BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2677_g1_i1 len=2489 path=[2467:0-217 2685:218-2488]

Length=2489
                                                                      Score     E

ref|XP_006366475.1|  PREDICTED: sulfate transporter 2.1-like            874   0.0      
ref|XP_010652824.1|  PREDICTED: low affinity sulfate transporter 3      863   0.0      
ref|XP_009776146.1|  PREDICTED: low affinity sulfate transporter ...    863   0.0      
ref|NP_001274303.1|  sulfate transporter 2.1-like                       860   0.0      
ref|XP_009619632.1|  PREDICTED: low affinity sulfate transporter ...    860   0.0      
emb|CBI21449.3|  unnamed protein product                                858   0.0      
ref|XP_007048017.1|  Slufate transporter 2,1                            830   0.0      
emb|CDP01420.1|  unnamed protein product                                826   0.0      
ref|XP_002309991.2|  Early nodulin 70 family protein                    822   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP46877.1|  hypothetical protein JCGZ_24086                         812   0.0      
ref|XP_007204972.1|  hypothetical protein PRUPE_ppa002425mg             812   0.0      
gb|KDP32701.1|  hypothetical protein JCGZ_11993                         810   0.0      
ref|XP_003552820.1|  PREDICTED: sulfate transporter 2.1-like            809   0.0      
ref|XP_008233993.1|  PREDICTED: low affinity sulfate transporter 3      809   0.0      
ref|XP_006472651.1|  PREDICTED: low affinity sulfate transporter ...    808   0.0      
ref|XP_003538517.1|  PREDICTED: sulfate transporter 2.1-like            807   0.0      
ref|XP_008233449.1|  PREDICTED: sulfate transporter 2.1-like            808   0.0      
ref|XP_004502442.1|  PREDICTED: sulfate transporter 2.1-like isof...    806   0.0      
ref|XP_006434037.1|  hypothetical protein CICLE_v10000521mg             805   0.0      
ref|XP_003602002.1|  Sulfate/bicarbonate/oxalate exchanger and tr...    804   0.0      
gb|KDO80888.1|  hypothetical protein CISIN_1g006030mg                   805   0.0      
gb|KHN44326.1|  Sulfate transporter 2.1                                 804   0.0      
ref|XP_007226968.1|  hypothetical protein PRUPE_ppa002519mg             803   0.0      
ref|XP_002513876.1|  sulfate transporter, putative                      803   0.0      Ricinus communis
ref|XP_011008597.1|  PREDICTED: sulfate transporter 2.1                 803   0.0      
ref|XP_007141139.1|  hypothetical protein PHAVU_008G170700g             800   0.0      
ref|XP_009378551.1|  PREDICTED: sulfate transporter 2.1-like            800   0.0      
ref|XP_006399511.1|  hypothetical protein EUTSA_v10012871mg             796   0.0      
ref|XP_006428147.1|  hypothetical protein CICLE_v10025101mg             795   0.0      
ref|XP_010090564.1|  Sulfate transporter 2.1                            795   0.0      
ref|XP_003531363.1|  PREDICTED: sulfate transporter 2.1-like isof...    792   0.0      
ref|XP_007018861.1|  STAS domain / Sulfate transporter family iso...    791   0.0      
ref|XP_003544185.1|  PREDICTED: low affinity sulfate transporter ...    790   0.0      
ref|XP_010061828.1|  PREDICTED: low affinity sulfate transporter ...    790   0.0      
gb|ACK44507.1|  AT5G10180-like protein                                  789   0.0      Arabidopsis arenosa
ref|XP_002871408.1|  hypothetical protein ARALYDRAFT_908975             789   0.0      
ref|XP_007163633.1|  hypothetical protein PHAVU_001G250700g             788   0.0      
ref|XP_010025490.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    788   0.0      
gb|KCW62157.1|  hypothetical protein EUGRSUZ_H04816                     788   0.0      
gb|KCW68851.1|  hypothetical protein EUGRSUZ_F02448                     786   0.0      
ref|XP_009125320.1|  PREDICTED: sulfate transporter 2.1                 787   0.0      
gb|ABK35754.1|  sulfate transporter                                     783   0.0      Populus tremula x Populus alba [gray poplar]
ref|NP_196580.1|  sulfate transporter 2;1                               787   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN41503.1|  Low affinity sulfate transporter 3                      785   0.0      
emb|CDY40086.1|  BnaC02g00440D                                          786   0.0      
ref|XP_006354019.1|  PREDICTED: low affinity sulfate transporter ...    785   0.0      
gb|KHN29086.1|  Sulfate transporter 2.1                                 784   0.0      
ref|XP_004490361.1|  PREDICTED: low affinity sulfate transporter ...    785   0.0      
ref|XP_011027673.1|  PREDICTED: low affinity sulfate transporter 3      784   0.0      
ref|XP_010061827.1|  PREDICTED: low affinity sulfate transporter ...    784   0.0      
ref|XP_004304832.1|  PREDICTED: sulfate transporter 2.1-like            785   0.0      
ref|XP_003543772.1|  PREDICTED: low affinity sulfate transporter ...    781   0.0      
ref|XP_009122079.1|  PREDICTED: sulfate transporter 2.1-like isof...    780   0.0      
ref|XP_004163495.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    780   0.0      
ref|XP_010261213.1|  PREDICTED: low affinity sulfate transporter ...    780   0.0      
ref|XP_003614966.1|  Sulfate transporter-like protein                   779   0.0      
ref|XP_008453779.1|  PREDICTED: low affinity sulfate transporter ...    779   0.0      
gb|ACO25294.1|  low affinity sulfate transporter Bnst2-1                780   0.0      
ref|XP_002284234.2|  PREDICTED: low affinity sulfate transporter 3      779   0.0      Vitis vinifera
ref|XP_002302276.1|  Low affinity sulfate transporter 3 family pr...    778   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004149160.1|  PREDICTED: sulfate transporter 2.1-like            778   0.0      
emb|CDX96981.1|  BnaC09g46440D                                          779   0.0      
ref|XP_009593440.1|  PREDICTED: low affinity sulfate transporter ...    778   0.0      
emb|CAG17931.1|  plasma membrane sulphate transporter                   778   0.0      Brassica oleracea var. viridis [collards]
ref|XP_010547619.1|  PREDICTED: sulfate transporter 2.1                 778   0.0      
gb|ABK35755.1|  sulfate transporter                                     773   0.0      Populus tremula x Populus alba [gray poplar]
ref|XP_010261212.1|  PREDICTED: low affinity sulfate transporter ...    775   0.0      
ref|XP_004237881.1|  PREDICTED: low affinity sulfate transporter ...    775   0.0      
ref|XP_010105877.1|  Low affinity sulfate transporter 3                 776   0.0      
ref|XP_009591937.1|  PREDICTED: low affinity sulfate transporter ...    773   0.0      
ref|XP_009345531.1|  PREDICTED: low affinity sulfate transporter ...    771   0.0      
gb|KFK25313.1|  hypothetical protein AALP_AA8G096500                    769   0.0      
ref|XP_009781347.1|  PREDICTED: low affinity sulfate transporter ...    768   0.0      
ref|XP_004252542.2|  PREDICTED: low affinity sulfate transporter ...    767   0.0      
ref|XP_008375005.1|  PREDICTED: low affinity sulfate transporter ...    767   0.0      
ref|XP_006300833.1|  hypothetical protein CARUB_v10019923mg             763   0.0      
sp|P53393.1|SUT3_STYHA  RecName: Full=Low affinity sulfate transp...    762   0.0      Stylosanthes hamata [Caribbean stylo]
gb|ABB59582.1|  putative sulfate transporter                            761   0.0      Populus tremula x Populus alba [gray poplar]
gb|AAZ67600.1|  80A08_15                                                761   0.0      Brassica rapa subsp. pekinensis [bai cai]
gb|ABB59581.1|  putative sulfate transporter                            759   0.0      Populus tremula x Populus alba [gray poplar]
ref|XP_010261211.1|  PREDICTED: low affinity sulfate transporter ...    760   0.0      
ref|XP_002528970.1|  sulfate transporter, putative                      756   0.0      Ricinus communis
gb|KEH34870.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    756   0.0      
ref|XP_007136219.1|  hypothetical protein PHAVU_009G028400g             755   0.0      
gb|EYU36527.1|  hypothetical protein MIMGU_mgv1a002607mg                755   0.0      
ref|XP_010320152.1|  PREDICTED: low affinity sulfate transporter ...    753   0.0      
ref|XP_010523328.1|  PREDICTED: sulfate transporter 2.1-like            755   0.0      
ref|XP_006390036.1|  hypothetical protein EUTSA_v10018230mg             753   0.0      
ref|XP_006287209.1|  hypothetical protein CARUB_v10000384mg             753   0.0      
gb|KDO80891.1|  hypothetical protein CISIN_1g006030mg                   749   0.0      
gb|AAZ08077.2|  putative low affinity sulfate transporter               750   0.0      Brassica napus [oilseed rape]
gb|KHN09143.1|  Low affinity sulfate transporter 3                      749   0.0      
ref|XP_003526596.1|  PREDICTED: low affinity sulfate transporter ...    750   0.0      
ref|XP_009804329.1|  PREDICTED: low affinity sulfate transporter ...    749   0.0      
ref|XP_010428901.1|  PREDICTED: sulfate transporter 2.2                 749   0.0      
ref|XP_010453042.1|  PREDICTED: sulfate transporter 2.1                 748   0.0      
ref|XP_009106442.1|  PREDICTED: sulfate transporter 2.2                 747   0.0      
ref|XP_010491674.1|  PREDICTED: sulfate transporter 2.1-like isof...    748   0.0      
ref|XP_010491673.1|  PREDICTED: sulfate transporter 2.1-like isof...    748   0.0      
ref|XP_010416764.1|  PREDICTED: sulfate transporter 2.2-like            746   0.0      
ref|XP_010491672.1|  PREDICTED: sulfate transporter 2.1-like isof...    747   0.0      
ref|XP_010926257.1|  PREDICTED: low affinity sulfate transporter ...    744   0.0      
gb|KHN26070.1|  Low affinity sulfate transporter 3                      739   0.0      
ref|XP_010471997.1|  PREDICTED: sulfate transporter 2.2-like            743   0.0      
emb|CDX87488.1|  BnaA07g33850D                                          741   0.0      
ref|XP_006585288.1|  PREDICTED: sulfate transporter 2.1-like isof...    740   0.0      
emb|CAM33601.1|  plasma membrane sulphate transporter                   741   0.0      Brassica oleracea
gb|KFK42184.1|  hypothetical protein AALP_AA2G222200                    740   0.0      
emb|CDP01189.1|  unnamed protein product                                739   0.0      
ref|XP_004301932.1|  PREDICTED: low affinity sulfate transporter ...    739   0.0      
gb|AAM20714.1|  sulfate transporter, putative                           739   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAA25174.1|  sulfate transporter                                    739   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAA12811.1|  sulfate transporter                                    738   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_565165.2|  sulfate transporter 2;2                               739   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004155745.1|  PREDICTED: LOW QUALITY PROTEIN: low affinity...    738   0.0      
ref|XP_004500603.1|  PREDICTED: low affinity sulfate transporter ...    738   0.0      
ref|XP_004140372.1|  PREDICTED: low affinity sulfate transporter ...    738   0.0      
ref|XP_006596331.1|  PREDICTED: low affinity sulfate transporter ...    735   0.0      
gb|AAL67130.2|  putative sulfate transporter protein                    735   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011098127.1|  PREDICTED: low affinity sulfate transporter 3      735   0.0      
ref|XP_008780885.1|  PREDICTED: low affinity sulfate transporter ...    733   0.0      
emb|CDX88403.1|  BnaC06g38470D                                          733   0.0      
ref|XP_008460487.1|  PREDICTED: LOW QUALITY PROTEIN: low affinity...    732   0.0      
ref|XP_006434038.1|  hypothetical protein CICLE_v10000521mg             729   0.0      
ref|XP_002306322.2|  Early nodulin 70 family protein                    728   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011074142.1|  PREDICTED: low affinity sulfate transporter ...    730   0.0      
ref|XP_002887712.1|  hypothetical protein ARALYDRAFT_316712             727   0.0      
emb|CBK55661.1|  sulphate transporter                                   724   0.0      Astragalus drummondii
emb|CBK55653.1|  sulphate transporter                                   723   0.0      Astragalus racemosus
emb|CBK55658.1|  sulphate transporter                                   722   0.0      Astragalus bisulcatus
ref|XP_010534060.1|  PREDICTED: sulfate transporter 2.2 isoform X1      721   0.0      
ref|XP_008652499.1|  PREDICTED: low affinity sulfate transporter 3      715   0.0      
ref|XP_006596332.1|  PREDICTED: low affinity sulfate transporter ...    705   0.0      
ref|XP_009404428.1|  PREDICTED: sulfate transporter 2.1                 705   0.0      
ref|XP_006300834.1|  hypothetical protein CARUB_v10019923mg             700   0.0      
ref|XP_004985352.1|  PREDICTED: low affinity sulfate transporter ...    701   0.0      
gb|KCW68852.1|  hypothetical protein EUGRSUZ_F02448                     694   0.0      
ref|XP_002465703.1|  hypothetical protein SORBIDRAFT_01g044100          696   0.0      Sorghum bicolor [broomcorn]
dbj|BAJ85215.1|  predicted protein                                      695   0.0      
ref|XP_006651130.1|  PREDICTED: low affinity sulfate transporter ...    690   0.0      
ref|XP_006434040.1|  hypothetical protein CICLE_v10000521mg             687   0.0      
gb|AAN59769.1|  Putative sulfate transporter                            691   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010905915.1|  PREDICTED: low affinity sulfate transporter ...    687   0.0      
gb|EEC74682.1|  hypothetical protein OsI_10373                          690   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008809316.1|  PREDICTED: LOW QUALITY PROTEIN: low affinity...    684   0.0      
ref|XP_009345532.1|  PREDICTED: low affinity sulfate transporter ...    686   0.0      
gb|KEH28061.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    678   0.0      
ref|XP_010534061.1|  PREDICTED: sulfate transporter 2.2 isoform X2      680   0.0      
ref|XP_008375006.1|  PREDICTED: low affinity sulfate transporter ...    681   0.0      
ref|XP_004985353.1|  PREDICTED: low affinity sulfate transporter ...    679   0.0      
gb|EMT09908.1|  hypothetical protein F775_52532                         676   0.0      
ref|XP_003558598.1|  PREDICTED: low affinity sulfate transporter ...    674   0.0      
gb|AAF17693.1|AC009243_20  F28K19.21                                    672   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389865.1|  PREDICTED: low affinity sulfate transporter ...    668   0.0      
gb|EEE58498.1|  hypothetical protein OsJ_09763                          664   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649557.1|  PREDICTED: sulfate transporter 2.1-like            664   0.0      
ref|XP_006826990.1|  hypothetical protein AMTR_s00010p00209860          662   0.0      
ref|XP_006354020.1|  PREDICTED: low affinity sulfate transporter ...    661   0.0      
ref|NP_001049257.1|  Os03g0195300                                       662   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC74681.1|  hypothetical protein OsI_10372                          660   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007136220.1|  hypothetical protein PHAVU_009G028400g             638   0.0      
