18   
ref|NP_194256.1|  plant invertase/pectin methylesterase inhibitor...  91.7    4e-18   
gb|ACJ83861.1|  unknown                                               91.3    4e-18   
gb|AFK45126.1|  unknown                                               91.7    4e-18   
ref|XP_008439100.1|  PREDICTED: 21 kDa protein-like                   91.3    4e-18   
ref|XP_011010936.1|  PREDICTED: 21 kDa protein-like isoform X1        91.3    5e-18   
ref|XP_002872657.1|  invertase/pectin methylesterase inhibitor fa...  91.7    5e-18   
ref|XP_010415758.1|  PREDICTED: 21 kDa protein-like                   91.7    5e-18   
gb|EYU24974.1|  hypothetical protein MIMGU_mgv1a014119mg              91.7    5e-18   
ref|XP_010681916.1|  PREDICTED: 21 kDa protein-like                   91.7    5e-18   
ref|XP_003611258.1|  Pectinesterase                                   91.7    5e-18   
ref|XP_002874013.1|  hypothetical protein ARALYDRAFT_488983           91.3    6e-18   
ref|XP_006440387.1|  hypothetical protein CICLE_v10022285mg           91.3    6e-18   
ref|XP_011041731.1|  PREDICTED: 21 kDa protein-like                   91.3    6e-18   
ref|XP_006413324.1|  hypothetical protein EUTSA_v10027588mg           91.3    6e-18   
ref|XP_006301230.1|  hypothetical protein CARUB_v10021629mg           91.3    6e-18   
ref|XP_003598238.1|  21 kDa protein                                   90.9    7e-18   
ref|XP_002886455.1|  hypothetical protein ARALYDRAFT_475076           91.3    7e-18   
gb|ACJ83345.1|  unknown                                               90.9    7e-18   
gb|ACE97291.1|  pectinesterase inhibitor                              90.5    7e-18   
ref|XP_006843218.1|  hypothetical protein AMTR_s00080p00031010        90.9    7e-18   
ref|XP_004287664.1|  PREDICTED: 21 kDa protein-like                   90.9    7e-18   
ref|XP_007210220.1|  hypothetical protein PRUPE_ppa015829mg           91.3    8e-18   
ref|XP_004511656.1|  PREDICTED: 21 kDa protein-like                   90.9    8e-18   
gb|KGN57274.1|  hypothetical protein Csa_3G175740                     91.7    8e-18   
ref|XP_002322404.2|  ripening-related family protein                  90.5    9e-18   
gb|ADE76337.1|  unknown                                               90.9    9e-18   
ref|XP_010493188.1|  PREDICTED: 21 kDa protein-like                   90.9    9e-18   
ref|XP_010431474.1|  PREDICTED: 21 kDa protein-like                   90.1    1e-17   
gb|AIT42251.1|  pectinmethylesterase inhibitor                        90.5    1e-17   
ref|XP_009393953.1|  PREDICTED: 21 kDa protein-like                   90.5    1e-17   
gb|KFK32788.1|  hypothetical protein AALP_AA6G288400                  90.5    1e-17   
ref|XP_010454384.1|  PREDICTED: 21 kDa protein-like                   90.5    1e-17   
ref|XP_011010940.1|  PREDICTED: 21 kDa protein-like                   90.5    1e-17   
gb|AES90968.2|  plant invertase/pectin methylesterase inhibitor       90.5    1e-17   
emb|CDY11066.1|  BnaA03g47250D                                        90.1    1e-17   
ref|XP_011010941.1|  PREDICTED: 21 kDa protein-like                   90.1    1e-17   
ref|XP_009370481.1|  PREDICTED: 21 kDa protein-like                   90.1    2e-17   
ref|XP_007151983.1|  hypothetical protein PHAVU_004G091900g           90.1    2e-17   
ref|XP_006288672.1|  hypothetical protein CARUB_v10001980mg           90.1    2e-17   
ref|XP_010427856.1|  PREDICTED: 21 kDa protein-like                   90.1    2e-17   
ref|XP_009392885.1|  PREDICTED: 21 kDa protein-like                   89.7    2e-17   
gb|AAG52326.1|AC011663_5  hypothetical protein; 38154-37561           89.7    2e-17   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                 94.4    2e-17   
ref|NP_564998.1|  plant invertase/pectin methylesterase inhibitor...  89.7    2e-17   
gb|KCW86259.1|  hypothetical protein EUGRSUZ_B02943                   89.7    2e-17   
gb|ACE97308.1|  pectinesterase inhibitor                              89.4    2e-17   
ref|XP_010555621.1|  PREDICTED: 21 kDa protein                        89.7    2e-17   
ref|XP_006284547.1|  hypothetical protein CARUB_v10005764mg           89.7    2e-17   
ref|XP_008357027.1|  PREDICTED: 21 kDa protein-like                   89.7    2e-17   
ref|XP_010646817.1|  PREDICTED: 21 kDa protein                        89.7    2e-17   
gb|ABK28461.1|  unknown                                               89.7    2e-17   
gb|KFK42156.1|  hypothetical protein AALP_AA2G218600                  89.7    2e-17   
ref|XP_010044213.1|  PREDICTED: 21 kDa protein-like                   89.7    2e-17   
gb|EYU30100.1|  hypothetical protein MIMGU_mgv1a013865mg              89.7    3e-17   
ref|XP_007039940.1|  Plant invertase/pectin methylesterase inhibi...  89.4    3e-17   
ref|XP_011041729.1|  PREDICTED: 21 kDa protein-like                   89.7    3e-17   
ref|XP_009104942.1|  PREDICTED: 21 kDa protein-like                   89.7    3e-17   
ref|XP_010515044.1|  PREDICTED: 21 kDa protein-like                   89.4    3e-17   
emb|CDX92687.1|  BnaC07g39450D                                        89.4    3e-17   
emb|CDY23485.1|  BnaC06g24540D                                        89.4    3e-17   
emb|CDY30715.1|  BnaA02g33370D                                        89.0    4e-17   
ref|XP_010049367.1|  PREDICTED: 21 kDa protein                        89.4    4e-17   
ref|XP_011076330.1|  PREDICTED: 21 kDa protein-like                   89.0    4e-17   
ref|XP_010919055.1|  PREDICTED: 21 kDa protein-like                   89.0    4e-17   
ref|XP_006826917.1|  hypothetical protein AMTR_s00010p00167000        89.0    4e-17   
ref|XP_009137508.1|  PREDICTED: 21 kDa protein-like                   89.0    4e-17   
ref|XP_010422204.1|  PREDICTED: 21 kDa protein-like                   89.0    4e-17   
ref|XP_009130208.1|  PREDICTED: 21 kDa protein-like                   89.0    4e-17   
ref|XP_010546336.1|  PREDICTED: 21 kDa protein-like                   89.0    5e-17   
gb|KFK27962.1|  hypothetical protein AALP_AA8G453900                  88.6    5e-17   
dbj|BAB17684.1|  DC 1.2 homolog                                       87.8    5e-17   
ref|XP_009115553.1|  PREDICTED: 21 kDa protein                        89.4    5e-17   
ref|XP_010433531.1|  PREDICTED: 21 kDa protein                        88.6    6e-17   
gb|ACE97327.1|  pectinesterase inhibitor                              87.8    6e-17   
ref|XP_009372895.1|  PREDICTED: 21 kDa protein-like                   88.6    6e-17   
ref|XP_010672019.1|  PREDICTED: 21 kDa protein-like                   88.6    6e-17   
emb|CDY34685.1|  BnaC04g19980D                                        88.6    7e-17   
ref|XP_008779098.1|  PREDICTED: 21 kDa protein-like                   88.2    7e-17   
ref|XP_003550896.1|  PREDICTED: 21 kDa protein-like                   88.6    7e-17   
gb|ACJ86212.1|  unknown                                               88.6    7e-17   
ref|XP_010931030.1|  PREDICTED: 21 kDa protein-like                   88.2    8e-17   
ref|XP_010426179.1|  PREDICTED: 21 kDa protein-like                   88.2    8e-17   
gb|AEX13526.1|  hypothetical protein UMN_CL110Contig1_03              85.1    8e-17   
ref|XP_010916195.1|  PREDICTED: 21 kDa protein                        87.8    9e-17   
gb|KDP22407.1|  hypothetical protein JCGZ_26238                       88.2    9e-17   
gb|AAM63827.1|  unknown                                               87.8    1e-16   
ref|XP_009127823.1|  PREDICTED: 21 kDa protein                        87.8    1e-16   
ref|XP_009359704.1|  PREDICTED: 21 kDa protein                        87.8    1e-16   
ref|NP_192976.1|  pectin methylesterase inhibitor 1                   87.8    1e-16   
ref|XP_006291874.1|  hypothetical protein CARUB_v10018051mg           87.4    1e-16   
ref|XP_010455677.1|  PREDICTED: 21 kDa protein-like                   87.8    1e-16   
ref|XP_007138623.1|  hypothetical protein PHAVU_009G224200g           87.8    1e-16   
emb|CDY09473.1|  BnaC02g20150D                                        87.4    1e-16   
ref|XP_007155620.1|  hypothetical protein PHAVU_003G217200g           87.4    1e-16   
gb|AEX13528.1|  hypothetical protein UMN_CL110Contig1_03              84.3    2e-16   
ref|XP_008775434.1|  PREDICTED: 21 kDa protein-like                   87.0    2e-16   
ref|XP_010503338.1|  PREDICTED: 21 kDa protein-like                   87.0    2e-16   



>ref|XP_009615877.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=195

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 155/194 (80%), Gaps = 2/194 (1%)
 Frame = -1

Query  1006  ILWKFMLVLAWIAP-ACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDR  830
             + WKFMLVLAW+    C       GG  YVRDACSVT +QD+C+HSLA FS+ AKN+P +
Sbjct  1     MTWKFMLVLAWVTILICSTTASSKGGESYVRDACSVTRYQDICMHSLASFSSTAKNNPSK  60

Query  829   WARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRK  650
             WARVG+SVT+ Q K +  SL KLK   SL+GR ++AL DC ECF+DALD+LH SLGVLRK
Sbjct  61    WARVGVSVTLSQAKGVTQSLLKLKKHNSLKGRGRVALLDCAECFQDALDNLHNSLGVLRK  120

Query  649   LNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLVNKVTNVSYLTSNALAL  473
             L+++ F  QMGDVTTW+SAALT+EDTCLDGF  + +RK+V+ L+N+VTNVSY+TSNALAL
Sbjct  121   LSSQTFNDQMGDVTTWLSAALTDEDTCLDGFEDQRRRKQVKLLLNRVTNVSYMTSNALAL  180

Query  472   VNKLATTGPQCLHH  431
             VNKLATTGP+CL +
Sbjct  181   VNKLATTGPECLEN  194



>ref|XP_009790824.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=195

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 152/194 (78%), Gaps = 2/194 (1%)
 Frame = -1

Query  1006  ILWKFMLVLAWIAP-ACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDR  830
             + WKFMLVLAW++   C       GG  YVRDACSVT +QDLC+  LA FS+ AKN+P +
Sbjct  1     MTWKFMLVLAWLSTLICLSTASSKGGESYVRDACSVTRYQDLCMRLLASFSSTAKNNPSK  60

Query  829   WARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRK  650
             WAR G+SVTI Q K +  SL KLK   SL+GR ++AL DC EC +DALD+LH SLGVLRK
Sbjct  61    WARAGVSVTISQAKGVTQSLLKLKKHNSLKGRGRVALLDCAECLQDALDNLHNSLGVLRK  120

Query  649   LNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLVNKVTNVSYLTSNALAL  473
             L+++ F  QMGDVTTW+SAALT+EDTCLDGF  + +RK+V+ L+N+VTNVSY+TSNALAL
Sbjct  121   LSSQTFNDQMGDVTTWLSAALTDEDTCLDGFEDQRRRKQVKLLLNRVTNVSYMTSNALAL  180

Query  472   VNKLATTGPQCLHH  431
             VNKLATTGP+CL +
Sbjct  181   VNKLATTGPECLEN  194



>ref|XP_004244511.2| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=194

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -1

Query  994  FMLVLAWIAP-ACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARV  818
             MLVLA +    C       GG  YVRDACSVT +QDLC+HSLA FS  AK++P +WAR 
Sbjct  5    LMLVLACLTSLTCSTMCLSKGGESYVRDACSVTRYQDLCLHSLASFSRTAKDNPSKWARA  64

Query  817  GLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAK  638
            G+SVTI Q K +   L KL+    L+G+S++A+ DCVEC +DALD+LH SLGVLRKL+++
Sbjct  65   GVSVTISQAKGVTQFLLKLRKSNFLKGKSRVAILDCVECLQDALDNLHNSLGVLRKLSSQ  124

Query  637  NFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLA  458
             F  QMGDVTTW+SAALT+EDTCLDG    KRK+V+ L+NKVTNVSY+TSNALALVNKLA
Sbjct  125  AFNDQMGDVTTWLSAALTDEDTCLDGLEDKKRKQVKLLLNKVTNVSYMTSNALALVNKLA  184

Query  457  TTGPQCLHH  431
            TTGPQCL +
Sbjct  185  TTGPQCLEN  193



>ref|XP_006357078.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=194

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = -1

Query  997  KFMLVLAWIAP-ACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWAR  821
            K +LVLA +    C       GG  YVRDACSVT +QDLC+HSLA FS  AK++P +WAR
Sbjct  4    KLILVLACLTSLICSTMCLSKGGESYVRDACSVTRYQDLCLHSLASFSRTAKDNPSKWAR  63

Query  820  VGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA  641
             G+SVTI Q K +  SL KL+    L+G+ ++A+ DCV+C +DALD+LH SLGVLRKL++
Sbjct  64   AGVSVTISQAKGVTQSLLKLRKNNFLKGKGRVAILDCVDCLQDALDNLHNSLGVLRKLSS  123

Query  640  KNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKL  461
            + F  QMGDVTTW+SAALT+EDTCLDG    KRK+V+ L+NKVTNVSY+TSNALALVNKL
Sbjct  124  QTFNDQMGDVTTWLSAALTDEDTCLDGLEDKKRKQVKLLLNKVTNVSYMTSNALALVNKL  183

Query  460  ATTGPQCLHH  431
            ATTGPQCL +
Sbjct  184  ATTGPQCLEN  193



>gb|EYU46665.1| hypothetical protein MIMGU_mgv1a014078mg [Erythranthe guttata]
Length=201

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 140/194 (72%), Gaps = 7/194 (4%)
 Frame = -1

Query  997  KFMLV---LAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRW  827
            KF++V   LA +  +C           YVRDACSVT ++DLC+HSLAPFSN AK +P RW
Sbjct  5    KFVIVPMLLACLIFSCSSTSQDENESGYVRDACSVTRYRDLCVHSLAPFSNTAKRNPIRW  64

Query  826  ARVGLSVTIRQVKAIAgslsklks----qgsLRGRSQIALGDCVECFEDALDSLHRSLGV  659
            AR G+SVTI + K +A  ++ +          R R+ IAL DCVECF+D LD+LH+SL V
Sbjct  65   ARAGVSVTIAESKRVAHYMAVISKNNKRANQTRRRNGIALSDCVECFQDTLDNLHKSLFV  124

Query  658  LRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNAL  479
            LR+L+   F +Q+ DVTTW+SAALT+EDTCLDGF   + K+VR++VN+V+NV+ +TSNAL
Sbjct  125  LRELSVGEFDSQVEDVTTWVSAALTDEDTCLDGFDEQRGKRVRYIVNRVSNVTCMTSNAL  184

Query  478  ALVNKLATTGPQCL  437
            AL+NKLATTGP CL
Sbjct  185  ALINKLATTGPDCL  198



>ref|XP_002321006.1| hypothetical protein POPTR_0014s12390g [Populus trichocarpa]
 gb|EEE99321.1| hypothetical protein POPTR_0014s12390g [Populus trichocarpa]
Length=195

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = -1

Query  1009  NILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDR  830
             +IL  F L L+W+   C    G   G  YVR+ACSVT + DLC+HSLA FS+ A   P +
Sbjct  5     SILITF-LFLSWLT--CATSRGSDNGDTYVREACSVTRYHDLCMHSLASFSHTAGRSPSK  61

Query  829   WARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRK  650
             WAR G+SVTI + K  +  L+KLK    +RGR++IAL DC+ECF+DA+D+LH+SLG+LRK
Sbjct  62    WARAGVSVTIGEAKNASQYLNKLKKDRIMRGRNRIALSDCIECFQDAIDNLHKSLGILRK  121

Query  649   LNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALV  470
             L+A NF TQMGD+TTW+SAALT+EDTCLDGF     K+V+ L+N+V+ V+Y+TSNALALV
Sbjct  122   LDATNFDTQMGDLTTWLSAALTDEDTCLDGFEDRSSKQVKMLLNQVSRVTYITSNALALV  181

Query  469   NKLATTGPQCLH  434
             NKLA  G   L+
Sbjct  182   NKLAAAGLGSLN  193



>ref|XP_011033536.1| PREDICTED: 21 kDa protein [Populus euphratica]
Length=195

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = -1

Query  994  FMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVG  815
              L L+W+   C    G   G  YVR+ACSVT + DLC+HSLA FS+ A   P +WAR G
Sbjct  9    IFLFLSWLT--CATSWGSDNGDTYVREACSVTRYHDLCMHSLASFSHTAGRSPSKWARAG  66

Query  814  LSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN  635
            +SVTI + K  +  L+KLK  G +RGR++IAL DC+ECF+DA+D+LHRSLG+LRKL+A N
Sbjct  67   VSVTIGEAKNASQYLNKLKKDGIMRGRNRIALSDCIECFQDAMDNLHRSLGILRKLDATN  126

Query  634  FTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLAT  455
            F TQMGD+TTW+SAALT+EDTCLDGF     K+V  L N+VT V+Y+TSNALALVNKLA 
Sbjct  127  FDTQMGDLTTWLSAALTDEDTCLDGFEDQSSKQVNMLQNQVTRVTYITSNALALVNKLAA  186

Query  454  TGPQCLH  434
             G   L+
Sbjct  187  AGLGSLN  193



>ref|XP_003625921.1| Pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 ref|XP_003628462.1| Pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES82139.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            V++ACSVT +Q+LCIH+LA FSN A   P +WAR G+SVTI +VK +   L+KLK  G +
Sbjct  34   VKEACSVTRYQNLCIHTLAQFSNTAGRTPSKWARAGVSVTISEVKNVQAYLTKLKKNGKM  93

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            +GR+++AL DC+E F  A+D LH+SLGVLRKL+   F+TQMGD+ TW+SAALTNEDTCLD
Sbjct  94   KGRNRVALSDCIETFGYAVDELHKSLGVLRKLSKNTFSTQMGDLNTWISAALTNEDTCLD  153

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGPQ  443
            GF     KK++ L NKV NVSY+TSNALALVNKLA+TG +
Sbjct  154  GFEGKTEKKIKLLQNKVKNVSYITSNALALVNKLASTGLE  193



>gb|AFK38286.1| unknown [Lotus japonicus]
Length=201

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 125/159 (79%), Gaps = 1/159 (1%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAI-Agslsklksqgs  746
            VR+ACSVT +Q+LCIH+L+ FSN A   P +WAR G+SVTI +VK + A      K++  
Sbjct  36   VREACSVTRYQNLCIHTLSHFSNTAGTSPSKWARAGVSVTITEVKNVQAYLTKLKKNKRM  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            ++GR++ AL DCVECF DALD LHRSLGVLR+L+ K F+TQMGD+ TW+SAALT+EDTC+
Sbjct  96   MKGRNRAALSDCVECFADALDELHRSLGVLRRLSKKTFSTQMGDLNTWISAALTDEDTCI  155

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF     ++++ L N+V NVSY+TSNALALVNKLATTG
Sbjct  156  DGFEGKTERQIKLLQNRVQNVSYITSNALALVNKLATTG  194



>ref|XP_011079662.1| PREDICTED: LOW QUALITY PROTEIN: 21 kDa protein [Sesamum indicum]
Length=201

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsk-lksqg  749
            YVRDACSVT ++DLCI SL+ FS+ AK++P +WAR G+SV I + K +A  L+   +++ 
Sbjct  35   YVRDACSVTRYRDLCIRSLSSFSSTAKDNPSKWARAGVSVAIGEAKRVARYLATLKRNRQ  94

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +RGR++IAL DCVECF+D LD+LHRSL VLRKL+ ++F +Q+ DV TW+SAALT+EDTC
Sbjct  95   RIRGRNRIALSDCVECFQDTLDNLHRSLYVLRKLSVRDFGSQVEDVATWVSAALTDEDTC  154

Query  568  LDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGPQCLHH  431
            +DGF     K V+ L+N+V+NV+Y+TSNALAL+NKL T GP+CL +
Sbjct  155  VDGFDERTGKGVKPLINRVSNVTYMTSNALALINKLVTAGPECLKN  200



>gb|KDP28163.1| hypothetical protein JCGZ_13934 [Jatropha curcas]
Length=201

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 122/162 (75%), Gaps = 3/162 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVRDACSVT +QDLCIHSLA FS  AK  P +WAR  +SVTI + K +   L KLK    
Sbjct  34   YVRDACSVTRYQDLCIHSLAAFSQTAKRSPTKWARAAVSVTISEAKNVTQYLKKLKKYKL  93

Query  745  LRG-RSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
            +R  R++IA+ DC+ECFED LD+LHRSLGVLR L+A NF +QMGDV TW SAALT+EDTC
Sbjct  94   IRSSRNRIAIADCIECFEDTLDNLHRSLGVLRNLDAANFDSQMGDVITWTSAALTDEDTC  153

Query  568  LDGFGR--PKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF       K++R L NKV+  SY+TSNALALVNKLA+TG
Sbjct  154  LDGFADQIEYSKQIRVLQNKVSRASYITSNALALVNKLASTG  195



>ref|XP_002267786.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=196

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y+R+ACSVT ++DLCIHSLA FS+ AK  P RWAR G+SVTI + K +A  L KL+ +G+
Sbjct  31   YLREACSVTRYRDLCIHSLASFSHTAKRSPSRWARAGVSVTIGEAKHVAQYLVKLRKRGT  90

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            +RGR+  AL DC+ECF+DA+D+L  SLG+LRKL++K F  QM DV+TWMSA LT+EDTCL
Sbjct  91   MRGRNGAALSDCIECFQDAIDNLLNSLGMLRKLSSKAFDRQMSDVSTWMSAVLTDEDTCL  150

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGPQCLH  434
            DGF   K K+ + + N+V NV+Y+TSNALALVNKLAT G   L+
Sbjct  151  DGFDGSKGKRAKLIRNQVQNVTYITSNALALVNKLATAGAGSLN  194



>ref|XP_002523085.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF39270.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=197

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = -1

Query  991  MLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGL  812
            +L L+W A A   G    G   YVRDACSVT +QDLC+HSL+ FS  AK  P  WAR G+
Sbjct  10   LLFLSWAANAISWGSKTNGDT-YVRDACSVTRYQDLCLHSLSSFSQVAKRSPSIWARAGV  68

Query  811  SVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNF  632
            SVTI + K I   L+ LK    ++GR++IAL DC+E F D +D+LH+SLG+LRKL+A +F
Sbjct  69   SVTIGEAKNITQYLNILKRNKIMKGRNRIALSDCIESFSDTIDNLHKSLGILRKLDAASF  128

Query  631  TTQMGDVTTWMSAALTNEDTCLDGFGRPK--RKKVRWLVNKVTNVSYLTSNALALVNKLA  458
              QMGDV TWMSAALT+E+TCLDGF   K   ++ R L+N+V+ ++YLTSNALALVNKLA
Sbjct  129  DVQMGDVITWMSAALTDEETCLDGFQEQKTISRQARVLLNRVSRITYLTSNALALVNKLA  188

Query  457  TTGPQCL  437
            +TG   L
Sbjct  189  STGLGSL  195



>ref|XP_006444353.1| hypothetical protein CICLE_v10022355mg [Citrus clementina]
 ref|XP_006479961.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|ESR57593.1| hypothetical protein CICLE_v10022355mg [Citrus clementina]
 gb|KDO87220.1| hypothetical protein CISIN_1g029211mg [Citrus sinensis]
Length=197

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 135/191 (71%), Gaps = 3/191 (2%)
 Frame = -1

Query  1009  NILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDR  830
             N+   FML LAW+A +     G      +VRDACSVT ++DLCIHSLAPFS  A+N P +
Sbjct  5     NMFMLFML-LAWLAKSGESASGNRN--NFVRDACSVTTYRDLCIHSLAPFSKSARNSPGK  61

Query  829   WARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRK  650
             WAR G+SVTI +VK +   L KLK +  +RGR+++AL DC+ECF++ +D LH SLG+LR+
Sbjct  62    WARAGVSVTIGEVKNVTQFLYKLKRRNLMRGRNRLALLDCIECFQETIDELHMSLGILRR  121

Query  649   LNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALV  470
             L+A+ F  QM D+TT++SAALT EDTCLDGF   K  +V  L  +V   +YL SNALAL+
Sbjct  122   LSAREFDRQMDDLTTFVSAALTYEDTCLDGFEGQKATQVDLLKKRVLKTTYLASNALALI  181

Query  469   NKLATTGPQCL  437
             NKLATT  + L
Sbjct  182   NKLATTSLESL  192



>ref|XP_008451567.1| PREDICTED: 21 kDa protein [Cucumis melo]
Length=197

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++AC VT+HQDLCI SL+PFS+ AK  P +WAR G+SVTI + K +A  L +LK+   
Sbjct  32   YVQEACRVTLHQDLCIQSLSPFSSTAKRSPTKWARAGVSVTITEAKKVAALLGRLKNNKR  91

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            ++GR++ A+ DCVE F+ A+D LHRSLGVLR+L+ +NF +QMGD+TTW+SAALT+EDTC+
Sbjct  92   MKGRNRAAVLDCVEVFDAAIDELHRSLGVLRRLSRRNFDSQMGDLTTWVSAALTDEDTCV  151

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            +GF   + K V  L N+V  V Y+TSNALALVNKLAT+G
Sbjct  152  EGFEGERGKVVSLLRNRVVKVGYITSNALALVNKLATSG  190



>ref|XP_007163112.1| hypothetical protein PHAVU_001G207300g [Phaseolus vulgaris]
 gb|ESW35106.1| hypothetical protein PHAVU_001G207300g [Phaseolus vulgaris]
Length=197

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VR+ACSVT +Q LC+HSL+ FSN A   P +WAR G+SV+I +VK +   +++LK  G +
Sbjct  33   VREACSVTRYQSLCVHSLSHFSNTAGRSPSKWARAGVSVSIGEVKNVKAYIAELKRHGHM  92

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            +GR++IAL DC E F  ALD LHRSLGVLR+L+   F+TQMGD+ TW+SAALT+E+TCL+
Sbjct  93   KGRNKIALSDCAESFAYALDELHRSLGVLRRLSKTTFSTQMGDLNTWISAALTDEETCLE  152

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            GF     K V+ L N+V NVSY+TSNALALVNKLATTG
Sbjct  153  GFEGENEKHVKVLQNRVQNVSYITSNALALVNKLATTG  190



>ref|XP_007050926.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOX95083.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=195

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            +YV++AC VT ++ LCI+SLA FS+ A+  P  WAR G+SVT+ + K +A  L K+K+  
Sbjct  29   KYVQEACKVTRYRALCINSLASFSSIARRSPSTWARAGVSVTLGETKNVAQYLMKVKNYR  88

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             + GR +I L DC+ECF++A+D LHRSLGVLRKL+A+ F +QMGDVTTW+SAALT++DTC
Sbjct  89   EMTGRYKIPLSDCMECFQNAIDQLHRSLGVLRKLSARRFYSQMGDVTTWLSAALTDQDTC  148

Query  568  LDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGPQCLH  434
            +DGF  P+ ++ + L N+V   +Y TSNALAL NKLAT+G + L+
Sbjct  149  MDGFENPRGRQAKMLRNRVMRATYFTSNALALANKLATSGLESLN  193



>ref|XP_010259553.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=196

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+ACSVT + D+CIHSLA FSN AK +P  WAR  +SVT+R+ K +A  L+KLK +G 
Sbjct  32   YVREACSVTRYPDVCIHSLASFSNAAKRNPRWWARAAVSVTLREAKCVAQYLAKLKKRGH  91

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            LRGRS++AL DC+ECF+D + +LH+SLG LR L ++ F  QMGDV TWMSA LT+EDTCL
Sbjct  92   LRGRSRVALADCIECFQDTIYNLHKSLGELRTLQSRTFERQMGDVETWMSATLTDEDTCL  151

Query  565  DGFGRPKRKKVR-WLVNKVTNVSYLTSNALALVNKLATTG  449
            +GFG  + +++R  L N+V NV+Y+TSNALALV KLA+ G
Sbjct  152  EGFGDQEGRQIRSSLSNRVLNVTYMTSNALALVTKLASVG  191



>ref|XP_004160554.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
 gb|KGN44941.1| hypothetical protein Csa_7G397050 [Cucumis sativus]
Length=197

 Score =   187 bits (474),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++AC VT HQDLCI SL+PFS+ AK  P +WAR G+SVTI + K +AG L +LK+   
Sbjct  32   YVQEACRVTRHQDLCIQSLSPFSSAAKRSPTKWARAGVSVTITEAKKVAGLLGRLKNNKR  91

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            ++GR++ A+ DCVE FE A+D LHRSLGVLR+L+ +NF  QMGD+TTW+SAALT+EDTC+
Sbjct  92   MKGRNRAAVLDCVEVFEAAIDELHRSLGVLRRLSRRNFDAQMGDLTTWVSAALTDEDTCV  151

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            +GF   + K V  L N+V  V Y+TSNALALVNKLA +
Sbjct  152  EGFEGEEGKVVTLLRNRVVKVGYITSNALALVNKLAAS  189



>ref|XP_004495957.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=198

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 118/158 (75%), Gaps = 0/158 (0%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            V++AC VT +Q LC+HSLAPFSN A   P +WAR G+SVTI +V+ +   L+ L   GSL
Sbjct  35   VKEACKVTRYQGLCVHSLAPFSNSAGRSPSKWARAGVSVTIAEVENVQTYLANLNRHGSL  94

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            RGR ++AL DC+E F DALD LH SLGVLRKL+   F TQMGD+ TW+SAALT+EDTCLD
Sbjct  95   RGRDKLALLDCIELFADALDELHSSLGVLRKLSRSTFGTQMGDLNTWISAALTDEDTCLD  154

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            GF   K +K++ L N+V  V Y TSNALALVNKL+TT 
Sbjct  155  GFQGKKDRKIQLLQNRVLKVYYKTSNALALVNKLSTTA  192



>ref|XP_008350094.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=211

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 134/210 (64%), Gaps = 7/210 (3%)
 Frame = -1

Query  1075  MKLSSLSHPTFECLPNTMLPFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTI  896
             MK++S S   F       L FH I W        ++              YV++ACSVT 
Sbjct  1     MKMASCSSYIF-----VSLIFHAI-WLICSTQLLVSGKGDKTYVQEACSNYVQEACSVTR  54

Query  895   HQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVK-AIAgslsklksqgsLRGRSQIAL  719
             ++D+CIHSL+PFS+ AKN P RWAR G+SV++ + K A    ++     G L+GR+++AL
Sbjct  55    YRDVCIHSLSPFSSSAKNSPSRWARAGVSVSLSEAKSATRYLVTLKTHGGGLKGRNEVAL  114

Query  718   GDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRK  539
              DC+ECF++A+D LH+SL VLR L    F T+M D+ TW+SAALTN DTCLDGF     K
Sbjct  115   SDCIECFQNAIDELHKSLDVLRTLTKMTFDTKMADLNTWLSAALTNGDTCLDGFEGQNGK  174

Query  538   KVRWLVNKVTNVSYLTSNALALVNKLATTG  449
              V+ L ++V  V+Y+TSNALALVNKLATTG
Sbjct  175   PVKLLQDRVLKVTYITSNALALVNKLATTG  204



>ref|XP_010069915.1| PREDICTED: 21 kDa protein [Eucalyptus grandis]
 gb|KCW58437.1| hypothetical protein EUGRSUZ_H01114 [Eucalyptus grandis]
Length=193

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT +++LC+ SLA FS  AK  P RWAR G+SV++ +VK     L K+ +  S
Sbjct  31   YVQEACSVTQYRELCVRSLASFSGSAKRSPSRWARAGVSVSLSEVKNAGRYLEKVYTSRS  90

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            LRGR++ AL DC+ECF+DA+D+LH+SLG+LR L   +F  +M D+ TWMSAALT+EDTCL
Sbjct  91   LRGRNRAALSDCLECFQDAVDNLHKSLGLLRMLTRNDFNDRMSDLLTWMSAALTDEDTCL  150

Query  565  DGF-GRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF G+   + VR + N+V  V+Y TSNALAL NKLA+TG
Sbjct  151  DGFEGQTGGRAVRAVHNRVQRVTYYTSNALALANKLASTG  190



>ref|XP_009335740.1| PREDICTED: 21 kDa protein [Pyrus x bretschneideri]
Length=202

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklks-qg  749
            YV +ACSVT ++DLCIHSLA FS  AKN P RWAR G+SV++ + K+ A  L  LK  + 
Sbjct  36   YVEEACSVTRYRDLCIHSLASFSTSAKNSPSRWARAGVSVSLSETKSAAHYLVTLKKHRR  95

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++GR+++AL DC+ECF +A+D LH+SLGVLR L    F ++M D+ TW+SAALT+  TC
Sbjct  96   RMQGRNKVALSDCIECFGNAIDELHKSLGVLRTLTKTTFDSEMADLKTWLSAALTDGYTC  155

Query  568  LDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF   K K+V+ L   V+ V+++TSNALALVNKLATTG
Sbjct  156  LDGFEGQKGKQVKLLQKTVSKVTHITSNALALVNKLATTG  195



>ref|XP_010545015.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
Length=189

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 121/192 (63%), Gaps = 4/192 (2%)
 Frame = -1

Query  1024  MLPFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAK  845
             M P   I   F L+L  + P+            YVRDACSVT +Q+LCI SL+PFS  AK
Sbjct  1     MNPLIRITVLFSLLLVELHPSLASRHNDA----YVRDACSVTRYQELCIRSLSPFSAAAK  56

Query  844   NHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSL  665
             N P +WAR G+SVTI + K +   +++ +   ++  R ++AL DC E  +DALD LH SL
Sbjct  57    NSPSKWARAGVSVTIAETKRVLKRIAETQRSAAVGKRDRVALADCRELLQDALDDLHMSL  116

Query  664   GVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSN  485
              VLRKL A  F  QM ++ TW+SAALT++DTCLDG+   +   VR +  +V N  Y TSN
Sbjct  117   SVLRKLTATEFQQQMSNLATWLSAALTDQDTCLDGYAGTRTSTVRIVRRRVANSMYFTSN  176

Query  484   ALALVNKLATTG  449
             ALALVNKLAT G
Sbjct  177   ALALVNKLATAG  188



>ref|XP_003591526.1| 21 kDa protein [Medicago truncatula]
Length=225

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VR+AC VT +Q+LC+ SLAPFS  A   P +WAR G+SVTI +VK +   L+ L   G L
Sbjct  33   VREACKVTRYQNLCMRSLAPFSYSAGRGPSKWARAGVSVTIGEVKNVQAYLTNLTRHGRL  92

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            RGR+++AL DCVE   DALD LHRSL VLR+L+ + F TQMGD+ TW+SAALT++DTCLD
Sbjct  93   RGRNKVALLDCVETIADALDELHRSLNVLRRLSRRTFGTQMGDLNTWISAALTDQDTCLD  152

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            GF     +K++ L N+V    Y+TSNALALV+KLATTG
Sbjct  153  GFQGENGRKIQLLQNRVLKAYYITSNALALVSKLATTG  190



>ref|XP_009335681.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklks-qg  749
            YV +ACSVT ++DLCIHSLA FS  AKN P RWAR G+SV++ + K+ A  L  LK  + 
Sbjct  36   YVEEACSVTRYRDLCIHSLASFSTSAKNSPSRWARAGVSVSLSETKSAAHYLVTLKKHRR  95

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++GR+++AL DC+ECF +A+D LH+SLGVLR L    F ++M D+ TW+SAALT+  TC
Sbjct  96   RMQGRNKVALSDCIECFGNAIDELHKSLGVLRTLTKTTFDSEMADLKTWLSAALTDGYTC  155

Query  568  LDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF   K K+V+ L   V+ V+++TSNALALVNKLATTG
Sbjct  156  LDGFEGQKGKQVKLLQKTVSKVTHITSNALALVNKLATTG  195



>ref|XP_003521571.1| PREDICTED: 21 kDa protein-like [Glycine max]
Length=197

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VRDACSVT  Q LC+ +L  FS  A   P +WAR G+SV+I +VK +   L+++K QG L
Sbjct  33   VRDACSVTRFQSLCVQTLGHFSRTAGTSPSKWARAGVSVSIGEVKNVEAYLAQVKRQGQL  92

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            +GR+ +AL DCVE F  A+D LH+SLGVLR L+   F+TQMGD+ TW+SAALT+E TCLD
Sbjct  93   KGRNSVALSDCVETFGYAIDELHKSLGVLRSLSKSKFSTQMGDLNTWISAALTDEVTCLD  152

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            GF   K   V+ L N+V N SY+TSNALAL+NKLAT G
Sbjct  153  GFEGSKGTNVKLLQNRVQNASYITSNALALINKLATEG  190



>ref|XP_008369014.1| PREDICTED: 21 kDa protein [Malus domestica]
Length=184

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklks-qg  749
            YV++ACSVT ++DLCIHSLA FS  AK+ P RWAR G+SV++ + K+ A  L  LK  + 
Sbjct  18   YVQEACSVTRYRDLCIHSLASFSTLAKDSPSRWARAGVSVSLSETKSAAHYLVTLKKHRR  77

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++G +++AL DC+ECF +A+D LH SLGVLR L    F ++M D+ TW+SAALT+ DTC
Sbjct  78   GMQGINKVALSDCIECFLNAIDELHXSLGVLRTLTKTTFGSEMADLKTWLSAALTDGDTC  137

Query  568  LDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF   K K+V+ L N+V+ V+++T+NALALVNKLATTG
Sbjct  138  LDGFEGHKGKQVKLLQNRVSKVTHITNNALALVNKLATTG  177



>ref|XP_008355483.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=202

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklks-qg  749
            YV++ACSVT ++DLCIHSLA FS  AK+ P RWAR G+SV++ + K+ A  L  LK  + 
Sbjct  36   YVQEACSVTRYRDLCIHSLASFSTLAKDSPSRWARAGVSVSLSETKSAAHYLVTLKKHRR  95

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++G +++AL DC+ECF +A+D LH SLGVLR L    F ++M D+ TW+SAALT+ DTC
Sbjct  96   GMQGINKVALSDCIECFLNAIDELHXSLGVLRTLTKTTFGSEMADLKTWLSAALTDGDTC  155

Query  568  LDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF   K K+V+ L N+V+ V+++T+NALALVNKLATTG
Sbjct  156  LDGFEGHKGKQVKLLQNRVSKVTHITNNALALVNKLATTG  195



>ref|XP_004494376.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=208

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            V++ACSVT +++LC H+L+ FSN A  +P +WAR G+SV I +V  +   L+ LK  G++
Sbjct  39   VKEACSVTRYKNLCFHTLSQFSNTAGRNPSKWARAGVSVAIGEVINVQQYLTTLKRYGNM  98

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            +GR+++AL DC+E F+ A D LHRSL VLRKL+   F+TQ+GD+ TW+SAAL++EDTC+D
Sbjct  99   KGRNRVALLDCIETFDYAADELHRSLVVLRKLSKSTFSTQLGDINTWISAALSDEDTCID  158

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            GF     +++++L +KV NVS +TSNALALVNKLA  G
Sbjct  159  GFEGNNEREIKFLQHKVQNVSCITSNALALVNKLAAMG  196



>ref|XP_010106384.1| 21 kDa protein [Morus notabilis]
 gb|EXC10300.1| 21 kDa protein [Morus notabilis]
Length=181

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 118/162 (73%), Gaps = 2/162 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVK-AIAgslsklksq  752
            +YVR AC+VT ++ LCI SL+PFS+ AK  P RWAR G+SVTI + K A+   +   + +
Sbjct  13   KYVRQACAVTRYRSLCIRSLSPFSDAAKTSPSRWARAGVSVTITEAKSAVQYLIKLKRQE  72

Query  751  gsLRG-RSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNED  575
               RG R+  AL DC+ECF +A+D LH+SLG+LR LN + F TQMGD+ TW+SAALT+ D
Sbjct  73   NRARGARNSAALSDCIECFGNAIDELHKSLGILRNLNRRTFGTQMGDLNTWLSAALTDAD  132

Query  574  TCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            TCLDGF   K ++VR + ++V+  S +TSN+LAL NKLA+TG
Sbjct  133  TCLDGFEGQKGREVRRIRSRVSRASCVTSNSLALANKLASTG  174



>ref|XP_010519346.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
 ref|XP_010521000.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
Length=189

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 105/159 (66%), Gaps = 0/159 (0%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+ACS T++++LC+ SL PFS  AKN P +WAR G++VTI   K     + + +    
Sbjct  30   YVRNACSATLYKELCVRSLTPFSALAKNSPSKWARAGVAVTITDTKHALRRIVETRRSAV  89

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            +  R  +AL DC E F+DALD LHRSLGVLR LN+    TQ+ D+TTW+S ALT++DTCL
Sbjct  90   VGKRDGLALSDCRELFQDALDELHRSLGVLRTLNSTASQTQISDMTTWVSTALTDQDTCL  149

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF        + +  +VT   Y TSNALALVNKLA  G
Sbjct  150  DGFEGSSSSTAKIIRRRVTIAMYFTSNALALVNKLAAAG  188



>ref|XP_008235094.1| PREDICTED: 21 kDa protein-like [Prunus mume]
Length=200

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            V+ ACSVT +QDLCI SLA FS  AK+ P RWAR  +SVT+ + K++A  L  L+    +
Sbjct  35   VQKACSVTRYQDLCIRSLASFSRSAKSSPSRWARAAVSVTLGEAKSVAQYLLALQKHSRI  94

Query  742  RGR-SQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             GR S++AL DC+ECF++++D LH+SLGVLR L+   F TQMGD+ TW+SA LTN DTCL
Sbjct  95   NGRRSRVALSDCIECFQNSIDELHKSLGVLRSLSRTTFDTQMGDLNTWLSATLTNGDTCL  154

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGPQCLHH  431
            DGF   + ++V+ L NKV   +++TSNALAL NKLA TG + L H
Sbjct  155  DGFEGQRGRQVKLLQNKVLKATHITSNALALANKLAATGLESLPH  199



>gb|AES61777.2| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=151

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -1

Query  880  IHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVEC  701
            + SLAPFS  A   P +WAR G+SVTI +VK +   L+ L   G LRGR+++AL DCVE 
Sbjct  1    MRSLAPFSYSAGRGPSKWARAGVSVTIGEVKNVQAYLTNLTRHGRLRGRNKVALLDCVET  60

Query  700  FEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLV  521
              DALD LHRSL VLR+L+ + F TQMGD+ TW+SAALT++DTCLDGF     +K++ L 
Sbjct  61   IADALDELHRSLNVLRRLSRRTFGTQMGDLNTWISAALTDQDTCLDGFQGENGRKIQLLQ  120

Query  520  NKVTNVSYLTSNALALVNKLATTG  449
            N+V    Y+TSNALALV+KLATTG
Sbjct  121  NRVLKAYYITSNALALVSKLATTG  144



>emb|CDY11451.1| BnaA09g40170D [Brassica napus]
Length=189

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 110/161 (68%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT HQ+LC+ SLAPFS+ AKN P +WAR G+SV I   K +  SL +++    
Sbjct  29   YVQNACSVTHHQNLCVQSLAPFSSVAKNSPSKWARAGVSVAISDNKDVLRSLLRMRRSAF  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R ++AL DC E  +D+LD+LH+SL VLR L A  F  QM D+ TW+S ALT++DTCL
Sbjct  89   GK-RDRVALSDCRELLQDSLDNLHKSLAVLRTLRAGEFQEQMSDLATWLSTALTDKDTCL  147

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF +   K   VR +  +VT   Y++S +LAL+NKLA  G
Sbjct  148  DGFEKTSAKSAMVRMIRRRVTTSMYMSSISLALLNKLAANG  188



>ref|XP_006402338.1| hypothetical protein EUTSA_v10006253mg [Eutrema salsugineum]
 gb|ESQ43791.1| hypothetical protein EUTSA_v10006253mg [Eutrema salsugineum]
Length=190

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 109/163 (67%), Gaps = 4/163 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT +QDLC+ +L  FS+ AKN P +WAR G+SV I   K +   L K +    
Sbjct  29   YVQNACSVTRYQDLCVQTLRQFSSVAKNSPSKWARAGVSVAISDNKDVLRYLLKTRRSAF  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R ++AL DC E  +D+LD+LH+SL VLRKL A  F  QM D+ TW+S ALT++DTCL
Sbjct  89   GK-RDRVALSDCRELLQDSLDNLHKSLAVLRKLRASEFQQQMSDLGTWLSTALTDKDTCL  147

Query  565  DGFGRPKRKK---VRWLVNKVTNVSYLTSNALALVNKLATTGP  446
            DGF +   K    VR + ++VT   YL+SN+LAL+NKLA  G 
Sbjct  148  DGFEKTSTKSSSTVRMVQDRVTTSLYLSSNSLALLNKLAADGS  190



>ref|NP_191841.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
 emb|CAB83132.1| putative protein [Arabidopsis thaliana]
 gb|AAM64377.1| putative pectinesterase [Arabidopsis thaliana]
 dbj|BAD43436.1| unknown protein [Arabidopsis thaliana]
 gb|AEE80397.1| plant invertase/pectin methylesterase inhibitor superfamily protein 
[Arabidopsis thaliana]
Length=194

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 108/162 (67%), Gaps = 4/162 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT +QDLC  +L PF++ AKN P +WAR G+SV I   K +   L K +    
Sbjct  33   YVQNACSVTRYQDLCAKTLLPFASVAKNSPSKWARAGVSVAITDNKDVLRHLLKTRLSTI  92

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R +IAL DC E  +D+LDSLH+SL VLR L A  F  QM D+ TW+S++LT++DTCL
Sbjct  93   GK-RDRIALSDCRELLQDSLDSLHKSLAVLRTLRASEFQQQMSDLATWLSSSLTDKDTCL  151

Query  565  DGFGRPKRKK---VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF +   +    VR +  +VT   YL+SN+LAL+NKLA  G
Sbjct  152  DGFEKTSTRSSSTVRMIRKRVTTSMYLSSNSLALLNKLAANG  193



>ref|XP_009116944.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=189

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 110/161 (68%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT +Q+LC+ SLAPFS+ AKN P +WAR G+SV I   K +  SL +++    
Sbjct  29   YVQNACSVTHYQNLCVQSLAPFSSVAKNSPSKWARAGVSVAISDNKDVLRSLLRMRRSAF  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R ++AL DC E  +D+LD+LH+SL VLR L A  F  QM D+ TW+S ALT++DTCL
Sbjct  89   GK-RDRVALSDCRELLQDSLDNLHKSLAVLRTLRAGEFQEQMSDLATWLSTALTDKDTCL  147

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF +   K   VR +  +VT   Y++S +LAL+NKLA  G
Sbjct  148  DGFEKTSAKSAMVRMIRRRVTTSMYMSSISLALLNKLAANG  188



>ref|XP_004290794.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=197

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 117/164 (71%), Gaps = 1/164 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV  ACSVT ++DLCI SLA FS+ AKN P RWAR G+SVT+ + K +   L  LK    
Sbjct  31   YVEHACSVTRYRDLCIRSLASFSSTAKNSPSRWARAGVSVTLGETKIVTRYLITLKKHNG  90

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            ++G+  +AL DC+ECF++A+D LH+SLGVLRKL+   F TQMGD+ TW+SAALT+ +TCL
Sbjct  91   MKGKFGVALSDCMECFDNAIDELHKSLGVLRKLSRTTFVTQMGDLNTWLSAALTDGNTCL  150

Query  565  DGFGRPKR-KKVRWLVNKVTNVSYLTSNALALVNKLATTGPQCL  437
            DGF   ++  +++ L N+V   ++ TSNALAL NKLA TG +  
Sbjct  151  DGFEEDRKGNQLKSLKNRVLRATHFTSNALALANKLAATGLESF  194



>ref|XP_002876691.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH52950.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=194

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 107/162 (66%), Gaps = 4/162 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT +QDLC  +L+PF+  AKN P +WAR G+SV I   K +   L K +    
Sbjct  33   YVQNACSVTRYQDLCAKTLSPFAPVAKNSPSKWARAGVSVAITDNKDVLRHLLKTRLSTI  92

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R +IAL DC E  +D+LDSLH+SL VLR L A  F  QM D+ TW+S +LT++DTCL
Sbjct  93   GK-RDRIALSDCRELLQDSLDSLHKSLAVLRTLRASEFQQQMSDLATWLSTSLTDKDTCL  151

Query  565  DGFGRPKRKK---VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF +   +    VR +  +VT   YL+SN+LAL+NKLA  G
Sbjct  152  DGFEKTSTRSSSTVRMIRKRVTTSLYLSSNSLALLNKLAANG  193



>emb|CDX76665.1| BnaC08g32510D [Brassica napus]
Length=189

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 109/161 (68%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT +Q LC+ SLAPFS+ AKN P +WAR G+SV I   K +  SL K++    
Sbjct  29   YVQNACSVTHYQKLCVQSLAPFSSVAKNSPSKWARAGVSVAISDNKDVLRSLLKMRRSAF  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R ++AL DC E  +D+LD+LH+SL VLR L A  F  QM D+ TW+S ALT++DTCL
Sbjct  89   GK-RDRVALSDCRELLQDSLDNLHKSLAVLRTLRAGEFQEQMSDLATWLSTALTDKDTCL  147

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF +   K   VR +  +VT   Y++S +LAL+NKLA  G
Sbjct  148  DGFEKTSAKSAMVRMIRRRVTTSMYMSSISLALLNKLAADG  188



>ref|XP_006291882.1| hypothetical protein CARUB_v10018059mg [Capsella rubella]
 gb|EOA24780.1| hypothetical protein CARUB_v10018059mg [Capsella rubella]
Length=194

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 108/163 (66%), Gaps = 3/163 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++AC VT +QDLC  +L+PF++ AKN P +WAR G+SV I   K +   L K +    
Sbjct  29   YVQNACRVTHYQDLCAKTLSPFASVAKNSPSKWARAGVSVAITDNKDVLRYLLKTRLSTV  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             +   ++AL DC E  +D+LDSLH+SL VLR L A  F  QM D+ TW+S +LT++DTCL
Sbjct  89   GK-HDRVALSDCRELLQDSLDSLHKSLAVLRTLRASEFQQQMSDLATWLSTSLTDKDTCL  147

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTGPQ  443
            DGF +   K   VR + N+VT   Y++SN+LAL+NKLA  G Q
Sbjct  148  DGFDKTSTKSSTVRMIRNRVTMSLYVSSNSLALLNKLAANGLQ  190



>ref|XP_009142512.1| PREDICTED: 21 kDa protein [Brassica rapa]
 emb|CDX80124.1| BnaA05g00320D [Brassica napus]
Length=206

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            RYV+DAC+VT ++ LC+ +L PF+  AKN+  +WAR G++VTI   K I   L K ++  
Sbjct  44   RYVKDACNVTRYKQLCLRTLWPFTIVAKNNSSKWARAGVAVTITDTKRILRLLLKTRNSS  103

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
            ++  R +IAL DC E + D+LD+L++SL VLRKL+A  F  QM D+ TW+SAALT+EDTC
Sbjct  104  AVGKRERIALSDCRELYVDSLDNLYQSLSVLRKLDADQFQQQMSDLATWLSAALTDEDTC  163

Query  568  LDGFGR--PKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF     K   VR +  K T   +L SNALAL NKLA  G
Sbjct  164  LDGFEETMSKSSTVRMIKRKATRCMHLCSNALALTNKLAYDG  205



>ref|XP_010468917.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=189

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT ++DLC  +L+PF++ AKN P +WAR G+SV I   K +   L K +    
Sbjct  29   YVQNACSVTHYRDLCAKTLSPFASVAKNSPSKWARAGVSVAITDNKDVLRYLLKTRLSTV  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R ++AL DC E  +D+LDSLH+SL VLR L A  F  QM D+ TW+S +LT++DTC+
Sbjct  89   GK-RDRVALSDCRELLQDSLDSLHKSLAVLRTLKASEFQQQMSDLATWLSTSLTDKDTCI  147

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF +   K   VR +  +VT   Y++SN+LAL+NKLA  G
Sbjct  148  DGFEKTSSKSSTVRMIRRRVTTSLYISSNSLALLNKLAANG  188



>ref|XP_010512677.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=189

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT ++DLC  +L+PF++ AKN P +WAR G+SV I   K +   L K +    
Sbjct  29   YVQNACSVTHYRDLCAKTLSPFASVAKNSPSKWARAGVSVAITDNKDVLRYLLKTRLSTV  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R ++AL DC E  +D+LDSLH+SL VLR L A  F  QM D+ TW+S +LT++DTC+
Sbjct  89   GK-RDRVALSDCRELLQDSLDSLHKSLAVLRTLKASEFQQQMSDLATWLSTSLTDKDTCI  147

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF +   K   VR +  +VT   Y++SN+LAL+NKLA  G
Sbjct  148  DGFEKTSSKSSTVRMIRRRVTTSLYISSNSLALLNKLAANG  188



>ref|XP_010413236.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=189

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT ++DLC  +L+PF++ AKN P +WAR G+SV I   K +   L K +    
Sbjct  29   YVQNACSVTHYRDLCATTLSPFASVAKNSPSKWARAGVSVAITDNKDVLRYLLKTRLSTV  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R +IAL DC E  +D+LDSLH+SL VLR L A  F  QM D+ TW+S +LT++DTC+
Sbjct  89   GK-RDRIALSDCRELLQDSLDSLHKSLAVLRTLKASEFQQQMSDLATWLSTSLTDKDTCI  147

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF +   K   VR +  +VT   Y++SN+LAL+NKLA  G
Sbjct  148  DGFEKTSSKSSTVRMIRRRVTTSLYVSSNSLALLNKLAANG  188



>gb|KFK35462.1| hypothetical protein AALP_AA5G287100 [Arabis alpina]
Length=190

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 106/162 (65%), Gaps = 4/162 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++ACSVT +QDLC+ +L+PFS+ AKN P +WAR  +SV I   K +   L K +    
Sbjct  29   YVQNACSVTHYQDLCVQTLSPFSSVAKNSPSKWARASVSVAISDNKDVLRYLLKTRRSSF  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             + R ++AL DC E  +D+LD+L++SL VLR L A  F  QM D+ TW+S+ALT++DTCL
Sbjct  89   GK-RDRVALSDCRELLQDSLDNLYKSLAVLRTLRASEFQVQMSDLATWLSSALTDKDTCL  147

Query  565  DGF---GRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF      K   VR L  +V    YL+SN+LAL+NKL   G
Sbjct  148  DGFENTSSAKSSAVRMLRERVMRSMYLSSNSLALLNKLMANG  189



>emb|CDY53010.1| BnaC04g00200D [Brassica napus]
Length=206

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            RYV+DAC+VT ++ LC+ +L PF+  AKN+  +WAR G++VTI   K I   L K ++  
Sbjct  44   RYVKDACNVTRYKQLCLRTLWPFTIVAKNNSSKWARAGVAVTITDTKRILRLLLKTRNSS  103

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
            ++  R +IAL DC E + D+L +L++SL VLRKL+A  F  QM D+ TW+SAALT+EDTC
Sbjct  104  AVGKRERIALSDCRELYVDSLGNLYQSLSVLRKLDADQFQQQMSDLATWLSAALTDEDTC  163

Query  568  LDGFGR--PKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF     K   VR +  K T   +L SNALAL NKLA  G
Sbjct  164  LDGFEETMSKSSTVRMIKRKATRCMHLCSNALALTNKLAYDG  205



>ref|XP_010921671.1| PREDICTED: 21 kDa protein-like [Elaeis guineensis]
Length=194

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 110/163 (67%), Gaps = 3/163 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKA---KNHPDRWARVGLSVTIRQVKAIAgslsklk  758
             Y+  AC+VT H+ LC+HSLA FS+ A   + +P  WAR  ++VT+ + K +   L+K+K
Sbjct  29   HYLEAACNVTEHRALCMHSLASFSHSAAWKQKNPCWWARAAVTVTLAEAKHLGRFLAKVK  88

Query  757  sqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNE  578
              G +RG    AL DC+ECF DA++ LH SLG LR+L    F  QM +V TW+SAALTN+
Sbjct  89   HGGRMRGGRAGALADCIECFGDAVEELHSSLGELRRLEKGTFECQMSNVETWVSAALTNQ  148

Query  577  DTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            D CLDGFG  K K+V  +  KV N +Y TSNALALVN LA++G
Sbjct  149  DGCLDGFGGYKGKEVGEVKAKVLNATYFTSNALALVNNLASSG  191



>ref|XP_006397964.1| hypothetical protein EUTSA_v10001636mg [Eutrema salsugineum]
 gb|ESQ39417.1| hypothetical protein EUTSA_v10001636mg [Eutrema salsugineum]
Length=204

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 110/163 (67%), Gaps = 4/163 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            RYV++ACSVT +++LC+ +L PF+  AKN+  +WAR G++VTI   K +   L K +   
Sbjct  42   RYVKNACSVTRYKNLCVRTLWPFAVVAKNNSSKWARAGVAVTITDTKQMLRLLGKTRRSE  101

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
              + R +IAL DC E F D+LD+L++SL VLRKL+A  F  QM D+ TW+SAALT+EDTC
Sbjct  102  VGK-RERIALSDCRELFVDSLDNLYKSLAVLRKLDADEFQRQMSDLATWLSAALTDEDTC  160

Query  568  LDGFGRPKRKK---VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF   + ++   VR +  + T    L SNALAL+NKLA  G
Sbjct  161  LDGFEYQEEEESSTVRMIRRRATKCMQLCSNALALLNKLAYDG  203



>ref|XP_007200177.1| hypothetical protein PRUPE_ppa016389mg [Prunus persica]
 gb|EMJ01376.1| hypothetical protein PRUPE_ppa016389mg [Prunus persica]
Length=186

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            V+ ACSVT +QDLCIHSLA FS+ AK+ P RWAR  +SVT+ + K++A  L  L+    +
Sbjct  21   VQKACSVTRYQDLCIHSLASFSSSAKSSPSRWARAAVSVTLGEAKSVAQYLLALQKHSGI  80

Query  742  RGR-SQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
             GR S++AL DC+ECF++A+D LH+SLGVLR L+   F TQMGD+ TW+SAALTN DTCL
Sbjct  81   NGRRSRVALSDCIECFQNAIDELHKSLGVLRSLSRTTFDTQMGDLNTWLSAALTNGDTCL  140

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGPQCLHH  431
            DGF   + ++V+ L NKV   +++TSNALAL NKLA TG + L H
Sbjct  141  DGFEGQRGRQVKLLQNKVLKATHITSNALALANKLAATGLESLPH  185



>ref|XP_006295007.1| hypothetical protein CARUB_v10024078mg [Capsella rubella]
 gb|EOA27905.1| hypothetical protein CARUB_v10024078mg [Capsella rubella]
Length=203

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 102/161 (63%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+ACSVT +Q LC+  L PF+  A+N   +W R  ++VTI   K I   +       +
Sbjct  43   YVRNACSVTQYQRLCVRKLWPFAIVARNKTSKWTRASVAVTITDTKRI-LRVLLRTRGSA  101

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            +  R +IAL DC E F D+LD+L++SL VLR LNA  F  QM D+ TW+SAALT+EDTCL
Sbjct  102  VEERERIALSDCRELFVDSLDNLYKSLAVLRTLNADEFQRQMSDLATWLSAALTDEDTCL  161

Query  565  DGFGR--PKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF     + + VR +  K T    L SNALAL+NKL++ G
Sbjct  162  DGFEETSSRSRTVRMVRRKATKCMQLCSNALALLNKLSSDG  202



>ref|XP_010506807.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=204

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 102/161 (63%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+ACSVT +Q LC+ +L PF+  A+N   +W R  ++VTI   K I   L K +   +
Sbjct  44   YVRNACSVTQYQQLCVRTLWPFAIVARNKTSKWTRASVAVTITDTKRILRILLKTRGSAA  103

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
               R +IAL DC E F D+LD+L++SL VLR LNA  F  QM D+ TW+SAALT+EDTCL
Sbjct  104  DE-RERIALSDCRELFVDSLDNLYKSLAVLRTLNADEFQRQMSDLATWLSAALTDEDTCL  162

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF     +   VR +  K T    L SNALAL+NKL+  G
Sbjct  163  DGFEETSSRSWTVRMVRRKATKCMQLCSNALALLNKLSYDG  203



>ref|XP_010518481.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=204

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 102/161 (63%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+ACSVT +Q LC+ +L PF+  A+N   +W R  ++VTI   K I   L K +   +
Sbjct  44   YVRNACSVTQYQRLCVRTLWPFAIVARNKTSKWTRASVAVTITDTKRILRILLKTRGSAA  103

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
               R +IAL DC E F D+LD+L++SL VLR LNA  F  QM D+ TW+SAALT+EDTCL
Sbjct  104  DE-RERIALSDCRELFVDSLDNLYKSLAVLRTLNADEFQRQMSDLATWLSAALTDEDTCL  162

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF     +   VR +  K T    L SNALAL+NKL+  G
Sbjct  163  DGFEETSSRSWTVRMVQRKATKCMQLCSNALALLNKLSYDG  203



>ref|XP_010507863.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=204

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 102/161 (63%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+ACSVT +Q LC+ +L PF+  A+N   +W R  ++VTI   K I   L K K   +
Sbjct  44   YVRNACSVTQYQQLCVRTLWPFAVVARNKTSKWTRASVAVTITDTKRILRILLKTKGSAA  103

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
               R +IAL DC E F D+LD+L++SL VLR LNA  F  QM D+ TW+SAALT++DTCL
Sbjct  104  DE-RERIALSDCRELFVDSLDNLYKSLAVLRTLNADEFQRQMSDLATWLSAALTDDDTCL  162

Query  565  DGFGRPKRKK--VRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF     +   VR +  K T    L SNALAL+NKL+  G
Sbjct  163  DGFEETSSRSWTVRMVRRKATKCMQLCSNALALLNKLSYDG  203



>ref|XP_002882126.1| hypothetical protein ARALYDRAFT_904242 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58385.1| hypothetical protein ARALYDRAFT_904242 [Arabidopsis lyrata subsp. 
lyrata]
Length=205

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 104/161 (65%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+AC+VT +Q LC+ +L PF+  A+N+  +WAR  ++VTI   K +   L K +    
Sbjct  45   YVRNACNVTRYQRLCVRTLWPFAIVARNNTSKWARASVAVTITDTKRMLRLLLKTQRSAV  104