emb|CAN66052.1|  hypothetical protein VITISV_009508                     643   0.0      Vitis vinifera
ref|XP_010422881.1|  PREDICTED: sulfate transporter 2.1-like            627   0.0      
gb|AAN59770.1|  Putative sulfate transporter                            630   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004490362.1|  PREDICTED: sulfate transporter 1.3-like isof...    629   0.0      
ref|XP_004502443.1|  PREDICTED: sulfate transporter 2.1-like isof...    625   0.0      
gb|KDO80893.1|  hypothetical protein CISIN_1g006030mg                   623   0.0      
ref|XP_002307394.1|  high affinity sulfate transporter family pro...    627   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO80892.1|  hypothetical protein CISIN_1g006030mg                   622   0.0      
ref|XP_003614968.1|  Sulfate transporter                                625   0.0      
ref|XP_008356837.1|  PREDICTED: sulfate transporter 2.1-like            620   0.0      
ref|XP_008364763.1|  PREDICTED: sulfate transporter 2.1-like            620   0.0      
ref|XP_002465704.1|  hypothetical protein SORBIDRAFT_01g044110          622   0.0      Sorghum bicolor [broomcorn]
ref|XP_007018862.1|  STAS domain / Sulfate transporter family iso...    619   0.0      
ref|XP_007141140.1|  hypothetical protein PHAVU_008G170800g             622   0.0      
ref|XP_006601860.1|  PREDICTED: early nodulin-70 isoform X1             622   0.0      
ref|XP_011015979.1|  PREDICTED: sulfate transporter 1.2-like            620   0.0      
gb|ABK35751.2|  sulfate transporter                                     619   0.0      Populus tremula x Populus alba [gray poplar]
ref|XP_011006147.1|  PREDICTED: sulfate transporter 1.2-like            619   0.0      
gb|KDO47029.1|  hypothetical protein CISIN_1g010524mg                   612   0.0      
gb|EPS63999.1|  hypothetical protein M569_10782                         617   0.0      
ref|XP_008780888.1|  PREDICTED: sulfate transporter 1.2-like            616   0.0      
ref|XP_003543770.2|  PREDICTED: sulfate transporter 1.3-like isof...    615   0.0      
gb|KHN41502.1|  Sulfate transporter 1.3                                 614   0.0      
ref|XP_011092411.1|  PREDICTED: sulfate transporter 1.3-like            613   0.0      
gb|ACL53345.1|  unknown                                                 607   0.0      Zea mays [maize]
gb|KDP32700.1|  hypothetical protein JCGZ_11992                         610   0.0      
ref|XP_011098138.1|  PREDICTED: sulfate transporter 1.2-like            610   0.0      
ref|XP_003602001.1|  Sulfate/bicarbonate/oxalate exchanger and tr...    610   0.0      
ref|XP_010926258.1|  PREDICTED: sulfate transporter 1.2-like            610   0.0      
ref|XP_010657602.1|  PREDICTED: sulfate transporter 1.3-like            608   0.0      
ref|XP_010261215.1|  PREDICTED: sulfate transporter 1.3-like            608   0.0      
ref|XP_007018858.1|  Sulfate transporter 1,3 isoform 2                  608   0.0      
ref|XP_010269183.1|  PREDICTED: sulfate transporter 1.2-like            608   0.0      
ref|XP_009409847.1|  PREDICTED: sulfate transporter 1.2-like            607   0.0      
ref|XP_007018857.1|  Sulfate transporter 1,3 isoform 1                  608   0.0      
ref|XP_010030063.1|  PREDICTED: sulfate transporter 1.3-like            605   0.0      
gb|KHN31354.1|  Sulfate transporter 2.1                                 598   0.0      
ref|XP_002513877.1|  sulfate transporter, putative                      603   0.0      Ricinus communis
ref|XP_006826989.1|  hypothetical protein AMTR_s00010p00208980          602   0.0      
ref|XP_010939616.1|  PREDICTED: sulfate transporter 1.3-like            602   0.0      
ref|XP_008444099.1|  PREDICTED: sulfate transporter 1.3-like            601   0.0      
ref|XP_008790803.1|  PREDICTED: sulfate transporter 1.3-like            600   0.0      
ref|XP_006659385.1|  PREDICTED: sulfate transporter 1.2-like            600   0.0      
gb|EYU39155.1|  hypothetical protein MIMGU_mgv1a002721mg                598   0.0      
ref|XP_006472647.1|  PREDICTED: sulfate transporter 1.3-like isof...    599   0.0      
ref|XP_007163634.1|  hypothetical protein PHAVU_001G250800g             599   0.0      
ref|XP_010667626.1|  PREDICTED: sulfate transporter 1.2-like isof...    598   0.0      
ref|XP_010030061.1|  PREDICTED: sulfate transporter 1.3-like            598   0.0      
gb|ABK35753.1|  sulfate transporter                                     591   0.0      Populus tremula x Populus alba [gray poplar]
gb|ACN39795.1|  unknown                                                 598   0.0      Picea sitchensis
ref|XP_003526594.1|  PREDICTED: sulfate transporter 1.3-like isof...    597   0.0      
ref|XP_010667625.1|  PREDICTED: sulfate transporter 1.2-like isof...    598   0.0      
gb|KDO80894.1|  hypothetical protein CISIN_1g006132mg                   597   0.0      
ref|XP_011027674.1|  PREDICTED: sulfate transporter 1.2-like            597   0.0      
ref|XP_006341835.1|  PREDICTED: sulfate transporter 1.3                 595   0.0      
ref|XP_002534156.1|  sulfate transporter, putative                      595   0.0      Ricinus communis
gb|EYU36528.1|  hypothetical protein MIMGU_mgv1a002617mg                595   0.0      
ref|XP_010664070.1|  PREDICTED: sulfate transporter isoform X1          594   0.0      
ref|XP_008375007.1|  PREDICTED: low affinity sulfate transporter ...    590   0.0      
ref|XP_009758742.1|  PREDICTED: sulfate transporter 1.3-like            593   0.0      
ref|XP_009607386.1|  PREDICTED: sulfate transporter 1.3-like            593   0.0      
ref|XP_003574460.1|  PREDICTED: sulfate transporter 1.2                 593   0.0      
ref|XP_011074140.1|  PREDICTED: sulfate transporter 1.3                 592   0.0      
ref|XP_004150525.1|  PREDICTED: sulfate transporter 1.3-like            592   0.0      
gb|EYU43601.1|  hypothetical protein MIMGU_mgv1a004486mg                587   0.0      
gb|AAK62820.1|  high affinity sulfate transporter                       590   0.0      Solanum lycopersicum
ref|XP_009404054.1|  PREDICTED: sulfate transporter 1.2-like            590   0.0      
ref|XP_010261543.1|  PREDICTED: sulfate transporter 1.2-like            590   0.0      
ref|NP_001275426.1|  high affinity sulfate transporter type 1           590   0.0      
ref|XP_010327388.1|  PREDICTED: sulfate transporter 1 isoform X1        590   0.0      
ref|XP_004299604.1|  PREDICTED: sulfate transporter 1.3-like            590   0.0      
ref|XP_007136221.1|  hypothetical protein PHAVU_009G028500g             590   0.0      
emb|CDO97472.1|  unnamed protein product                                590   0.0      
gb|AAM14588.1|AF493790_1  putative sulphate transporter                 590   0.0      Oryza sativa [red rice]
ref|NP_001049259.1|  Os03g0195800                                       590   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006434033.1|  hypothetical protein CICLE_v10000528mg             590   0.0      
ref|XP_010105878.1|  Sulfate transporter 1.3                            591   0.0      
dbj|BAK00729.1|  predicted protein                                      589   0.0      
ref|XP_004237882.1|  PREDICTED: sulfate transporter 1.3                 588   0.0      
ref|XP_007226563.1|  hypothetical protein PRUPE_ppa024463mg             588   0.0      
ref|NP_001234565.1|  sulfate transporter 1                              588   0.0      
ref|XP_008337948.1|  PREDICTED: sulfate transporter 1.2-like            588   0.0      
ref|XP_007043016.1|  Sulfate transporter 1,3 isoform 1                  588   0.0      
ref|XP_011087851.1|  PREDICTED: sulfate transporter 1.3-like isof...    587   0.0      
ref|XP_011087852.1|  PREDICTED: sulfate transporter 1.3-like isof...    587   0.0      
ref|XP_006354018.1|  PREDICTED: sulfate transporter 1.3-like            587   0.0      
ref|XP_010060154.1|  PREDICTED: sulfate transporter 1.3                 587   0.0      
ref|XP_008460483.1|  PREDICTED: sulfate transporter 1.3-like isof...    587   0.0      
ref|NP_001234569.1|  sulfate transporter 2                              586   0.0      
ref|XP_010939615.1|  PREDICTED: sulfate transporter 1.3-like            586   0.0      
gb|EAZ06949.1|  hypothetical protein OsI_29191                          586   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004140373.1|  PREDICTED: sulfate transporter 1.3-like            586   0.0      
ref|XP_008374998.1|  PREDICTED: sulfate transporter 1.3-like            585   0.0      
dbj|BAC98594.1|  putative high affinity sulfate transporter             585   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010498678.1|  PREDICTED: sulfate transporter 1.3-like            585   0.0      
ref|XP_009362511.1|  PREDICTED: sulfate transporter 1.3-like            585   0.0      
gb|AGI96997.1|  putative high-affinity sulfate transporter              585   0.0      
ref|XP_010916916.1|  PREDICTED: sulfate transporter 1.3-like            584   0.0      
ref|XP_008218902.1|  PREDICTED: sulfate transporter 1.3-like            585   0.0      
ref|XP_008798427.1|  PREDICTED: sulfate transporter 1.3-like            584   0.0      
ref|XP_008648264.1|  PREDICTED: sulfate permease1 isoform X1            584   0.0      
ref|XP_006649558.1|  PREDICTED: sulfate transporter 1.2-like            583   0.0      
ref|XP_002872409.1|  SULTR1_1                                           582   0.0      
ref|XP_006360279.1|  PREDICTED: sulfate transporter 1.2-like isof...    583   0.0      
ref|XP_004985351.1|  PREDICTED: sulfate transporter 1.2-like isof...    583   0.0      
ref|NP_001105050.1|  sulfate permease1                                  582   0.0      Zea mays [maize]
ref|XP_009128268.1|  PREDICTED: sulfate transporter 1.2-like            582   0.0      
dbj|BAA33932.1|  sulfate transporter                                    582   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004502509.1|  PREDICTED: early nodulin-70-like                   582   0.0      
ref|NP_192602.1|  sulfate transporter 1.1                               582   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009369644.1|  PREDICTED: sulfate transporter 1.2                 582   0.0      
gb|EYU43602.1|  hypothetical protein MIMGU_mgv1a019382mg                581   0.0      
ref|XP_009345534.1|  PREDICTED: sulfate transporter 1.2-like            582   0.0      
ref|XP_008233994.1|  PREDICTED: sulfate transporter 1.3-like            581   0.0      
ref|XP_009758428.1|  PREDICTED: sulfate transporter 1.3-like            581   0.0      
ref|XP_006304513.1|  hypothetical protein CARUB_v10011339mg             580   0.0      
gb|AGT40333.1|  sulfate transporter                                     580   0.0      
ref|XP_010428905.1|  PREDICTED: sulfate transporter 1.2-like isof...    580   0.0      
ref|XP_006301018.1|  hypothetical protein CARUB_v10021409mg             579   0.0      
gb|EMS54294.1|  Low affinity sulfate transporter 3                      574   0.0      
ref|XP_002468339.1|  hypothetical protein SORBIDRAFT_01g044090          579   0.0      
ref|XP_002301036.1|  high affinity sulfate transporter family pro...    578   0.0      
ref|XP_010538958.1|  PREDICTED: sulfate transporter 1.1-like            577   0.0      
gb|AFX60924.1|  high-affinity sulfate transporter 1;2b                  578   0.0      
ref|XP_010416766.1|  PREDICTED: sulfate transporter 1.2                 578   0.0      
ref|XP_010477471.1|  PREDICTED: sulfate transporter 1.3                 578   0.0      
gb|AFW89362.1|  hypothetical protein ZEAMMB73_695392                    578   0.0      
ref|XP_010471998.1|  PREDICTED: sulfate transporter 1.2-like            578   0.0      
ref|XP_009409155.1|  PREDICTED: sulfate transporter 1.3-like            578   0.0      
ref|XP_010527550.1|  PREDICTED: sulfate transporter 1.3-like            578   0.0      
ref|XP_010687477.1|  PREDICTED: sulfate transporter 1.2-like            578   0.0      
ref|XP_007225673.1|  hypothetical protein PRUPE_ppa002542mg             578   0.0      
ref|XP_009106443.1|  PREDICTED: sulfate transporter 1.2                 578   0.0      
emb|CAC39420.1|  sulfate transporter                                    577   0.0      
ref|XP_009592454.1|  PREDICTED: sulfate transporter 1.3-like            577   0.0      
ref|XP_009403246.1|  PREDICTED: sulfate transporter 1.3-like            577   0.0      
gb|EMT11843.1|  High affinity sulfate transporter 2                     576   0.0      
gb|AFX60923.1|  high-affinity sulfate transporter 1;2a                  576   0.0      
emb|CDX87487.1|  BnaA07g33860D                                          576   0.0      
gb|AGI96996.1|  putative high-affinity sulfate transporter              576   0.0      
ref|XP_010229044.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    576   0.0      
ref|XP_006390034.1|  hypothetical protein EUTSA_v10018244mg             575   0.0      
emb|CDX88404.1|  BnaC06g38480D                                          575   0.0      
ref|XP_008361631.1|  PREDICTED: sulfate transporter 1.2-like            575   0.0      
ref|XP_002889173.1|  SULTR1_2                                           574   0.0      
ref|XP_004301997.1|  PREDICTED: high affinity sulfate transporter...    574   0.0      
ref|XP_009629531.1|  PREDICTED: sulfate transporter 1.3-like            574   0.0      
ref|XP_010459957.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    574   0.0      
gb|KFK32123.1|  hypothetical protein AALP_AA6G201100                    573   0.0      
ref|XP_006434036.1|  hypothetical protein CICLE_v10000528mg             572   0.0      
ref|XP_010030062.1|  PREDICTED: sulfate transporter 1.3-like            572   0.0      
ref|XP_009145372.1|  PREDICTED: sulfate transporter 1.3                 571   0.0      
ref|XP_010421777.1|  PREDICTED: sulfate transporter 1.1-like            571   0.0      
gb|EPS65934.1|  hypothetical protein M569_08843                         569   0.0      
ref|NP_564159.1|  sulfate transporter 1.3                               571   0.0      
ref|XP_009800111.1|  PREDICTED: sulfate transporter 1.3-like            570   0.0      
gb|KEH34873.1|  high affinity sulfate transporter type 1                570   0.0      
ref|XP_006290109.1|  hypothetical protein CARUB_v10003753mg             570   0.0      
ref|XP_008455224.1|  PREDICTED: sulfate transporter 1.2-like            570   0.0      
ref|XP_010496703.1|  PREDICTED: sulfate transporter 1.1-like            569   0.0      
gb|AFX60922.1|  high-affinity sulfate transporter 1;1                   569   0.0      
ref|XP_010455280.1|  PREDICTED: sulfate transporter 1.1                 569   0.0      
gb|EMS55614.1|  Sulfate transporter 1.2                                 569   0.0      
gb|EYU39150.1|  hypothetical protein MIMGU_mgv1a002714mg                568   0.0      
emb|CAD55701.1|  sulphate transporter                                   569   0.0      
ref|XP_010521202.1|  PREDICTED: sulfate transporter 1.2-like            568   0.0      
ref|XP_009127201.1|  PREDICTED: sulfate transporter 1.1                 567   0.0      
emb|CAN75170.1|  hypothetical protein VITISV_041032                     567   0.0      
gb|EYU39154.1|  hypothetical protein MIMGU_mgv1a002718mg                567   0.0      
sp|P53391.1|SUT1_STYHA  RecName: Full=High affinity sulfate trans...    567   0.0      
ref|XP_006596866.1|  PREDICTED: sulfate transporter 1.3-like            566   0.0      
ref|XP_004985349.1|  PREDICTED: sulfate transporter 1.2-like isof...    567   0.0      
gb|KGN43700.1|  hypothetical protein Csa_7G060690                       565   0.0      
gb|EYU39153.1|  hypothetical protein MIMGU_mgv1a002707mg                565   0.0      
emb|CDX96184.1|  BnaC02g14670D                                          564   0.0      
ref|XP_006649559.1|  PREDICTED: sulfate transporter 1.2-like isof...    565   0.0      
sp|P53392.1|SUT2_STYHA  RecName: Full=High affinity sulfate trans...    564   0.0      
ref|XP_003638788.1|  Sulfate transporter                                569   0.0      
gb|AAA97952.1|  high affinity sulfate transporter HVST1                 564   0.0      
ref|XP_002890494.1|  F2E2.22                                            565   0.0      
gb|KHN33509.1|  High affinity sulfate transporter 2                     563   0.0      
emb|CAD55695.1|  sulphate transporter                                   563   0.0      
ref|XP_008677618.1|  PREDICTED: uncharacterized protein LOC100383...    563   0.0      
emb|CBK55657.1|  sulphate transporter                                   562   0.0      
emb|CAC94920.1|  sulfate transporter                                    561   0.0      
gb|ABM17059.2|  sulfate transporter                                     561   0.0      
emb|CAA65291.1|  high affinity sulphate transporter                     561   0.0      
emb|CAB42985.1|  putative high affinity sulfate transporter             561   0.0      
ref|XP_003547605.1|  PREDICTED: high affinity sulfate transporter...    560   0.0      
gb|AAF86552.1|AC069252_11  F2E2.22                                      561   0.0      
gb|ACG46907.1|  sulfate transporter 1.2                                 560   0.0      
emb|CBK55660.1|  sulphate transporter                                   560   0.0      
emb|CBK55651.1|  sulphate transporter                                   558   0.0      
ref|XP_002444315.1|  hypothetical protein SORBIDRAFT_07g020050          558   0.0      
ref|XP_007043017.1|  Sulfate transporter 1,3 isoform 2                  557   0.0      
emb|CBK55663.1|  sulphate transporter                                   557   0.0      
ref|XP_003532966.1|  PREDICTED: high affinity sulfate transporter...    557   0.0      
gb|KHN45351.1|  Sulfate transporter 1.3                                 555   0.0      
ref|XP_004973399.1|  PREDICTED: sulfate transporter 1.2-like isof...    555   0.0      
ref|XP_007148429.1|  hypothetical protein PHAVU_006G207800g             555   0.0      
ref|XP_010539238.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    554   0.0      
ref|NP_565166.1|  sulfate transporter 1;2                               553   0.0      
ref|XP_006649560.1|  PREDICTED: sulfate transporter 1.2-like isof...    554   0.0      
emb|CAD55702.1|  sulphate transporter                                   553   0.0      
emb|CBK55652.1|  sulphate transporter                                   552   0.0      
ref|XP_004485557.1|  PREDICTED: high affinity sulfate transporter...    550   0.0      
ref|XP_010103934.1|  High affinity sulfate transporter 2                549   0.0      
ref|XP_004485558.1|  PREDICTED: high affinity sulfate transporter...    549   0.0      
ref|NP_001049261.1|  Os03g0196000                                       548   0.0      
emb|CBK55650.1|  sulphate transporter                                   547   0.0      
gb|KEH36439.1|  high affinity sulfate transporter type 1                547   0.0      
gb|EAZ25923.1|  hypothetical protein OsJ_09766                          546   1e-180   
gb|AES63416.2|  high affinity sulfate transporter type 1                547   2e-180   
ref|XP_004485559.1|  PREDICTED: high affinity sulfate transporter...    545   5e-180   
gb|KHG07987.1|  High affinity sulfate transporter 2                     543   1e-179   
ref|XP_008339255.1|  PREDICTED: sulfate transporter 1.2-like            549   2e-179   
ref|XP_002464158.1|  hypothetical protein SORBIDRAFT_01g013290          543   2e-179   
ref|XP_003593165.1|  Sulfate transporter                                545   8e-179   
ref|XP_002980841.1|  hypothetical protein SELMODRAFT_113596             540   4e-178   
ref|NP_001267950.1|  sulfate transporter                                540   5e-178   
ref|XP_002989364.1|  hypothetical protein SELMODRAFT_184503             538   4e-177   
ref|XP_009371954.1|  PREDICTED: sulfate transporter 3.1-like            535   2e-176   
ref|XP_010503899.1|  PREDICTED: sulfate transporter 3.1-like            536   2e-176   
gb|KFK34430.1|  hypothetical protein AALP_AA5G143800                    535   3e-176   
ref|XP_009778206.1|  PREDICTED: sulfate transporter 3.1-like            535   4e-176   
ref|XP_009609980.1|  PREDICTED: sulfate transporter 3.1-like            535   4e-176   
ref|XP_010426769.1|  PREDICTED: sulfate transporter 3.1 isoform X1      535   4e-176   
ref|XP_010428902.1|  PREDICTED: sulfate transporter 1.2-like isof...    536   4e-176   
gb|KDP21414.1|  hypothetical protein JCGZ_21885                         534   7e-176   
ref|XP_010515628.1|  PREDICTED: sulfate transporter 3.1-like isof...    534   1e-175   
ref|XP_010256148.1|  PREDICTED: sulfate transporter 3.1-like isof...    533   2e-175   
gb|KEH34875.1|  high affinity sulfate transporter type 1                530   4e-175   
ref|XP_010552755.1|  PREDICTED: sulfate transporter 3.1 isoform X1      531   5e-175   
ref|XP_008390997.1|  PREDICTED: sulfate transporter 3.1-like isof...    532   6e-175   
gb|ABR16213.1|  unknown                                                 533   7e-175   
ref|XP_010552756.1|  PREDICTED: sulfate transporter 3.1 isoform X2      531   7e-175   
ref|XP_008677619.1|  PREDICTED: uncharacterized protein LOC100383...    531   9e-175   
emb|CAD55700.1|  sulphate transporter                                   530   4e-174   
dbj|BAJ34524.1|  unnamed protein product                                530   4e-174   
ref|XP_006403870.1|  hypothetical protein EUTSA_v10010178mg             530   6e-174   
gb|KDP40223.1|  hypothetical protein JCGZ_02221                         529   8e-174   
ref|XP_009804926.1|  PREDICTED: sulfate transporter 3.1-like            529   8e-174   
emb|CAD55696.1|  sulphate transporter                                   529   8e-174   
ref|XP_004137049.1|  PREDICTED: high affinity sulfate transporter...    526   1e-173   
gb|EYU40896.1|  hypothetical protein MIMGU_mgv1a002568mg                528   1e-173   
gb|ABF94445.1|  Sulfate transporter 2.1, putative, expressed            523   1e-173   
ref|XP_008224259.1|  PREDICTED: sulfate transporter 3.1-like            528   2e-173   
ref|XP_003561623.1|  PREDICTED: sulfate transporter 1.2-like            527   2e-173   
ref|XP_007225118.1|  hypothetical protein PRUPE_ppa002648mg             528   2e-173   
ref|XP_010259124.1|  PREDICTED: sulfate transporter 3.1-like            527   3e-173   
ref|XP_004146971.1|  PREDICTED: sulfate transporter 3.1-like            528   3e-173   
ref|XP_010024227.1|  PREDICTED: sulfate transporter 3.1-like            527   3e-173   
emb|CAD54674.1|  sulphate transporter                                   527   4e-173   
ref|XP_011030640.1|  PREDICTED: sulfate transporter 3.1-like            527   4e-173   
emb|CDP03663.1|  unnamed protein product                                527   4e-173   
ref|XP_006649437.1|  PREDICTED: sulfate transporter 3.1-like            527   5e-173   
emb|CDX90628.1|  BnaA03g41530D                                          527   5e-173   
ref|XP_006360746.1|  PREDICTED: sulfate transporter 3.1-like            527   5e-173   
ref|XP_006290679.1|  hypothetical protein CARUB_v10016772mg             528   6e-173   
gb|EAY88641.1|  hypothetical protein OsI_10116                          526   7e-173   
emb|CAD55699.1|  sulphate transporter                                   526   9e-173   
gb|EYU46548.1|  hypothetical protein MIMGU_mgv1a002543mg                526   1e-172   
ref|XP_010256149.1|  PREDICTED: sulfate transporter 3.1-like isof...    525   2e-172   
ref|NP_001141114.1|  uncharacterized protein LOC100273198               525   2e-172   
ref|XP_006838985.1|  hypothetical protein AMTR_s00002p00271530          525   3e-172   
emb|CDY29052.1|  BnaC07g32580D                                          528   4e-172   
gb|AAN06871.1|  Putative sulfate transporter ATST1                      524   4e-172   
ref|XP_004247591.1|  PREDICTED: sulfate transporter 3.1-like            524   6e-172   
ref|NP_001049042.1|  Os03g0161200                                       524   7e-172   
ref|XP_002465820.1|  hypothetical protein SORBIDRAFT_01g046410          524   8e-172   
gb|AAC14417.1|  unknown                                                 526   8e-172   
ref|XP_010092428.1|  Sulfate transporter 3.1                            524   8e-172   
dbj|BAA21657.1|  sulfate transporter                                    524   1e-171   
ref|XP_002877831.1|  sulfate transporter                                523   1e-171   
ref|XP_002314667.1|  hypothetical protein POPTR_0010s09280g             523   1e-171   
gb|KDO47030.1|  hypothetical protein CISIN_1g010524mg                   513   2e-171   
ref|XP_009136641.1|  PREDICTED: sulfate transporter 3.1-like            523   2e-171   
gb|KEH34874.1|  high affinity sulfate transporter type 1                519   2e-171   
ref|XP_009612528.1|  PREDICTED: sulfate transporter 3.1-like            523   2e-171   
ref|NP_190758.2|  sulfate transporter 3;1                               523   3e-171   
ref|XP_009115890.1|  PREDICTED: sulfate transporter 3.1                 522   3e-171   
emb|CDY14642.1|  BnaC02g24710D                                          518   5e-171   
emb|CAD55698.1|  sulphate transporter                                   522   5e-171   
ref|XP_008390930.1|  PREDICTED: sulfate transporter 3.1-like            521   5e-171   
ref|XP_004290627.1|  PREDICTED: sulfate transporter 3.1-like            521   9e-171   
ref|XP_009335285.1|  PREDICTED: sulfate transporter 3.1-like            521   1e-170   
ref|XP_004495176.1|  PREDICTED: sulfate transporter 3.1-like            520   2e-170   
emb|CAD54673.1|  sulphate transporter                                   520   2e-170   
ref|XP_004247192.1|  PREDICTED: sulfate transporter 3.1                 520   3e-170   
gb|KHG01733.1|  Sulfate transporter 3                                   520   3e-170   
ref|XP_009620840.1|  PREDICTED: sulfate transporter 3.1-like isof...    519   5e-170   
ref|XP_008235373.1|  PREDICTED: sulfate transporter 3.1-like            519   5e-170   
ref|XP_006349709.1|  PREDICTED: sulfate transporter 3.1-like            519   5e-170   
ref|XP_011026981.1|  PREDICTED: sulfate transporter 3.1-like            518   2e-169   
ref|XP_004982297.1|  PREDICTED: sulfate transporter 1.2-like isof...    518   2e-169   
ref|XP_009773833.1|  PREDICTED: sulfate transporter 3.1-like isof...    517   2e-169   
gb|KDO74470.1|  hypothetical protein CISIN_1g006373mg                   517   2e-169   
ref|XP_002283184.2|  PREDICTED: sulfate transporter 3.1-like            517   3e-169   
ref|XP_007201737.1|  hypothetical protein PRUPE_ppa002556mg             517   4e-169   
emb|CBI26298.3|  unnamed protein product                                518   5e-169   
emb|CBI28733.3|  unnamed protein product                                516   5e-169   
ref|XP_003632327.1|  PREDICTED: sulfate transporter 3.1-like            516   5e-169   
gb|AAF17685.1|AC009243_12  F28K19.22                                    519   6e-169   
ref|XP_006489450.1|  PREDICTED: sulfate transporter 3.1-like            516   6e-169   
ref|XP_011079899.1|  PREDICTED: sulfate transporter 3.1                 516   9e-169   
ref|XP_008368821.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    516   1e-168   
ref|XP_006420023.1|  hypothetical protein CICLE_v10004520mg             515   2e-168   
ref|XP_011082583.1|  PREDICTED: sulfate transporter 3.1-like            514   5e-168   
ref|XP_004982298.1|  PREDICTED: sulfate transporter 1.2-like isof...    514   5e-168   
ref|XP_006416228.1|  hypothetical protein EUTSA_v10009756mg             513   5e-168   
ref|XP_004242345.1|  PREDICTED: sulfate transporter 3.1-like            514   5e-168   
emb|CDX85771.1|  BnaA02g00420D                                          506   6e-168   
ref|XP_002307605.1|  Sulfate transporter 3.2 family protein             514   6e-168   
emb|CDO99099.1|  unnamed protein product                                514   6e-168   
ref|XP_011090680.1|  PREDICTED: sulfate transporter 3.1-like            514   6e-168   
ref|XP_011032651.1|  PREDICTED: sulfate transporter 3.1-like            514   7e-168   
ref|XP_002300821.2|  Sulfate transporter 3.2 family protein             514   7e-168   
ref|XP_006352762.1|  PREDICTED: sulfate transporter 3.1-like            514   8e-168   
ref|XP_008366542.1|  PREDICTED: sulfate transporter 3.1-like            513   1e-167   
ref|XP_001756291.1|  predicted protein                                  513   1e-167   
ref|XP_003590594.1|  Sulfate/bicarbonate/oxalate exchanger and tr...    512   3e-167   
ref|XP_009393046.1|  PREDICTED: sulfate transporter 3.1-like            511   5e-167   
gb|KHG29534.1|  Sulfate transporter 3                                   511   6e-167   
ref|XP_003554265.1|  PREDICTED: sulfate transporter 3.1-like            511   1e-166   
gb|EMT20443.1|  High affinity sulfate transporter 2                     510   1e-166   
ref|XP_009620841.1|  PREDICTED: sulfate transporter 3.1-like isof...    509   1e-166   
ref|XP_010070167.1|  PREDICTED: sulfate transporter 3.1-like            511   1e-166   
emb|CAE46442.1|  sulphate transporter                                   510   2e-166   
ref|XP_002976095.1|  hypothetical protein SELMODRAFT_175286             508   3e-166   
ref|XP_009370789.1|  PREDICTED: sulfate transporter 3.1-like            509   4e-166   
ref|XP_010917792.1|  PREDICTED: sulfate transporter 3.1-like            509   4e-166   
ref|XP_003521258.1|  PREDICTED: sulfate transporter 3.1-like            509   4e-166   
ref|XP_011026121.1|  PREDICTED: sulfate transporter 3.1-like            509   5e-166   
ref|XP_009773834.1|  PREDICTED: sulfate transporter 3.1-like isof...    508   7e-166   
ref|XP_003558765.1|  PREDICTED: sulfate transporter 3.1-like            509   7e-166   
ref|XP_009367588.1|  PREDICTED: sulfate transporter 3.1-like            508   1e-165   
ref|XP_007162459.1|  hypothetical protein PHAVU_001G154200g             508   1e-165   
gb|EMT20444.1|  High affinity sulfate transporter 2                     512   1e-165   
gb|EMS54293.1|  High affinity sulfate transporter 2                     507   2e-165   