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
               R +IAL DC E F D+LD+L++SL VLR LNA  F  Q+ D+ TW+SAALT+EDTCL
Sbjct  105  GE-RERIALSDCRELFVDSLDNLYKSLAVLRTLNADEFQRQISDLATWLSAALTDEDTCL  163

Query  565  DGFGR--PKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF     + + VR +  K T    L SNALAL+NKLA  G
Sbjct  164  DGFEETSSRSRTVRMVRRKATKCMRLCSNALALLNKLAFDG  204



>gb|KFK37505.1| hypothetical protein AALP_AA4G266100 [Arabis alpina]
Length=204

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 99/163 (61%), Gaps = 5/163 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YV++AC VT  Q LCI +L PF+  AKN+   WAR G++VTI   K  A          +
Sbjct  42   YVKNACHVTRFQSLCIRTLWPFAIIAKNNSSIWARAGVAVTITDTKE-ALRRLLRTRNSA  100

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            +  R +IAL DC E F D+LD+L++SL VLRKLNA  F  Q+ D+ TW+SAALT++DTCL
Sbjct  101  VGKRERIALSDCRELFVDSLDNLYKSLNVLRKLNADEFQRQISDLATWLSAALTDQDTCL  160

Query  565  DGFGR----PKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF           VR +  K T    L SNALAL NKLA  G
Sbjct  161  DGFAETSVIASSSTVRMIRRKATKCMQLCSNALALANKLAYDG  203



>ref|XP_008784876.1| PREDICTED: 21 kDa protein-like [Phoenix dactylifera]
Length=195

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 113/183 (62%), Gaps = 4/183 (2%)
 Frame = -1

Query  985  VLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKA---KNHPDRWARVG  815
            +L ++  + H          Y+  AC+VT H+ LC+ SL  FS+ A   + +P  WAR  
Sbjct  9    LLFFVTISSHLASSTAASAHYLEAACNVTRHRALCMRSLESFSHSAAWKQKNPCWWARGA  68

Query  814  LSVTIRQVKAIAgslsklk-sqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAK  638
            ++VT+ +   +   L+K+K    +  GR+  A+ DCVECF DA+  L  SLG LR+L   
Sbjct  69   VAVTLTEANDVGRYLAKMKHGGRTRGGRAGRAMADCVECFGDAVAELRSSLGELRRLERG  128

Query  637  NFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLA  458
             F  QM +V TW+SAALTN+DTCLDGFG  K K+V  +  KV N +YLTSNALALVN LA
Sbjct  129  TFEYQMSNVETWVSAALTNQDTCLDGFGGYKGKEVGEVKAKVLNATYLTSNALALVNNLA  188

Query  457  TTG  449
            ++G
Sbjct  189  SSG  191



>ref|XP_006855615.1| hypothetical protein AMTR_s00044p00081280 [Amborella trichopoda]
 gb|ERN17082.1| hypothetical protein AMTR_s00044p00081280 [Amborella trichopoda]
Length=187

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y+R AC  T++  LCI +L P S+   +     AR  +SV + + K  +  +S L    +
Sbjct  30   YLRHACRATLYPSLCIRTLCPNSHTRSSR--GVARAAISVCLAKAKDASSYISSLAQGKT  87

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            ++     AL DC E F+D LD LHRSL VLRKL+A +F  QM +V TW+SAALTNEDTCL
Sbjct  88   MKRIEVAALSDCRENFDDVLDLLHRSLRVLRKLSAVDFELQMSNVQTWVSAALTNEDTCL  147

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGP  446
            DGF          L + VTNV +LTSNALALVN+LA+ GP
Sbjct  148  DGFRGVSSTIWPPLSSTVTNVEHLTSNALALVNRLASGGP  187



>ref|XP_009118264.1| PREDICTED: 21 kDa protein-like [Brassica rapa]
Length=203

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 103/162 (64%), Gaps = 3/162 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            R +++ACSVT +Q LC  ++ PF+  AKN+  + AR  ++VTI   K I   L K +S  
Sbjct  42   RCIKNACSVTQNQQLCFRTIWPFAIVAKNNSSKRARASVAVTITDTKQILRLLLKTRSSA  101

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
              + R ++AL DC E F D+L +L++SL +LRKL+A  F  QM D+ TW+S+ALT+EDTC
Sbjct  102  VGK-RERVALSDCRELFVDSLGNLYKSLALLRKLDADEFQQQMSDLATWLSSALTDEDTC  160

Query  568  LDGFGRP--KRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF     +   VR +  + T    L SNALA+++KLA  G
Sbjct  161  LDGFEETSIRSSTVRMIRRRATRCMQLCSNALAILSKLAYDG  202



>ref|NP_182289.1| pectin methylesterase inhibitor 6 [Arabidopsis thaliana]
 gb|AAC63623.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAM14850.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC10874.1| pectin methylesterase inhibitor 6 [Arabidopsis thaliana]
Length=208

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+AC+VT +  LC+ +L PF+  A+N+  +WAR  ++VTI   K +   L K +    
Sbjct  48   YVRNACNVTRYNRLCVRTLWPFAIVARNNTSKWARASVAVTITDTKRVLRLLLKTQRSAV  107

Query  745  LRGRSQ-IALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
              G S+ IAL DC E F D+LD+L++SL VLR LNA  F  Q+ D+ TW+SAALT++DTC
Sbjct  108  --GESERIALSDCRELFVDSLDNLYKSLAVLRTLNADEFQRQISDLATWLSAALTDDDTC  165

Query  568  LDGFGRPKR--KKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            LDGF       + VR +  K T    L SNALAL+ KLA  G
Sbjct  166  LDGFEETSSRTRTVRMVRRKATKCMRLCSNALALLKKLAFDG  207



>gb|AAM63611.1| putative pectinesterase [Arabidopsis thaliana]
Length=208

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 101/161 (63%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            YVR+AC+VT +  LC+ +L PF+  A+N+  +WAR  ++VTI   K +   L K +    
Sbjct  48   YVRNACNVTRYNRLCVRTLWPFAIVARNNTSKWARGSVAVTITDTKRMLRLLLKTQRSAV  107

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
               R +IAL DC E F D+LD+L++SL VLR LNA  F  Q+ D+ TW+SAALT++DTCL
Sbjct  108  GE-RERIALSDCRELFVDSLDNLYKSLAVLRTLNADEFQRQISDLATWLSAALTDDDTCL  166

Query  565  DGFGRPKR--KKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            DGF       + VR +  K T    L SNALAL+ KLA  G
Sbjct  167  DGFEETSSRTRTVRMVRRKATKCMRLCSNALALLKKLAFDG  207



>ref|XP_009595798.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=215

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 109/191 (57%), Gaps = 3/191 (2%)
 Frame = -1

Query  1015  FHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHP  836
             F+ IL    L+ +  A              ++ ++C  T++  LCI +L+P+SN  + +P
Sbjct  25    FYFILITSALICSATATRNLAKKSEINTSEFITNSCGTTLYTKLCIETLSPYSNSIQTNP  84

Query  835   DRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVL  656
                A   L+V+++  K+    +SK+  +  L      AL DCVE  ED++D L +SL  +
Sbjct  85    KELANAALTVSLKGAKSTTNKISKMSKEQDLGPAETHALTDCVENMEDSVDELQKSLLEM  144

Query  655   RKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF--GRPKRKKVRWLV-NKVTNVSYLTSN  485
             + LN  +F  +MG+V TW+SAALT+EDTC+DGF       +KV+  + N + NV+ LTSN
Sbjct  145   KNLNGPDFEEKMGNVMTWVSAALTDEDTCMDGFDGNDNMNEKVKATIRNYIVNVAQLTSN  204

Query  484   ALALVNKLATT  452
             ALAL   L+++
Sbjct  205   ALALTKNLSSS  215



>ref|XP_006362112.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=209

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 101/161 (63%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C  T++  LCI +L+P+SN  + +P   A   L+V+++  K+    ++K+  + S
Sbjct  49   FIKTSCGTTLYPKLCIETLSPYSNSIQTNPMELANSALTVSLKGAKSTTNKIAKMSKEES  108

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L      AL DCVE  ED++D L +SL  ++ LN  +F  +MG+V TW+SAALT+EDTC+
Sbjct  109  LGPAEAHALTDCVENMEDSVDELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALTDEDTCM  168

Query  565  DGFGRPK--RKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            DGF        KV+  + N + NV+ LTSNALAL   L+++
Sbjct  169  DGFQENSAMNAKVKATIRNYIVNVAQLTSNALALTKNLSSS  209



>ref|XP_004234936.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=209

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 100/161 (62%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C  T++  LCI +L+P+SN  +  P   A   L+V+++  K+    ++K+  + S
Sbjct  49   FIKTSCGTTLYPKLCIETLSPYSNSIQTSPMELANSALTVSLKGAKSTTNKIAKMSKEES  108

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L      AL DCVE  ED++D L +SL  ++ LN  +F  +MG+V TW+SAALT+EDTC+
Sbjct  109  LGPAEAHALTDCVENMEDSVDELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALTDEDTCM  168

Query  565  DGF--GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            DGF        KV+  + N + NV+ LTSNALAL   L+++
Sbjct  169  DGFQDNSAMNSKVKATIRNYIVNVAQLTSNALALTKNLSSS  209



>ref|XP_009779184.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=215

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 100/162 (62%), Gaps = 3/162 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++ ++C  T++  LCI +L+P+SN  + +P   A   L+V+++  K+    +SK+  + 
Sbjct  54   EFITNSCGTTLYSKLCIETLSPYSNSIQTNPKELANAALTVSLKGAKSTTNKISKMSKEQ  113

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L      AL DCVE  ED++  L +SL  ++ LN  +F  +MG+V TW+SAALT+EDTC
Sbjct  114  DLGLAETHALTDCVENMEDSVVELQKSLLEMKNLNGPDFEEKMGNVMTWVSAALTDEDTC  173

Query  568  LDGF--GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            +DGF       +KVR  + N + NV+ LTSNALAL   L+++
Sbjct  174  MDGFEGNGNMNEKVRATIRNYIVNVAQLTSNALALTKNLSSS  215



>ref|XP_007039951.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24452.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=204

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             Y++ +CS T +  LC  SL+ +++K    P       L+VT++  K+ +  + K+    
Sbjct  39   EYIKSSCSTTTYPRLCYRSLSIYASKINTSPRLLVHTALNVTLKASKSTSRLMIKISRIH  98

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             LR R   A+ DC+E   D++D L +S+G L  + + NF+  M D+ TW+SAALT+EDTC
Sbjct  99   GLRPRVAAAMADCIEVMGDSVDELQQSIGELGHIRSSNFSLTMSDIQTWVSAALTDEDTC  158

Query  568  LDGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLATT  452
            +DGF G+      + +V K +  +++LTSNALAL+N  A+T
Sbjct  159  MDGFAGKAMNGYAKTMVRKRIVKIAHLTSNALALINNYAST  199



>ref|XP_004298672.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=197

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 99/162 (61%), Gaps = 4/162 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             Y++ +CSVT++  LC  SL+ ++ K K  P   A   L+VT+R  KA +  +++     
Sbjct  35   EYIKTSCSVTLYPKLCYTSLSIYAGKIKTSPKVLAHTALNVTLRATKATSAVINRCSKVH  94

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL--NAKNFTTQMGDVTTWMSAALTNED  575
             L+     A  DCVE   DALD L +S+G L      +++F  Q+ D+ TW+SAALT+ED
Sbjct  95   GLKPIEVAATLDCVEEISDALDELRKSIGELGHAVKGSRSFLFQISDIQTWVSAALTDED  154

Query  574  TCLDGFGRPK-RKKVRWLVNK-VTNVSYLTSNALALVNKLAT  455
            TCLDGF  PK   +V  +V + +T +++LTSNALAL+N  A+
Sbjct  155  TCLDGFDEPKLNGRVETIVRREITKIAHLTSNALALINNYAS  196



>ref|XP_006440385.1| hypothetical protein CICLE_v10023344mg [Citrus clementina]
 gb|ESR53625.1| hypothetical protein CICLE_v10023344mg [Citrus clementina]
 gb|KDO37980.1| hypothetical protein CISIN_1g042707mg [Citrus sinensis]
Length=203

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 98/165 (59%), Gaps = 3/165 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            ++++ +C VT + DLCI +L+ ++ K +  P   A   LSV ++     + +++KL    
Sbjct  39   QFIKTSCRVTTYPDLCITTLSGYATKIQASPKLLASTALSVALKTALVTSTTMNKLSKSQ  98

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L  R   AL DCV+   DA+D L  S+  + +    NF  QM +V TW+SAALTNEDTC
Sbjct  99   GLNPREAAALYDCVDQLRDAVDELQNSISEMGRNERSNFALQMNNVQTWVSAALTNEDTC  158

Query  568  LDGFGRPKRK-KVRWLVNK-VTNVSYLTSNALALVNKLAT-TGPQ  443
            +DGF R      V+  V + ++NV++LTSN LALVN  A+ T P+
Sbjct  159  MDGFSRKSMNGNVKATVRRQISNVAHLTSNGLALVNSYASITSPK  203



>ref|XP_008238630.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=200

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 98/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            +Y++ +CSVTI+  LC HSL+ ++ K K  P   A   L+VT+   +  +  + +L    
Sbjct  34   QYIKRSCSVTIYPRLCYHSLSIYAGKIKTDPKVLAHTALNVTLAATQESSVIMRRLSEIH  93

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVL-RKLNAKNFTTQMGDVTTWMSAALTNEDT  572
             L+     A+ DC+E   DA+D L +SL  L   L   NF  QM D+ TW+SAALT+EDT
Sbjct  94   GLKPIETAAVHDCMEEIGDAIDELQQSLDELGHVLRGSNFWFQMSDIQTWVSAALTDEDT  153

Query  571  CLDGFGRPK-RKKVRWLVNKVT-NVSYLTSNALALVNKLATT  452
            C+DGF     R +V  +V + T NV++LTSNALAL+N  A++
Sbjct  154  CMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNALALINSYASS  195



>ref|XP_007039937.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24438.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=202

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 98/159 (62%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            ++++ +CS T++ D+C  +L+ ++++ +  P   A   LSVT+   ++ + ++ K     
Sbjct  38   QFIKTSCSSTVYPDVCFTTLSSYASEIQASPKLLASTALSVTLNATRSASTTMIKRSKSQ  97

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   AL DC+E   D++  L RS+G + +   KNF  QM D+ TW+SAALT+E TC
Sbjct  98   GMKPREAEALSDCMEELRDSVYELQRSVGEMDQPGGKNFGLQMNDIETWVSAALTDEHTC  157

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
            +DGF G+     V+  V +++  V+++TSNALALVN  A
Sbjct  158  MDGFSGKAMNGNVKNSVRSQIVKVAHMTSNALALVNSYA  196



>ref|XP_004503384.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=222

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 99/169 (59%), Gaps = 8/169 (5%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgsls--klks  755
             ++R +C+ T++ D+C  SL+ ++N  + +P + ARV +SV++ +V  IA  +S    ++
Sbjct  41   EFIRSSCNTTLYPDICYTSLSRYANAVQQNPGQLARVAISVSLSKVHRIASYISNLTHEA  100

Query  754  qgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA-----KNFTTQMGDVTTWMSAA  590
                  R+ +AL DC    +DA+  +  SL  +R+L A      +F  QM +V TWMSAA
Sbjct  101  DYGASSRAVLALHDCFSNLDDAVSEIRGSLKQMRQLGAAGSGTDSFLFQMSNVQTWMSAA  160

Query  589  LTNEDTCLDGFGR-PKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGP  446
            LT+E+TC DGF   P+      + N+VT V   TSNALALVN  A  GP
Sbjct  161  LTDEETCTDGFQDVPECPMKSDVYNRVTRVKKFTSNALALVNSYANKGP  209



>ref|XP_002264799.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
Length=201

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y++ +C  T +  LC  SL+ ++NK +  P R A   LSV     ++   S+ +L     
Sbjct  36   YIKTSCLATTYPHLCYDSLSIYANKIQTSPKRLATTALSVASSSARSTLVSMKQLSKTHG  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+ R   A+ DCVE   D++D LH+S+G +      +F  +MG++ TW+SAALT+E+TC 
Sbjct  96   LKPREASAMIDCVEEVADSVDELHKSIGEMGHAGGPDFEFRMGNIQTWVSAALTDEETCT  155

Query  565  DGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLATT  452
            DGF GR     ++  V + +  V+ LTSNALALVNK A+T
Sbjct  156  DGFAGRAMNGNLKKTVQRHINKVARLTSNALALVNKYAST  195



>gb|ABK22631.1| unknown [Picea sitchensis]
 gb|ACN40721.1| unknown [Picea sitchensis]
Length=204

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 91/162 (56%), Gaps = 5/162 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSV---TIRQVKAIAgslsklk  758
             +++ +C+VT++  LC+ SL+ ++   K        V L V   T R V   A  +   +
Sbjct  37   EFIKTSCNVTLYPQLCVSSLSSYAGSLKATQSNLVNVALQVSLVTARNVSVWAAGMKSRR  96

Query  757  sqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNE  578
            +  S R R+  ALGDC+E F D  D + +SL  L+KL    F  QM +V TWMSAALTNE
Sbjct  97   ALMSRRERA--ALGDCIEDFGDTADQIRQSLAELKKLRRNTFKFQMSNVETWMSAALTNE  154

Query  577  DTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            D+CLDGF   K +    +  +V  V  + SNALAL+NK A T
Sbjct  155  DSCLDGFQVAKGRVKAMVTGRVQKVCKMISNALALLNKFAAT  196



>gb|KDP22408.1| hypothetical protein JCGZ_26239 [Jatropha curcas]
Length=186

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 100/159 (63%), Gaps = 3/159 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAK-NHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            +++ +C VT + DLC  +L+ ++   + N+P + A   L+VT++  +A +  +SK+    
Sbjct  26   FIKSSCLVTRYPDLCYQTLSAYATSIQDNNPTQLANAALNVTLKSAEATSNMVSKMLKAH  85

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
            +L  +   A+ DCVE   D++D + +SL V+  L   +F  +M ++ TW+SAALT+EDTC
Sbjct  86   NLMPKEAAAIKDCVETMRDSVDEIKQSLLVMSDLEGPDFEMKMSNIQTWVSAALTDEDTC  145

Query  568  LDGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLA  458
            +DGF G     KV+  + + V  VS LTSNALAL+NK+A
Sbjct  146  MDGFQGNAMNGKVKLKIRQYVERVSQLTSNALALINKVA  184



>ref|XP_006362111.1| PREDICTED: 21 kDa protein-like isoform X2 [Solanum tuberosum]
Length=201

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 96/159 (60%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  SN     P   A   LSV++   ++ +  + KL    
Sbjct  39   EFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLSVSLETAQSTSAMMIKLSHSQ  98

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   DA+  + +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  99   GMTPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAALTDEDTC  158

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  K+  V+++TSNALAL+N+LA
Sbjct  159  TEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINRLA  197



>ref|XP_002312451.2| hypothetical protein POPTR_0008s13190g [Populus trichocarpa]
 gb|EEE89818.2| hypothetical protein POPTR_0008s13190g [Populus trichocarpa]
Length=212

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 108/205 (53%), Gaps = 10/205 (5%)
 Frame = -1

Query  1033  PNTMLPFHNILWKFMLVLAWIAPACHggg--gggggGRYVRDACSVTIHQDLCIHSLAPF  860
             P  +L F   L  F+L    I+             G  Y+R +C VT++ ++C  SL+ +
Sbjct  6     PGPLLLFTFFLTNFLLYSQPISTVASPDPGFSRSSGTDYIRSSCGVTLYPEICYTSLSRY  65

Query  859   SNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRG--RSQIALGDCVECFEDAL  686
             ++  K  P R ARV + V++ + + +A  +S L       G  R+  A+ DC+    DA+
Sbjct  66    ASAVKQSPSRLARVAIGVSLSRARRLAAYVSNLTRHEDFGGDHRATAAIHDCLSNMGDAV  125

Query  685   DSLHRSLGVLRK-----LNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLV  521
             D +  SL  +RK     L+A++F  QM +V TWMSAALT+E+TC DGF       V+  V
Sbjct  126   DEMSGSLKQMRKVGAAGLSAESFQFQMSNVQTWMSAALTDEETCTDGFEDVADGAVKTEV  185

Query  520   -NKVTNVSYLTSNALALVNKLATTG  449
              N+V +    TSNALALVN  A  G
Sbjct  186   CNRVADAKKFTSNALALVNTFAAAG  210



>ref|XP_008389193.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=211

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 103/171 (60%), Gaps = 11/171 (6%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgsls--klks  755
             ++R +C  T++ DLC  SL+PF++  +++P + A+V + V++ + +++A  +S    ++
Sbjct  39   EFIRTSCGXTLYPDLCYTSLSPFASAVQDNPAQLAKVAIXVSLARARSMAAYVSNISRQA  98

Query  754  qgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL--------NAKNFTTQMGDVTTWM  599
                  R+  AL DC   F DA+D +  SL  +R+L         + +F  QM +V TWM
Sbjct  99   DYGADSRAASALHDCFSNFGDAVDEIRGSLKQMRQLISTAASGGGSSSFRFQMSNVQTWM  158

Query  598  SAALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            SAALT+E+TC DGF   +   ++  V N+V NV  +TSNALALVN++A  G
Sbjct  159  SAALTDEETCTDGFDDVEDGPLKTDVSNRVENVKKVTSNALALVNRVAEKG  209



>ref|XP_006362110.1| PREDICTED: 21 kDa protein-like isoform X1 [Solanum tuberosum]
 ref|XP_006367637.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=201

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 95/159 (60%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  SN     P   A   LSV++   ++ +  + KL    
Sbjct  39   EFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLSVSLETAQSTSAMMIKLSHSQ  98

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   DA+  + +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  99   GMTPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMSDIQTWVSAALTDEDTC  158

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  K+  V+++TSNALAL+N LA
Sbjct  159  TEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINSLA  197



>emb|CDP05319.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 96/160 (60%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +CS T + +LC  SL+  +   ++ P+  A   LSV++   K+ +  + KL    
Sbjct  43   EFIRTSCSTTTYPELCYASLSDQATIIRSDPELLAHAALSVSLDTAKSTSSMMVKLSQSH  102

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   D++D L +S+G + +L   NF   + D+ TW+SAALT+EDTC
Sbjct  103  GMTPREVGAMRDCVEELGDSVDELKKSMGEMPQLRGPNFALTVNDIQTWVSAALTDEDTC  162

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
            +DGF G+      +  V N++ NV+++TSNALAL+N  A+
Sbjct  163  MDGFAGKAMNGNTKIAVRNQIVNVAHMTSNALALINSYAS  202



>ref|XP_002264167.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=200

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 99/168 (59%), Gaps = 7/168 (4%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R AC  T +  LC  SLA  ++  + +P   A   LSVT+   ++ +  +S L  + 
Sbjct  38   EFIRTACGTTTYPQLCFTSLAAHASVIQTNPKLLASTALSVTLATARSTSSDMSTLLKRH  97

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L  R   A+ DCVE   D++D L +S+G + ++ + NF   + D+ TW+SAALT+EDTC
Sbjct  98   GLTPREVSAMRDCVEELSDSVDQLKKSMGEMSQIKSSNFGLMINDIQTWVSAALTDEDTC  157

Query  568  LDGFGR-PKRKKVRWLVN-KVTNVSYLTSNALALVNKLATTGPQCLHH  431
             +GF      + VR +VN ++ N++++TSNALAL+N  A+     LHH
Sbjct  158  ANGFTENAMTENVRTVVNARIVNIAHMTSNALALINSYAS-----LHH  200



>ref|XP_010035020.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW46287.1| hypothetical protein EUGRSUZ_K00154 [Eucalyptus grandis]
Length=222

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 107/203 (53%), Gaps = 4/203 (2%)
 Frame = -1

Query  1057  SHPTFECLPNTMLPFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCI  878
             S P+   +P   L         +  +A    A  G         +++ +C  TI+ D+C 
Sbjct  19    SSPSPPTIPRLALAISTTAIFTLFSIAQPCAASSGFDPSPSYTEFIKTSCGFTIYPDVCY  78

Query  877   HSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECF  698
              +L+P+++  +  P   A   L VT+    + +  +S+L + G L  R   A+ DCVE  
Sbjct  79    QTLSPYASTIQTSPKEMANAALLVTLDGALSASNMVSRLSNAGGLSKREARAVIDCVETM  138

Query  697   EDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF---GRPKRKKVRW  527
              D++D + +SL  ++ L+   F T M D+ TW+SAALT+EDTC+DGF   G    KKV  
Sbjct  139   SDSVDEIRQSLVAMKTLDGPEFETNMSDMRTWVSAALTDEDTCMDGFQERGISNNKKVEG  198

Query  526   LV-NKVTNVSYLTSNALALVNKL  461
              + + +  V+ LTSNALAL+N+L
Sbjct  199   PIRSSIVRVAQLTSNALALINRL  221



>ref|XP_004136168.1| PREDICTED: 21 kDa protein-like [Cucumis sativus]
Length=155

 Score =   109 bits (272),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -1

Query  706  ECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRW  527
            E  E A+D LHRSLGVLR+L+ +NF  QMGD+TTW+SAALT+EDTC++GF   + K V  
Sbjct  63   EVEEPAIDELHRSLGVLRRLSRRNFDAQMGDLTTWVSAALTDEDTCVEGFEGEEGKVVTL  122

Query  526  LVNKVTNVSYLTSNALALVNKLATT  452
            L N+V  V Y+TSNALALVNKLA +
Sbjct  123  LRNRVVKVGYITSNALALVNKLAAS  147



>ref|XP_002314795.2| hypothetical protein POPTR_0010s11950g [Populus trichocarpa]
 gb|EEF00966.2| hypothetical protein POPTR_0010s11950g [Populus trichocarpa]
Length=230

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 97/167 (58%), Gaps = 8/167 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg-  749
            Y+R  C  T++ ++C  SL+ +++  +N P R ARV + V++ +   +A  +S L  Q  
Sbjct  62   YIRSGCGATLYPEICYASLSRYASAVQNSPGRLARVAIKVSLLRTSHMAAYVSNLSRQSD  121

Query  748  -sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA-----KNFTTQMGDVTTWMSAAL  587
                 R+  AL DC     DA+D +  SL  +R++ A     ++F  QMG+V TWMSAAL
Sbjct  122  FGADNRAAAALHDCFSNLGDAVDEIRGSLKQMRQVGAAGPSTESFQFQMGNVQTWMSAAL  181

Query  586  TNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            T+EDTC DGF      +V+  V N+  +V  LTSNALALVN  A TG
Sbjct  182  TDEDTCTDGFEDVGDGEVKTEVCNRAADVKKLTSNALALVNSYAATG  228



>ref|XP_002284784.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CAN63370.1| hypothetical protein VITISV_031278 [Vitis vinifera]
Length=207

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 95/157 (61%), Gaps = 4/157 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C+ T++  LC  SL+ ++N  +  P   ARV +++++ + + +A  ++ L  Q  
Sbjct  38   FIRTSCNATLYPKLCYTSLSAYANTIQQSPAHLARVAVAISLSRARHMASYVANLSRQAD  97

Query  745  LRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNA-KNFTTQMGDVTTWMSAALTNED  575
                 R+  AL DC   F DA+D +  SL  +R+L A ++F  QMG+V TWMSAALTNED
Sbjct  98   YGSAPRTAAALHDCFSTFGDAIDQIRGSLKQMRQLKAGESFRFQMGNVQTWMSAALTNED  157

Query  574  TCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVN  467
            TC DGF       V+  V ++V NV   TSNALALVN
Sbjct  158  TCTDGFEDAPDGAVKSEVCDRVENVKKFTSNALALVN  194



>ref|XP_006367638.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=203

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 95/159 (60%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  SN     P   A   L+V++   ++ +  + KL    
Sbjct  41   EFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAYSQ  100

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   DA+  + +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  101  GMAPREVGAMRDCVEELSDAVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAALTDEDTC  160

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  K+  V+++TSNALAL+N LA
Sbjct  161  TEGFAGKVMNGKVKTVVREKILEVAHMTSNALALINSLA  199



>ref|XP_009385222.1| PREDICTED: 21 kDa protein-like [Musa acuminata subsp. malaccensis]
Length=198

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 4/163 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKA-KNHPDRWARVGLSVTIRQVKAIAgsls-klksq  752
            Y+  AC+ T +  LC+ SLA FS  A   +P  WAR  + VT  + + + G L+   +  
Sbjct  33   YLNAACNATRYPSLCVRSLAGFSRAAAPENPCLWARAAVVVTAVESERVGGYLAGLQRGG  92

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDT  572
                 R++ AL DCVEC  DA+  L  +L  LR+L    F  QM +V TW+SAALTN+DT
Sbjct  93   RIRGRRARAALADCVECLADAVSELRDALAELRQLQRTTFALQMSNVETWVSAALTNQDT  152

Query  571  CLDGFGRPKRK--KVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            CLDGF   + K   V  + +KV N ++ TSNALALVNKLA+TG
Sbjct  153  CLDGFAELQGKGAAVSVITSKVLNATHFTSNALALVNKLASTG  195



>gb|ABG49144.1| pectin methylesterase inhibitor isoform [Solanum phureja]
Length=198

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 107/187 (57%), Gaps = 4/187 (2%)
 Frame = -1

Query  1012  HNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPD  833
             +N L  F+++LA+   A      G     ++R +C  T + +LC  SL+  S+     P 
Sbjct  10    YNFLTVFLILLAFTTAA--RPDSGETNREFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQ  67

Query  832   RWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLR  653
               A   LSV+I   ++ +  + K+     +  R   A+ DCVE   D +  L +SLG ++
Sbjct  68    LLAHESLSVSIETAQSTSTMMIKVAHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEMK  127

Query  652   KLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNAL  479
             +L  ++F  +M D+ TW+SAALTNEDTC +GF G+    KV+ +V  K+  V+++TSNAL
Sbjct  128   QLRGRDFDMKMSDIQTWVSAALTNEDTCTEGFAGKAMNGKVKTVVREKILEVAHMTSNAL  187

Query  478   ALVNKLA  458
             AL+N+LA
Sbjct  188   ALINRLA  194



>ref|XP_006490092.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=209

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 95/158 (60%), Gaps = 2/158 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +C VT++ DLC ++L+ +++  + +P   A   LSV++ + K+ +  + KL    
Sbjct  50   EFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKLSKGL  109

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             LR R   A+ DCVE   D++D L +SL  ++ L    F  ++ D+ TW+SAALTNEDTC
Sbjct  110  ELRPREASAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWVSAALTNEDTC  169

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKL  461
            +D F G     KV+  +  ++   S L SNALAL+N+L
Sbjct  170  MDNFEGNGMNGKVKDTIRGRIVRASQLISNALALINQL  207



>ref|XP_006440386.1| hypothetical protein CICLE_v10022313mg [Citrus clementina]
 gb|ESR53626.1| hypothetical protein CICLE_v10022313mg [Citrus clementina]
 gb|KDO48402.1| hypothetical protein CISIN_1g028904mg [Citrus sinensis]
Length=202

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             Y+R +CS TI++ LC  SL+ ++ K K++P   A   L++T++  K+ +  + K+    
Sbjct  35   EYIRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKSTSRMMVKMSRIP  94

Query  748  sLRGRSQI-ALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDT  572
             +  R    A+ DC+E   D++D L  S+  L  +   NF   MGDV TW+SAALT EDT
Sbjct  95   GMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNSNFWLTMGDVQTWVSAALTYEDT  154

Query  571  CLDGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLA  458
            C+DG  GRP     + ++ + +  V++LTSNALAL+N  A
Sbjct  155  CVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINSYA  194



>gb|KDO65436.1| hypothetical protein CISIN_1g028434mg [Citrus sinensis]
Length=209

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 95/158 (60%), Gaps = 2/158 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +C VT++ DLC ++L+ +++  + +P   A   LSV++ + K+ +  + KL    
Sbjct  50   EFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKLSKGL  109

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             LR R   A+ DCVE   D++D L +SL  ++ L    F  ++ D+ TW+SAALTNEDTC
Sbjct  110  ELRPREASAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWVSAALTNEDTC  169

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKL  461
            +D F G     KV+  +  ++   S L SNALAL+N+L
Sbjct  170  MDNFEGNGVNGKVKDTIRGRIVRASQLISNALALINQL  207



>ref|XP_006421708.1| hypothetical protein CICLE_v10007178mg [Citrus clementina]
 gb|ESR34948.1| hypothetical protein CICLE_v10007178mg [Citrus clementina]
Length=209

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 95/158 (60%), Gaps = 2/158 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +C VT++ DLC ++L+ +++  + +P   A   LSV++ + K+ +  + KL    
Sbjct  50   EFIKTSCRVTLYPDLCYNTLSSYASTIQTNPTELANAALSVSLNEAKSTSALVLKLSKGL  109

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             LR R   A+ DCVE   D++D L +SL  ++ L    F  ++ D+ TW+SAALTNEDTC
Sbjct  110  ELRPREAGAVKDCVENTRDSVDELQQSLQAMKDLKGPEFEFKINDLQTWVSAALTNEDTC  169

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKL  461
            +D F G     KV+  +  ++   S L SNALAL+N+L
Sbjct  170  MDNFEGNGMNGKVKDTIRGRIVRASQLISNALALINQL  207



>ref|XP_006838616.1| hypothetical protein AMTR_s00002p00229990 [Amborella trichopoda]
 gb|ERN01185.1| hypothetical protein AMTR_s00002p00229990 [Amborella trichopoda]
Length=205

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 95/160 (59%), Gaps = 0/160 (0%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C  T +  LC+ SL+ ++   +  P + A   LSV++ + K+ +  ++KL +   
Sbjct  46   FIRASCRTTRYPALCVSSLSAYAPAIRTSPRQLAHAALSVSLTRAKSTSSFVAKLGTTRG  105

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            LR R   A+ DCVE   D++D + RSLG + ++    F  +M +V TW+SAALTNE+TC+
Sbjct  106  LRAREAGAIRDCVENMGDSVDEIKRSLGEMGRVGGGTFQWRMSNVQTWVSAALTNENTCV  165

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTGP  446
            DGF          +  ++ NV+ +TSNALALVN LA   P
Sbjct  166  DGFQGVDGSTKSAVKARIQNVAQVTSNALALVNCLAAPAP  205



>gb|KDP25617.1| hypothetical protein JCGZ_20773 [Jatropha curcas]
Length=204

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 98/161 (61%), Gaps = 2/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            +Y++ +C+ T +  LC HSL+ +++K K +P     + L+VT++  K+ +  + +L    
Sbjct  39   QYIKTSCTNTTYPRLCYHSLSIYASKIKTNPKLLTNIALNVTLKATKSTSRLMKRLSRIH  98

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R   AL DCVE   D++  L RS+G + +     F   + D+ TW+SAALT++DTC
Sbjct  99   GLKRREAAALVDCVEVVGDSVYELQRSIGEMGQAEGSKFAQVIDDIQTWVSAALTDDDTC  158

Query  568  LDGFGR-PKRKKVRWLVNK-VTNVSYLTSNALALVNKLATT  452
            +DGF      +KV+ +  K +  +++LTSNALAL+N  A++
Sbjct  159  MDGFSEVSMNRKVKIIARKHLLKIAHLTSNALALINNFASS  199



>ref|XP_009594970.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=204

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 94/159 (59%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  +      P   A   L+V++   ++ +  + KL    
Sbjct  42   EFIRTSCKSTTYPNLCFSSLSGRATAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAHVQ  101

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L  R   A+ DCVE   D +D L +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  102  GLTPREVGAMHDCVEELSDTVDELRKSLGEMKQLRGKDFDLKMSDIQTWVSAALTDEDTC  161

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  K+  V++LTSNALAL+N LA
Sbjct  162  TEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALINSLA  200



>ref|XP_009351520.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=211

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 101/171 (59%), Gaps = 11/171 (6%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T++ DLC  SL+ F++  +++P R A+V + V++ + + IA  +S +  Q 
Sbjct  39   EFIRTSCGTTLYPDLCYTSLSRFASAVQDNPTRLAKVAIGVSLARARRIAAYVSNISRQA  98

Query  748  sLRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNA--------KNFTTQMGDVTTWM  599
                  R+  AL DC   F DA+D +  SL  +R+L++         +F  QM +V TWM
Sbjct  99   DYGADPRASSALHDCFSNFGDAVDEIRGSLKQMRQLSSTANSRGGSSSFRFQMSNVQTWM  158

Query  598  SAALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            SAALT+E+TC DGF   +   ++  V N+V NV  +TSNALALVN +A  G
Sbjct  159  SAALTDEETCTDGFDDVEDGPLKTDVSNRVENVKKVTSNALALVNSVAEKG  209



>ref|XP_009779202.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=206

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 94/159 (59%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  S      P   A   L+V++   ++ +  + KL    
Sbjct  44   EFIRTSCKSTTYPNLCFSSLSSRSAAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAHVQ  103

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L  R   A+ DCVE   D +D L +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  104  GLTPREVGAMHDCVEELSDTVDELRKSLGEMKQLRGKDFDLKMNDIQTWVSAALTDEDTC  163

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  K+  V++LTSNALALVN +A
Sbjct  164  TEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALVNSVA  202



>ref|XP_006367807.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=198

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 105/186 (56%), Gaps = 4/186 (2%)
 Frame = -1

Query  1012  HNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPD  833
             +N L  F+++LA+   A      G     ++R +C  T + +LC  SL+  S+     P 
Sbjct  10    YNFLTVFLILLAFTTAA--RPDSGETNTEFIRTSCKSTTYPNLCFSSLSSRSSAIGVSPQ  67

Query  832   RWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLR  653
               A   LSV+I   ++ +  + K+     +  R   A+ DCVE   D +  L +SLG ++
Sbjct  68    LLAHESLSVSIETAQSTSTMMIKVAHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEMK  127

Query  652   KLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNAL  479
             +L  ++F  +M D+ TW+SAALTNEDTC +GF G+    KV+ +V  K+  V+++TSNAL
Sbjct  128   QLRGRDFDMKMSDIQTWVSAALTNEDTCTEGFAGKAMNGKVKTVVRGKIVEVAHMTSNAL  187

Query  478   ALVNKL  461
             AL+N L
Sbjct  188   ALINTL  193



>emb|CDX87244.1| BnaC09g05590D [Brassica napus]
Length=199

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 101/188 (54%), Gaps = 2/188 (1%)
 Frame = -1

Query  1012  HNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPD  833
             H+ L   ++  A                 +V+ +C+VT +  LC+ SL+  ++  +  P 
Sbjct  9     HHFLTSLLITAAITITTLKSVHTTATNTEFVKSSCTVTTYPRLCVASLSTHASLIQTSPK  68

Query  832   RWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLR  653
               A   L++T+   KA +  + +L S   L+ R   A+ DCVE   D LD L +S+G + 
Sbjct  69    LMAHAALNITLASAKATSVMMVRLSSSSQLKPREVSAMRDCVEELGDTLDELRKSIGEMG  128

Query  652   KLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNAL  479
             +L   ++   M D+ TW+SAALT+E+TC DGF G     KV+  V  ++  +++LTSNAL
Sbjct  129   QLIGSSYEVYMSDIQTWVSAALTDENTCTDGFEGDDMNGKVKVFVRERILVIAHLTSNAL  188

Query  478   ALVNKLAT  455
             AL+N  A+
Sbjct  189   ALINHFAS  196



>ref|XP_010259038.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=208

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +C  T++  LCI SL+ +++  +  P   A   L+V++   ++ +  +++L    
Sbjct  46   EFIKTSCDTTMYPKLCISSLSGYASAIQTDPKLLADAALNVSLTNARSTSTMMTELSRSH  105

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DCVE   D++D L RS+  +  L   N   Q+ ++ TW+SAALTNEDTC
Sbjct  106  GMKPREAAAMQDCVETVGDSVDELQRSMAEMGHLGGPNLAFQISNIQTWVSAALTNEDTC  165

Query  568  LDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLATTGP  446
            +DGF G+     ++  V  ++ N++ LTSNAL+ +N L  T P
Sbjct  166  MDGFAGKAVDGSIKTTVRARILNLAQLTSNALSFINGLVKTSP  208



>ref|XP_002263991.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=200

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  TI+  LC  SL+  +N  +  P   A   LSVT+   ++ +  +S L    
Sbjct  38   EFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARSTSSVMSNLLLSH  97

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R  +A+ DCVE   D++D L +++G + ++   NF   M D+ TW+SAALT EDTC
Sbjct  98   GLKPREVVAMKDCVEELSDSVDQLRKAMGEMNQIKGSNFGLIMNDIQTWVSAALTYEDTC  157

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGF G     K++  V  ++  ++++TSNALAL+N  A+
Sbjct  158  TDGFAGNTMDGKLKKAVRTRIVKIAHMTSNALALINSYAS  197



>ref|XP_010919458.1| PREDICTED: 21 kDa protein [Elaeis guineensis]
Length=208

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 99/161 (61%), Gaps = 2/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            R++R +CS T +  LC +SL+ +++  +N P + A   LSV++   ++ +  +S++ + G
Sbjct  44   RFIRTSCSATKYPILCFNSLSSYASTIQNSPMKLAHAALSVSLSTARSTSTMMSRMCTAG  103

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DC+E   D++D L  SL  +  +  KN    + D+ TW+SAALT++DTC
Sbjct  104  RMKPREVAAVSDCMENLGDSVDELQESLAEMAHMRGKNMGLTINDIQTWVSAALTDDDTC  163

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            +DGF G     +V+  V   V  V+ LTSNALAL+N L++T
Sbjct  164  MDGFAGNAMNGEVKNAVRGHVVKVARLTSNALALINALSST  204



>emb|CAN70288.1| hypothetical protein VITISV_015784 [Vitis vinifera]
Length=200

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  TI+  LC  SL+  +N  +  P   A   LSVT+   ++ +  +S L    
Sbjct  38   EFIRTSCGTTIYPRLCFTSLSAHANVIQTSPRLLADTALSVTLSTARSTSSVMSNLLLSH  97

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R  +A+ DCVE   D++D L +++G + ++   NF   M D+ TW+SAALT EDTC
Sbjct  98   GLKPREVVAMKDCVEELSDSVDQLRKAMGEMNQIKGSNFGLIMNDIQTWVSAALTYEDTC  157

Query  568  LDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLAT  455
             DGF G     K++  V  ++  ++++TSNALAL+N  A+
Sbjct  158  TDGFAGNTMDGKLKKAVRARIVKIAHMTSNALALINSYAS  197



>emb|CBA10126.1| PME inhibitor [Nicotiana benthamiana]
Length=205

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 94/159 (59%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  +      P   A   L+V++   ++ +  + KL    
Sbjct  43   EFIRTSCKSTTYPNLCFSSLSSRATAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAHVR  102

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L  R   A+ DCVE   D +D + +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  103  GLTPREVGAMHDCVEELSDTVDEMRKSLGEMKQLRGKDFDLKMNDIQTWVSAALTDEDTC  162

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  K+  V++LTSNALAL+N LA
Sbjct  163  TEGFAGKVMNGKVKTVVRGKILEVAHLTSNALALINSLA  201



>ref|XP_010473498.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=270

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 99/161 (61%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y++ +C++T+++ LC  SL+P+++K  ++P + A + L++T+   K+ +  +  +   G 
Sbjct  105  YIKTSCNLTLYKTLCYISLSPYASKIISNPQKLAIIALNLTLTSAKSASKFIKNVSHGGG  164

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN---FTTQMGDVTTWMSAALTNED  575
            L G   +A+ DCVE   D++ SL  S+  L  +N K+   F   M DV TW+SAALT++D
Sbjct  165  LTGLEAVAVADCVEEIGDSVISLQDSIRELDSINHKDSRKFEMVMSDVQTWVSAALTDDD  224

Query  574  TCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            TC+DGF R K      +   V  V+ LTSNALAL+N  A+T
Sbjct  225  TCMDGFRRIKTVVKDLVRQHVVKVARLTSNALALINMYAST  265



>ref|XP_011070592.1| PREDICTED: 21 kDa protein-like [Sesamum indicum]
Length=210

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 88/160 (55%), Gaps = 5/160 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVK--AIAgslsklks  755
             ++R +C  T++ +LC HSLA ++N  +  P R ARV + V++ +     I  +    + 
Sbjct  43   EFIRTSCETTLYPELCYHSLAGYANAVQQDPGRLARVAIGVSLSRATRMTIYLANVSRQV  102

Query  754  qgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA--KNFTTQMGDVTTWMSAALTN  581
                  R  +AL DC   F DA+D +  SL  +R+L    +    QM +V TWMSAALTN
Sbjct  103  DYGADHREAVALHDCFTVFGDAVDQIRGSLKQMRQLTGTGEELRFQMSNVQTWMSAALTN  162

Query  580  EDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNK  464
            EDTC+DGF       V+  V ++   V  +TSNALALVN 
Sbjct  163  EDTCVDGFEDVGDGPVKMDVCDRTVKVKEVTSNALALVNS  202



>ref|XP_007209621.1| hypothetical protein PRUPE_ppa011699mg [Prunus persica]
 gb|EMJ10820.1| hypothetical protein PRUPE_ppa011699mg [Prunus persica]
Length=200

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 97/162 (60%), Gaps = 3/162 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            +Y++ +CSVTI+  LC HSL+ ++ K K  P   A   L+VT+   +  +  + +L    
Sbjct  34   QYIKRSCSVTIYPRLCYHSLSIYAGKIKTDPKVLAHTALNVTLAATQESSVIMRRLSEIH  93

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVL-RKLNAKNFTTQMGDVTTWMSAALTNEDT  572
             L+     A+ DC+E   DA+  L +SL  L   +   NF  QM D+ TW+SAALT+EDT
Sbjct  94   GLKPIETAAVLDCMEEIGDAILELQQSLDELGHVVRGSNFWFQMSDIQTWVSAALTDEDT  153

Query  571  CLDGFGRPK-RKKVRWLVNKVT-NVSYLTSNALALVNKLATT  452
            C+DGF     R +V  +V + T NV++LTSNALAL+N  A++
Sbjct  154  CMDGFEEHHLRGRVEAVVRRYTVNVAHLTSNALALINSYASS  195



>ref|XP_010062118.1| PREDICTED: 21 kDa protein-like [Eucalyptus grandis]
 gb|KCW90824.1| hypothetical protein EUGRSUZ_A02883 [Eucalyptus grandis]
Length=201

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 92/159 (58%), Gaps = 2/159 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +CS T +  LC  SL+  +   +  P   A   L VT++  ++++  +  L     
Sbjct  40   FIRTSCSKTTYPKLCFSSLSSHAAAIQMSPKLLACTALDVTLKNARSVSVLMVNLSRSQG  99

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+ R   A+ DC+E   DA+D L RS+  ++ L  ++F   + DV TW SAALT+EDTC 
Sbjct  100  LKPREAAAMQDCMELLGDAVDELRRSIAEMKDLKERDFKLMISDVQTWASAALTDEDTCS  159

Query  565  DGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLAT  455
            DGF G+    KV+ +V   +  +S+LTSNALAL+N  A+
Sbjct  160  DGFAGKEMDGKVKTVVRAWIVTLSHLTSNALALINAYAS  198



>ref|XP_002510934.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51536.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=185

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 96/158 (61%), Gaps = 2/158 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C  T + DLC  +L+ +++  + +P + A   L+VT+   ++ + S+  +    +
Sbjct  28   FIKTSCGATRYPDLCYQTLSAYASSIQENPLQLANAALNVTLESAESTSNSVLNMLKAHN  87

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L  +   A+ DCVE  +D++D L  SL  +  L   +F  +M ++ TW+SAALT+EDTC+
Sbjct  88   LSPKEAGAISDCVENMKDSVDELRESLMTMTDLEGPDFNMKMSNIQTWVSAALTDEDTCM  147

Query  565  DGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
            DGF G     KV+  + + +  V+ LTSNALAL+NK+A
Sbjct  148  DGFEGNAMNGKVKNTIRSYIEKVAQLTSNALALINKVA  185



>ref|XP_006826919.1| hypothetical protein AMTR_s00010p00168350 [Amborella trichopoda]
 gb|ERM94156.1| hypothetical protein AMTR_s00010p00168350 [Amborella trichopoda]
Length=186

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 98/184 (53%), Gaps = 8/184 (4%)
 Frame = -1

Query  994  FMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVG  815
            F LVL  + P             ++R +C  T++  LC  SL+ +S+  K  P + AR  
Sbjct  6    FSLVLTVVLPTI-TAVTNDSRSDFIRTSCDTTLYPSLCYDSLSVYSDSIKQSPSQLARAA  64

Query  814  LSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN  635
            +SV+++  +  +  +++L       G    ++ DC E   DALD + RS   L +L+   
Sbjct  65   VSVSLKSTQKASALVARLGHSTREHG----SVRDCAENLADALDQVKRSARELSRLSRAG  120

Query  634  FTTQMGDVTTWMSAALTNEDTCLDGF---GRPKRKKVRWLVNKVTNVSYLTSNALALVNK  464
            F  QMG+V TW+SAA+TN+DTC+DGF   G      V  L  +V+    +TSNALALVN 
Sbjct  121  FRLQMGNVQTWLSAAITNDDTCMDGFDGSGESDGGGVTALSGRVSCAKQVTSNALALVNN  180

Query  463  LATT  452
            LA T
Sbjct  181  LAET  184



>ref|XP_007225804.1| hypothetical protein PRUPE_ppa011318mg [Prunus persica]
 gb|EMJ27003.1| hypothetical protein PRUPE_ppa011318mg [Prunus persica]
Length=215

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 98/169 (58%), Gaps = 9/169 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C  T++  +C  SL+ +++  +N+P + A+V + V++ + + +A  +S +  Q  
Sbjct  41   FIRTSCGTTLYPQVCYTSLSRYASAIQNNPAQLAKVAIGVSLAKARRMAAYVSDISRQAD  100

Query  745  LRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN------FTTQMGDVTTWMSAA  590
                 RS  AL DC   F++A+D +H SL  +R+L+         F  QM +V TWMSAA
Sbjct  101  YGADPRSAAALHDCFSNFDEAVDQIHDSLTQMRQLSGPAGSGGGSFLFQMSNVQTWMSAA  160

Query  589  LTNEDTCLDGFGRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLATTGP  446
            LT+E+TC DGF       ++  V K V NV  +TSNALALVN  A  GP
Sbjct  161  LTDEETCTDGFEDVAEGPLKTDVTKRVENVKKVTSNALALVNSFAQKGP  209



>ref|XP_006381574.1| hypothetical protein POPTR_0006s14010g [Populus trichocarpa]
 gb|ERP59371.1| hypothetical protein POPTR_0006s14010g [Populus trichocarpa]
Length=204

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 100/186 (54%), Gaps = 3/186 (2%)
 Frame = -1

Query  1018  PFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNH  839
             PF      F+ +    +P              VR +C    + +LC+ +L+ ++  A N 
Sbjct  10    PFSLFNLLFIFISFSTSPYSAAAKSHNAPRDLVRSSCVHASYPNLCLRTLSSYAGPA-NT  68

Query  838   PDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGV  659
             P   A+  + V+I + + ++  LS L      R R  +AL DC+E   D++D L ++LG 
Sbjct  69    PRDLAQAAVKVSIARARKVSNYLSTLSGLKKKRER--VALSDCIEQIYDSVDELSKTLGE  126

Query  658   LRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNAL  479
             L+ L  + F  QM +  TW+SAALTNEDTCLDGF   + K    +  K+TNV+ +TSNAL
Sbjct  127   LKHLREETFGWQMSNAQTWVSAALTNEDTCLDGFHEVESKAKDDVKRKITNVARVTSNAL  186

Query  478   ALVNKL  461
              ++N+L
Sbjct  187   YMINRL  192



>ref|XP_007160400.1| hypothetical protein PHAVU_002G318700g [Phaseolus vulgaris]
 gb|ESW32394.1| hypothetical protein PHAVU_002G318700g [Phaseolus vulgaris]
Length=213

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 97/169 (57%), Gaps = 9/169 (5%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsk---lk  758
             ++R +C+ T++ D+C  SL+ ++N  + +P + ARV +SV++ +    A  +S      
Sbjct  43   EFIRSSCNTTLYPDVCFTSLSRYANAVQQNPGQLARVAISVSLSKAHRAASYISNLTHDA  102

Query  757  sqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAK-----NFTTQMGDVTTWMSA  593
              G+   R+ +AL DC     DA+D +  SL  +R++ A      +F  QM +V TWMSA
Sbjct  103  DYGTSGSRAALALHDCFSNLGDAVDEIRGSLKQMRQIGAAGEGAGSFLFQMSNVQTWMSA  162

Query  592  ALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            ALT+E+TC DGF       V+  V N+VTNV   TSNALALVN  A  G
Sbjct  163  ALTDEETCTDGFQDVAECPVKADVCNRVTNVKKFTSNALALVNSYAGKG  211



>gb|ABK22757.1| unknown [Picea sitchensis]
Length=199

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 89/161 (55%), Gaps = 1/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAg-slsklksq  752
             ++R +C+VT++  +C+ SL+ ++   K          + V++     ++  +      +
Sbjct  37   EFIRTSCNVTLYPQVCVSSLSSYAGPLKPKQSDLVNAAVQVSLVNTHNVSVWAAGLKTRR  96

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDT  572
             ++  R + AL DC+E F   +D +H+SL  L+ L    F  QM +V TWMSAALTNED+
Sbjct  97   ATMSKREKAALKDCMENFGTTMDQIHQSLAELKHLRRNTFKIQMSNVETWMSAALTNEDS  156

Query  571  CLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            CLDGF   K +    +  +V  +S L SNALALVN  A TG
Sbjct  157  CLDGFQVAKGRVKAMVTGRVHYLSKLISNALALVNTFAATG  197



>ref|XP_009779211.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=205

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 95/159 (60%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  S      P   A   L+V++   ++ + ++ KL    
Sbjct  43   EFIRTSCKSTTYPNLCFSSLSSRSTAIGVSPQLLAHESLTVSLETAQSTSATMLKLAHGQ  102

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   DA+  L +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  103  GMTAREVGAMHDCVEELSDAVVELRKSLGEMKQLRGKDFDLKMNDIQTWVSAALTDEDTC  162

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  ++  V+++TSNALAL+N LA
Sbjct  163  TEGFAGKVMNGKVKTVVRGRILEVAHMTSNALALINSLA  201



>gb|ACN40648.1| unknown [Picea sitchensis]
Length=199

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 89/161 (55%), Gaps = 1/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAg-slsklksq  752
             ++R +C+VT++  +C+ SL+ ++   K          + V++     ++  +      +
Sbjct  37   EFIRTSCNVTLYPQVCVSSLSSYAGPLKPKQSDLVNAAVQVSLVNTHNVSVWAAGLKTRR  96

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDT  572
             ++  R + AL DC+E F   +D +H+SL  L+ L    F  QM +V TWMSAALTNED+
Sbjct  97   ATMSKREKAALKDCMENFGTTMDQIHQSLAELKHLRRNTFKIQMSNVETWMSAALTNEDS  156

Query  571  CLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            CLDGF   K +    +  +V  +S L SNALALVN  A TG
Sbjct  157  CLDGFEVAKGRVKAMVTGRVHYLSKLISNALALVNTFAATG  197



>gb|ABG47806.1| pectin methlyesterase inhibitor protein 1 [Capsicum annuum]
 gb|ABG81102.1| pectin methlyesterase inhibitor protein 1 [Capsicum annuum]
Length=200

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 95/159 (60%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  ++     P   A   L+V++   ++ +  + KL    
Sbjct  38   EFIRTSCKSTTYPNLCFSSLSSRASAIGASPQLLAHESLTVSLETAQSTSSMMLKLAHGQ  97

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   D +  L +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  98   GMTPREIGAMHDCVEELSDTVVGLRKSLGEMKQLRGKDFDLKMNDIQTWVSAALTDEDTC  157

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  K+  V++LTSNALAL+N+LA
Sbjct  158  TEGFDGKVMNGKVKTVVRGKILEVAHLTSNALALINRLA  196



>gb|KFK27963.1| hypothetical protein AALP_AA8G454300 [Arabis alpina]
Length=199

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 101/188 (54%), Gaps = 2/188 (1%)
 Frame = -1

Query  1012  HNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPD  833
             H+ L  F++ +                  +V+ AC+ T +  LCI SL+  +   +  P 
Sbjct  9     HHFLASFLITITIATLKSVYTTTPTTNTEFVKSACTYTTYPRLCIASLSTHATLIQTSPK  68

Query  832   RWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLR  653
               A   L++T+   KA +  + +L S   L+ R   A+ DCVE   D ++ L +S+G + 
Sbjct  69    LMAHAALNITLASAKATSAMMVRLSSNVQLKPREVSAMRDCVEELGDTVEELRKSIGEMG  128

Query  652   KLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNAL  479
             +LN+ N+   + D+ TW+SAALT+E+TC DGF G     K +  V  ++  +++LTSNAL
Sbjct  129   QLNSSNYEVYISDIQTWVSAALTDENTCTDGFQGDEMNGKAKVFVRGRILFIAHLTSNAL  188

Query  478   ALVNKLAT  455
             AL+N  A+
Sbjct  189   ALINHFAS  196



>gb|KEH32318.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=207

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 100/172 (58%), Gaps = 12/172 (7%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C+ T++ D+C  SL+ ++N  + +P + AR+ ++V+  +V   A  LS L  + 
Sbjct  34   EFIRSSCNATLYPDICYTSLSRYANAVQQNPGQLARIAIAVSFSKVHRTASYLSNLTREA  93

Query  748  sLRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNA---------KNFTTQMGDVTTW  602
               G  R+ +AL DC    +DA+D +  SL  +R++ A          +F  QM +V TW
Sbjct  94   DYSGSSRAALALHDCFSNLDDAVDEIRGSLKQMRQIGAAGTGAGAGADSFLFQMSNVQTW  153

Query  601  MSAALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            MSAALT+E+TC DGF   +   V+  V N+V+ V  LTSNALALVN  A  G
Sbjct  154  MSAALTDEETCTDGFQDVEDCPVKADVQNRVSKVKKLTSNALALVNGYAQKG  205



>ref|XP_003530773.1| PREDICTED: 21 kDa protein-like [Glycine max]
Length=214

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 98/167 (59%), Gaps = 8/167 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C+ T++ D+C  SL+ +++  + +P + ARV +SV++ +V   A  +S L     
Sbjct  46   FIRTSCNTTLYPDVCFTSLSRYASAVQQNPGQLARVAISVSLSKVHRAASYVSNLTRDAD  105

Query  745  LRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNA-----KNFTTQMGDVTTWMSAAL  587
              G  R+ +AL DC     DA+D +  SL  +R++ A      +F  QM +V TWMSAAL
Sbjct  106  YDGTTRAALALHDCFSNLGDAVDEIRGSLKQMRQIGAAGAGASSFLFQMSNVQTWMSAAL  165

Query  586  TNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            T+E+TC DGF       V+  V ++VTNV   TSNALALVN  A  G
Sbjct  166  TDEETCTDGFQDVADCPVKTDVCDRVTNVKKFTSNALALVNSYANKG  212



>gb|KEH21383.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=216

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 100/172 (58%), Gaps = 12/172 (7%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C+ T++ D+C  SL+ ++N  + +P + AR+ ++V+  +V   A  LS L  + 
Sbjct  43   EFIRSSCNATLYPDICYTSLSRYANAVQQNPGQLARIAIAVSFSKVHRTASYLSNLTREA  102

Query  748  sLRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNA---------KNFTTQMGDVTTW  602
               G  R+ +AL DC    +DA+D +  SL  +R++ A          +F  QM +V TW
Sbjct  103  DYSGSSRATLALHDCFSNLDDAVDEIRGSLKQMRQIGAAGTGAGAGADSFLFQMSNVQTW  162

Query  601  MSAALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            MSAALT+E+TC DGF   +   V+  V N+V+ V  LTSNALALVN  A  G
Sbjct  163  MSAALTDEETCTDGFQDVEDCPVKADVQNRVSKVKKLTSNALALVNGYAQKG  214



>ref|XP_010259039.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=197

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 102/163 (63%), Gaps = 5/163 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C  T +  +C+ SLA ++N  +  P + A+  L V++ + K+    +SK+     
Sbjct  29   FIKTSCGATRYPTVCVESLAVYANAIQQSPRQLAQTALKVSLDRAKSTKVFVSKMTRMHG  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRS---LGVLRKLNAKNFTTQMGDVTTWMSAALTNED  575
            L+GR   A+ DCV+   +++D L RS   LG + + ++++F   M +V TW+SAALT+E+
Sbjct  89   LKGRQYQAVKDCVDTMGNSVDRLSRSIQELGQISRGSSQDFMWHMSNVQTWVSAALTDEN  148

Query  574  TCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            TC+DGF GR     V+  +  K+ NV+ +TSNALALVN+ A+T
Sbjct  149  TCMDGFAGRGMDGHVKMAIRGKIVNVAQVTSNALALVNQYAST  191



>gb|KFK40568.1| hypothetical protein AALP_AA2G013000 [Arabis alpina]
Length=201

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 94/161 (58%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y++ +C++T+++++C +SL+P+++   + P + A   L++T+   K+    +  +  +  
Sbjct  38   YIKTSCNLTLYKNICYNSLSPYASTIDSKPQKLAVTALNLTLSSAKSALKVIKAISHKTG  97

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN---FTTQMGDVTTWMSAALTNED  575
            L      A+ DCVE   D++  L  SL  L  +N K+   F   + DV TW SAALTN+D
Sbjct  98   LTRLEVAAVNDCVEEIGDSVSELQDSLRELDSINNKDSSKFEMVVSDVQTWASAALTNDD  157

Query  574  TCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            TC+DGFGR        +   V NV+ LTSNALAL+N  A+T
Sbjct  158  TCMDGFGRAGTVMKDLVRQHVVNVARLTSNALALINMYAST  198



>gb|EYU24972.1| hypothetical protein MIMGU_mgv1a023170mg [Erythranthe guttata]
Length=187

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 102/181 (56%), Gaps = 2/181 (1%)
 Frame = -1

Query  994  FMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVG  815
             +++ + I   C    GG    R++R +CS T +  LC  +L+  ++  +  P   A V 
Sbjct  3    ILIIGSSIDSGCAAAAGGKPDTRFIRTSCSTTTYPTLCYTALSNHASAIQQDPKLLAHVA  62

Query  814  LSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN  635
            LSV++   +  +  + ++  +  +  R   A+ DCVE   D+++ L RS+  + ++N  N
Sbjct  63   LSVSLDTARTTSVDMVRISRRAGITPREAGAMRDCVEELSDSVEQLGRSMSEMNRMNRSN  122

Query  634  FTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKL  461
            F   M D+ TW+SAA+T+EDTC++GF G+      +  +  ++ NV+++TSNALAL+N  
Sbjct  123  FGRTMSDIQTWVSAAMTDEDTCMEGFAGKFMNGAAKSAIRTRIVNVAHMTSNALALINSY  182

Query  460  A  458
            A
Sbjct  183  A  183



>ref|NP_176463.2| plant invertase/pectin methylesterase inhibitor domain-containing 
protein [Arabidopsis thaliana]
 gb|AAF19547.1|AC007190_15 F23N19.12 [Arabidopsis thaliana]
 gb|AEE34001.1| plant invertase/pectin methylesterase inhibitor domain-containing 
protein [Arabidopsis thaliana]
Length=312