>ref|XP_006366475.1| PREDICTED: sulfate transporter 2.1-like [Solanum tuberosum]
Length=689

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/652 (70%), Positives = 536/652 (82%), Gaps = 12/652 (2%)
 Frame = -1

Query  2261  FSQTLQKTSSTLPPAAERA-SWVLNVPEPPGLSRKLEGSFKKTATF-LGTAFQRLRKRPV  2088
             FSQTLQ      P A+ER   WVLNVPEPPGL   L+ SFKKT    L    Q L K PV
Sbjct  44    FSQTLQT-----PVASERRRDWVLNVPEPPGLLSNLKTSFKKTLLCPLENKIQCLGKHPV  98

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
               ++S    +FP LSW K+Y++ K K D+LAGLTLASLCIPQSIGYA LA LDPQYGLYT
Sbjct  99    PTLVSILSVIFPPLSWCKEYNVTKFKRDILAGLTLASLCIPQSIGYATLAKLDPQYGLYT  158

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SV+PPLIYA+MGSSR+IAIGPVAV+SLL+SSM+PKLEDP +NP  Y  LVLTVTFFAG F
Sbjct  159   SVIPPLIYAMMGSSRDIAIGPVAVVSLLLSSMIPKLEDPTTNPIAYRKLVLTVTFFAGAF  218

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QAAFG+LRLGFLVDFLSHAAIVGFMAGAA VIGLQQLK L GISNFTNKTD++SVLT I 
Sbjct  219   QAAFGLLRLGFLVDFLSHAAIVGFMAGAACVIGLQQLKSLLGISNFTNKTDIISVLTSIC  278

Query  1547  TSLHHSPWNPYNliigfsflsfilITRF-LGQKHRKLFWLPAMAPLLSVILSTLLVYLTR  1371
              S+H    NPY+ IIG SFL FIL T++ L +K++KLFWL AMAPLLSVI+STLLV+LTR
Sbjct  279   KSMHT--LNPYSFIIGSSFLIFILSTKYYLARKYKKLFWLAAMAPLLSVIMSTLLVFLTR  336

Query  1370  AENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMK  1191
             A+ HGVKIVKH+ GGLNPSSLH+L FN+PH  +  KIG I+A+VALTEAIAVG SFA+MK
Sbjct  337   ADKHGVKIVKHITGGLNPSSLHELQFNSPHTAEAAKIGLIIALVALTEAIAVGRSFATMK  396

Query  1190  GYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISL  1011
             GY LDGNKEMLA+GV NI GSLTSCYVATGSFSR+AVNF AGCE+AVSN+VMA+TVLISL
Sbjct  397   GYRLDGNKEMLAMGVMNITGSLTSCYVATGSFSRTAVNFSAGCETAVSNIVMAITVLISL  456

Query  1010  QLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEI  831
             +  T+LLYFTPVAILASIILSALPGLIN+ EA  IWKVDK+DFLACA AF GVLF SVEI
Sbjct  457   EFCTRLLYFTPVAILASIILSALPGLINITEAKYIWKVDKMDFLACAAAFLGVLFVSVEI  516

Query  830   GLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLL  651
             GLL+AVG+SFAKI+LNSIQPG EKLGRLPG+D LF  + QYP+A  TPG  ++R KS+LL
Sbjct  517   GLLLAVGISFAKIILNSIQPGTEKLGRLPGSD-LFGDMEQYPIATTTPGALIVRVKSALL  575

Query  650   CFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYD  471
             CFANANFI+ RIL+L +EEQ      + +++ R+ L++ DMSN++N+DTS+I +L++L +
Sbjct  576   CFANANFIRGRILNLALEEQNEG-VMESANQDRVQLVILDMSNLLNIDTSSIAALEDLQN  634

Query  470   KITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDKNM  315
              + S G+Q  +ANPRW VIHKLRLA+F  KI+G+VFLTIGEAI+ACL  KNM
Sbjct  635   DLESNGMQLALANPRWHVIHKLRLANFLKKIEGRVFLTIGEAIEACLTSKNM  686



>ref|XP_010652824.1| PREDICTED: low affinity sulfate transporter 3 [Vitis vinifera]
Length=676

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/666 (66%), Positives = 536/666 (80%), Gaps = 21/666 (3%)
 Frame = -1

Query  2264  EFSQTLQKTSSTLPPA----------------AERASWVLNVPEPPGLSRKLEGSFKKTA  2133
             +FSQTLQ T +   P                 AER  WVLN PEPPGL ++L  S ++TA
Sbjct  13    KFSQTLQTTMAAASPVEACTAEEMLDPEQNGRAERVQWVLNAPEPPGLWQELMDSIRETA  72

Query  2132  TFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIG  1953
                G  F  L+K+P    +S  + +FP+L W + Y   K K D++AGLTLASL IPQSIG
Sbjct  73    FPHGNNFPSLQKQPTTHAISVLQGIFPILQWCRNYKATKFKKDLMAGLTLASLSIPQSIG  132

Query  1952  YAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAG  1773
             YA LA LDPQ+GLYTS +PPLIYA+MG+SREIAIGPVAV+SLLISSMVPKLEDP  NP  
Sbjct  133   YATLAKLDPQFGLYTSAIPPLIYALMGTSREIAIGPVAVVSLLISSMVPKLEDPVDNPIA  192

Query  1772  YTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISN  1593
             Y  LV T TF AGIFQAAF +LRLGFLVDFLSHAA+VGFMAGAA+VIGLQQLK L GI++
Sbjct  193   YRKLVFTATFLAGIFQAAFALLRLGFLVDFLSHAALVGFMAGAAVVIGLQQLKGLLGITH  252

Query  1592  FTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPL  1413
             FTNKTDV+SVL  ++ S HH+ W+PYN I+G SFLSFILITRF+G++++KLFWLPA+APL
Sbjct  253   FTNKTDVISVLEAVWRSFHHT-WSPYNFILGCSFLSFILITRFVGRRNKKLFWLPAIAPL  311

Query  1412  LSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVAL  1233
             +SVILSTL+V+LTRA+ HGVK+VKH+KGGLNPSS+HQL F  PH  ++ KIG IVA++AL
Sbjct  312   VSVILSTLIVFLTRADKHGVKVVKHIKGGLNPSSVHQLQFTGPHTGEIAKIGLIVAIIAL  371

Query  1232  TEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESA  1053
             TEAIAVG SFAS+KGYHLDGNKEM+A+G+ NIAGSLTSCYVATGSFSRSAVNF AGCE+A
Sbjct  372   TEAIAVGRSFASIKGYHLDGNKEMVALGIMNIAGSLTSCYVATGSFSRSAVNFSAGCETA  431

Query  1052  VSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLAC  873
             +SN+VMA+TVLISLQ  TKLLYFTP AILASIILSA+PGLI+++EAY IWKVDKLDFLAC
Sbjct  432   ISNIVMAITVLISLQFFTKLLYFTPTAILASIILSAIPGLIDISEAYKIWKVDKLDFLAC  491