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y++ +C++T+++ +C +SL+P+++  +++P + A + L++T+   K+ +  +  +   G 
Sbjct  147  YIKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKFVKNISHGGG  206

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN---FTTQMGDVTTWMSAALTNED  575
            L     +A+ DCVE   D++ SL  S+  L  +N K+   F   M DV TW+SAALTN+D
Sbjct  207  LTRLEVVAVADCVEEIGDSVTSLQDSIRELDSINYKDSAKFEMVMSDVETWVSAALTNDD  266

Query  574  TCLDGFGRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLATT  452
            TC+DGF   K   V+ LV + V  V+ LTSNALAL+N  A+T
Sbjct  267  TCMDGFSLVK-TAVKDLVRRHVVEVARLTSNALALINMYAST  307



>ref|XP_009362111.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=201

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 96/167 (57%), Gaps = 3/167 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            +Y++ +CSVT +  LC +SL+ ++ K K +P   AR  L+VTI   +    ++ +L    
Sbjct  33   QYIKRSCSVTTYPKLCYNSLSIYAGKIKTNPKVLARTALNVTIAATQETYVTMKRLSKTH  92

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL-NAKNFTTQMGDVTTWMSAALTNEDT  572
             L      A  DCVE   DA++ + +S+     +    NF  QM D+ TW+SAALT+EDT
Sbjct  93   GLNPIEAAAALDCVEEIGDAVEEVQKSIDEFGHVARGSNFWVQMSDIQTWVSAALTDEDT  152

Query  571  CLDGFGRPKRK-KVRWLVNK-VTNVSYLTSNALALVNKLATTGPQCL  437
            C+DGF       +V  LV + + NV++LTSNALAL+N  A+   + L
Sbjct  153  CMDGFDEHHMSGRVESLVRRYIVNVAHLTSNALALINSYASASTEAL  199



>ref|XP_009597893.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
 dbj|BAA95794.1| DC1.2 homologue [Nicotiana tabacum]
Length=205

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 96/159 (60%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  +      P   A   L+V++   ++ + ++ +L    
Sbjct  43   EFIRTSCKSTTYPNLCFSSLSSRATAIGVSPQLLAHESLTVSLETAQSTSVTMVELAHGQ  102

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   DA+  L +SLG +++L  K+F  +M D+ TW+SAALT+EDTC
Sbjct  103  GMTPREIGAMHDCVEELSDAVVELRKSLGEMKQLRGKDFDLKMSDIQTWVSAALTDEDTC  162

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
             +GF G+    KV+ +V  ++ +V+++TSNALAL+N LA
Sbjct  163  TEGFAGKVMNGKVKTVVRGRILDVAHMTSNALALINSLA  201



>ref|XP_011038600.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=212

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 96/167 (57%), Gaps = 8/167 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg-  749
            Y+R  C  T++ ++C  SL+ +++  +N P R ARV + V++ +   +A  +S L  Q  
Sbjct  44   YIRSGCGATLYPEICYASLSRYASAIQNSPGRLARVAIKVSLLRTSHMAAYVSNLSRQSD  103

Query  748  -sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA-----KNFTTQMGDVTTWMSAAL  587
                 R+  AL DC     DA+D +  SL  +R++ A     ++F  QMG+V TWMSAAL
Sbjct  104  FGADNRAAAALHDCFSNLGDAVDEIRGSLKQMRQVGAAGPSTESFQFQMGNVQTWMSAAL  163

Query  586  TNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            T+++TC DGF      +V+  V N+   V  LTSNALALVN  A TG
Sbjct  164  TDDETCTDGFEDVGDGEVKTEVCNRAAIVKKLTSNALALVNSYAATG  210



>ref|XP_003590138.1| Pectinesterase inhibitor [Medicago truncatula]
 ref|XP_003609717.1| Pectinesterase inhibitor [Medicago truncatula]
 gb|AES91914.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=207

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (58%), Gaps = 12/172 (7%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C+ T++ D+C  SL+ ++N  + +P + AR+ ++V+  +V   A  LS L  + 
Sbjct  34   EFIRSSCNATLYPDICYTSLSRYANAVQQNPGQLARIAIAVSFSKVHRTASYLSNLTREA  93

Query  748  sLRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNA---------KNFTTQMGDVTTW  602
               G  R+ +AL DC    +DA+D +  SL  +R++ A          +F  QM +V TW
Sbjct  94   DYSGSSRAALALHDCFSNLDDAVDEIRGSLKQMRQIGAAGTGAGAGADSFLFQMSNVQTW  153

Query  601  MSAALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            MSAALT+E+TC DGF   +   V+  V N+V+ V   TSNALALVN  A  G
Sbjct  154  MSAALTDEETCTDGFQDVEDCPVKADVQNRVSKVKKFTSNALALVNGYAQKG  205



>ref|XP_008791710.1| PREDICTED: 21 kDa protein [Phoenix dactylifera]
Length=208

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +CS T +  LC  SL+ +++  +N P + A   L+V++   ++ +  +S++ + G
Sbjct  44   EFIRTSCSATEYPILCFDSLSSYASTIQNSPMKLADAALTVSLSTARSTSTMMSRMSAAG  103

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DC+E   D++D L  SL  +  + +KN   Q+ D+ TW+SAALT++DTC
Sbjct  104  GMKPREAAAVSDCMENLGDSVDELQESLAEMAHMRSKNMGLQINDIQTWVSAALTDDDTC  163

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            +DG        +V+  V   V NV+ LTSNALA +N L++T
Sbjct  164  MDGLAANAMNGEVKNAVRGHVVNVAQLTSNALAFINALSST  204



>gb|AFK34211.1| unknown [Medicago truncatula]
Length=207

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (58%), Gaps = 12/172 (7%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C+ T++ D+C  SL+ ++N  + +P + AR+ ++V+  +V   A  LS L  + 
Sbjct  34   EFIRSSCNATLYPDICYTSLSRYANAVQQNPGQLARIAIAVSFSKVHRTASYLSNLTREA  93

Query  748  sLRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNA---------KNFTTQMGDVTTW  602
               G  R+ +AL DC    +DA+D +  SL  +R++ A          +F  QM +V TW
Sbjct  94   DYSGSSRAALALHDCFSNLDDAVDEIRGSLKQMRQIGAAGTGAGAGADSFLFQMSNVQTW  153

Query  601  MSAALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            MSAALT+E+TC DGF   +   V+  V N+V+ V   TSNALALVN  A  G
Sbjct  154  MSAALTDEETCTDGFQDVEDCPVKADVQNRVSKVKKFTSNALALVNGYAQKG  205



>ref|XP_009112019.1| PREDICTED: 21 kDa protein-like [Brassica rapa]
 emb|CDY16779.1| BnaA09g06030D [Brassica napus]
Length=199

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +V+ +C+VT +  LC+ SL+  ++  +  P   A   L++T+   KA +  + +L S  
Sbjct  37   EFVKSSCTVTTYPRLCVASLSTHASLIQTSPKLMAHAALNITLASAKATSVMMVRLSSSS  96

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R   A+  CVE   D LD L +S+G + +L+  ++   M D+ TW+SAALT+E+TC
Sbjct  97   QLKPREVSAMRVCVEELGDTLDELRKSIGEMGQLSGSSYEVYMSDIQTWVSAALTDENTC  156

Query  568  LDGFGRPKRK-KVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGFG      KV+  V  ++  +++LTSNALAL+N  A+
Sbjct  157  TDGFGGDDMNGKVKIFVRERILVIAHLTSNALALINHFAS  196



>gb|AFK49039.1| unknown [Medicago truncatula]
 gb|KEH29367.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 91/160 (57%), Gaps = 2/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++++CS T +  LC  SL   ++  + +        L+VT+   K+ +  +S L     
Sbjct  36   FIKNSCSSTTYPRLCYTSLVKHADSIQTNHVLLTCTALNVTLASAKSTSAMISTLSKSQG  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+ R   A+ DCVE   D++D L RS+G + +L   NF   M DV TW+SAALT+E TC 
Sbjct  96   LKPREAAAMKDCVEELSDSVDELRRSIGEMSRLRTSNFELTMSDVQTWVSAALTDESTCT  155

Query  565  DGFGRPKRK-KVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            DGF        V+  V  K+  V+ LTSNALAL+NKLAT+
Sbjct  156  DGFQEVNAPGNVQTTVRGKIVQVAQLTSNALALINKLATS  195



>emb|CDX86901.1| BnaC03g51710D [Brassica napus]
Length=200

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +V+ +C+ T +  LC+ SL+  S+  +      A   L++T+   KA +  + +L S  
Sbjct  38   EFVKSSCTFTTYPRLCVTSLSTQSSLIQTSHKLIAHAALNITLASAKATSAMMVRLSSSS  97

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R   A+ DCVE   D L+ L +S+G + +L+  N+   M D+ TW+SAALTNE+TC
Sbjct  98   RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMSDIQTWVSAALTNENTC  157

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGF G     KV+ LV  ++  +++LTSNALAL+N  A+
Sbjct  158  SDGFEGDDMNGKVKVLVRGRILVIAHLTSNALALINHFAS  197



>ref|XP_006826916.1| hypothetical protein AMTR_s00010p00166600 [Amborella trichopoda]
 gb|ERM94153.1| hypothetical protein AMTR_s00010p00166600 [Amborella trichopoda]
Length=197

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 91/157 (58%), Gaps = 0/157 (0%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ AC  T++ DLC+ SL+           + AR  L V++   KA AG +++L     
Sbjct  33   FIKTACETTLYPDLCLSSLSGQVEYVTYSHKKLARAALMVSLSATKATAGFVAELIKTAK  92

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            +    Q+AL DCVE  ED  D ++ S+  L+++  ++F  QM +V TW+SAALT+E+ C 
Sbjct  93   VSEEEQMALNDCVEALEDGEDKMNDSMKELQRIKTESFKWQMSNVQTWISAALTDENACS  152

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLAT  455
            DGF     +    +  K+ +++ LTSNAL+LVN  +T
Sbjct  153  DGFEELDGEVKDVIAGKIGDLAQLTSNALSLVNHFST  189



>ref|XP_009401795.1| PREDICTED: 21 kDa protein-like [Musa acuminata subsp. malaccensis]
Length=209

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 98/161 (61%), Gaps = 2/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C+ T++ DLC  SL+ +++  +  P + A V LSV++   ++ + ++S+  +  
Sbjct  45   EFIRASCAATMYPDLCFSSLSSYASTIRTSPVQLADVALSVSLAGARSASAAMSRSIAGR  104

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DC+E   D++D L  SL  +  +  +N   Q+  + TW+SAALT+EDTC
Sbjct  105  GMAPRVAAAVKDCLETMGDSVDELRESLAAMGHVAGRNAAYQINSIQTWVSAALTDEDTC  164

Query  568  LDGFGRPKRK-KVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            +DGF       +V+ +V + V  V+ L+SNALALVN LAT+
Sbjct  165  VDGFASGAMDGEVKNMVRSHVVYVAQLSSNALALVNGLATS  205



>ref|XP_010418274.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=260

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 97/161 (60%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y++ +C+ T+++ LC  SL+P+++K  ++P   A + L++T+   K+ +  +  +   G 
Sbjct  95   YIKTSCNHTLYKTLCYISLSPYASKIISNPQNLAIIALNLTLTSAKSTSKFIKNVSHGGG  154

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN---FTTQMGDVTTWMSAALTNED  575
            L G   +A+ DCVE   D++ SL  S+  L  +N K+   F   M DV TW+SAALT++D
Sbjct  155  LTGLEAVAVADCVEEIGDSVISLQDSIRELDSINHKDSRKFEMVMSDVQTWVSAALTDDD  214

Query  574  TCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            TC+DGF R K      +   V  V+ LTSNALAL+N  A+T
Sbjct  215  TCMDGFRRIKTVVKDLVRQHVVKVARLTSNALALINMYAST  255



>ref|XP_006385730.1| hypothetical protein POPTR_0003s11310g, partial [Populus trichocarpa]
 gb|ERP63527.1| hypothetical protein POPTR_0003s11310g, partial [Populus trichocarpa]
Length=198

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 97/178 (54%), Gaps = 3/178 (2%)
 Frame = -1

Query  976  WIAPACHggggggggGRYVRDAC-SVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTI  800
            +I  +C          RY++ +C   T++  LC H+LA +++  K +P   A   L V++
Sbjct  16   YINSSCSATRPSPRNIRYIKTSCYDTTLYPKLCYHTLAIYASTIKTNPKLLANTALHVSL  75

Query  799  RQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQM  620
            +   + +  + +      L  R   A+ DCVE   DA+  L RS+  +      NF+  M
Sbjct  76   KSTNSTSRLMKRASKTPGLDPRVLAAMLDCVEEVGDAVYELQRSIEEMDHAGGSNFSMVM  135

Query  619  GDVTTWMSAALTNEDTCLDGFGRPK-RKKVRWLVNK-VTNVSYLTSNALALVNKLATT  452
             DV TW+SAALT++DTC+DGF      KKV+  V + +  ++ LTSNALALVN+ A+T
Sbjct  136  NDVETWVSAALTDDDTCMDGFAEGAVNKKVKTTVKRHLGRIARLTSNALALVNRYAST  193



>ref|XP_004234934.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=200

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 105/187 (56%), Gaps = 3/187 (2%)
 Frame = -1

Query  1012  HNILWKFMLVLAWI-APACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHP  836
             +N L  F+++LA+  + +      G     ++R +C  T + +LC  SL+  S+     P
Sbjct  9     YNFLTIFLILLAFTTSTSSTRPATGHTNTEFIRTSCKSTTYPNLCFSSLSSRSSAIGVSP  68

Query  835   DRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVL  656
                A   LSV++   ++ +  + KL     +  R   A+ DCVE   D +  L +SLG +
Sbjct  69    QLLAHESLSVSLETAQSTSAMMLKLSHSQGMTPREVGAMQDCVEELSDTVSELRKSLGEM  128

Query  655   RKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNA  482
             ++L  ++F  +M D+ TW+SAALTNEDTC +GF G+    KV+  +  K+  V+++TSNA
Sbjct  129   KQLRGRDFDMKMSDIQTWVSAALTNEDTCTEGFAGKAMNGKVKTAIRGKIVEVAHMTSNA  188

Query  481   LALVNKL  461
             LAL+N L
Sbjct  189   LALINTL  195



>ref|XP_010553774.1| PREDICTED: 21 kDa protein [Tarenaya hassleriana]
Length=213

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 101/200 (51%), Gaps = 14/200 (7%)
 Frame = -1

Query  1006  ILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRW  827
             ++  F++VL     A            ++R +C+ T++ D+C  SL+ ++   K +P R 
Sbjct  12    LIAAFLMVLHRPISAVQTPSPTTNDLDFIRTSCNATLYPDVCFTSLSGYAAAVKANPARL  71

Query  826   ARVGLSVTIRQVKAIAgslsklksqgsLRG--RSQIALGDCVECFEDALDSLHRSLGVLR  653
             AR+ + +++ + K+ A  L+KL          R+  AL DCV    DA+D +  SL  LR
Sbjct  72    ARLAIGISLSRAKSTAAYLAKLSHAAEYGSDHRTVAALHDCVSNVGDAIDEMRGSLKQLR  131

Query  652   KLN-----------AKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLV-NKVT  509
              +N           A  F  QM +V TWMSAALT+EDTC DGF        +  V  ++ 
Sbjct  132   DINRPAVGAAARRSADTFRFQMSNVQTWMSAALTDEDTCTDGFDDAAEGDTKAEVGERIA  191

Query  508   NVSYLTSNALALVNKLATTG  449
             +V   TSNALALVN  A  G
Sbjct  192   DVKKFTSNALALVNCYANNG  211



>ref|XP_002886456.1| hypothetical protein ARALYDRAFT_893206 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62715.1| hypothetical protein ARALYDRAFT_893206 [Arabidopsis lyrata subsp. 
lyrata]
Length=175

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y++ +C++T+++ LC +SL P+++   ++P + A   L++T+   K+ +  +  +  +G 
Sbjct  10   YIKTSCNLTLYKTLCYNSLYPYASTVHSNPHKLAVTALNLTLSSAKSASKFVKNISHRGG  69

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN---FTTQMGDVTTWMSAALTNED  575
            L     +A+ DCVE   D++ SL  S+  L  +N K+   F   M DV TW+SAALT+++
Sbjct  70   LTLLEAVAVADCVEEIGDSVISLQDSIRELDSINYKDSAKFEMVMSDVETWVSAALTDDE  129

Query  574  TCLDGFGRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLATT  452
            TC+DGF R K   V+ LV + V  V+ LTSNALAL+N  A+T
Sbjct  130  TCMDGFSRVK-TAVKDLVRRHVVEVARLTSNALALINMFAST  170



>ref|XP_006421706.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
 gb|ESR34946.1| hypothetical protein CICLE_v10005926mg [Citrus clementina]
Length=200

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 102/194 (53%), Gaps = 5/194 (3%)
 Frame = -1

Query  1030  NTMLPFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNK  851
             N ML +  IL      L   + + H         R+++ +CS T +  LC  SLA  ++ 
Sbjct  7     NHMLKYFLILLAIFSYLNSSSASRHCPSKIAADRRFIKTSCSSTTYPTLCYKSLARHASL  66

Query  850   AKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHR  671
              +  P   A   L+VT+   K+ +  + K+     ++ R   A+ DC+E   D++D L +
Sbjct  67    IQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKSPGMKPREVDAMQDCLEELSDSVDELRK  126

Query  670   SLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRP--KRKKVRWLVNKVTNVSY  497
             S+G +  + A NF   M D+ TW+SAALT+E TC DGF +     K VR    ++  +++
Sbjct  127   SIGEMGLIKASNFELTMSDIQTWVSAALTDETTCSDGFEKNTVNGKVVRA---QIVKIAH  183

Query  496   LTSNALALVNKLAT  455
             +TSNALAL+N  A+
Sbjct  184   MTSNALALINSYAS  197



>ref|XP_006490094.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
 gb|KDO65438.1| hypothetical protein CISIN_1g027094mg [Citrus sinensis]
Length=228

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 103/194 (53%), Gaps = 5/194 (3%)
 Frame = -1

Query  1030  NTMLPFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNK  851
             N ML +  IL      L   + + HG        R+++ +CS T +  LC  SLA  ++ 
Sbjct  35    NHMLKYFLILLAIFSYLNSSSASRHGPSKIAADRRFIKTSCSSTTYPTLCYKSLARHASL  94

Query  850   AKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHR  671
              +  P   A   L+VT+   K+ +  + K+     ++ R   A+ DC+E   D++D L +
Sbjct  95    IQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKSPGMKPREVDAMQDCLEELSDSVDELRK  154

Query  670   SLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRP--KRKKVRWLVNKVTNVSY  497
             S+G +  + A NF   M D+ TW+SAALT+E TC DGF +     K VR    ++  +++
Sbjct  155   SIGEMGLIKASNFELTMSDIQTWVSAALTDETTCSDGFEKNTVNGKVVRA---QIVKIAH  211

Query  496   LTSNALALVNKLAT  455
             +TSNALAL+N  A+
Sbjct  212   MTSNALALINSYAS  225



>ref|XP_003635233.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
Length=204

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 97/161 (60%), Gaps = 2/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +C VT +  LCI SL+ +++K ++ P   A   LS+++    + + +++KL    
Sbjct  39   EFIQKSCHVTPYPRLCISSLSSYASKIESSPKLLAVTALSMSLETALSTSTAITKLSKIH  98

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+     A+ DCVE   D++D L RSL  ++     NF   M DV TW+SAALT++ TC
Sbjct  99   GLQPAEAAAISDCVEQIRDSVDELQRSLQEMKHPGGSNFVFPMNDVQTWVSAALTDDHTC  158

Query  568  LDGFGRPKRK-KVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            +DGF     K KV  +V +++ +V+ +TSNAL+L+N  A+T
Sbjct  159  MDGFAEIASKGKVHTMVRSRILHVAQMTSNALSLINNYAST  199



>ref|XP_002264028.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CBI24573.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 92/160 (58%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T +  LC  SL+  ++  +  P   A   L+VT+   ++ +  +SK+    
Sbjct  39   EFIRTSCGTTTYPKLCYTSLSAHASVIQTSPKLLADTALAVTLSTARSTSSLMSKMVQSH  98

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R   A+ DCVE   D++D L +++G + ++   NF   M D+ TW+SAALT+EDTC
Sbjct  99   GLKPREVAAMHDCVEELSDSVDQLRKAMGEMTQIKGSNFGLMMNDIQTWVSAALTDEDTC  158

Query  568  LDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLAT  455
             DGF G      ++  V  +V N++++TSNAL L+N  A+
Sbjct  159  TDGFAGNAMNGNLKTTVRARVVNMAHMTSNALGLINSYAS  198



>gb|AFK35257.1| unknown [Medicago truncatula]
 gb|KEH29362.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 91/160 (57%), Gaps = 2/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R++CS T +  LC  SL   ++  + +        L+VT+   K+ +  +S L     
Sbjct  36   FIRNSCSSTTYPRLCYTSLVKHADFIQTNQMLLTGTALNVTLASAKSTSALMSTLSKGQQ  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L  R   A+ DCVE   D++D L RS+  + +L   NF   M DV TW+SAALT+++TC 
Sbjct  96   LNPREAAAMKDCVEVLSDSVDELRRSIDEMSRLRTSNFEITMSDVQTWVSAALTDQNTCT  155

Query  565  DGFGRPK-RKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            DGF      + V+ LV   +  V+ LTSNALAL+NKLAT+
Sbjct  156  DGFQEINATENVKTLVRGSIVQVAQLTSNALALINKLATS  195



>gb|AAX20046.1| DC1.2-like [Capsicum annuum]
Length=205

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  ++     P   A   L+V++   ++ +  + KL    
Sbjct  43   EFIRTSCKSTSYPNLCFSSLSSRASAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAHGQ  102

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   D +  L +SLG +++L  K+F  ++ D+ TW+SAALT+EDTC
Sbjct  103  GMTPREVGAMHDCVEELSDTVAGLRKSLGEMKQLRGKDFDLKINDIQTWVSAALTDEDTC  162

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             +GF G+    KV+ +V  K+  V++LTSNALAL+N LA+
Sbjct  163  TEGFDGKVMNGKVKTVVRGKILEVAHLTSNALALINSLAS  202



>ref|XP_006394407.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
 gb|ESQ31693.1| hypothetical protein EUTSA_v10004950mg [Eutrema salsugineum]
Length=198

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 101/188 (54%), Gaps = 3/188 (2%)
 Frame = -1

Query  1012  HNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPD  833
             H+ L   ++ +A I               +V+ +C+ T +Q LC+ SL+  ++  +  P 
Sbjct  9     HHFLTSLLITIA-ITTLVKSVHTTTTNTEFVKSSCNFTQYQRLCVASLSTQASLIQTSPK  67

Query  832   RWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLR  653
               A   L++T+   KA +  + +L     L+ R   A+ DCVE   D L+ L +S+G + 
Sbjct  68    LMAHAALNITLASAKATSVMMVRLSRTSPLKPREASAMRDCVEELGDTLEELRKSIGEMG  127

Query  652   KLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNAL  479
             +L+  N+   M DV TW+SAALT+  TC DGF G     KV+ LV  ++  ++ LTSNAL
Sbjct  128   QLSGSNYELYMSDVQTWVSAALTDVTTCTDGFEGDDMNGKVKVLVRRRILVITQLTSNAL  187

Query  478   ALVNKLAT  455
             AL+N  A+
Sbjct  188   ALINHFAS  195



>ref|XP_009370483.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +CS TI++ LC+ SL+  +N  +  P   A   L+VT+   K+ +  + KL    
Sbjct  40   EFLKTSCSATIYRKLCLTSLSSHANAIQTSPKLMASEALTVTLASAKSTSIIMLKLSQSH  99

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DCVE   D++D++ RS+  +    + +F   + DV TW+SAALT+E TC
Sbjct  100  GMKPREVGAMRDCVEELSDSVDAIQRSIAEMGNFRSSDFQLMISDVQTWVSAALTDETTC  159

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGF G      ++ +V  ++ N++ LTSN+LALVN+ A+
Sbjct  160  SDGFGGNLMNGNLKTIVRGRIVNIAQLTSNSLALVNRYAS  199



>ref|XP_007045219.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
partial [Theobroma cacao]
 gb|EOY01051.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
partial [Theobroma cacao]
Length=266

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 92/165 (56%), Gaps = 6/165 (4%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVK--AIAgslsklksq  752
            ++R +CS T++ DLC  SL+ ++N  +  P R AR  + V++ + +  A+  S    ++ 
Sbjct  100  FIRTSCSATLYPDLCYTSLSGYANAIQQDPARLARTAIGVSLSKTRHMAVYVSNLSREAD  159

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL---NAKNFTTQMGDVTTWMSAALTN  581
                 R+  AL DC     DA+D +  SL  +R+L    +++F  QMG+V TWMSAALT+
Sbjct  160  YGADPRASAALHDCFSNMGDAVDEIRGSLKQMRQLVAPGSESFRFQMGNVQTWMSAALTD  219

Query  580  EDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            EDTC DGF       ++  V  +   V   TSNALALVN  A  G
Sbjct  220  EDTCTDGFEDVAEGPMKTDVCQRTGKVKKFTSNALALVNSYAEKG  264



>emb|CDY31839.1| BnaC09g13100D [Brassica napus]
Length=204

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 108/204 (53%), Gaps = 17/204 (8%)
 Frame = -1

Query  1027  TMLPFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKA  848
             T+     I     L+L   + A            Y++ +C++T ++ LC  SL+P++ K 
Sbjct  3     TLSQIEIIFLSIALLLFITSSATPSTYSNQTNLDYIKTSCNLTHYKTLCYISLSPYALKI  62

Query  847   KNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQI------ALGDCVECFEDAL  686
              ++P R A   L++T+   K+ A  +          GRS +      A+ DCVE   D++
Sbjct  63    DSNPQRLAVTALNLTLSSAKSAAKFIKNFP-----HGRSGLTRFEAGAVADCVEEIGDSV  117

Query  685   DSLHRSLGVLRKLNAKN---FTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKK--VRWLV  521
               L  S+  L  +N ++   F   M DV TW+SAALT++DTC+DGFG+  R K  V+ LV
Sbjct  118   SELQDSIRELESINYEDSSKFEMVMSDVETWVSAALTDDDTCMDGFGQDGRAKAVVKDLV  177

Query  520   NK-VTNVSYLTSNALALVNKLATT  452
              + V  V+ +TSNALA++N  A+T
Sbjct  178   RRHVVKVARMTSNALAVINMYAST  201



>ref|XP_009372896.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +CS TI++ LC+ SL+  +N  +  P   A   L+VT+   K+ +  + KL    
Sbjct  40   EFLKTSCSATIYRKLCLTSLSSHANAIQTSPKLMASEALTVTLASAKSTSIMMLKLSQSH  99

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DCVE   D++D++ RS+  +    + +F   + DV TW+SAALT+E TC
Sbjct  100  GMKPREVGAMRDCVEELSDSVDAIQRSIAEMGNFRSSDFQLMISDVQTWVSAALTDETTC  159

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGF G      ++ +V  ++ N++ LTSN+LALVN+ A+
Sbjct  160  SDGFGGNLMNGNLKTVVRGRIVNIAQLTSNSLALVNRYAS  199



>ref|XP_007012560.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
 gb|EOY30179.1| Plant invertase/pectin methylesterase inhibitor superfamily protein 
[Theobroma cacao]
Length=192

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VR +C    +  LC+ +L+ +S  A N P   A+  + V++ + + ++  L+   +  S 
Sbjct  31   VRSSCVHASYPSLCLRTLSSYSGPA-NTPRDLAQAAVKVSLSRARKVSNYLTTSVTGKSK  89

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            R R   AL DCVE   ++++ L R+LG L+ L  + F  QM +  TW+SAALTNEDTCLD
Sbjct  90   RERG--ALSDCVEQIAESVEELSRTLGELKHLRGETFEFQMSNAQTWVSAALTNEDTCLD  147

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKL  461
            GF     K    +  K+TNV+ +TSNAL ++N+L
Sbjct  148  GFEGVDGKVKSDVKRKITNVAKVTSNALYMINRL  181



>ref|XP_002322403.1| ripening-related family protein [Populus trichocarpa]
 gb|EEF06530.1| ripening-related family protein [Populus trichocarpa]
Length=203

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 104/197 (53%), Gaps = 7/197 (4%)
 Frame = -1

Query  1009  NILWKFMLVL----AWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKN  842
             N L +F+L+L    +++  +            ++R +CS T +  LC  SL+  S+  + 
Sbjct  7     NSLAEFLLLLIAISSYLNSSSAARVTTKSSTEFIRTSCSTTTYPRLCYTSLSIHSSTIQT  66

Query  841   HPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLG  662
              P   A   L+VT+   K+ +  +S L     ++ R   A+ DCVE   DA++ L +S+ 
Sbjct  67    SPKLLANAALNVTLSSAKSTSTMISTLSQTHRMKPREVSAMKDCVEELGDAVNELGKSMD  126

Query  661   VLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTS  488
              +      NF + + DV TW+SAALT+E TC DGF G      ++  V  ++ N++ LTS
Sbjct  127   EMSHARQSNFQSMIDDVQTWVSAALTDESTCSDGFAGNAMNGNLKTAVRGRIVNIAQLTS  186

Query  487   NALALVNKLATTGPQCL  437
             NALAL+N  A + P+ L
Sbjct  187   NALALINNYA-SDPEML  202



>ref|XP_010264195.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=210

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 97/164 (59%), Gaps = 4/164 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksq--  752
            +++ +C  T++  LC  +L+ +++  +  P   A   LSV++   ++ +  +S+L     
Sbjct  47   FIKTSCGTTMYPKLCFSTLSGYASAIQTDPKLLADTALSVSLTNARSSSAMISELSKSQL  106

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDT  572
             +++ R   A+ DCVE   D++D L +S+  +  L   +   Q+ ++ TW+SAALTNEDT
Sbjct  107  ATMKPREAAAMRDCVEMVGDSVDELQKSMAEMSHLGGPDLGFQISNIQTWVSAALTNEDT  166

Query  571  CLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTGP  446
            C+DGF G+     ++  +  ++ N++ LTSNAL+L+NKL  T P
Sbjct  167  CMDGFAGKAMDSNIKTSIRGRILNLAQLTSNALSLINKLVNTSP  210



>ref|XP_009151355.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=198

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 92/159 (58%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +V+  C+ T +  LC+ SL+  S+  +      A   L++T+   KA +  + ++    
Sbjct  36   EFVKSLCTFTTYPRLCVTSLSTQSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSRSS  95

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R   A+ DCVE   D L+ L +S+G + +L+  N+   M D+ TW+SAALT+E TC
Sbjct  96   RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALTDEYTC  155

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
            LDGF G     KV+ LV  ++  +++LTSNALAL+N  A
Sbjct  156  LDGFEGDEMNGKVKVLVRGRILIIAHLTSNALALINHFA  194



>ref|XP_010261745.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=201

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 106/193 (55%), Gaps = 3/193 (2%)
 Frame = -1

Query  1024  MLPFHNILWKFMLVLAWIAPACHggggggggGR--YVRDACSVTIHQDLCIHSLAPFSNK  851
             + PF + +   +  L + +   +G      G +   VR +C    + +LC+ +L+ ++  
Sbjct  2     VFPFFSFITFLVFFLCFSSATFYGAATTKSGAKQDLVRSSCIHASYPNLCLRTLSSYAGS  61