Query  872   AGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQ  693
              GAF GVLF SVEIGLLVA+ +SFAKI+LN+I+PGIE LGRLPGT+ +F  + QYPMA+ 
Sbjct  492   IGAFLGVLFGSVEIGLLVALTISFAKIILNAIRPGIETLGRLPGTN-MFCDVDQYPMAIT  550

Query  692   TPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMN  513
             +PGV ++R KS+LLCFANANF++ RI+  V EE   A++ K S++ R  L+V DMSN+MN
Sbjct  551   SPGVLIVRVKSALLCFANANFVRERIMMWVTEE---AEDNKGSAKGRNQLVVLDMSNLMN  607

Query  512   VDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDAC  333
             +DTS I SL+E++ ++ S G++  IANPRWQVIHKL+LA F NKI G+VFL++ EA+D C
Sbjct  608   IDTSGIASLEEVHKQLVSQGMELAIANPRWQVIHKLKLAKFVNKIGGRVFLSVAEAVDEC  667

Query  332   LVDKNM  315
                K M
Sbjct  668   STIKIM  673



>ref|XP_009776146.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
sylvestris]
Length=676

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/653 (68%), Positives = 536/653 (82%), Gaps = 19/653 (3%)
 Frame = -1

Query  2264  EFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQ  2085
             +FSQTLQ          +R +WVLNVPEPPGL  KL+  F      L      + K+P+ 
Sbjct  36    QFSQTLQ---------TQRRNWVLNVPEPPGLFSKLKTIFSP----LENKLHCIGKQPLP  82

Query  2084  AVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTS  1905
             A++S  +++FP LSW KQY++ K KSD+LAGLTLASLCIPQSIGYA LA LDPQYGLYTS
Sbjct  83    ALISILKTIFPPLSWCKQYNVTKFKSDILAGLTLASLCIPQSIGYATLAKLDPQYGLYTS  142

Query  1904  VVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifq  1725
             V+PPLIY++MGSSR+IAIGPVAV+SLL+SSM+ K EDPA NPA YT LVLTVTFFAG FQ
Sbjct  143   VIPPLIYSIMGSSRDIAIGPVAVVSLLLSSMIQKFEDPAVNPAAYTKLVLTVTFFAGTFQ  202

Query  1724  aafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFT  1545
             AAFG+LRLGFLVDFLSHAAIVGFMAGAA VIGLQQLK L G+S FTN TD++SVLT I  
Sbjct  203   AAFGLLRLGFLVDFLSHAAIVGFMAGAACVIGLQQLKSLLGLSKFTNNTDIISVLTSISK  262

Query  1544  SLHHSPWNPYNliigfsflsfilITRF-LGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
             S+H   WNP++ +IG SF  FIL T++ L +KH+KLF L AMAPLLSVILSTL+V+LTRA
Sbjct  263   SMH--TWNPFSFMIGSSFFIFILFTKYYLARKHKKLFLLSAMAPLLSVILSTLIVFLTRA  320

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + HGVKIVKH+ GGLNP+S+H L FN+PH  +  KIG IVA++ALTEAIAVG SFA+MKG
Sbjct  321   DKHGVKIVKHITGGLNPTSIHDLQFNSPHTAEAAKIGLIVALIALTEAIAVGRSFATMKG  380

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             Y LDGNKEMLA+GV NI GSLTSCYVATGSFSR+AVNF AGCE+AVSN+VMAVTVLISL+
Sbjct  381   YRLDGNKEMLAMGVMNITGSLTSCYVATGSFSRTAVNFSAGCETAVSNIVMAVTVLISLE  440

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
               T+LLYFTP+AILAS+IL+ALPGLINL+EA  IWKVDK+DFL C  AF GV+F SVEIG
Sbjct  441   FFTRLLYFTPIAILASVILAALPGLINLSEAKYIWKVDKMDFLTCTAAFFGVVFVSVEIG  500

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             LL+AVG+SFAK++LNSIQPG EKLGRLPG+D LF  ++QYPMA++ PG+ ++R KS+LLC
Sbjct  501   LLLAVGISFAKVILNSIQPGTEKLGRLPGSD-LFGDVNQYPMAMKIPGILIVRVKSALLC  559

Query  647   FANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDK  468
             FANA+FI+A+IL L +EEQ   ++  ES+E R+ L++ DMSN++N+DT++I SL+EL+ +
Sbjct  560   FANADFIRAKILDLALEEQN--EDAIESAEDRVQLVILDMSNLLNIDTTSIASLEELHSE  617

Query  467   ITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDKNMQA  309
             + S G++  +ANPRW VIHKLRLA F  KI+G+VFLTIGEAI+AC   KNM A
Sbjct  618   LESNGMKLALANPRWHVIHKLRLAKFVKKIEGRVFLTIGEAIEACFTSKNMHA  670



>ref|NP_001274303.1| sulfate transporter 2.1-like [Solanum lycopersicum]
 gb|AHA36634.1| sulfate transporter 2.1-like protein [Solanum lycopersicum]
 gb|AHA36635.1| sulfate transporter 2.2-like protein [Solanum lycopersicum]
Length=689

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/652 (69%), Positives = 536/652 (82%), Gaps = 12/652 (2%)
 Frame = -1

Query  2261  FSQTLQKTSSTLPPAAERA-SWVLNVPEPPGLSRKLEGSFKKTATF-LGTAFQRLRKRPV  2088
             FSQTLQ      P A++R   WVLNVPEPPGL   L+ SFKKT    L    Q L K PV
Sbjct  44    FSQTLQT-----PVASDRRRDWVLNVPEPPGLLSNLKTSFKKTLLCPLENKIQCLGKHPV  98

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
              A++S    +FP LSW K+Y++ K + D+LAGLTLASLCIPQSIGYA LA LDPQYGLYT
Sbjct  99    SALVSILNVIFPPLSWCKEYNVTKFRRDILAGLTLASLCIPQSIGYATLAKLDPQYGLYT  158

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SV+PPLIYA+MGSSR+IAIGPVAV+SLL+SSMVPKLEDP +NP  Y  LVLTVTFFAG+F
Sbjct  159   SVIPPLIYAMMGSSRDIAIGPVAVVSLLLSSMVPKLEDPTTNPIAYRKLVLTVTFFAGVF  218

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QAAFG+LRLGFLVDFLSHAAIVGFMAGAA VIGLQQLK L GISNFTN TD++SVL  I 
Sbjct  219   QAAFGLLRLGFLVDFLSHAAIVGFMAGAACVIGLQQLKSLLGISNFTNNTDIISVLASIC  278

Query  1547  TSLHHSPWNPYNliigfsflsfilITRF-LGQKHRKLFWLPAMAPLLSVILSTLLVYLTR  1371
              S++    N ++ IIG SFL FIL T++ L +K++KLFWL AMAPLLSVI+STLLV+LTR
Sbjct  279   KSIN--TLNLHSFIIGSSFLIFILSTKYYLARKYKKLFWLAAMAPLLSVIMSTLLVFLTR  336

Query  1370  AENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMK  1191
             A+ HGVKIVKH+ GGLNPSSLH+L FN+PH  +  KIG IVA+VALTEAIAVG SFA+MK
Sbjct  337   ADKHGVKIVKHITGGLNPSSLHELQFNSPHTAEAAKIGLIVALVALTEAIAVGRSFATMK  396

Query  1190  GYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISL  1011
             GY LDGNKEMLA+GV NI GSLTSCYVATGSFSR+AVNF AGCE+AVSN+VMA+TVLISL
Sbjct  397   GYRLDGNKEMLAMGVMNITGSLTSCYVATGSFSRTAVNFSAGCETAVSNIVMAITVLISL  456

Query  1010  QLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEI  831
             +  T+LLYFTPVAILASIILSALPGLIN++EA  IWK+DK+DFLACA AF GVLF SVEI
Sbjct  457   EFCTRLLYFTPVAILASIILSALPGLINISEAKYIWKIDKMDFLACAAAFLGVLFVSVEI  516

Query  830   GLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLL  651
             GLL+AVG+SFAKI+LNSIQPG EKLGRLPG+D LF  + QYP+A  TPG  ++R KS+LL
Sbjct  517   GLLLAVGISFAKIILNSIQPGTEKLGRLPGSD-LFGDMEQYPIATTTPGALIVRVKSALL  575

Query  650   CFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYD  471
             CFANANFI+ RIL+L +EEQ +    + ++  R+ L++ DMSN++N+DTS+I +L++L +
Sbjct  576   CFANANFIRGRILNLALEEQDTG-AIESANHNRVQLVILDMSNLLNIDTSSIAALEDLQN  634

Query  470   KITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDKNM  315
              + S G+Q  +ANPRW VIHKLRLA+F  KI+G++FLTIGEAI+ACL  KNM
Sbjct  635   DLESNGMQLALANPRWHVIHKLRLANFLKKIEGRIFLTIGEAIEACLTSKNM  686



>ref|XP_009619632.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
tomentosiformis]
Length=706

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/654 (68%), Positives = 536/654 (82%), Gaps = 15/654 (2%)
 Frame = -1

Query  2261  FSQTLQKTSSTLPPAAERA---SWVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKR  2094
             FSQTLQ      P A+E     +WVLNVPEPPGL   L+ SFKKT  + L      L K+
Sbjct  60    FSQTLQT-----PMASENERTRNWVLNVPEPPGLFSNLKSSFKKTIFSPLENKLHCLGKQ  114

Query  2093  PVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGL  1914
             PV A++S  +++FP L+W K+Y++ K KSD+LAGLTLASLCIPQSIGYA LA LDPQYGL
Sbjct  115   PVPALVSILKTIFPPLTWCKEYNVTKFKSDILAGLTLASLCIPQSIGYATLAKLDPQYGL  174

Query  1913  YTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffag  1734
             YTSV+PPLIY++MGSSR+IAIGPVAV+SLL+SSM+ K EDP  NPA YT LVLTVTFFAG
Sbjct  175   YTSVIPPLIYSMMGSSRDIAIGPVAVVSLLLSSMIQKFEDPTVNPAAYTKLVLTVTFFAG  234

Query  1733  ifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTH  1554
              FQAAFG+LR GFLVDFLSHAAIVGFMAGAA VIGLQQLK L G+S FTN TD++SVL+ 
Sbjct  235   TFQAAFGLLRFGFLVDFLSHAAIVGFMAGAACVIGLQQLKSLLGLSKFTNNTDIISVLSS  294

Query  1553  IFTSLHHSPWNPYNliigfsflsfilITRF-LGQKHRKLFWLPAMAPLLSVILSTLLVYL  1377
             I  S+H   WNP++ +IG SFL FIL T++ L +KH+KLF L AMAPLLSVILSTL+V+L
Sbjct  295   ISKSMH--TWNPFSFMIGSSFLIFILFTKYYLARKHKKLFLLSAMAPLLSVILSTLIVFL  352

Query  1376  TRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFAS  1197
             TRA+ HGVKIVKH+ GGLNP+S+H L FN+PH  +  KIG IVA++ALTEAIAVG SFA+
Sbjct  353   TRADKHGVKIVKHITGGLNPTSIHDLQFNSPHTAEAAKIGLIVALIALTEAIAVGRSFAT  412

Query  1196  MKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLI  1017
             MKGY LDGNKEMLA+GV NI GSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMAVTVLI
Sbjct  413   MKGYRLDGNKEMLAMGVMNITGSLTSCYVATGSFSRTAVNFSAGCETTVSNIVMAVTVLI  472

Query  1016  SLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASV  837
             SL+  T+LLYFTP+AILASIILSALPGLINL+EA  IWKVDK+DFL C  AF GVLF SV
Sbjct  473   SLEFFTRLLYFTPIAILASIILSALPGLINLSEAKYIWKVDKMDFLTCIAAFLGVLFVSV  532

Query  836   EIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSS  657
             EIGLL+AVG+SFAK++LNSIQPG EKLGRLPG+D LF  ++QYPMA++ PG  ++R KS+
Sbjct  533   EIGLLLAVGISFAKVILNSIQPGTEKLGRLPGSD-LFGDVNQYPMAMKIPGALIVRVKSA  591

Query  656   LLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKEL  477
             LLCFANANFI+A+IL L +EEQ   ++  ES+E R+ L++ DMSN++N+DT++I SL+EL
Sbjct  592   LLCFANANFIRAKILDLALEEQN--EDAIESAEDRVQLVILDMSNLLNIDTTSIASLEEL  649

Query  476   YDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDKNM  315
             + ++ S G++  +ANPRW VIHKLRL  F  KI+G+VFLTIGEAI+AC   KNM
Sbjct  650   HSELESNGMKLALANPRWHVIHKLRLTKFVKKIEGRVFLTIGEAIEACFTSKNM  703



>emb|CBI21449.3| unnamed protein product [Vitis vinifera]
Length=641

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/634 (68%), Positives = 526/634 (83%), Gaps = 5/634 (1%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWG  2037
             AER  WVLN PEPPGL ++L  S ++TA   G  F  L+K+P    +S  + +FP+L W 
Sbjct  10    AERVQWVLNAPEPPGLWQELMDSIRETAFPHGNNFPSLQKQPTTHAISVLQGIFPILQWC  69

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y   K K D++AGLTLASL IPQSIGYA LA LDPQ+GLYTS +PPLIYA+MG+SREI
Sbjct  70    RNYKATKFKKDLMAGLTLASLSIPQSIGYATLAKLDPQFGLYTSAIPPLIYALMGTSREI  129

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLLISSMVPKLEDP  NP  Y  LV T TF AGIFQAAF +LRLGFLVDFLS
Sbjct  130   AIGPVAVVSLLISSMVPKLEDPVDNPIAYRKLVFTATFLAGIFQAAFALLRLGFLVDFLS  189

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAA+VGFMAGAA+VIGLQQLK L GI++FTNKTDV+SVL  ++ S HH+ W+PYN I+G 
Sbjct  190   HAALVGFMAGAAVVIGLQQLKGLLGITHFTNKTDVISVLEAVWRSFHHT-WSPYNFILGC  248

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G++++KLFWLPA+APL+SVILSTL+V+LTRA+ HGVK+VKH+KGGLNP
Sbjct  249   SFLSFILITRFVGRRNKKLFWLPAIAPLVSVILSTLIVFLTRADKHGVKVVKHIKGGLNP  308

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             SS+HQL F  PH  ++ KIG IVA++ALTEAIAVG SFAS+KGYHLDGNKEM+A+G+ NI
Sbjct  309   SSVHQLQFTGPHTGEIAKIGLIVAIIALTEAIAVGRSFASIKGYHLDGNKEMVALGIMNI  368

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
             AGSLTSCYVATGSFSRSAVNF AGCE+A+SN+VMA+TVLISLQ  TKLLYFTP AILASI
Sbjct  369   AGSLTSCYVATGSFSRSAVNFSAGCETAISNIVMAITVLISLQFFTKLLYFTPTAILASI  428

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSA+PGLI+++EAY IWKVDKLDFLAC GAF GVLF SVEIGLLVA+ +SFAKI+LN+I
Sbjct  429   ILSAIPGLIDISEAYKIWKVDKLDFLACIGAFLGVLFGSVEIGLLVALTISFAKIILNAI  488

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE LGRLPGT+ +F  + QYPMA+ +PGV ++R KS+LLCFANANF++ RI+  V E
Sbjct  489   RPGIETLGRLPGTN-MFCDVDQYPMAITSPGVLIVRVKSALLCFANANFVRERIMMWVTE  547

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E   A++ K S++ R  L+V DMSN+MN+DTS I SL+E++ ++ S G++  IANPRWQV
Sbjct  548   E---AEDNKGSAKGRNQLVVLDMSNLMNIDTSGIASLEEVHKQLVSQGMELAIANPRWQV  604

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACLVDKNM  315
             IHKL+LA F NKI G+VFL++ EA+D C   K M
Sbjct  605   IHKLKLAKFVNKIGGRVFLSVAEAVDECSTIKIM  638



>ref|XP_007048017.1| Slufate transporter 2,1 [Theobroma cacao]
 gb|EOX92174.1| Slufate transporter 2,1 [Theobroma cacao]
Length=645

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/634 (67%), Positives = 521/634 (82%), Gaps = 23/634 (4%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV--------QAVLSASESV  2058
             ER  WVLN P+PPGL  +L          + TAF    K P           VLS  ++ 
Sbjct  24    ERVQWVLNTPKPPGLGHEL----------METAFSWRNKIPFLNKQSGWKGEVLSMLQAT  73

Query  2057  FPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAV  1878
              P+LSW + Y   K K D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYAV
Sbjct  74    LPILSWCQNYKATKFKHDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAV  133

Query  1877  MGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLG  1698
             MG+SREIAIGPVAVISLL+SSMV KL+DP +NP  Y  LVLT TFFAG FQAAFG+ R G
Sbjct  134   MGTSREIAIGPVAVISLLLSSMVQKLQDPVANPIAYQKLVLTATFFAGTFQAAFGLFRSG  193

Query  1697  FLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNP  1518
             FLVDFLSHAAIVGFMAGAAIVIGLQQLK L G + FTNKTD++SV+  +++S HH PW+P
Sbjct  194   FLVDFLSHAAIVGFMAGAAIVIGLQQLKGLLGFTQFTNKTDIISVMKAMWSSFHH-PWSP  252

Query  1517  YNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKH  1338
             +N I+G SFL FILITRFLG+++RKLFWLPA+APLLSVIL+TL+V+LT+A+ HGVKI+KH
Sbjct  253   HNFILGSSFLIFILITRFLGKRNRKLFWLPAIAPLLSVILATLIVFLTKADKHGVKIIKH  312

Query  1337  VKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEML  1158
             +KGGLNPSS+HQL FN PH+ +V KIG +VA++ALTEAIAVG SFA++KGYHLDGNKEM+
Sbjct  313   IKGGLNPSSVHQLQFNGPHVGEVAKIGLVVAIIALTEAIAVGRSFAAIKGYHLDGNKEMV  372

Query  1157  AIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTP  978
             A+G  NI GS TSCYVATGSFSR+AVNF AGCE+AVSN+VMA+TV ISL+L T+LLY+TP
Sbjct  373   AMGFMNIIGSFTSCYVATGSFSRTAVNFSAGCETAVSNIVMAITVFISLELFTRLLYYTP  432

Query  977   VAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFA  798
              AILASIILSALPGLI+LNEAY+IWKVDKLDFLAC GAF GVLFA+VEIGLLVAV +SFA
Sbjct  433   TAILASIILSALPGLIDLNEAYNIWKVDKLDFLACIGAFLGVLFATVEIGLLVAVTISFA  492

Query  797   KIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR  618
             KI+L SI+PG E LGRLPG+D +F  ++QYPMAV+TPGV  +R KS+LLCFANANF++ R
Sbjct  493   KIILISIRPGTETLGRLPGSD-MFGDVNQYPMAVKTPGVLTMRLKSALLCFANANFVRER  551

Query  617   ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVI  438
             I+  V+EE+K   ++K ++EK I L++ D+SN+M++DTS I SL+EL+  + S G++  I
Sbjct  552   IIKWVVEEEK---DSKGNAEKTIQLVILDISNLMDIDTSGIASLEELHKNLDSNGMKLAI  608

Query  437   ANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDA  336
             ANPRWQVIHKL+LA+F +KI G+V+L++GEA+D+
Sbjct  609   ANPRWQVIHKLKLANFVDKIGGRVYLSVGEAMDS  642



>emb|CDP01420.1| unnamed protein product [Coffea canephora]
Length=694

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/667 (65%), Positives = 524/667 (79%), Gaps = 28/667 (4%)
 Frame = -1

Query  2264  EFSQTLQKTSSTLPPAAE------------RASWVLNVPEPPGLSRKLEGSFKKTATFLG  2121
             +F QTLQ T  T+P A E            R  WVLN PEPPGL  KL+    +T   L 
Sbjct  35    QFPQTLQTT--TVPSAQETSIMVADDKLPERFQWVLNAPEPPGLWCKLQNGMTETIFPLK  92

Query  2120  TAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAAL  1941
               FQ LR+  +   L    ++FP+LSWGK Y++   + D+LAGLTLASLCIPQSIGYA L
Sbjct  93    NKFQHLREHQMSKSLG---NLFPILSWGKAYNIKVFRKDLLAGLTLASLCIPQSIGYATL  149

Query  1940  ANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSL  1761
             A LDPQYGLYTSVVPP +YA++G+SREIAIGPVAV+SLL+S+M+ K+EDP +NP  YT L
Sbjct  150   AKLDPQYGLYTSVVPPFLYAILGTSREIAIGPVAVVSLLLSAMIQKIEDPVANPVAYTGL  209

Query  1760  VLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNK  1581
             V+TVT FAGIFQAAFG  RLGFLVD LSHAAIVGFMAGAAI+IGLQQLK L G + FTNK
Sbjct  210   VITVTLFAGIFQAAFGAFRLGFLVDLLSHAAIVGFMAGAAIMIGLQQLKGLLGTTKFTNK  269

Query  1580  TDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFL-------GQKHRKLFWLPAM  1422
             TD++SVL  ++ S+H S WNP N I+G SFLSFIL TRFL       G+K +KLFWL  +
Sbjct  270   TDIISVLAAVWRSVHDS-WNPLNFILGCSFLSFILTTRFLASNILQTGRKKKKLFWLSTI  328

Query  1421  APLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAV  1242
             APL SV+LSTL+V+LTRA+ HGVKIVKH+K GLNP S+HQL  N PH  +  KIG IVAV
Sbjct  329   APLTSVVLSTLIVFLTRADKHGVKIVKHIKSGLNPISVHQLQLNGPHTAEAAKIGLIVAV  388

Query  1241  VALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGC  1062
             VAL EAIAVG SFAS++GYHLDGNKEM+A+GV N+AGSLTSCYVATGSFSR+AVNF AGC
Sbjct  389   VALAEAIAVGRSFASVRGYHLDGNKEMVAMGVMNVAGSLTSCYVATGSFSRTAVNFSAGC  448

Query  1061  ESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDF  882
             E+ VSN+VMAVTV+ISL+L T+LL++TP+AILASIILSALPGLI+LNEAY+IWKVDKLDF
Sbjct  449   ETVVSNIVMAVTVIISLELFTRLLFYTPIAILASIILSALPGLIDLNEAYNIWKVDKLDF  508

Query  881   LACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPM  702
             LAC GAF GVLFASVEIGLLVAVG+SF  ++L+SIQPG E LGR+PG D +F+ ++QYPM
Sbjct  509   LACIGAFLGVLFASVEIGLLVAVGVSFVTVILSSIQPGTETLGRIPGAD-IFVDVNQYPM  567

Query  701   AVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSN  522
             AV+ PG+ V R K +LLCFAN+N IK RIL L   +Q+  D  K ++  +  LIVFDMSN
Sbjct  568   AVEIPGILVTRLKCALLCFANSNCIKERILQLATGKQEVGD--KGNANGKTQLIVFDMSN  625

Query  521   IMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAI  342
             +MN+DT+ + SLKEL++ + S G++F + NPRWQVIHKLRLA+F + I  +VFLT+G+AI
Sbjct  626   LMNIDTTGLASLKELHNSLASEGIEFAVTNPRWQVIHKLRLANFVDNIGRRVFLTVGDAI  685

Query  341   DACLVDK  321
             DAC+  K
Sbjct  686   DACITAK  692



>ref|XP_002309991.2| Early nodulin 70 family protein [Populus trichocarpa]
 gb|EEE90441.2| Early nodulin 70 family protein [Populus trichocarpa]
Length=652

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/631 (67%), Positives = 520/631 (82%), Gaps = 9/631 (1%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV--QAVLSASESVFPLLS  2043
             AE+A WVLN PEPP L ++L GS ++T       F  ++ +    + V+S   ++FP+  
Sbjct  22    AEKAQWVLNAPEPPSLWQELTGSVRETVLPHARRFPTVKDKGSLSKTVISFLHAIFPIFC  81

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             W + Y     K+D+LAGLTLASLCIPQSIGYA LA LDPQYGLYTSV+PPLIYAVMG+SR
Sbjct  82    WCRNYKATNFKNDLLAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVIPPLIYAVMGTSR  141

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             +IAIGPVAV+SLL+SSM+PKLEDP +NP  Y +LVLT TFFAGIFQAAFG+ RLGFLVDF
Sbjct  142   DIAIGPVAVVSLLLSSMIPKLEDPEANPILYRNLVLTTTFFAGIFQAAFGLFRLGFLVDF  201

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGF+AGAAIVIGLQQ+K L GI++FTNKTDV+SV+  I+ ++HHS WNP+N I+
Sbjct  202   LSHAAIVGFVAGAAIVIGLQQMKGLLGITHFTNKTDVISVMEAIWRAVHHS-WNPHNFIL  260

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL+FILITRF+G+++RKLFWLPA+APL+SV+LSTLLVYLTRA+ HGV I+KH+K GL
Sbjct  261   GCSFLTFILITRFVGRRNRKLFWLPAIAPLISVVLSTLLVYLTRADKHGVMIIKHIKRGL  320

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS+HQL FN PHI +V KIG IVAVVALTEAIAVG SFAS+KGYH++GN+EM+A+G  
Sbjct  321   NPSSVHQLQFNNPHIGEVAKIGLIVAVVALTEAIAVGRSFASIKGYHINGNQEMVAMGFM  380

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NI GS TSCYVATGSFSRSAVNF AGCE+A+SN+VMA+TV+ISL+L T+LLY+TP+AILA
Sbjct  381   NILGSFTSCYVATGSFSRSAVNFSAGCETAMSNIVMAITVIISLELFTRLLYYTPIAILA  440

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             +IILSALPGL++L+EAY+IWK+DKLDFLACAGAF GVLFASVEIGLL AV +SF KI++ 
Sbjct  441   AIILSALPGLVDLHEAYNIWKIDKLDFLACAGAFIGVLFASVEIGLLAAVTISFVKIIII  500

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             SI+PG E LGRLP TD +F  + QYPMA + P V +IR KS LLCFANANF+K +I+ L 
Sbjct  501   SIRPGAEVLGRLPETD-IFCDVDQYPMAAKNPQVLIIRVKSGLLCFANANFVKEKIMKLA  559

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              EE++ +       ++ I +++ DMSN+MN+D S I SL EL+  + S G++  I NP+W
Sbjct  560   TEEEEGS-----KGKRTIQVVILDMSNLMNIDVSGITSLVELHKNLASSGMELAITNPKW  614

Query  422   QVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             QVIHKLR+A+F  KI G+VFLTIGEA+DACL
Sbjct  615   QVIHKLRVANFVTKIGGRVFLTIGEAVDACL  645