Query  850   AKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHR  671
             A N P+  A+  +++++ + ++++  L++L+   +   R Q A+ DCVE   D++D L +
Sbjct  62    A-NTPNDLAQAAVTISLGRARSVSLYLARLQKLHNGSKRQQGAVSDCVEQLSDSVDELQQ  120

Query  670   SLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLT  491
             +L  LR L    F  QM +  TW+SAALTNEDTCLDGF     K    +  K+ NV+ +T
Sbjct  121   TLSELRHLRRGTFREQMSNAQTWVSAALTNEDTCLDGFQNVDGKVKSDVKQKINNVARIT  180

Query  490   SNALALVNKLATT  452
             SNAL  +N L  T
Sbjct  181   SNALYFINLLDET  193



>ref|XP_010933727.1| PREDICTED: 21 kDa protein [Elaeis guineensis]
Length=211

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 103/189 (54%), Gaps = 11/189 (6%)
 Frame = -1

Query  994  FMLVLAWIAPACHgg---ggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWA  824
             +L  A  A  CH       G  G  ++R +C+ T +  LC +SLA ++   +  P + A
Sbjct  21   LILAFALDASTCHAARPNTHGTIGLEFIRTSCNKTKYPSLCFNSLAAYAPTIQTSPTQLA  80

Query  823  RVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN  644
               LSV++   +  +  +++L     +  R   A+ DC+E   D++D L +SL V+  L+
Sbjct  81   EASLSVSLSYARGTSTMMTRLSKDKGMSSREAEAISDCMESLGDSVDELKQSLKVMGHLS  140

Query  643  AKNFTTQMGDVTTWMSAALTNEDTCLDGFGR-----PKRKKVRWLVNKVTNVSYLTSNAL  479
             +N   ++ D+ TW+S+ALT+E+TCLDGF        +R  VR    ++  V+ LTSNAL
Sbjct  141  GENLKLRVNDIQTWVSSALTDENTCLDGFASNGMKTGERSNVR---GRIVRVAQLTSNAL  197

Query  478  ALVNKLATT  452
            ++++ LA T
Sbjct  198  SIISGLAPT  206



>ref|XP_010483948.1| PREDICTED: 21 kDa protein-like isoform X1 [Camelina sativa]
 ref|XP_010483950.1| PREDICTED: 21 kDa protein-like isoform X2 [Camelina sativa]
Length=195

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 95/160 (59%), Gaps = 3/160 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +V+ +C+ T +  LC  SL+  ++  +  P   A   L++T+   KA +  + +L S  
Sbjct  34   EFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLSSSR  93

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
              + R   A+ DCVE   D LD L +S+G + +L++ N+   M D+ TW+SAALT+E+TC
Sbjct  94   L-KPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALTDENTC  152

Query  568  LDGFGRPKRK-KVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             +GF R +   K + LV  K+  V++LTSNALAL+N  A+
Sbjct  153  TEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS  192



>ref|XP_004506603.1| PREDICTED: 21 kDa protein-like [Cicer arietinum]
Length=198

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 90/160 (56%), Gaps = 2/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +CS T +  LC  SL   +N  + +        L+VT+  VK+    +S L     
Sbjct  37   FIRTSCSSTTYPRLCYASLVKHANSIQTNRFLLTDTALNVTLATVKSTWAMMSSLAKTRE  96

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+ R   A+ DC+E   D++D L +S+  + +L   NF   M D+ TW+SAALT++ TC 
Sbjct  97   LKPRETAAMKDCIELLSDSIDELRKSINEMSRLRTSNFELTMSDIQTWVSAALTDQSTCS  156

Query  565  DGFGRPKRK-KVRWLVN-KVTNVSYLTSNALALVNKLATT  452
            DGF        ++ +V  K+  V+ LTSNALAL+NKLAT+
Sbjct  157  DGFEEINATGDIKTIVQVKIVQVAQLTSNALALINKLATS  196



>gb|KFK33383.1| hypothetical protein AALP_AA5G006000 [Arabis alpina]
Length=218

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 99/176 (56%), Gaps = 19/176 (11%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklk-sqg  749
            ++R +C+ T++ D+C  SL+ +++  ++ P R A++ + V++ Q K+ A  LSKL  S  
Sbjct  43   FIRTSCNATLYPDVCFTSLSGYASAVQDSPARLAKLAIGVSLSQAKSTAAFLSKLSHSAA  102

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA----------KNFTTQMGDVTTWM  599
               G +  A+ DC+   EDA+D +  SL  LR +N           + F  QM +V TWM
Sbjct  103  LTAGTASAAIRDCLSNVEDAVDEMRGSLRQLRDMNGGGVAAGRRSVETFRFQMSNVQTWM  162

Query  598  SAALTNEDTCLDGFGRPKRKKVRWLV------NKVTNVSYLTSNALALVNKLATTG  449
            SAALT+EDTC DGF     ++V   V      ++V  V  LTSNALALVN  A  G
Sbjct  163  SAALTDEDTCTDGF--EDMEEVLGGVIKTSVCDRVEGVKRLTSNALALVNTYANNG  216



>ref|XP_011076332.1| PREDICTED: 21 kDa protein [Sesamum indicum]
Length=201

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 101/186 (54%), Gaps = 7/186 (4%)
 Frame = -1

Query  994  FMLVLAWIAPACHggggg-----gggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDR  830
             +++L +I+ + H G             ++R +CS T +  LC  +LA  ++  +  P  
Sbjct  12   LLILLTFISSSIHSGSAARPAGGATNTEFIRTSCSATTYPRLCYSALASHASTIQQDPKL  71

Query  829  WARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRK  650
             A   LSV++   ++ +  + KL     +  R   A+ DCVE   D+++ L +S+  +  
Sbjct  72   LAHAALSVSLDTARSTSVDMVKLSRSTGMTPRQVGAMRDCVEELSDSVEQLRKSVEEMNL  131

Query  649  LNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALA  476
            +   NF   M D+ TW+SAALT++DTC+DGF G+     V+  V  ++ NV+++TSNALA
Sbjct  132  MKGSNFGMMMSDIQTWVSAALTDDDTCMDGFAGKFMNGAVKTAVRGRIVNVAHMTSNALA  191

Query  475  LVNKLA  458
            L+N  A
Sbjct  192  LINSFA  197



>gb|KDP22409.1| hypothetical protein JCGZ_26240 [Jatropha curcas]
Length=203

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 92/160 (58%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +CS T +  LC  SL+  +N  +  P   A   L+VT+   K+ +  +SKL    
Sbjct  41   EFIRTSCSTTTYPKLCYTSLSVHANTIQTSPKLLANAALNVTLGSAKSTSAMMSKLSQSH  100

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++     A+ DCVE   D ++ L +S+G ++     +F   + DV TW+SAALT+E+TC
Sbjct  101  GMKPIEVEAMQDCVEELSDTVEGLRKSIGEMKTYKESDFKLMINDVQTWVSAALTDENTC  160

Query  568  LDGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLAT  455
             DGF G+      + LV + + N+++LTSNALAL+N  A+
Sbjct  161  SDGFAGKTMNGNTKTLVREMILNIAHLTSNALALINNYAS  200



>ref|XP_002304431.2| hypothetical protein POPTR_0003s20640g [Populus trichocarpa]
 gb|EEE79410.2| hypothetical protein POPTR_0003s20640g [Populus trichocarpa]
Length=203

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 103/194 (53%), Gaps = 6/194 (3%)
 Frame = -1

Query  1015  FHNILWKFMLVLAWIAP---ACHggggggggGRYVRDAC-SVTIHQDLCIHSLAPFSNKA  848
             F  +    +LV+ +  P   +C          RY++ +C   T++  LC H+LA +++  
Sbjct  5     FVGLALAAILVIQFSTPVNSSCSATRPSPRNIRYIKTSCYDTTLYPKLCYHTLAIYASTI  64

Query  847   KNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRS  668
             K +P   A   L V+++   + +  + +      L  R   A+ DCVE   DA+  L RS
Sbjct  65    KTNPKLLANTALHVSLKSTNSTSRLMKRASKTPGLDPRVLAAMLDCVEEVGDAVYELQRS  124

Query  667   LGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPK-RKKVRWLVNK-VTNVSYL  494
             +  +      NF+  M DV TW+SA+LT++DTC+DGF      KKV+  V + +  ++ L
Sbjct  125   IEEMDHAGGSNFSMVMNDVVTWVSASLTDDDTCMDGFAEGAVNKKVKTTVKRHLGRIARL  184

Query  493   TSNALALVNKLATT  452
             TSNALALVN+ A++
Sbjct  185   TSNALALVNRYASS  198



>ref|XP_011023856.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=212

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 94/167 (56%), Gaps = 8/167 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y+R +C  T++ ++C  SL+ +++  K  P   ARV + V++ + + +A  +S L     
Sbjct  44   YIRSSCGATLYPEICYTSLSRYASAVKQSPSCLARVAIGVSLSRARHLAAYISNLTRHED  103

Query  745  LRG--RSQIALGDCVECFEDALDSLHRSLGVLRK-----LNAKNFTTQMGDVTTWMSAAL  587
              G  R+  AL DC+    DA+D +  SL  + K     L+A++F  QM +V TWMSAAL
Sbjct  104  FGGDHRATAALHDCLSNMGDAVDEMSGSLKQMLKVGAAGLSAESFQFQMSNVQTWMSAAL  163

Query  586  TNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            T+E+TC DGF       V+  V N+V +    TSNALALVN  A  G
Sbjct  164  TDEETCTDGFDDVADGAVKAEVCNRVADAKKFTSNALALVNTYAAAG  210



>ref|XP_002264101.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
 ref|XP_002264204.1| PREDICTED: 21 kDa protein-like [Vitis vinifera]
 emb|CAN82970.1| hypothetical protein VITISV_006071 [Vitis vinifera]
 emb|CBI24574.3| unnamed protein product [Vitis vinifera]
 emb|CBI24575.3| unnamed protein product [Vitis vinifera]
Length=202

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 91/160 (57%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T +  LC  SL+  ++  +  P   A   L+VT+   ++ +  +SK+    
Sbjct  40   EFIRTSCGTTTYPRLCYTSLSAHASVIQTSPKLLADTALAVTLSTARSTSSLMSKMVQSH  99

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R   A+ DCVE   D++D L R++G + ++   NF   M D+ TW+S ALT+EDTC
Sbjct  100  GLKPREVAAMHDCVEELSDSVDQLRRAMGEMTQIKGSNFGLMMDDIQTWVSTALTDEDTC  159

Query  568  LDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLAT  455
             DGF G      ++  V  ++ N++++TSNAL L+N  A+
Sbjct  160  TDGFAGNAMNGNLKTTVRARIVNMAHMTSNALGLINSYAS  199



>ref|XP_002263715.1| PREDICTED: 21 kDa protein [Vitis vinifera]
 emb|CAN82390.1| hypothetical protein VITISV_030086 [Vitis vinifera]
Length=212

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 106/202 (52%), Gaps = 6/202 (3%)
 Frame = -1

Query  1048  TFECLPNTMLPFHNILWK-FMLVLAWIAP---ACHggggggggGRYVRDACSVTIHQDLC  881
             +F CL  +  P   +++  F   L+   P   A           +++R +C VT++  LC
Sbjct  3     SFTCLRLSSSPGLAVIFALFFFYLSLTTPCSAASPEPHPPTNTTQFIRTSCGVTMYPKLC  62

Query  880   IHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVEC  701
               +L+ +++  +      A   L V+++  ++ +  + KL     L  R   A+ DC+E 
Sbjct  63    FKTLSAYASTIQTSHMELANAALCVSLKGAQSSSNKVLKLSKGQGLSRREAAAITDCIEN  122

Query  700   FEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKK--VRW  527
              +D++D L +SL  ++ L   +F  +M D+ TW+SAALT+EDTC+DGF     K      
Sbjct  123   MQDSVDELQQSLVAMKDLQGPDFQMKMSDIVTWVSAALTDEDTCMDGFAEHAMKGDLKST  182

Query  526   LVNKVTNVSYLTSNALALVNKL  461
             + + + +V+ LTSNALA++NK 
Sbjct  183   IRSNIVSVAQLTSNALAIINKF  204



>gb|KDP22406.1| hypothetical protein JCGZ_26237 [Jatropha curcas]
Length=195

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 96/159 (60%), Gaps = 2/159 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C  T +  LC+ SL+ ++   + +P +     LSV++ + +A    + KL     
Sbjct  35   FIKASCRTTTYPVLCVESLSAYAPSIQQNPRQLTEAALSVSVARAQATRTFVYKLTKFKG  94

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            ++ R + A+ DC+E  +D +D L +S   L+    K+F   M +V TW+SAALT+E+TC+
Sbjct  95   VKPREREAINDCLEEIDDTVDRLSKSFKELKSAKGKDFQWHMSNVETWVSAALTDENTCV  154

Query  565  DGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLAT  455
            DGF G+    K++  +  ++ NV+ +TSNAL+L+NK A+
Sbjct  155  DGFAGKALDGKLKASIKARIVNVAQVTSNALSLINKFAS  193



>ref|XP_004234935.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=201

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 94/158 (59%), Gaps = 2/158 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C  T +  LC  SL+  S+     P   A   LSV++   ++ +  + KL     
Sbjct  40   FIRTSCKSTTYPTLCFSSLSSRSSAIGVSPQLLAHESLSVSLETAQSTSAMMLKLSHSQG  99

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            +  R   A+ DCVE   DA+  + +SLG +++L  K+F  +M D+ TW+SAALT+EDTC 
Sbjct  100  MTPREVGAMRDCVEELSDAVSGIKKSLGEMKELKGKDFDLKMNDIQTWVSAALTDEDTCT  159

Query  565  DGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
            +GF G+    KV+ +V  K+  V+ LTSNALAL+N+LA
Sbjct  160  EGFAGKVMNGKVKTVVRGKILEVAQLTSNALALINRLA  197



>ref|XP_010101980.1| 21 kDa protein [Morus notabilis]
 gb|EXB90904.1| 21 kDa protein [Morus notabilis]
Length=216

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 112/209 (54%), Gaps = 19/209 (9%)
 Frame = -1

Query  1036  LPNTMLPFHNILWKFMLVLAWIAPACHgggggggg--GRYVRDACSVTIHQDLCIHSLAP  863
             LP ++  F+ +L+  +  +    PA      G       ++R +C  T++ D+C  +L+ 
Sbjct  6     LPTSLHFFYTLLFLIIFSVLKPIPAVGYADPGSSTNGTDFIRTSCVTTLYPDVCFTALSR  65

Query  862   FSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg--sLRGRSQIALGDCVECFEDA  689
             ++   + +P++ ARV +SV++ +VK +A  +S +  Q       R+  AL DC   F DA
Sbjct  66    YAAAVQRNPEQLARVAISVSLAKVKHVAAYVSNVSRQADYGANPRAAAALHDCFSNFGDA  125

Query  688   LDSLHRSLGVLRKLNA--------KNFTTQMGDVTTWMSAALTNEDTCLDGFGR----PK  545
             +D +  SL  +R LN         ++F  QM +V TWMSAALT+++TC DGF      P 
Sbjct  126   VDEIRGSLRQMRHLNVGGTGAGGGESFRFQMSNVQTWMSAALTDQETCTDGFQDVADGPL  185

Query  544   RKKVRWLVNKVTNVSYLTSNALALVNKLA  458
             +K+V    ++ T V   TSNALALVN  A
Sbjct  186   KKEV---CDRATEVKKHTSNALALVNSYA  211



>ref|XP_004307823.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=199

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 89/160 (56%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +CS T +  LC+ SLA  +   +  P   A   LSVT+   K+ +  +  L    
Sbjct  37   EFMKTSCSATTYPKLCLTSLASQATAIQTSPKLMASAALSVTLSSAKSTSNLMLSLSHGH  96

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DCVE   D++D L RS+  +    + ++   + DV TW+SAALT+E TC
Sbjct  97   GMKPREVAAMRDCVEVLGDSVDELQRSISEMGNFKSSDYEMMISDVQTWVSAALTDESTC  156

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGF G      ++ +V  K+  ++ LTSNALAL+N+ A+
Sbjct  157  ADGFAGNGLNGNLKTVVRGKIVTIAQLTSNALALINRYAS  196



>ref|XP_008242280.1| PREDICTED: 21 kDa protein [Prunus mume]
Length=207

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 97/158 (61%), Gaps = 5/158 (3%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VR +CS   + +LCIHSL+ ++  A N P   A+  ++V++ + + ++G L++L +    
Sbjct  40   VRSSCSHASYPNLCIHSLSTYAGPA-NTPRDLAQAAVNVSLSRARRVSGYLAQLSNSDQG  98

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
              R + AL DC++   +++D L R+L  L+ L+A+ F  QM +  TW+SAALT++DTCLD
Sbjct  99   TKRERSALSDCIDLMSESVDELTRTLDELKHLHAETFRFQMSNAQTWVSAALTDDDTCLD  158

Query  562  GFGRPKRKKVRW----LVNKVTNVSYLTSNALALVNKL  461
            GF     K        +  KVTN + +TSNAL L+N+L
Sbjct  159  GFEELDVKVKVKVKADMKRKVTNAARVTSNALYLINRL  196



>emb|CDY46918.1| BnaA09g12760D [Brassica napus]
Length=204

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 106/199 (53%), Gaps = 7/199 (4%)
 Frame = -1

Query  1027  TMLPFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKA  848
             T+     I     L+L   + A            Y++ +C++T ++ LC  SL+P++ K 
Sbjct  3     TLSQIEIIFLSIALLLFITSSATPSTYSNQTNLDYIKTSCNLTHYKTLCYISLSPYALKI  62

Query  847   KNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQI-ALGDCVECFEDALDSLHR  671
              ++P R A   L++T+    + A  +  +        R +  A+ DCVE   D++  L  
Sbjct  63    DSNPQRLAVTALNLTLSSANSAAKFIKNIPHGRGGLTRFEAGAVADCVEEIGDSVSELQD  122

Query  670   SLGVLRKLNAKN---FTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKK--VRWLVNK-VT  509
             S+  L  +N ++   F   M DV TW+SAALT++DTC+DGFG+  R K  V+ LV + V 
Sbjct  123   SIRELESINYEDSSKFEMVMSDVETWVSAALTDDDTCMDGFGQDGRAKAVVKDLVRRHVV  182

Query  508   NVSYLTSNALALVNKLATT  452
              V+ LTSNALA++N  A+T
Sbjct  183   KVARLTSNALAVINMYAST  201



>ref|XP_009611479.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=227

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 90/165 (55%), Gaps = 12/165 (7%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y+R +C  T++   C HSL  ++   +  P R ARV + V++ + K IA  LS    +  
Sbjct  61   YIRSSCKTTMYPATCYHSLNHYATAVQQDPARLARVAVGVSLAKAKRIAAFLSNQSREAD  120

Query  745  LRGRSQI--ALGDCVECFEDALDSLHRSLGVLRKL--NAKNFTTQMGDVTTWMSAALTNE  578
               + ++  AL DC   F D +D +  SL  +RKL  ++++   QM +V TWMSAALTNE
Sbjct  121  YGAQPRVVAALHDCFSVFGDTIDQIRDSLSQMRKLGGSSESLRFQMSNVQTWMSAALTNE  180

Query  577  DTCLDGF-----GRPKRKKVRWLVNKVTNVSYLTSNALALVNKLA  458
            DTC DGF       P +  V    ++   V  +TSNALALVN  A
Sbjct  181  DTCTDGFEDVTDDEPLKLDV---CDRAGKVKEVTSNALALVNNFA  222



>ref|XP_010264194.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=211

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 93/158 (59%), Gaps = 2/158 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++++C  T++  +C+ SL+ +++  +  P   A+V LSV+++  ++    +  L    
Sbjct  45   EFIKNSCRRTLYPQVCVESLSAYASTIQESPKLLAQVALSVSLKSARSTEKLVLNLSKVN  104

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +R R   AL DCVE   D ++ L +SL  ++ L   +F  ++ ++ TW+SAALTNEDTC
Sbjct  105  DIRPREAAALMDCVETMGDCVEELRQSLQEMKHLGGPDFALKLSNIKTWVSAALTNEDTC  164

Query  568  LDGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKL  461
             DGF  +     ++  + K +  V+ LTSNALAL+N +
Sbjct  165  RDGFQDKSMNGNIKNTITKSIDYVAKLTSNALALINNI  202



>ref|XP_010458855.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 94/160 (59%), Gaps = 3/160 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +V+ +C+ T +  LC  SL+  ++  +  P   A   L++T+   KA +  + +L S  
Sbjct  34   EFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLSSSR  93

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
                R   A+ DCVE   D LD L +S+G + +L++ N+   M D+ TW+SAALT+E+TC
Sbjct  94   L-NPREAAAMRDCVEELADTLDELRKSIGEMCRLSSSNYEVYMSDMQTWVSAALTDENTC  152

Query  568  LDGFGRPKRK-KVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             +GF R +   K + LV  K+  V++LTSNALAL+N  A+
Sbjct  153  TEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS  192



>ref|XP_008387667.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=200

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 93/165 (56%), Gaps = 3/165 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            +Y+R +CSVT +  LC +SL+ ++ K K +P   A   L+VTI   +  +  + +L    
Sbjct  32   QYIRTSCSVTNYPRLCYNSLSIYAGKIKTNPKALAHTALNVTIAATQETSVIMRRLSKIH  91

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN-AKNFTTQMGDVTTWMSAALTNEDT  572
             L+     A  DC+E   DA+D L  S+  L  +    NF  QM D+ TW+S ALT+EDT
Sbjct  92   GLKPIEXAAALDCMEEIGDAVDELQNSIDELSHVXRGSNFWLQMSDIQTWVSXALTDEDT  151

Query  571  CLDGFGRPKRK-KVRWLVNK-VTNVSYLTSNALALVNKLATTGPQ  443
            C+DGF       +V  LV + + NV++LT NALAL+N  A+   +
Sbjct  152  CMDGFDEHNXSGRVENLVRRYIVNVAHLTCNALALINSYASASTE  196



>ref|XP_007038418.1| DC1.2-like, putative [Theobroma cacao]
 gb|EOY22919.1| DC1.2-like, putative [Theobroma cacao]
Length=201

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 98/189 (52%), Gaps = 7/189 (4%)
 Frame = -1

Query  1000 WKFMLVLAWIAP-----ACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHP  836
            +KF+L+L  I       +            ++R +CS T +  LC  +L+  ++  +  P
Sbjct  10   FKFLLILLAINSYINFSSAGRQIAPQSSAEFIRTSCSSTTYPKLCFETLSTHASLIQTSP  69

Query  835  DRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVL  656
               A   L+VT+   ++ +  +  L     L+ R   A+ DCVE   D++D L +S+  +
Sbjct  70   QLLAHAALNVTLSTTESTSAMMVTLSKSHGLKPREAEAMQDCVEELSDSIDELRKSISEM  129

Query  655  RKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNA  482
             ++   NF   + DV TW+SAALT+E TC DGF G      V+  V  K+  +++LTSNA
Sbjct  130  GQVKGSNFGLMINDVQTWVSAALTDESTCSDGFQGNNMNGNVKTAVRTKILRIAHLTSNA  189

Query  481  LALVNKLAT  455
            LAL+N  A+
Sbjct  190  LALINNYAS  198



>gb|ABY81888.1| pectin methylesterase inhibitor-like protein [Capsicum annuum]
Length=205

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  ++     P   A   L+V++   ++ +  + KL    
Sbjct  43   EFIRTSCKSTSYPNLCFSSLSSRASAIGVAPQLLAHESLTVSLETAQSTSAMMLKLAHGQ  102

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   D +  L +SLG +++L  K+F  ++ D+ TW+SAALT+EDTC
Sbjct  103  GMTPREVGAMHDCVEELSDTVAGLRKSLGEMKQLRGKDFDLKINDIQTWVSAALTDEDTC  162

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             +GF G+    KV+ +V  K+  V++LTS+ALAL+N LA+
Sbjct  163  TEGFDGKVMNGKVKTVVRGKIFEVAHLTSSALALINSLAS  202



>gb|KEH29361.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=197

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 91/160 (57%), Gaps = 2/160 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R++CS T +  LC  SL   ++  + +        L+VT+   K+ +  +S L     
Sbjct  36   FIRNSCSSTTYPRLCYTSLVKHADFIQTNRMLLTGTALNVTLASAKSTSALMSTLSKGQG  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L  R   A+ DCVE   D++D L RS+  + +L   NF   M DV TW+SAALT+++TC 
Sbjct  96   LNPREAAAMKDCVEVLSDSVDELRRSIDEMSRLRTSNFELTMSDVQTWVSAALTDQNTCT  155

Query  565  DGFGRPK-RKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
            DGF      + V+ LV   +  V+ LTSNALAL+NKL+T+
Sbjct  156  DGFQEINATENVKTLVRGSIVQVAQLTSNALALINKLSTS  195



>ref|XP_009374503.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=202

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 94/160 (59%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +V+ +CS T +  LC+ SL+  ++  +  P   A   L+VT+   K+ +  +SKL  + 
Sbjct  40   EFVKTSCSATTYPKLCLTSLSSHASAIQTSPKLMASTALTVTLASAKSTSTVMSKLSQRH  99

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DC+E   D++D + RS+  +    + +F   + DV TW+SAALT+E TC
Sbjct  100  GMKPREVGAMRDCIEELSDSVDVIQRSIAEMGNFRSSDFQLMISDVQTWVSAALTDETTC  159

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGF G      ++ +V  +V N++ LTSNALAL+N+ A+
Sbjct  160  SDGFGGNGMNSNLKTVVRGRVVNIAQLTSNALALINRYAS  199



>gb|AFK44781.1| unknown [Lotus japonicus]
Length=211

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 99/172 (58%), Gaps = 13/172 (8%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgsls--klksq  752
            ++R +C+ T++ D+C  SL+ ++N  + +P + AR+ ++VT+ +V   A  L+     + 
Sbjct  38   FIRTSCNTTLYPDVCYTSLSRYANAVQQNPGQLARIAIAVTLSKVHRTASYLTNLTRVTD  97

Query  751  gsLRGRSQIA---LGDCVECFEDALDSLHRSLGVLRKLNAK-------NFTTQMGDVTTW  602
             S  G S +A   L DC    +DA+D +  SL  +R++ A        +F  QM +V TW
Sbjct  98   YSAEGSSSLAAQALRDCFSNLDDAVDEIRGSLKQMRQIGAAGAGAGTGSFLFQMSNVQTW  157

Query  601  MSAALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            MSAALT+E+TC DGF       V+  V ++VT V   TSNALALVN+ A  G
Sbjct  158  MSAALTDEETCTDGFQDVAECPVKVDVCDRVTKVKKFTSNALALVNRYANKG  209



>ref|XP_006349456.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=210

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 90/162 (56%), Gaps = 6/162 (4%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgsls--klksq  752
            Y+R +C  T++ D C HSL  ++   +  P R ARV + V++ + K ++  +S    ++ 
Sbjct  46   YIRSSCKTTLYPDTCYHSLNHYATAVQQDPGRLARVAIGVSLAKAKRMSAFVSNLSREAD  105

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL--NAKNFTTQMGDVTTWMSAALTNE  578
               + R+  AL DC   F DA+D +  SL  +R L  ++++   QM +V TWMSAAL+NE
Sbjct  106  YGAQPRALAALHDCFSVFGDAVDQIRDSLSQMRTLGGSSESLRFQMSNVQTWMSAALSNE  165

Query  577  DTCLDGFGRPKRKKVRWL--VNKVTNVSYLTSNALALVNKLA  458
            DTC DGF      +   L   N+   V  +TSNALA +N  A
Sbjct  166  DTCTDGFEDVSDDEPLKLDVCNRAGKVKEVTSNALAFINSFA  207



>ref|XP_010550579.1| PREDICTED: 21 kDa protein [Tarenaya hassleriana]
Length=197

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 91/160 (57%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +CSVT +  LC  SL+  +   +  P   A   L+V++   K+ +  +++L    
Sbjct  35   EFIRSSCSVTTYPRLCFTSLSSHATFIQTSPKLMAHAALNVSLSSAKSTSAMMTRLSRSH  94

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++     A+ DCVE   + +D L  S+G + +L   N+   M D+ TW+SAALT+E+TC
Sbjct  95   GIKPLEASAVRDCVEELSNTVDELRSSVGEMDRLRGSNYEVYMSDIETWVSAALTDENTC  154

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGF G     KV+ LV  ++  ++ LTSNALAL+N  A+
Sbjct  155  TDGFEGSAMDGKVKVLVRERILAIARLTSNALALINHFAS  194



>gb|KDP33962.1| hypothetical protein JCGZ_07533 [Jatropha curcas]
Length=202

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VR +C    + DLCI +L+  S  A N P   A+  ++V++ + + ++ +L+ L +    
Sbjct  39   VRSSCLHASYPDLCIRTLSSCSGSA-NTPRDIAQAAVNVSVERARGVSKNLNALSAGLKT  97

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            + R ++AL DCVE   D +D L  +L  L+ L  + F  QM +  TW+SAALTNE+TCLD
Sbjct  98   K-RERVALSDCVEQISDTVDELSSTLSELKHLRGETFQWQMSNAETWVSAALTNENTCLD  156

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKL  461
            GF   + K    +  ++TNV+ +TSNAL ++N+L
Sbjct  157  GFEEVESKVKGDVKRQITNVARVTSNALYMINRL  190



>ref|XP_008364822.1| PREDICTED: 21 kDa protein-like [Malus domestica]
Length=214

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 99/161 (61%), Gaps = 5/161 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++RD+CS T + ++CI SL+ +++  K  P + A+  LSV++ + ++    ++KL     
Sbjct  51   FIRDSCSATTYPEVCIKSLSSYASSIKQSPRQLAQAALSVSLTKAQSAKTFVTKLAKFKG  110

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLR---KLNAKNFTTQMGDVTTWMSAALTNED  575
            L+ R   A+ DC+E   D +D L +S+  L+   K   ++F   M +V TW+SAALT+++
Sbjct  111  LKSREYGAIKDCMEEIGDTVDRLSKSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDDN  170

Query  574  TCLDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLA  458
            TCLDGF G+    K++  V  +V NV+  TSNAL+L N+ A
Sbjct  171  TCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFA  211



>ref|XP_009148876.1| PREDICTED: 21 kDa protein-like [Brassica rapa]
 emb|CDY45298.1| BnaA06g09680D [Brassica napus]
Length=201

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 94/166 (57%), Gaps = 12/166 (7%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C+ T++ D+C  SLA +++  + +P R ARV + V++ + K  A  LSKL     
Sbjct  40   FIRTSCNATLYPDVCFTSLAGYASSVQYNPARLARVSVGVSLSRAKHTASYLSKLS----  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN-----AKNFTTQMGDVTTWMSAALTN  581
             R  +  A+ DCV    DA++ +  SL  LR++N     A  F  QM +V TWMSAALT+
Sbjct  96   -RASASAAVHDCVSNVGDAMEKMRGSLRQLREMNHRRPGAPTFRFQMSNVQTWMSAALTD  154

Query  580  EDTCLDGFGRPKR--KKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            E+TC DG        +    +  KV +V   TSNALA+VN  A +G
Sbjct  155  EETCTDGITEEMEDGETKTAVCEKVADVKRFTSNALAIVNTYANSG  200



>ref|XP_006490093.1| PREDICTED: 21 kDa protein-like [Citrus sinensis]
Length=196

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +CS T +  LC  SLA  ++  +  P   A   L+VT+   K+ +  + K+    
Sbjct  37   EFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKISKSL  96

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DC+E   D++D L +S+G +  + A NF   M D+ TW+SAALT+E TC
Sbjct  97   GMKPREAEAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDETTC  156