>gb|KDP46877.1| hypothetical protein JCGZ_24086 [Jatropha curcas]
Length=658

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/636 (66%), Positives = 514/636 (81%), Gaps = 10/636 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAF-----QRLRKRPVQAVLSASESVFPL  2049
             ERA WVLN PEPP    +L GS K+T    GT F      +   +PV +VL A   +FP+
Sbjct  24    ERAKWVLNAPEPPSPWCQLMGSIKETLFPHGTGFLTPFKNQNGNKPVLSVLRA---IFPI  80

Query  2048  LSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGS  1869
             LSW + Y   K K+D+LAGLTLASLCIPQ IGYA LA LDPQYGLYTSVVPP+IYA++G+
Sbjct  81    LSWCRNYKATKFKNDLLAGLTLASLCIPQGIGYATLAKLDPQYGLYTSVVPPIIYALLGT  140

Query  1868  SREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLV  1689
             SREIAIGPVAV+SLL+SS++P ++DP +NP  + +LV+T TFFAGIFQAAFG+ RLGFLV
Sbjct  141   SREIAIGPVAVVSLLLSSLIPNIQDPEANPVAFRNLVITTTFFAGIFQAAFGLFRLGFLV  200

Query  1688  DFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNl  1509
             DFLSHAAIVGFMAGAAIVIGLQQLK L GI++FTNKTDV+SV    +TS+HHS WNP+N 
Sbjct  201   DFLSHAAIVGFMAGAAIVIGLQQLKGLLGITHFTNKTDVISVAKATWTSVHHSSWNPHNF  260

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             I+G SFLSFIL TRF+G++ RKLFWLPA+APL+SV+LSTL+V+LTRA+ HGVKI+KH+KG
Sbjct  261   ILGCSFLSFILTTRFIGKRKRKLFWLPAIAPLVSVVLSTLIVFLTRADKHGVKIIKHIKG  320

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNPSS+HQL FN P I Q+VKIGFIVA+VALTEAIAVG SFAS+KGYH+DGNKEM+AIG
Sbjct  321   GLNPSSIHQLQFNDPQIGQIVKIGFIVALVALTEAIAVGRSFASIKGYHIDGNKEMVAIG  380

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
             + NI GS +SCYVATGSFSRSAVNF AGCE+A+SN+VMA+TV+I L+ LT+LLYFTP AI
Sbjct  381   MTNILGSFSSCYVATGSFSRSAVNFTAGCETAMSNIVMAITVIICLEFLTRLLYFTPTAI  440

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI+LNE Y++WK+DKLDFLAC GA  GVLF SVEIGLL AV +SF KI+
Sbjct  441   LASIILSALPGLIDLNEIYNVWKLDKLDFLACIGALFGVLFCSVEIGLLAAVTVSFLKII  500

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             + SI+PG E LGR+PGTD +F  + QYPMA++TP V VIR KS  LCFANAN +K  I+ 
Sbjct  501   IISIKPGTEVLGRIPGTD-MFCDVLQYPMALETPSVLVIRVKSGFLCFANANLVKHNIIK  559

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
                E+++  +  K + ++ + L++ D+SN+ ++DT+ I  L+EL   +   G++  I NP
Sbjct  560   WATEKEEE-ENIKGNVKRSVQLVILDLSNLTSIDTAGIACLEELRKNLVLNGIEMAITNP  618

Query  428   RWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
             RWQVIHKL+LA+F NKI  ++FLTI EAIDACL  K
Sbjct  619   RWQVIHKLKLANFVNKIGERIFLTIDEAIDACLSSK  654



>ref|XP_007204972.1| hypothetical protein PRUPE_ppa002425mg [Prunus persica]
 gb|EMJ06171.1| hypothetical protein PRUPE_ppa002425mg [Prunus persica]
Length=674

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/645 (64%), Positives = 524/645 (81%), Gaps = 9/645 (1%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLS  2073
             L+K SS +    +R+ WVLN PEPPGL  +L  S ++TA++ G  +  L+ +P +++V+S
Sbjct  32    LEKNSSPV----QRSEWVLNGPEPPGLWHELMDSVRETASYCGNKYSSLKNQPALKSVVS  87

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               + +FP+L WG+ Y++ K K D+LAGLT+ASLCIPQSIGYA LA LDPQYGLYTSVVPP
Sbjct  88    IQQEIFPILVWGRSYNISKFKHDLLAGLTIASLCIPQSIGYATLAKLDPQYGLYTSVVPP  147

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYAVMG+SREIAIGPVAV+SLL+ SM+ KL+DP ++   YT LVLT TFF GIFQA+FG
Sbjct  148   LIYAVMGTSREIAIGPVAVVSLLLPSMIQKLQDPGADSIAYTKLVLTATFFTGIFQASFG  207

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             + RLGFLVDFLSHAAIVGF+AGAAI+IGLQQLK L GI++F   TDV+SV+  ++TS HH
Sbjct  208   LFRLGFLVDFLSHAAIVGFVAGAAIIIGLQQLKGLLGITHFPTNTDVISVMEAVWTSFHH  267

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
              PW+P+N I+G SFL FILI+R+LG+K++KLFWLPA+APLLSVILSTL+VYLTR + HG+
Sbjct  268   -PWSPHNFILGCSFLCFILISRYLGKKNKKLFWLPAVAPLLSVILSTLIVYLTRGDKHGI  326

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             KIVKH+K GLNPSS++ L  N P++  V K+G IVA+VALTEAIAVG SF+S+KGYH+DG
Sbjct  327   KIVKHIKDGLNPSSVNLLELNGPYVGDVAKVGLIVALVALTEAIAVGRSFSSIKGYHMDG  386

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+A+G  NI GS TSCYVATGSFSR+AVN+ AGCE+ VSN+VMA+TV+ISLQ LTKL
Sbjct  387   NKEMMAMGFMNIVGSFTSCYVATGSFSRTAVNYSAGCETPVSNIVMAITVIISLQFLTKL  446

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP AILASIILSALPGL++LN+ Y IWKVDKLDFLAC GAF GVLFASVEIGLLVAV
Sbjct  447   LYYTPTAILASIILSALPGLVDLNKVYRIWKVDKLDFLACIGAFFGVLFASVEIGLLVAV  506

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SF KI+L SI+PG E LG+LPGT+ +F    QYPMA++ PGV +IR KS+L CFANAN
Sbjct  507   TISFTKIILISIRPGTETLGKLPGTE-MFCDTAQYPMAIKIPGVMIIRVKSALFCFANAN  565

Query  632   FIKARILSLVMEEQKSADETKESSEKRIA-LIVFDMSNIMNVDTSAIISLKELYDKITSC  456
             F+K RI+  +   QK+AD   ++ +K    L++ DMSN++N+DTS I +L+EL   + S 
Sbjct  566   FVKERIVRWI-TAQKAADTKGQTKDKEATHLVILDMSNLINIDTSGIATLEELQKNLISE  624

Query  455   GVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
             G++  IANPRWQVIHKL+L++F  KI G+VF+T+GEA+DA    K
Sbjct  625   GIELAIANPRWQVIHKLKLSNFVGKIGGRVFVTVGEAVDASFGGK  669



>gb|KDP32701.1| hypothetical protein JCGZ_11993 [Jatropha curcas]
Length=654

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/627 (66%), Positives = 517/627 (82%), Gaps = 11/627 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ERA WVLN P+PPGL ++L GS K+   F     +  ++    A +S  +S+FP+L WGK
Sbjct  29    ERAKWVLNSPDPPGLLQELIGSAKEL-VFSNVKKKISKQTKTTAAVSFFQSLFPILKWGK  87

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y + + K+D++AGLTLASL IPQSIGYA LA LDPQYGLYTS VPPLIYA+MGSSREIA
Sbjct  88    DYKVSQFKNDLMAGLTLASLSIPQSIGYATLAKLDPQYGLYTSAVPPLIYALMGSSREIA  147

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+S+L+SS + K++DPA++P  Y  LV TVTFFAGIFQA FG+ RLGFLVDFLSH
Sbjct  148   IGPVAVVSMLLSSTLQKVQDPATDPVAYRKLVFTVTFFAGIFQAVFGLFRLGFLVDFLSH  207

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AAIVGFMAGAAIVIGLQQLK L GI++FTNKTDVVSVL  +FTS+ H PW P N ++G S
Sbjct  208   AAIVGFMAGAAIVIGLQQLKGLIGITHFTNKTDVVSVLGSVFTSIDH-PWCPLNFVLGCS  266

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL F+LI RF+G++++KLFW PA+APL+SVILSTL+V+L++A+ HGVKIVKH+KGGLNPS
Sbjct  267   FLIFLLIARFIGRRNKKLFWFPAIAPLISVILSTLIVFLSKADKHGVKIVKHIKGGLNPS  326

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S+H L  N+PH+ Q  KIG I A+VALTEAIAVG SFAS+KGYHLDGNKEM+++G  NI 
Sbjct  327   SVHDLQLNSPHVGQAAKIGLISAIVALTEAIAVGRSFASIKGYHLDGNKEMVSMGFMNIV  386

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV++SL+L T+LLY+TP+AILASII
Sbjct  387   GSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVILSLELFTRLLYYTPMAILASII  446

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGLI++NEAY IWKVDKLDFLAC GAF GVLF SVEIGLLVAV +SF KI+LNSI+
Sbjct  447   LSALPGLIDINEAYHIWKVDKLDFLACIGAFFGVLFESVEIGLLVAVTISFGKILLNSIR  506

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             P IE+LGR+P TD  F  I+QYPMA++TPGV ++R  SSLLCFANANFI+ RI+  V E+
Sbjct  507   PSIEELGRIPRTDT-FGDINQYPMAIKTPGVLIVRINSSLLCFANANFIRERIMRWVTED  565

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             +       E++++R+ +++ DMSN+ N+DT+ +++L+EL+ K+ S   +  IANPRWQVI
Sbjct  566   E-------ENTKERVQIVILDMSNVTNIDTAGLLALEELHKKLLSYETELDIANPRWQVI  618

Query  413   HKLRLADFHNKI-KGKVFLTIGEAIDA  336
             HKL++A F ++I +G+VFLT+ EAIDA
Sbjct  619   HKLKVAKFPDRIGRGRVFLTVSEAIDA  645



>ref|XP_003552820.1| PREDICTED: sulfate transporter 2.1-like [Glycine max]
Length=653

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/624 (66%), Positives = 513/624 (82%), Gaps = 5/624 (1%)
 Frame = -1

Query  2210  RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVL-SASESVFPLLSWGK  2034
             R+ WVLN PEPP   R +  S  KT +        L  +P   +L S  + VFP+L+WG+
Sbjct  28    RSQWVLNAPEPPSPWRVVADSVSKTISHYKHKLSSLIDQPCTTLLLSVLQVVFPILAWGR  87

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y+  K + D+LAGLT+ASLCIPQSIGYA LA+LDPQYGLYTSVVPPLIYAVMG+SREIA
Sbjct  88    NYTATKFRKDLLAGLTIASLCIPQSIGYATLAHLDPQYGLYTSVVPPLIYAVMGTSREIA  147

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSM+ KL DPA++P GYT L+L  T FAGIFQ +FG+LRLGFLVDFLSH
Sbjct  148   IGPVAVVSLLLSSMMEKLVDPATDPVGYTKLILLATLFAGIFQTSFGLLRLGFLVDFLSH  207

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AAIVGF+AGAAIVIGLQQLK L GI++FT KTD+VSV+  ++ ++H+ PWNP N I+G S
Sbjct  208   AAIVGFVAGAAIVIGLQQLKGLLGITHFTTKTDIVSVMKAVWEAVHN-PWNPRNFILGCS  266

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL FIL TR LG++ +KLFWL +++PL+SV++STL+V++TRA+ +GVKIVKHVKGGLNPS
Sbjct  267   FLVFILTTRCLGKRKKKLFWLASISPLVSVVVSTLIVFITRADKNGVKIVKHVKGGLNPS  326

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S+HQL FN P+I +V KIG +VAVVALTE+IAVG SFAS+KGY LDGNKEM++IG+ NI 
Sbjct  327   SIHQLDFNNPYIGEVAKIGLVVAVVALTESIAVGRSFASIKGYQLDGNKEMMSIGLTNII  386

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GS TSCYVATGSFSR+AVN+ AGCE+ VSN+VMA+TVLISLQ LTKLLY+TP AILAS+I
Sbjct  387   GSFTSCYVATGSFSRTAVNYAAGCETLVSNIVMAITVLISLQFLTKLLYYTPTAILASVI  446

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGLI+L+EAY IWKVDK+DFLACAGAF GVLFASVEIGLLVAV +SF+KI+L SI+
Sbjct  447   LSALPGLIDLSEAYKIWKVDKIDFLACAGAFFGVLFASVEIGLLVAVVISFSKIILISIR  506

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             PG E LG+LPGTD LF  ++QYPMAV+ PGV +IR KS+LLCFANANF++ RI+  V EE
Sbjct  507   PGTETLGKLPGTD-LFCDVYQYPMAVKVPGVMIIRVKSALLCFANANFVRERIIKWVTEE  565

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             +   D  K +S   I L++ D SN++N+DT+ I +L+EL+  ++S G Q  IANPRWQVI
Sbjct  566   ESEDD--KGNSRSTIQLLILDTSNLVNIDTAGITALEELHKSLSSHGKQLAIANPRWQVI  623

Query  413   HKLRLADFHNKIKGKVFLTIGEAI  342
             HKL++++F  KI+G+VFLT+ EA+
Sbjct  624   HKLKVSNFVGKIRGRVFLTVEEAV  647



>ref|XP_008233993.1| PREDICTED: low affinity sulfate transporter 3 [Prunus mume]
Length=663