Query  568  LDGFGRP--KRKKVRWLVNKVTNVSYLTSNALALVNKLAT  455
             DGF +     K VR    ++  ++++TSNALAL+N  A+
Sbjct  157  SDGFEKNTVNGKVVR---GQIVKIAHMTSNALALINSYAS  193



>ref|XP_007039938.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY24439.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=200

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 93/161 (58%), Gaps = 2/161 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +C  T + DLC  + + ++++ +  P   A   LS+T+    + +  L++L    
Sbjct  38   EFIKTSCGATSYPDLCFTTFSSYASEIQASPKILASKSLSLTLNTTLSASKFLTELSKSQ  97

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L  +   AL DCVE   D++D L RS+G + ++  K+F  +M D+ TW+SAALT+EDTC
Sbjct  98   DLEPQEAAALQDCVEEISDSVDELKRSIGEIDEIEGKSFAFRMSDIETWVSAALTDEDTC  157

Query  568  LDGFGR-PKRKKVRWLV-NKVTNVSYLTSNALALVNKLATT  452
             DGF        V+  V +++  V+++TS ALA VN+ A T
Sbjct  158  TDGFSENATDGDVKATVRSQIEKVAHMTSIALAFVNRYAGT  198



>emb|CDY00279.1| BnaA06g21800D [Brassica napus]
Length=198

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +V+  C+ T +  LC+ SL+  S+  +      A   L++T+   KA +  + ++ S  
Sbjct  36   EFVKSLCTFTTYPRLCVTSLSTQSSLIQTSHKLMAHAALNITLASAKATSAMMVRVSSSS  95

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             L+ R   A+ DCVE   D L+ L +S+G + +L+  N+   M D+ TW+SAALT+E TC
Sbjct  96   RLKPREVSAMRDCVEELGDTLEELRKSIGEMGQLSGSNYEVYMNDIQTWVSAALTDEYTC  155

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             DGF G     KV+ LV  ++  +++LTSNALAL+N  A+
Sbjct  156  SDGFEGDEMNGKVKVLVRGRILIIAHLTSNALALINHFAS  195



>gb|KDP38091.1| hypothetical protein JCGZ_04734 [Jatropha curcas]
Length=206

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 95/167 (57%), Gaps = 8/167 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y+R +C  T++ ++C  SL+ +S+  +  P R ARV + V++ + + ++  +S L  Q  
Sbjct  38   YIRTSCGATLYPEVCYSSLSRYSSAVQQSPGRLARVAIGVSLSRARHMSSFVSNLSRQAD  97

Query  745  LRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLNA-----KNFTTQMGDVTTWMSAAL  587
                 R+  AL DC+  F DA++ +  SL  +R+L A     + F  QM +V TWMSAAL
Sbjct  98   YGSDHRAAAALHDCLSNFGDAVEEIRGSLKQMRQLGAAGSSDEAFRFQMSNVQTWMSAAL  157

Query  586  TNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            T+E+TC DGF       ++  V ++  +V   TSNALALVN  A  G
Sbjct  158  TDEETCTDGFDDVADGPLKSEVCDRAADVKKFTSNALALVNSYAAKG  204



>ref|XP_010273892.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=202

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 91/154 (59%), Gaps = 1/154 (1%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VR +C    + +LC+ +L+ ++   +   D  AR  ++V++ + +A++G +++L      
Sbjct  37   VRSSCIHASYPNLCLRTLSSYTGSTRTAND-LARAAVTVSLSRARAVSGCIARLAKLHGG  95

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
              R Q AL DCVE   D++D L  +L  LR L   +F  QM +  TW+SAALTNEDTCLD
Sbjct  96   SKRQQGALRDCVEQLSDSVDELRETLAELRHLRRGSFRWQMSNAETWVSAALTNEDTCLD  155

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKL  461
            GF +   K    +  K+ NV+ +TSNAL  +N+L
Sbjct  156  GFEKVDGKVKLAVRRKINNVARVTSNALYFINRL  189



>ref|XP_006357906.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=192

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 101/161 (63%), Gaps = 5/161 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C +T +  +C+ SLA ++   K  P + A+  LSV++ + ++    ++KL     
Sbjct  29   FIKSSCKITTYPQVCVSSLAVYAPTIKRSPQQLAQTALSVSLDRAQSAHTFITKLNKFKG  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA---KNFTTQMGDVTTWMSAALTNED  575
            L+ R   AL DC+E   + +D +++S+  L+ + +   K+F  +M ++ TW+SAA+TNE+
Sbjct  89   LKQREYAALKDCLEEMSETIDRINKSVKELKSMGSARGKDFQWRMSNIETWISAAITNEN  148

Query  574  TCLDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLA  458
            TC DGF GR    +++  +  +VT+V+ +TSNALAL+N+ A
Sbjct  149  TCADGFAGRALNGRIKTSIRARVTHVTQVTSNALALINQFA  189



>ref|XP_011039933.1| PREDICTED: 21 kDa protein [Populus euphratica]
Length=197

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VR +C    + +LC+ +L+ ++  A N P   A+  + V+I + + ++  L+ L      
Sbjct  36   VRSSCVHASYPNLCLRTLSSYAGPA-NTPRDLAQAAVKVSIARARNVSNYLNTLSGLKKK  94

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
            R R  +AL DCVE   D++D L ++L  L+ L  + F  QM +  TW+SAALTNEDTCLD
Sbjct  95   RAR--VALSDCVEQIYDSVDELSKTLRELKHLREETFRWQMSNAQTWVSAALTNEDTCLD  152

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKL  461
            GF     +    +  K+TNV+ +TSNAL ++N+L
Sbjct  153  GFHEVGSRAKDDVKRKITNVARVTSNALYMINRL  186



>ref|XP_009801663.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=228

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 90/165 (55%), Gaps = 12/165 (7%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y+R +C  T++   C HSL  ++   +  P R ARV + VT+ + K +A  LS L  +  
Sbjct  61   YIRSSCKTTMYPATCYHSLNHYATAVQQDPARLARVAVGVTLAKAKRMAAFLSNLSREAD  120

Query  745  LRGRSQI--ALGDCVECFEDALDSLHRSLGVLRKL--NAKNFTTQMGDVTTWMSAALTNE  578
               + ++  AL DC   F D +D +  SL  +RKL  + ++   QM +V TWMSAALTNE
Sbjct  121  YGAQPRVVAALHDCFSVFGDTIDQIRDSLSQMRKLGGSGESLRFQMSNVQTWMSAALTNE  180

Query  577  DTCLDGF-----GRPKRKKVRWLVNKVTNVSYLTSNALALVNKLA  458
            DTC DGF       P +  V    ++   V  +TSNALALVN  A
Sbjct  181  DTCTDGFEDVTDDEPLKLDV---CDRAGKVKEVTSNALALVNNFA  222



>ref|XP_010444081.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=195

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 93/160 (58%), Gaps = 3/160 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +V+ +C+ T +  LC  SL+  ++  +  P   A   L++T+   KA +  + +L S  
Sbjct  34   EFVKSSCTFTTYPRLCFTSLSTQASLIQTSPKLMAHAALNITLASAKATSAMMVRLSSSR  93

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
                R   A+ DCVE   D LD L +S+G + +L+  N+   M D+ TW+SAALT+E+TC
Sbjct  94   L-NPREAAAMRDCVEELADTLDELRKSIGEMCRLSTSNYEVYMSDMQTWVSAALTDENTC  152

Query  568  LDGFGRPKRK-KVRWLV-NKVTNVSYLTSNALALVNKLAT  455
             +GF R +   K + LV  K+  V++LTSNALAL+N  A+
Sbjct  153  TEGFDRDEMNGKTKVLVRGKILVVAHLTSNALALINHFAS  192



>ref|XP_009370484.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=194

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 99/161 (61%), Gaps = 5/161 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++ D+CS T + ++C+ SL+ +++  K +P R A+  LSV++++ ++    ++KL     
Sbjct  31   FISDSCSATTYPEVCVKSLSSYASSIKQNPRRLAQAALSVSLKKAQSAKTFVTKLAKFKG  90

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLR---KLNAKNFTTQMGDVTTWMSAALTNED  575
            L+ R   A+ DC+E   D +D L  S+  L+   K   ++F   M +V TW+SAALT+++
Sbjct  91   LKSREYGAIKDCMEEIGDTVDRLSNSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDDN  150

Query  574  TCLDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLA  458
            TCLDGF G+    K++  V  +V NV+  TSNAL+L N+ A
Sbjct  151  TCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFA  191



>emb|CDP00817.1| unnamed protein product [Coffea canephora]
Length=236

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 95/169 (56%), Gaps = 13/169 (8%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQ--VKAIAgslsklks  755
             ++R +C+ T + D C +SL+ +++  + +P R ARV ++V++ +  ++A   S    ++
Sbjct  63   EFIRSSCASTRYPDECYNSLSGYASAVQQNPARLARVAIAVSLSRARLEATYFSNLSKEA  122

Query  754  qgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL----NAKNFTTQMGDVTTWMSAAL  587
                  R   A+ DC   F DA+D L  SL  +R L    +++ F  QM +V TWMSAAL
Sbjct  123  DYGADHRVSAAIHDCFSTFGDAVDQLRGSLNQMRHLVPAGSSETFRFQMSNVQTWMSAAL  182

Query  586  TNEDTCLDGF----GRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            TNEDTC DGF      P +K V    ++V     +TSNALALVN  A T
Sbjct  183  TNEDTCTDGFDGVSDGPTKKDV---FDRVHRAEAVTSNALALVNSYANT  228



>ref|XP_004307821.1| PREDICTED: 21 kDa protein-like [Fragaria vesca subsp. vesca]
Length=193

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 99/163 (61%), Gaps = 6/163 (4%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +CS T + DLC+ SL+ +SN  +  P + A+  LSV++ + +     ++KL     
Sbjct  29   FIKTSCSATTYPDLCVQSLSSYSNAIQQSPRQLAQTALSVSLTRAQYAKSFVTKLTKFKG  88

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN----AKNFTTQMGDVTTWMSAALTNE  578
            L  +   A+ DC+E   D++D L +S+  L+K+      ++F   M +V TW+SAALT++
Sbjct  89   LSHKEYEAIDDCLEEMGDSVDRLSKSVDELKKMGKSSKGQDFIWHMSNVETWVSAALTDD  148

Query  577  DTCLDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLAT  455
            +TCLDGF G+    K++  +  +V NV+ +TSNALAL N  A+
Sbjct  149  NTCLDGFSGKAMDGKIKASIRAQVLNVAKVTSNALALCNHFAS  191



>ref|XP_003525240.1| PREDICTED: 21 kDa protein-like [Glycine max]
Length=214

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 97/167 (58%), Gaps = 8/167 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C+ T++ ++C  SL+ ++N  + +P   ARV ++V++ +V   A  +S L     
Sbjct  46   FIRTSCNTTLYPEVCFTSLSRYANAVQQNPGHLARVAIAVSLSKVHRAASYVSNLTRDAD  105

Query  745  LRG--RSQIALGDCVECFEDALDSLHRSLGVLRKLN-----AKNFTTQMGDVTTWMSAAL  587
              G  R+ +AL DC     DA+D +  SL  +R++      A +F  QM +V TW+SAAL
Sbjct  106  YGGSTRAALALHDCFSNLGDAVDEIRGSLKQMRQIGSAGAGASSFLFQMSNVQTWLSAAL  165

Query  586  TNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            T+E+TC DGF       ++  V ++V+NV   TSNALALVN  A  G
Sbjct  166  TDEETCTDGFQDVADCPMKTGVCDRVSNVKKFTSNALALVNSYANKG  212



>ref|XP_010424933.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=222

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 97/178 (54%), Gaps = 19/178 (11%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C+ T++ D+C  SLA +++  K+ P R A++ + V++ Q K+ A  LSKL    +
Sbjct  43   FIRTSCNATLYPDVCFTSLASYASAVKDSPARLAKLAIGVSLSQAKSAAAYLSKLSRSAA  102

Query  745  LRGRS---QIA---LGDCVECFEDALDSLHRSLGVLRKLNAKN-----------FTTQMG  617
            +       Q A   + DCV   EDA+D +  SL  LR +N K            F  QM 
Sbjct  103  VTSAGDGHQTASSVIRDCVSNVEDAVDEMRGSLRQLRDMNGKGGVPAARRSVETFRFQMS  162

Query  616  DVTTWMSAALTNEDTCLDGFGRPKRKKV--RWLVNKVTNVSYLTSNALALVNKLATTG  449
            +V TWMSAALT+EDTC DGF       +    + +++  V  LTSNALALVN  A  G
Sbjct  163  NVQTWMSAALTDEDTCTDGFEDMDEGGLIKTTVCDRLEEVKRLTSNALALVNTYANNG  220



>ref|XP_002516226.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF46228.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=252

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 101/181 (56%), Gaps = 2/181 (1%)
 Frame = -1

Query  994  FMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVG  815
            F+L L+  + A      G      V  +C    + +LC+ +L+ +S  A N P   A   
Sbjct  72   FILFLSLCSAAAKTHSAGAAPQDLVHSSCLHASYPNLCMRTLSSYSGPA-NTPHDLALAA  130

Query  814  LSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN  635
            + V++ +   ++  LS L S    R + ++AL DCVE   D++D L  +L  L+ L  + 
Sbjct  131  VEVSLGRASKVSKYLSSLSSGLKTR-KERVALSDCVEQISDSVDELSNTLNELKHLRGET  189

Query  634  FTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLAT  455
            F  QM +  TW+SAALTNE+TCLDGF + +RK    +  K+TNV+ +TSNAL ++N+L  
Sbjct  190  FRWQMNNAQTWVSAALTNEETCLDGFEQVQRKVKCDVKRKITNVARVTSNALYMINRLGE  249

Query  454  T  452
            +
Sbjct  250  S  250



>ref|XP_010264393.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=204

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C VT +  LC  SL+ F++  + +P + A+  L+++I   ++ +  +SKL  +  
Sbjct  47   FIRTSCGVTTYPQLCYTSLSSFASSIQANPRKLAQTALNISITSAQSTSVLVSKLSQRRD  106

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+      + DCV+  ED++D L +SL  L+KL       +M ++ TW+SAAL+N++TC+
Sbjct  107  LKTWEAATVKDCVDQIEDSIDELKQSLEQLQKLEGPGIDFKMSNIKTWLSAALSNDETCM  166

Query  565  DGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKL  461
            DG  G+   ++V   + K + NV+ LTSNALA++N L
Sbjct  167  DGIDGKDINEEVNSTIKKSILNVAKLTSNALAIINHL  203



>ref|XP_006281048.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
 gb|EOA13946.1| hypothetical protein CARUB_v10027064mg [Capsella rubella]
Length=228

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 104/188 (55%), Gaps = 6/188 (3%)
 Frame = -1

Query  1012  HNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPD  833
             H+ L+  +L++  +  + H          +V+ +C+ T +  LC  SLA  ++  +  P 
Sbjct  42    HHHLFTSLLIIITMLKSVHTITTNT---EFVKSSCTFTTYPRLCFTSLATQASLIQTSPK  98

Query  832   RWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLR  653
               A   L++T+   KA +  + +L +    + R   A+ DCVE   D LD L +S+G + 
Sbjct  99    LMAHAALNITLASAKATSAMMVRLSNTRL-KPREVAAMRDCVEELGDTLDELRKSIGEMC  157

Query  652   KLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNAL  479
             +L+  N+   M D+ TW+SAALT+E+TC +GF G     K + LV  ++  +++LTSNAL
Sbjct  158   RLSNSNYEVYMSDIQTWVSAALTDENTCTEGFEGDDMNGKAKVLVRGRILVIAHLTSNAL  217

Query  478   ALVNKLAT  455
             AL+N  A+
Sbjct  218   ALINHFAS  225



>ref|XP_009113052.1| PREDICTED: 21 kDa protein [Brassica rapa]
Length=220

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 106/199 (53%), Gaps = 7/199 (4%)
 Frame = -1

Query  1027  TMLPFHNILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKA  848
             T+     I     L+L   + A            Y++ +C++T ++ LC  SL+P++ K 
Sbjct  19    TLSQIEIIFLSIALLLFITSSATPSTYSNQTNLDYIKTSCNLTHYKTLCYISLSPYALKI  78

Query  847   KNHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQI-ALGDCVECFEDALDSLHR  671
              ++P R A   L++T+    + A  +  +        R +  A+ DCVE   D++  L  
Sbjct  79    DSNPQRLAVTALNLTLSSANSAAKFIKNIPHGRGGLTRFEAGAVADCVEEIGDSVSELQD  138

Query  670   SLGVLRKLNAKN---FTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKK--VRWLVNK-VT  509
             S+  L  +N ++   F   M DV TW+SAALT++DTC+DGFG+  R K  V+ LV + V 
Sbjct  139   SIRELDSINYEDSSKFEMVMSDVETWVSAALTDDDTCMDGFGQDGRAKAVVKDLVRRHVV  198

Query  508   NVSYLTSNALALVNKLATT  452
              V+ LTSNALA++N  A+T
Sbjct  199   KVARLTSNALAVINMYAST  217



>gb|AFK47771.1| unknown [Lotus japonicus]
Length=205

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 88/163 (54%), Gaps = 5/163 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +CS T +  LC  SL   +   +N   +     L+VT+   K+ +  +S +  +  
Sbjct  41   FIKTSCSSTTYPRLCFASLVKHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMAKKQG  100

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            ++ R   A+ DCVE   D++D L RS+  L  L   NF   M DV TW+SAALT+E TC 
Sbjct  101  MKPREVAAMQDCVEVLSDSVDELRRSIAELGNLKTSNFEMTMSDVQTWVSAALTDESTCT  160

Query  565  DGFGRPKRKKVRW-----LVNKVTNVSYLTSNALALVNKLATT  452
            DGF +     V       +  +V   + LTSNALAL+N+LA++
Sbjct  161  DGFQQQSEDAVNEDDKSAVRVRVVQTAQLTSNALALINRLASS  203



>ref|XP_004249077.1| PREDICTED: 21 kDa protein-like [Solanum lycopersicum]
Length=210

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 90/162 (56%), Gaps = 6/162 (4%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y+R +C  T++ D C HSL  ++   +  P R ARV + V++ + K ++  +S L  +  
Sbjct  46   YIRSSCKTTLYPDTCYHSLNHYATAVQQDPGRLARVAIGVSLAKAKRMSAFVSNLSREAD  105

Query  745  --LRGRSQIALGDCVECFEDALDSLHRSLGVLRKL--NAKNFTTQMGDVTTWMSAALTNE  578
               + R+  AL DC   F DA+D +  SL  +R L  ++++   QM +V TWMSAAL+NE
Sbjct  106  YGAQPRAVAALHDCFSVFGDAVDQIRDSLRQMRTLGGSSESLRFQMSNVQTWMSAALSNE  165

Query  577  DTCLDGFGRPKRKKVRWL--VNKVTNVSYLTSNALALVNKLA  458
            DTC DGF      +   L   N+   V  +TSNALA +N  A
Sbjct  166  DTCTDGFEDVSDDEPLKLDVCNRAGKVKEVTSNALAFINSFA  207



>ref|XP_002276089.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=189

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 91/157 (58%), Gaps = 1/157 (1%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            V  +C    + ++C+ +L+ +S  AK  P   A+  + V++ + + ++  L+ +  QG  
Sbjct  26   VHSSCIHASYPNICLRTLSSYSGPAKT-PRDLAQAAVKVSLSRAQRVSTYLNGVAGQGKA  84

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLD  563
              R Q+AL DCVE   D ++ L  +L  L+ L    F  QM +  TW+SAALTNEDTCLD
Sbjct  85   SKREQVALSDCVEQISDTVEELSNTLKELKHLRPGTFRWQMSNAETWVSAALTNEDTCLD  144

Query  562  GFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            GF     K    +  K+TNV+ +TSNAL L+N+L +T
Sbjct  145  GFQGVDGKVKADVKRKITNVARVTSNALYLINRLDST  181



>ref|XP_011033917.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=203

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 99/186 (53%), Gaps = 6/186 (3%)
 Frame = -1

Query  991  MLVLAWIAP---ACHggggggggGRYVRDAC-SVTIHQDLCIHSLAPFSNKAKNHPDRWA  824
            +L+L    P   +C          RY++ +C   T++  LC H+LA +++  K +P   A
Sbjct  13   ILILQISTPVNSSCSATRPSPRNIRYIKTSCYDTTLYPKLCYHTLAIYASTIKTNPKLLA  72

Query  823  RVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN  644
               L V+++   + +  + +      L  R   A+ DCVE   DA+  L RS+  +    
Sbjct  73   NTALHVSLKSTNSTSRLIKRASKTPGLDPRVHAAMLDCVEEVGDAVGELQRSIEEMDHAG  132

Query  643  AKNFTTQMGDVTTWMSAALTNEDTCLDGF--GRPKRKKVRWLVNKVTNVSYLTSNALALV  470
              NF+  M DV TW+SAALT++DTC+DGF  G  K+K    +   +  ++ LTSNALALV
Sbjct  133  GSNFSMAMNDVETWVSAALTDDDTCMDGFAEGAMKKKVKTTVKRHLRRIARLTSNALALV  192

Query  469  NKLATT  452
            N+ A+T
Sbjct  193  NRYAST  198



>ref|XP_002890079.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66338.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=201

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 95/166 (57%), Gaps = 12/166 (7%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C+ T++ D+C  SLA +++  +++P R A++ + V++ + K  A  LSKL     
Sbjct  40   FIRTSCNATLYPDVCFTSLAGYASAVQDNPARLAKLAIGVSLSRAKYTAAYLSKLS----  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN-----AKNFTTQMGDVTTWMSAALTN  581
             R  +  A+ DCV    DA+D +  SL  LR++N     A  F  QM +V TWMSAALT+
Sbjct  96   -RRTASAAVHDCVSNVGDAVDQMRGSLRQLREMNHRRPGAPAFRFQMSNVQTWMSAALTD  154

Query  580  EDTCLDGFGRPKR--KKVRWLVNKVTNVSYLTSNALALVNKLATTG  449
            E+TC DG        +    + ++V +V   TSNALALVN  A  G
Sbjct  155  EETCTDGITEEMEDGETKTAICDRVADVKMFTSNALALVNTYANNG  200



>ref|XP_011075388.1| PREDICTED: 21 kDa protein-like [Sesamum indicum]
Length=197

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 100/188 (53%), Gaps = 6/188 (3%)
 Frame = -1

Query  1006  ILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRW  827
             IL  F L++   +     G        ++R  C +T++  LC HSLA ++N  +  P R 
Sbjct  3     ILPPFFLLILTFSSYTSLGAPTLNATDFIRTNCQITLYPQLCYHSLAGYANAIQQDPARL  62

Query  826   ARVGLSVTIRQVKAIAgslsklksqgsLRG--RSQIALGDCVECFEDALDSLHRSLGVLR  653
             ARV +++++ + K++   ++ L  Q       R+  AL DC     DA+D +  S+  +R
Sbjct  63    ARVAVALSLSRAKSMTLYVANLSRQADYAADPRAASALHDCFSLLGDAVDQIRGSVKQMR  122

Query  652   KL---NAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSN  485
             +L   + +    Q+ +V TWMSAALTNEDTC+DGF   +   +   V ++   V  +TSN
Sbjct  123   RLTSGSGEELRFQLSNVQTWMSAALTNEDTCVDGFEDVEDGALMSDVCDRTLKVKEVTSN  182

Query  484   ALALVNKL  461
             ALALVN  
Sbjct  183   ALALVNSF  190



>ref|XP_002867618.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43877.1| invertase/pectin methylesterase inhibitor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=201

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 104/190 (55%), Gaps = 6/190 (3%)
 Frame = -1

Query  1006  ILWKFMLVLAWIAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRW  827
             IL+   L  A IA A +      G  ++++ +C +T + D C  SL+ ++++ K  P + 
Sbjct  10    ILFVLYLSTAAIAMARNLEEESSGDTKFIKASCEMTSYPDRCFQSLSSYASEIKKQPRKL  69

Query  826   ARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL  647
             A   L+V+I + K+    +S++     +  R   A+ DCVE   D +D L  SL  L+ L
Sbjct  70    AETALAVSIARAKSAKTYVSEMTDYKGITKRQHEAVADCVEEMGDTVDRLSNSLKELKHL  129

Query  646   NAKNFTTQ----MGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSN  485
                +   +    + +V TW SAALT+E TCLDGF G+    +++ L+  ++ +V+  TSN
Sbjct  130   EEGDSGEEFWFCLSNVRTWTSAALTDETTCLDGFGGKAMNGELKSLIRTRIVSVAEETSN  189

Query  484   ALALVNKLAT  455
             ALAL+N  A+
Sbjct  190   ALALINDFAS  199



>ref|XP_006395872.1| hypothetical protein EUTSA_v10004939mg [Eutrema salsugineum]
 gb|ESQ33158.1| hypothetical protein EUTSA_v10004939mg [Eutrema salsugineum]
Length=202

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 94/167 (56%), Gaps = 15/167 (9%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C+ T + D+C  SLA +++  K+ P R AR+ + V++ Q K+    LS L     
Sbjct  41   FIKTSCNATTYPDVCFKSLAGYASAVKDSPARLARLAVGVSLSQAKSTVAFLSNLS----  96

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKL----NAKNFTTQMGDVTTWMSAALTNE  578
             R  SQ+   DCV   EDA+DS+  SL  LR +    + + F  Q+ +V TWMSAALT+E
Sbjct  97   -RTASQVR--DCVSSVEDAIDSMRDSLQQLRDMKRGKSGETFRFQLSNVQTWMSAALTDE  153

Query  577  DTCLDGFGR---PKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            + C DGF      +   ++  V ++V  +   TSNALALVN  A  G
Sbjct  154  EDCTDGFEEVYHEEEDVIKTTVCDRVQELKRFTSNALALVNTYANNG  200



>ref|XP_010264193.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=202

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 101/162 (62%), Gaps = 5/162 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C VT +  +C+ SL+ ++N  +  P + A+  L V++ + ++    +SK+     
Sbjct  31   FIKASCGVTRYPAVCVESLSVYANAIQQSPRQLAQAALQVSLGRARSATAFVSKMTRLRG  90

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN---AKNFTTQMGDVTTWMSAALTNED  575
            L+GR   A+ DCV+   D++D + RS+  L ++N   +++F   M +V TW+SAALT+E+
Sbjct  91   LKGRQYQAVKDCVDNLGDSVDRISRSIHELGQINRGASQDFMWHMSNVQTWVSAALTDEN  150

Query  574  TCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
            TC+DGF G      V+  +  K+ NV+ +TSNALAL+N+ A+
Sbjct  151  TCMDGFAGHGMDGHVKTAIRGKILNVAQVTSNALALLNRFAS  192



>gb|KDO65437.1| hypothetical protein CISIN_1g029238mg [Citrus sinensis]
Length=196

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 92/160 (58%), Gaps = 5/160 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +CS T +  LC  SLA  ++  +  P   A   L+VT+ + K+ +  + K+    
Sbjct  37   EFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAKAKSTSAVMLKMSKSP  96

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DC+E   D++D L +S+G +  + A NF   M D+ TW+SAALT++ TC
Sbjct  97   GMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDDTTC  156

Query  568  LDGFGRP--KRKKVRWLVNKVTNVSYLTSNALALVNKLAT  455
             DGF +     K VR    ++  ++++TSNALAL+N  A+
Sbjct  157  SDGFEKNTVNGKVVR---GQIVKIAHMTSNALALINSYAS  193



>gb|KDP25618.1| hypothetical protein JCGZ_20774 [Jatropha curcas]
Length=205

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            +YV+ +CS T + +LC  SL+ ++ K + +P   A V L+VT+   K+ +  +  L +  
Sbjct  35   QYVQASCSNTTYPELCYSSLSCYARKIQRNPKTLAYVALNVTLTATKSASEFIKTLYNNK  94

Query  748  s--LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNED  575
               L+ +   A+ DCVE  ++A+D L RS+G + +    N    + D+ TW+SAALT+++
Sbjct  95   LHGLKPKEAAAMADCVELADEAVDELERSIGKMGRARGSNSDPVINDIQTWVSAALTDDN  154

Query  574  TCLDGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLATT  452
            TC+DGF G     +V+ +V K +T V+ LTS ALALVN+ A++
Sbjct  155  TCMDGFSGDVLDGEVKSIVLKNMTQVAQLTSVALALVNRFASS  197



>gb|KHN32444.1| 21 kDa protein [Glycine soja]
Length=202

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 88/161 (55%), Gaps = 8/161 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +CS T +  LC  SL   ++  + +        L+VT+  VK+ +  +S L  +  
Sbjct  43   FIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAKKQG  102

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+ R   A+ DCVE   D +D L RS+  +  L A NF   M DV TW+SAALT+E TC 
Sbjct  103  LKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALTDETTCN  162

Query  565  DGFGRPK-----RKKVRWLVNKVTNVSYLTSNALALVNKLA  458
            DGF         +  VR L   V  V+ LTSNALAL+NKLA
Sbjct  163  DGFQEITAATDIKSTVRRL---VIQVAQLTSNALALINKLA  200



>gb|AFK37116.1| unknown [Lotus japonicus]
Length=206

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 91/167 (54%), Gaps = 12/167 (7%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +CS T +  LC  SL   +   +N   +     L+VT+   K+ +  +S +  +  
Sbjct  41   FIKTSCSSTTYPRLCFASLVKHAESIQNDRLQLTCTALNVTLAAAKSTSAMISTMAKKQG  100

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            ++ R   A+ DCVE   D++D L RS+  L  L   NF   M DV TW+SAALT+E TC 
Sbjct  101  MKPREVAAMQDCVEVLSDSVDELRRSIAELGNLKTSNFEMTMSDVQTWVSAALTDESTCT  160

Query  565  DGFGRPKRKKVRWLVN---------KVTNVSYLTSNALALVNKLATT  452
            DGF   ++++    VN         +V   + LTSNALAL+N+LA++
Sbjct  161  DGF---RQQQSEDAVNEDDKSAVRVRVVQTAQLTSNALALINRLASS  204



>ref|XP_009372897.1| PREDICTED: 21 kDa protein-like [Pyrus x bretschneideri]
Length=194

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 98/161 (61%), Gaps = 5/161 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++ D+CS T + ++C+ SL+ +++  K +P R A+  LSV++ + ++    +++L     
Sbjct  31   FISDSCSATTYPEVCVKSLSSYASSIKQNPRRLAQAALSVSLTKAQSAKTFVTRLAKFKG  90

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLR---KLNAKNFTTQMGDVTTWMSAALTNED  575
            L+ R   A+ DC+E   D +D L  S+  L+   K   ++F   M +V TW+SAALT+++
Sbjct  91   LKSREYGAIKDCMEEIGDTVDRLSNSVQELKNMGKSKGQDFLWHMSNVETWVSAALTDDN  150

Query  574  TCLDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLA  458
            TCLDGF G+    K++  V  +V NV+  TSNAL+L N+ A
Sbjct  151  TCLDGFSGKTLNGKIKSAVRAQVLNVAQCTSNALSLCNRFA  191



>ref|XP_002322405.2| ripening-related family protein [Populus trichocarpa]
 gb|EEF06532.2| ripening-related family protein [Populus trichocarpa]
Length=197

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 2/158 (1%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +CS TI+  LC  SL+  S+  +  P+  A   L+VT+   K+ +  +S L     
Sbjct  36   FIRTSCSTTIYPKLCYSSLSIHSSTIQTSPELLANAALNVTLSSAKSTSAKMSTLSQSHG  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+ R   A+ DCVE   DA+  L +S+  +      NF   + DV TW+SAALT+E TC 
Sbjct  96   LKPREVSAMEDCVEELTDAVYELKKSIDEMSHAKKSNFRMMISDVQTWVSAALTDESTCS  155

Query  565  DGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
            DGF G      ++  V  K+ + + LTSNALAL+N  A
Sbjct  156  DGFEGNAMNGNLKTAVRGKIVHTAQLTSNALALINNYA  193



>ref|XP_006421715.1| hypothetical protein CICLE_v10005928mg [Citrus clementina]
 gb|ESR34955.1| hypothetical protein CICLE_v10005928mg [Citrus clementina]
Length=200

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 96/161 (60%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++  +C  T ++ +C+ SL P++ K +  P + A   LSV++ + K+    +S L     
Sbjct  37   FIETSCKSTRYRTVCVQSLLPYAYKIQRSPLQMALEALSVSLSRTKSADSFVSNLVKHKD  96

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKL---NAKNFTTQMGDVTTWMSAALTNED  575
            L+ R Q  + DC++   D++D L +S+  LR +   N ++F   + +V TW+SAALT++D
Sbjct  97   LKPREQQPIDDCLQLMGDSIDRLSKSVQELRGISGANDRDFLWHISNVQTWVSAALTDDD  156

Query  574  TCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            TCLDG      +    +  +V+NV+ +TSNALALVN+LA T
Sbjct  157  TCLDGLAALDGEVKDSIRTRVSNVAEVTSNALALVNQLAKT  197



>ref|XP_008796852.1| PREDICTED: 21 kDa protein-like [Phoenix dactylifera]
Length=209

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 102/190 (54%), Gaps = 7/190 (4%)
 Frame = -1

Query  1006  ILWKFMLVLAWI--APACHgg---ggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKN  842
             +L  F+ ++A+   A  CH       G     +VR +C+ T +  LC +SLA ++   + 
Sbjct  14    LLTAFLTLIAFALDASTCHAARPNTHGTISLEFVRTSCNKTKYPSLCFNSLAAYATTIQT  73

Query  841   HPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLG  662
              P + A   LSV++   +  +  +++L     +  R   A+ DC+E   D+++ L +SL 
Sbjct  74    SPVQLAEAALSVSLSYARGASTMMTRLSKGKGMSSREAEAMSDCIESLGDSVEELRQSLK  133

Query  661   VLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKV--RWLVNKVTNVSYLTS  488
              +  L+ KN   ++ D+ TW+S+ALT+E TC+DGF     K      L + +  V+ LTS
Sbjct  134   AMGHLSGKNLKLRVNDIQTWVSSALTDESTCMDGFANDGMKAGGRSALRSHIVKVAQLTS  193

Query  487   NALALVNKLA  458
             NAL++++ LA
Sbjct  194   NALSIISGLA  203



>gb|KDP25616.1| hypothetical protein JCGZ_20772 [Jatropha curcas]
Length=202

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 97/162 (60%), Gaps = 5/162 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C  T + DLC+  L+ +++  + +    A V LSV++ + K+    ++ L     
Sbjct  30   FIKSSCKATRYPDLCVECLSGYASAIQQNEKHLAEVALSVSLARAKSATDYVTTLTKVRG  89

Query  745  LRGRSQIALGDCVECFEDALDSLHRS---LGVLRKLNAKNFTTQMGDVTTWMSAALTNED  575
            ++ R   A+ DC+E   D++D L +S   LG +     ++F   M +V TW+SAALT+E+
Sbjct  90   IKAREYQAVKDCIENMGDSVDRLSQSIKELGHMGGAVGQDFVWHMSNVQTWVSAALTDEN  149

Query  574  TCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLAT  455
            TCLDGF GR     V+  + +++TNV  +TSNALALVN+ A+
Sbjct  150  TCLDGFAGRRMDGSVKAAIKHRITNVVKVTSNALALVNRFAS  191



>gb|KGN54954.1| hypothetical protein Csa_4G615740 [Cucumis sativus]
Length=149

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -1

Query  706  ECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGFGRPKRKKVRW  527
            + FE A+D LH S GVLR+L+ +NF TQMG +TTW+S ALTNED C+ GF   + K V  
Sbjct  27   KVFEAAIDELHMSFGVLRRLSRRNFDTQMGYLTTWVSIALTNEDICVKGFEGGREKIVNL  86

Query  526  LVNKVTNVSYLTSNALALVNKLATT  452
            L N +  V Y+ SNALALVNKL  +
Sbjct  87   LRNGMVKVGYIMSNALALVNKLVVS  111



>ref|XP_009618650.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=191

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++++C  T + DLC+ SL+ ++   KN  ++  +  LSV++ + ++  G +SKL     
Sbjct  28   FIKNSCKPTTYPDLCVASLSGYAQTIKNSQEQLIKTALSVSLDRAQSTKGFVSKLLKFKG  87

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN---AKNFTTQMGDVTTWMSAALTNED  575
            L+ R   A+ DCVE   D++D L +S+  L++++    K+F   + +V TW+SAA+T+E+
Sbjct  88   LKPREYEAIKDCVEETSDSVDRLSKSVSELKEVDHSRGKDFLWHISNVETWVSAAITDEN  147

Query  574  TCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
            TC DGF GR    +++  + N++ N++ +TSNALAL+N+ A
Sbjct  148  TCTDGFAGRALNGRIKASIRNRIANLAQVTSNALALINQYA  188



>ref|XP_006421707.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
 gb|ESR34947.1| hypothetical protein CICLE_v10005946mg [Citrus clementina]
Length=196

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 91/160 (57%), Gaps = 5/160 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             +++ +CS T +  LC  SLA  ++  +  P   A   L+VT+   K+ +  + K+    
Sbjct  37   EFIKTSCSSTTYPTLCYKSLARHASLIQTSPKLLAHASLNVTLAMAKSTSAVMLKMSKSP  96

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             ++ R   A+ DC+E   D++D L +S+G +  + A NF   M D+ TW+SAALT++ TC
Sbjct  97   GMKPREADAMQDCLEELSDSVDELRKSIGEMGLIKASNFELTMNDIQTWVSAALTDDTTC  156

Query  568  LDGFGRP--KRKKVRWLVNKVTNVSYLTSNALALVNKLAT  455
             DGF +     K VR    ++  ++++TSNALAL+N  A+
Sbjct  157  SDGFEKNTVNGKVVR---GQIVKIAHMTSNALALINSYAS  193



>ref|XP_002510935.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF51537.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=201

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 99/192 (52%), Gaps = 7/192 (4%)
 Frame = -1

Query  1009  NILWKFMLVLAWIA-----PACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAK  845
             N    F+L+L  I+      +            ++R +CS T +  LC  SL   ++K +
Sbjct  7     NTFSNFLLILLAISFHINSSSAGRNLAQTTSTEFIRTSCSTTTYPRLCYSSLKIHASKIQ  66

Query  844   NHPDRWARVGLSVTIRQVKAIAgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSL  665
               P   A   L+VT+   ++ +  + KL     ++ R   A+ DC++   D++D L +S+
Sbjct  67    TSPMLLANAALNVTLASTRSTSTMMQKLSKSHGMKPREVSAMQDCMDELTDSVDELRKSI  126

Query  664   GVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLVNKVT-NVSYLT  491
               L K     F   M DV TW+SAALT+E TC DGF G     +++ LV + T  +++LT
Sbjct  127   DELGKAQGSKFGLMMNDVQTWVSAALTDESTCSDGFAGSTMNGELKTLVRQQTVKIAHLT  186

Query  490   SNALALVNKLAT  455
             SNAL+LVN  A+
Sbjct  187   SNALSLVNSYAS  198



>gb|KDO65431.1| hypothetical protein CISIN_1g029020mg [Citrus sinensis]
Length=200

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 96/161 (60%), Gaps = 3/161 (2%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++  +C  T ++ +C+ SL P++ K +  P + A   LSV++ + K+    +S L     
Sbjct  37   FIETSCKSTRYRTVCVQSLLPYAYKIQRSPLQMALEALSVSLSRTKSADSFVSNLVKHKD  96

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKL---NAKNFTTQMGDVTTWMSAALTNED  575
            L+ R Q  + DC++   D++D L +S+  LR +   N ++F   + +V TW+SAALT++D
Sbjct  97   LKPREQQPIDDCLQLMGDSIDRLSKSVQELRGISGANDRDFLWHISNVQTWVSAALTDDD  156

Query  574  TCLDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKLATT  452
            TCLDG      +    +  +V+NV+ +TSNALALVN+LA T
Sbjct  157  TCLDGLAALDGEVKDSIRTRVSNVAEVTSNALALVNQLAKT  197



>ref|XP_010502142.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=223

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 95/179 (53%), Gaps = 20/179 (11%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAg-------sls  767
            ++R +C+ T++ D+C  SLA +++  ++ P R A++ + V++ Q K+ A        S +
Sbjct  43   FIRTSCNATLYPDVCFTSLASYASAVQDSPGRLAKLAIGVSLSQAKSTAAYLSKLSRSAA  102

Query  766  klksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN-----------FTTQM  620
             + S G     +   + DCV   EDA+D +  SL  LR +N K            F  QM
Sbjct  103  VITSVGDGHQTASSVIRDCVSNVEDAVDEMRGSLRQLRDMNGKGGVPAARRSVETFRFQM  162

Query  619  GDVTTWMSAALTNEDTCLDGFGRPKRKKV--RWLVNKVTNVSYLTSNALALVNKLATTG  449
             +V TWMSAALT+EDTC DGF       +    + +++  V  LTSNALALVN  A  G
Sbjct  163  SNVQTWMSAALTDEDTCTDGFEDMDEGGLIKTTVCDRLEEVKRLTSNALALVNTYANNG  221



>ref|XP_002527780.1| 21 kDa protein precursor, putative [Ricinus communis]
 gb|EEF34590.1| 21 kDa protein precursor, putative [Ricinus communis]
Length=208

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 92/167 (55%), Gaps = 8/167 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgsls--klksq  752
            Y+R  C  T++ D+C  SL+ +++  + +P+R ARV + V++ + + +A  +S    ++ 
Sbjct  40   YIRTNCVATLYPDICYTSLSRYASAIQKNPERLARVAIGVSLSRARHMAAYVSNLSRQAD  99

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL-----NAKNFTTQMGDVTTWMSAAL  587
                 R+  AL DC   F DA+D +  SL  +R+L     + + F  QM +V TWMSAAL
Sbjct  100  YGSDPRAAAALHDCFSNFGDAVDEIRGSLKQMRQLGTAGSSEEAFRFQMSNVQTWMSAAL  159

Query  586  TNEDTCLDGFGRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            T+EDTC DGF       ++  V  +  +     SNALALVN  A  G
Sbjct  160  TDEDTCTDGFEDVADGPMKSEVCQRAADAKKFVSNALALVNNYAAKG  206



>ref|XP_010553474.1| PREDICTED: 21 kDa protein-like [Tarenaya hassleriana]
Length=207

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 101/168 (60%), Gaps = 10/168 (6%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklk--sq  752
            Y++ +C+V ++Q LC  SL P+++   + PD+ A   L++T+ + K+    +  +    Q
Sbjct  37   YIKTSCNVALYQTLCYSSLYPYASLIASSPDKLAITALNLTLSETKSSRKFVKFISHRRQ  96

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDT  572
            GSL  R   +L DC+E   D++  L  S+  ++ +N  +F   M DV TW+SAALT+EDT
Sbjct  97   GSLTPREASSLKDCIEEMSDSVYELKDSISEMKAINYSSFEMVMSDVQTWVSAALTDEDT  156

Query  571  CLDGF-------GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKLATT  452
            C+DGF       G   R++V+ LV K +  V+ +TSNALALVN  A+T
Sbjct  157  CMDGFEEAGGGGGGEARREVKDLVRKRIDRVARITSNALALVNMYAST  204



>emb|CDP05320.1| unnamed protein product [Coffea canephora]
Length=201

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 91/159 (57%), Gaps = 2/159 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +CS T +  LC  +L+  +   ++ P   A   LS ++   K+ +  ++KL    
Sbjct  39   EFIRTSCSTTTYPKLCYATLSNQATIIQSDPKLLAHAALSASLDTAKSTSSMMAKLSQSH  98

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   +++D L  SL  + +L   NF   M D+ TW+SAALT++DTC
Sbjct  99   GMTPRQGGAMRDCVEELRESVDELKNSLDEMPQLTGSNFALTMNDIQTWVSAALTDDDTC  158

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
            ++GF G+      +  V +++ NV+++TSNALAL+N  A
Sbjct  159  MEGFAGKATNGNTKIAVRDQIVNVAHVTSNALALINSYA  197



>ref|XP_006353777.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=189

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 86/156 (55%), Gaps = 6/156 (4%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTI-RQVKAIAgslsklksqgs  746
            VR +C    +  +CI +L+ +S  A N P   A+  + +T+ R  KA             
Sbjct  28   VRSSCVHASYPTICIRTLSSYSGSAINTPQDLAQAAVKITLSRAHKASGFLSQVKVGSKR  87

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN-FTTQMGDVTTWMSAALTNEDTC  569
             +G    AL DC+E   D+++ L +SL  L+ L   N F  QM ++ TW+SAALTNEDTC
Sbjct  88   EKG----ALSDCIEQMGDSMEELSKSLSELKHLRRGNAFKWQMSNLETWVSAALTNEDTC  143

Query  568  LDGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKL  461
            LDGF     K    +  K+TNV+ +TSNAL L+N+L
Sbjct  144  LDGFKEIDGKIRSDVKRKITNVARVTSNALYLINRL  179



>ref|XP_010271276.1| PREDICTED: 21 kDa protein-like [Nelumbo nucifera]
Length=209

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 90/158 (57%), Gaps = 6/158 (4%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +CS T++ D+C  SL+ + +  +  P + AR+ ++V++      A  LS L  +  
Sbjct  40   FIRSSCSTTLYPDVCYTSLSRYGSAVQQDPGQLARLAIAVSLSNAHRTATYLSNLSREAE  99

Query  745  LRGRSQIA---LGDCVECFEDALDSLHRSLGVLRKLNAKN-FTTQMGDVTTWMSAALTNE  578
              G  Q A   L DC   F DA+D + RS+  +R +N++  F  QM +V TWMSAALTNE
Sbjct  100  T-GADQGAAAVLQDCFTTFGDAVDQMRRSINEMRHINSQETFKFQMNNVQTWMSAALTNE  158

Query  577  DTCLDGFGR-PKRKKVRWLVNKVTNVSYLTSNALALVN  467
            DTC + F   P       + ++V NV   TSNALALVN
Sbjct  159  DTCTEEFDDVPDGPTKTDVCDRVGNVRKFTSNALALVN  196



>ref|XP_010513891.1| PREDICTED: 21 kDa protein-like [Camelina sativa]
Length=223

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 95/179 (53%), Gaps = 20/179 (11%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAg-------sls  767
            ++R +C+ T++ D+C  SLA +++  ++ P R A++ + V++ Q K+ A        S +
Sbjct  43   FIRTSCNATLYPDVCFTSLASYASAVQDSPARLAKLAIGVSLSQAKSTAAYLSKLSRSTA  102

Query  766  klksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN-----------FTTQM  620
             + S G     +   + DCV   EDA+D +  SL  LR +N K            F  QM
Sbjct  103  VITSAGDGHQTASSVIRDCVSNVEDAVDEMRGSLRQLRDMNGKGGVPAARRSVETFRFQM  162

Query  619  GDVTTWMSAALTNEDTCLDGFGRPKRKKV--RWLVNKVTNVSYLTSNALALVNKLATTG  449
             +V TWMSAALT+EDTC DGF       +    + +++  V  LTSNALALVN  A  G
Sbjct  163  SNVQTWMSAALTDEDTCTDGFEDMDEGGLIKTTVCDRLKEVKRLTSNALALVNTYANNG  221



>sp|P17407.1|21KD_DAUCA RecName: Full=21 kDa protein; AltName: Full=1.2 protein; Flags: 
Precursor [Daucus carota]
 emb|CAA36642.1| precursor polypeptide (AA -22 to 171) [Daucus carota]
Length=193

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 96/162 (59%), Gaps = 5/162 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
            ++++ +C++T +  +C  SL+ ++   +N+P   A   L V++ + +     + +L    
Sbjct  27   QFIKTSCTLTTYPAVCEQSLSAYAKTIQNNPQELASTALQVSLTRTQQAQTFMKRLNKFK  86

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN---AKNFTTQMGDVTTWMSAALTNE  578
             L+ R   A+ DC+E  ED+LD + RS   ++ L+     +FT +M +V TW+SAALT+E
Sbjct  87   GLKARQYAAIHDCLEEVEDSLDRVSRSCDEMKNLSHAKGNDFTFRMSNVETWVSAALTDE  146

Query  577  DTCLDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLA  458
             TC+DGF G+    K++  V  +V  V+ +TSNALALVN  A
Sbjct  147  TTCMDGFAGKGMDGKIKESVRAQVVAVARVTSNALALVNNFA  188



>ref|XP_006362121.1| PREDICTED: 21 kDa protein-like [Solanum tuberosum]
Length=200

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 89/155 (57%), Gaps = 2/155 (1%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T + +LC  SL+  SN     P   A   L+V++   ++ +  + KL    
Sbjct  41   EFIRTSCKSTTYPNLCFSSLSSRSNAIGVSPQLLAHESLTVSLETAQSTSAMMLKLAYSQ  100

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTC  569
             +  R   A+ DCVE   D +  + +SLG +++L  K+F  +M D+ TW+SAA  +EDTC
Sbjct  101  GMAPREVGAMRDCVEELSDTVSGIKKSLGEMKELRGKDFDLKMNDIQTWVSAAFADEDTC  160

Query  568  LDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALV  470
             +GF G+    KV+ +V  K+  V+++TSN+LAL+
Sbjct  161  TEGFAGKVMNGKVKTVVREKILEVAHMTSNSLALI  195



>ref|XP_003541070.2| PREDICTED: 21 kDa protein-like [Glycine max]
Length=251

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 88/161 (55%), Gaps = 8/161 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +CS T +  LC  SL   ++  + +        L+VT+  VK+ +  +S L  +  
Sbjct  92   FIRTSCSSTTYPRLCYSSLVKHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAKKQG  151

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+ R   A+ DCVE   D +D L RS+  +  L A NF   M DV TW+SAALT+E TC 
Sbjct  152  LKPREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALTDETTCN  211

Query  565  DGFGRPK-----RKKVRWLVNKVTNVSYLTSNALALVNKLA  458
            DGF         +  VR L   V  V+ LTSNALAL+NKLA
Sbjct  212  DGFQEITAATDIKSTVRRL---VIQVAQLTSNALALINKLA  249



>ref|XP_009796710.1| PREDICTED: 21 kDa protein-like [Nicotiana sylvestris]
Length=191

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++++C  T + DLC+ SL+ ++   KN  ++  +  LSV++ + ++  G +SKL     
Sbjct  28   FIKNSCKPTTYPDLCVASLSGYAPTIKNSQEQLIKTALSVSLDRAQSTKGFVSKLLKFKG  87

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLN---AKNFTTQMGDVTTWMSAALTNED  575
            L+ R   A+ DC+E   D++D L +S+  L++++    K+F   + +V TW+SAA+T+E+
Sbjct  88   LKPREYAAIKDCIEETSDSVDRLSKSVSELKEVDHSRGKDFLWHISNVETWVSAAITDEN  147

Query  574  TCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNKLA  458
            TC DGF GR    +++  + N++ N++ +TSNALAL+N+ A
Sbjct  148  TCTDGFAGRALNGRIKASIRNRIANLAQVTSNALALINQYA  188



>ref|XP_011010939.1| PREDICTED: 21 kDa protein-like [Populus euphratica]
Length=203

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 93/161 (58%), Gaps = 10/161 (6%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            +++ +C VT + DLC   L+ +++  +++P + A V LS T++  ++    + KL  +  
Sbjct  46   FIKTSCGVTRYPDLCYKKLSAYADTIRDNPTQLANVSLSETLKNAESTLIMVQKLLKKRK  105

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            LR R   A+ +CVE  +D++D L +S+  +  L   +F  +M ++ TW+SAALT EDTC+
Sbjct  106  LRPREAGAIKECVETMKDSVDELQKSMLAMSDLEGPDFEMEMSNIQTWVSAALTEEDTCM  165

Query  565  DGF------GRPKRKKVRWLVNKVTNVSYLTSNALALVNKL  461
            D F      G+ K     ++V     V+ LTS +LAL+N +
Sbjct  166  DDFEENSMDGKVKDTTRSYIV----TVAQLTSISLALINSI  202



>ref|XP_010091300.1| 21 kDa protein [Morus notabilis]
 gb|EXC36884.1| 21 kDa protein [Morus notabilis]
Length=205

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 91/159 (57%), Gaps = 4/159 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqg  749
             ++R +C  T +  LC  SL+  ++  ++ P   A   LSVT+   K  +  +++L    
Sbjct  41   EFIRTSCVSTTYPKLCFSSLSTHASTIQSSPQLLAITSLSVTLSSAKTTSAEMTRLSLSH  100

Query  748  sLRGRSQIALGDCVECFEDALDSLHRSLGVLRKL--NAKNFTTQMGDVTTWMSAALTNED  575
             L+ R   A+ DC+E   D++D L +S+G + +L      F   + D+ TW+SAALT+E+
Sbjct  101  GLKPREVDAMKDCIEELRDSVDELRKSMGEMSQLVKGKSGFKLMINDIQTWVSAALTDEN  160

Query  574  TCLDGF-GRPKRKKVRWLV-NKVTNVSYLTSNALALVNK  464
            TC DGF  +P    ++  V  +V NV+ LTSNALAL+N+
Sbjct  161  TCTDGFEEKPMNGNLKTAVRGQVVNVAQLTSNALALINR  199



>gb|ACU13418.1| unknown [Glycine max]
Length=202

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 88/161 (55%), Gaps = 8/161 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +CS T +  LC  SL   ++  + +        L+VT+  VK+ +  +S L  +  
Sbjct  43   FIRTSCSSTTYPRLCYSSLVRHADLIQTNRVVLTGAALNVTLASVKSTSAMMSTLAKKQG  102

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNEDTCL  566
            L+ R   A+ DCVE   D +D L RS+  +  L A NF   M DV TW+SAALT+E TC 
Sbjct  103  LKLREVAAMQDCVEQLSDTVDELRRSIAEMSDLRASNFEMIMSDVQTWVSAALTDETTCN  162

Query  565  DGFGRPK-----RKKVRWLVNKVTNVSYLTSNALALVNKLA  458
            DGF         +  VR L   V  V+ LTSNALAL+NKLA
Sbjct  163  DGFQEITAATDIKSTVRRL---VIQVAQLTSNALALINKLA  200



>ref|XP_009608759.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=201

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 92/155 (59%), Gaps = 4/155 (3%)
 Frame = -1

Query  922  VRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgsL  743
            VR +C    +  +CI +L+ +S  A N P   A+  + V++ + +  +  LS LK Q   
Sbjct  39   VRTSCVHASYPTICIRTLSSYSGSAINTPQDLAQAAVKVSLSRAQKASDFLSALKVQSK-  97

Query  742  RGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAKN-FTTQMGDVTTWMSAALTNEDTCL  566
              R + AL DCVE   D++D L ++L  L+ L+  N F  QM ++ TW+SAALTNEDTC+
Sbjct  98   --REKGALSDCVEQMADSMDELSKTLSELKHLSKGNAFKWQMSNLETWVSAALTNEDTCI  155

Query  565  DGFGRPKRKKVRWLVNKVTNVSYLTSNALALVNKL  461
            DGF     K    +  K+TNV+ +TSNAL L+N+L
Sbjct  156  DGFKEIDGKLRSDVKRKITNVARVTSNALYLINRL  190



>ref|XP_002263511.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=211

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 97/163 (60%), Gaps = 5/163 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVK-AIAgslsklksq  752
            ++++ +C+ T +  +C  SL+ +++K +  P + A V L+V+++  + A +     L+ +
Sbjct  46   QFIKTSCNSTTYPGVCYKSLSSYASKVQTSPLKLANVALTVSLKAARNASSTITLLLERK  105

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA-KNFTTQMGDVTTWMSAALTNED  575
            G  R  + I + DCVE F D +D L +SL   + L   KN   QM ++ TW+SAALT+E 
Sbjct  106  GMTRMETSI-VKDCVENFGDCIDELQQSLQEFKSLGGGKNVAFQMANIKTWVSAALTDEY  164

Query  574  TCLDGFGRPKRKKV--RWLVNKVTNVSYLTSNALALVNKLATT  452
            TC DGF   K      + + N ++NV+ +TSNALAL+N L+ T
Sbjct  165  TCSDGFEGQKVSSSLQQQIKNYISNVAKITSNALALINNLSVT  207



>emb|CAN79278.1| hypothetical protein VITISV_005236 [Vitis vinifera]
Length=211

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 97/163 (60%), Gaps = 5/163 (3%)
 Frame = -1

Query  928  RYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVK-AIAgslsklksq  752
            ++++ +C+ T +  +C  SL+ +++K +  P + A V L+V+++  + A +     L+ +
Sbjct  46   QFIKTSCNSTTYPGVCYKSLSSYASKVQTSPLKLANVALTVSLKAARNASSTITLLLERK  105

Query  751  gsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA-KNFTTQMGDVTTWMSAALTNED  575
            G  R  + I + DCVE F D +D L +SL   + L   KN   QM ++ TW+SAALT+E 
Sbjct  106  GMTRMETSI-VKDCVENFGDCIDELQQSLQEFKSLGGGKNVAFQMANIKTWVSAALTDEY  164

Query  574  TCLDGFGRPKRKKV--RWLVNKVTNVSYLTSNALALVNKLATT  452
            TC DGF   K      + + N ++NV+ +TSNALAL+N L+ T
Sbjct  165  TCSDGFEGQKVSSSLQQQIKNYISNVAKITSNALALINNLSVT  207



>ref|XP_011029961.1| PREDICTED: 21 kDa protein [Populus euphratica]
Length=202

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 95/160 (59%), Gaps = 8/160 (5%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y++ AC+ T +  LC  SL+ +++  K +  +  R  L+VT+   KA + + S +K+   
Sbjct  44   YLQTACNSTTYPQLCFKSLSSYTSTIKTNDLKLCRTALTVTL---KAASNTSSLVKALSK  100

Query  745  LRGRSQIALG---DCVECFEDALDSLHRSLGVLRKLNAKNFTTQMGDVTTWMSAALTNED  575
             +G S+   G   DC+E   D++D L++SL  L  L   +   Q+ ++ TW+SAA+T+ED
Sbjct  101  QKGLSKTEAGIIKDCIEVIGDSIDELNQSLKALGSLKGSDIEFQIANIKTWISAAITDED  160

Query  574  TCLDGF-GRPKRKKVRWLVNK-VTNVSYLTSNALALVNKL  461
            TC +GF  R    +V   + K + NV+ LTSNALAL+NKL
Sbjct  161  TCTEGFEERNITDEVMIKIRKSIVNVTRLTSNALALINKL  200



>emb|CDY17457.1| BnaC09g20800D [Brassica napus]
Length=204

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 97/169 (57%), Gaps = 17/169 (10%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            ++R +C+ T++QDLC +SLA +++  ++ P R A++   V++ + K+    LSK+     
Sbjct  41   FIRTSCNATLYQDLCFNSLAGYASVVQDSPARLAKIATGVSLSKAKSTLAFLSKI-----  95

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKL--------NAKNFTTQMGDVTTWMSAA  590
               RS   + DCV   ++A+ S+  SL  LR +        + + F++Q+ DV TWMSAA
Sbjct  96   --SRSAAEVQDCVSYLDEAVGSIRDSLRTLRNMSRVAAAPSSEETFSSQVNDVQTWMSAA  153

Query  589  LTNEDTCLDGFGR-PKRKKVRWLV-NKVTNVSYLTSNALALVNKLATTG  449
            LT EDTC D +    +  +++  V ++V  +   TSNALALVN    TG
Sbjct  154  LTYEDTCTDEYEEMDEAGEIKTTVYDRVNTLKRFTSNALALVNTYGNTG  202



>ref|XP_002280585.1| PREDICTED: 21 kDa protein [Vitis vinifera]
Length=208

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 99/178 (56%), Gaps = 6/178 (3%)
 Frame = -1

Query  973  IAPACHggggggggGRYVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQ  794
            + PA            ++  +C  T +  LC+  L+ ++NK +  P + A+V LSV++ +
Sbjct  22   VEPASVQHARKSRARTFIEASCRSTRYPSLCVKCLSGYANKTQQSPFQLAQVALSVSLAK  81

Query  793  VKAI-AgslsklksqgsLRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNAK----NFT  629
             +   A  +    +   + GR+   + DC++   D +D L +S+  LR++N +    +FT
Sbjct  82   TRHTRAYVMEVASNFKDVEGRTHQDISDCLDQINDGVDRLAQSIIELRRMNQEGGDSDFT  141

Query  628  TQMGDVTTWMSAALTNEDTCLDGF-GRPKRKKVRWLVNKVTNVSYLTSNALALVNKLA  458
             +M ++ TW+SAALT+  TC+DGF GR   K    +  KV NV+ +TSNALALVN+ A
Sbjct  142  WRMSNIETWVSAALTDATTCVDGFSGRDMGKLKATIKGKVLNVAQVTSNALALVNRFA  199



>gb|ABS01356.1| unknown [Carica papaya]
Length=193

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 96/163 (59%), Gaps = 5/163 (3%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y++ +C  T    +C+ +L+ +S+K +  P   A   LSV++ + +   G +SK+     
Sbjct  30   YIQKSCKATTFPAVCLQTLSAYSSKIQQSPQNLALTALSVSLSRAQYAKGFVSKMTKFKG  89

Query  745  LRGRSQIALGDCVECFEDALDSLHRSLGVLRKLNA---KNFTTQMGDVTTWMSAALTNED  575
            L+ R   A+ DCVE  +D +D L ++   L++L+      F   M +V T++SAALT+E+
Sbjct  90   LKRREYQAIKDCVEEMDDTVDRLSKAAQELQRLSGFRGDEFLFHMSNVQTYVSAALTDEN  149

Query  574  TCLDGF-GRPKRKKVRWLVN-KVTNVSYLTSNALALVNKLATT  452
            TC DGF GR    K++  +  +V  VS +TSNALALVN+LA T
Sbjct  150  TCFDGFAGRALNGKLKSSIRAQVVKVSQVTSNALALVNQLAAT  192



>ref|XP_009595722.1| PREDICTED: 21 kDa protein-like [Nicotiana tomentosiformis]
Length=228

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 90/165 (55%), Gaps = 12/165 (7%)
 Frame = -1

Query  925  YVRDACSVTIHQDLCIHSLAPFSNKAKNHPDRWARVGLSVTIRQVKAIAgslsklksqgs  746
            Y+R +C  T++   C HSL  ++   +    R ARV + V++ + K  A   S L  +  
Sbjct  61   YIRSSCKTTMYPATCYHSLNHYATAVQQDSARLARVAVGVSLAKAKRTAAFFSNLSREAG  120

Query  745  LRGRSQI--ALGDCVECFEDALDSLHRSLGVLRKL--NAKNFTTQMGDVTTWMSAALTNE  578
               + ++  AL DC   F DA+D +  SL  +R+L  ++++   QM +V TWMSAALTNE
Sbjct  121  YGAQPRVVAALHDCFSIFGDAVDQIRDSLSQMRRLGGSSESLRFQMSNVQTWMSAALTNE  180

Query  577  DTCLDGF-----GRPKRKKVRWLVNKVTNVSYLTSNALALVNKLA  458
            DTC DGF       P +  V    ++V  V  +TSNALALVN  A
Sbjct  181  DTCTDGFEDVTDDEPMKLNV---CDRVGKVKEVTSNALALVNSFA  222



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3121169722840