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/656 (63%), Positives = 522/656 (80%), Gaps = 8/656 (1%)
 Frame = -1

Query  2273  LPYE-FSQTLQKTSSTLPPAA---ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQR  2106
             LP E FS  LQ+    +       ERA W+LN PEPPGL R+L    K      G  +  
Sbjct  4     LPTEVFSVELQQHPHHVEDTTGRVERAQWLLNSPEPPGLWRQLLHGIKSNVFPEGNNYSS  63

Query  2105  LRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDP  1926
              +K P     S    +FP+LSWG+ Y   K K+DV+AGLTLASL +PQSIGYA LA LDP
Sbjct  64    KQKTPASHAFSFFRGLFPILSWGRNYKASKFKNDVMAGLTLASLSVPQSIGYANLAKLDP  123

Query  1925  QYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVT  1746
             QYGLYTS+VPPL+Y++MGSSRE+AIGPVAV+S+L++S+V K+EDP +NP  Y  L+ TVT
Sbjct  124   QYGLYTSIVPPLVYSLMGSSRELAIGPVAVVSMLLASLVQKIEDPVANPVAYRKLIFTVT  183

Query  1745  ffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVS  1566
             FFAGIFQAAFGI RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLK L GI++FT  TDVVS
Sbjct  184   FFAGIFQAAFGIFRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKGLLGINHFTTNTDVVS  243

Query  1565  VLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLL  1386
             VL  +F S+ H PW P N+++G SFL F+L+TRF+G++++KLFWLPA+APL+SV+LSTL+
Sbjct  244   VLESVFNSIVHEPWYPLNIVLGCSFLIFLLLTRFIGKRNKKLFWLPAIAPLISVLLSTLI  303

Query  1385  VYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGS  1206
             V+LT+A+ HGVKIVKH+KGGLNPSS HQL    PH+ Q  K G I AV+AL EAIAVG S
Sbjct  304   VFLTKADKHGVKIVKHIKGGLNPSSAHQLQLGGPHVGQAAKAGLISAVIALAEAIAVGRS  363

Query  1205  FASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVT  1026
             FAS+KGYHLDGNKEM+A+G  NIAGSLTSCYV+TGSFSR+AVNF AGCE+ VSN+VMA+T
Sbjct  364   FASIKGYHLDGNKEMIAMGCMNIAGSLTSCYVSTGSFSRTAVNFSAGCETVVSNIVMALT  423

Query  1025  VLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLF  846
             V++S++LLT+LLYFTP+AILASIILSALPGL+++  AY IWKVDKLDFLAC GAF GVLF
Sbjct  424   VILSVELLTRLLYFTPIAILASIILSALPGLVDITGAYHIWKVDKLDFLACIGAFFGVLF  483

Query  845   ASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRT  666
             AS EIGLLVAV +SFAKI++NS++PGIE LGRLP TD +F  I+QYPMA +TP + +I  
Sbjct  484   ASAEIGLLVAVSISFAKILVNSLRPGIEVLGRLPRTD-IFCNINQYPMATKTPSILIIGI  542

Query  665   KSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISL  486
              SSLLCFANAN ++ R+++ VM+E+   ++ KE  + RI  ++ DMSN++NVDTS I++L
Sbjct  543   NSSLLCFANANSVRERVMTSVMKEENETEDQKE--KGRIQHVILDMSNVINVDTSGILAL  600

Query  485   KELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKG-KVFLTIGEAIDACLVDK  321
             +E++ K+ S G++  +ANPRWQVIH+L++A   ++I G +VFLT+GEA+DACL  K
Sbjct  601   EEIHKKLFSYGIELAMANPRWQVIHRLKVAKLLDRIGGERVFLTVGEAVDACLNSK  656



>ref|XP_006472651.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Citrus sinensis]
 ref|XP_006472652.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Citrus sinensis]
Length=664

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/635 (65%), Positives = 517/635 (81%), Gaps = 9/635 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQ---RLRKRPVQAVLSASESVFPLLS  2043
             ERA W+LN P+PP +  +L GS ++ A F         R+++   ++  S    +FP+L+
Sbjct  28    ERARWLLNSPDPPSIWHELAGSIRE-AFFPRNKLSSSSRVKQTWRRSAFSFLRGLFPILN  86

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y   K KSD++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MGSSR
Sbjct  87    WGRNYKASKFKSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYALMGSSR  146

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+S+L+S+++  ++DPA++P  Y  LV TVTFFAG+FQ+ FG+ RLGFLVDF
Sbjct  147   EIAIGPVAVVSMLLSALMQNVQDPAADPVAYRKLVFTVTFFAGVFQSVFGLFRLGFLVDF  206

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDVVSVL  +F+SLHHS W P N ++
Sbjct  207   LSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVVSVLGSVFSSLHHSYWYPLNFVL  266

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYLT+A+ HGVKIVKH+KGGL
Sbjct  267   GCSFLIFLLIARFIGRRNKKLFWLPAIAPLLSVILSTLIVYLTKADKHGVKIVKHIKGGL  326

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS HQL    PH+ Q  KIG I AVVALTEAIAVG SFAS+KGYHLDGNKEM+A+G  
Sbjct  327   NPSSAHQLQLTGPHLGQTAKIGLISAVVALTEAIAVGRSFASIKGYHLDGNKEMVAMGFM  386

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NIAGSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+TVL+SL+L T LLY+TP+AILA
Sbjct  387   NIAGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAITVLLSLELFTSLLYYTPIAILA  446

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SIILSALPGLI++NEA +I+KVDKLDFLAC GAF GVLFASVEIGLL AV +SFAKI+LN
Sbjct  447   SIILSALPGLIDINEAINIYKVDKLDFLACIGAFLGVLFASVEIGLLAAVTISFAKILLN  506

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             +++PGIE  GRLP TD  +  I Q+PMA++TPG+  IR  S+L CFANANFI+ RI+  V
Sbjct  507   AVRPGIELQGRLPRTDT-YGDISQFPMAIKTPGILTIRINSALFCFANANFIRERIMRWV  565

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              EEQ   DE +E++++ I  ++ DMSN+MN+DTS I+ L+EL+ K+ S G++ V+A+PRW
Sbjct  566   TEEQ---DELEETTKRTIQAVIIDMSNLMNIDTSGILVLEELHKKLASNGIELVMASPRW  622

Query  422   QVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             QVIHKL+ A   ++I KG V+L++ EA++ACL  K
Sbjct  623   QVIHKLKSAKLLDRIGKGCVYLSVAEAMEACLASK  657



>ref|XP_003538517.1| PREDICTED: sulfate transporter 2.1-like [Glycine max]
Length=653

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/624 (66%), Positives = 511/624 (82%), Gaps = 5/624 (1%)
 Frame = -1

Query  2210  RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVL-SASESVFPLLSWGK  2034
             R+ WVLN PEPP   R +  S  KT +        L  +P   +L S    +FP+L+WG+
Sbjct  28    RSQWVLNAPEPPSPWRVVADSVSKTISHYKHKLSSLTDQPCTTLLLSVLRVIFPILAWGR  87

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y+  K + D+LAGLT+ASLCIPQSIGYA LA+LDPQYGLYTSVVPPLIYAVMG+SREIA
Sbjct  88    NYTATKFRKDLLAGLTIASLCIPQSIGYATLAHLDPQYGLYTSVVPPLIYAVMGTSREIA  147

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSM+ KL DPA++P GYT L+L  T FAGIFQ +FG+ RLGFLVDFLSH
Sbjct  148   IGPVAVVSLLLSSMMVKLVDPATDPVGYTKLILLATLFAGIFQTSFGLFRLGFLVDFLSH  207

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AAIVGF+AGAAIVIGLQQLK L GI++FT KTD+VSV+  ++ ++H+ PW+P N I+G S
Sbjct  208   AAIVGFVAGAAIVIGLQQLKGLLGITHFTTKTDIVSVMKAVWEAVHN-PWSPRNFILGCS  266

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL FIL TRFLG++ +KLFWL +++PL+SV+LSTL+V+LTRA+ +GVKIVKHVKGGLNPS
Sbjct  267   FLVFILTTRFLGKRKKKLFWLASISPLVSVVLSTLIVFLTRADKNGVKIVKHVKGGLNPS  326

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             SLHQL FN P+I +V KIG +VAVVALTE+IAVG SFAS+KGY LDGNKEM++IG+ NI 
Sbjct  327   SLHQLDFNNPYIGEVAKIGLVVAVVALTESIAVGRSFASIKGYQLDGNKEMMSIGLTNII  386

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GS TSCYVATGSFSR+AVN+ AGCE+ VSN+VMA+TVLISLQ LTKLLY+TP AILAS+I
Sbjct  387   GSFTSCYVATGSFSRTAVNYAAGCETLVSNIVMAITVLISLQFLTKLLYYTPTAILASVI  446

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGLI+++EAY IWKVDK+DFLACAGAF GVLFASVEIGLLVAV +SF+KI+L SI+
Sbjct  447   LSALPGLIDVSEAYKIWKVDKIDFLACAGAFFGVLFASVEIGLLVAVLISFSKIILISIR  506

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             PG E LG++PGTD LF  ++QYPMAV+ PGV +IR KS+LLCFANANF++ RI+  V EE
Sbjct  507   PGTETLGKIPGTD-LFCDVYQYPMAVKIPGVMIIRVKSALLCFANANFVRERIIKWVTEE  565

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             +   D  K +S   I L++ D SN++N+DTS I +L+EL+  ++S G Q  IANPRWQVI
Sbjct  566   ESEDD--KGNSRSTIQLVILDTSNLVNIDTSGITALEELHKSLSSQGKQLAIANPRWQVI  623

Query  413   HKLRLADFHNKIKGKVFLTIGEAI  342
             HKL++++F  KI G+VFLT+ EA+
Sbjct  624   HKLKVSNFVGKIGGRVFLTVEEAV  647



>ref|XP_008233449.1| PREDICTED: sulfate transporter 2.1-like [Prunus mume]
Length=713

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/645 (64%), Positives = 525/645 (81%), Gaps = 9/645 (1%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLS  2073
             L+K S+ +    +R+ WVLN PEPPGL  +L  S ++T ++ G  +  L+ +P +++V+S
Sbjct  71    LEKNSNPV----QRSEWVLNGPEPPGLWHELMDSVRETVSYFGNKYSSLKNQPALKSVVS  126

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               + +FP+L WG+ Y++ K K D+LAGLT+ASLCIPQSIGYA LA LDPQYGLYTSVVPP
Sbjct  127   IQQEIFPILVWGRSYNISKFKHDLLAGLTIASLCIPQSIGYATLAKLDPQYGLYTSVVPP  186

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYAVMG+SREIAIGPVAV+SLL+ SM+ KL+DP ++   YT LVLT TFF GIFQA+FG
Sbjct  187   LIYAVMGTSREIAIGPVAVVSLLLPSMIQKLQDPGADAIAYTKLVLTATFFTGIFQASFG  246

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             + RLGFLVDFLSHAAIVGF+AGAAI+IGLQQLK L GI++F   TDV+SV+  ++TS HH
Sbjct  247   LFRLGFLVDFLSHAAIVGFVAGAAIIIGLQQLKGLLGITHFPTNTDVISVMEAVWTSFHH  306

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
              PW+P+N I+G SFL FILI+R+LG+K++KLFWLPA+APLLSVILSTL+VYLTR + HG+
Sbjct  307   -PWSPHNFILGCSFLCFILISRYLGKKNKKLFWLPAVAPLLSVILSTLIVYLTRGDKHGI  365

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             KIVKH+K GLNPSS++ L  N P++  V K+G IVA+VALTEAIAVG SF+S+KGYH+DG
Sbjct  366   KIVKHIKDGLNPSSVNLLELNGPYVGDVAKVGLIVALVALTEAIAVGRSFSSIKGYHMDG  425

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+A+G  NI GSLTSCYVATGSFSR+AVN+ AGCE+ VSN+VMA+TV+ISLQ LTKL
Sbjct  426   NKEMMAMGFMNIVGSLTSCYVATGSFSRTAVNYSAGCETPVSNIVMAITVIISLQFLTKL  485

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP AILASIILSALPGL++L++ Y IWKVDKLDFLAC GAF GVLFASVEIGLLVAV
Sbjct  486   LYYTPTAILASIILSALPGLVDLDKVYKIWKVDKLDFLACIGAFFGVLFASVEIGLLVAV  545

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SF KI+L SI+PG E LG+LPG++ +F    QYPMAV+ PGV +IR KS+L CFANAN
Sbjct  546   TISFTKIILISIRPGTETLGKLPGSE-MFCDTAQYPMAVKIPGVMIIRVKSALFCFANAN  604

Query  632   FIKARILSLVMEEQKSADETKESSEKR-IALIVFDMSNIMNVDTSAIISLKELYDKITSC  456
             F+K RI+  +   QK+AD   ++ +K  I L++ DMSN++N+DTS I +L+EL   + S 
Sbjct  605   FVKERIVRWI-TAQKAADTKGQTKDKEAIHLVILDMSNLINIDTSGIATLEELQKNLISE  663

Query  455   GVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
             G++  +ANPRWQVIHKL+L++F  KI G+VF+T+GEA+DA    K
Sbjct  664   GIELAVANPRWQVIHKLKLSNFVGKIGGRVFVTVGEAVDASFGGK  708



>ref|XP_004502442.1| PREDICTED: sulfate transporter 2.1-like isoform X1 [Cicer arietinum]
Length=657

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/634 (65%), Positives = 507/634 (80%), Gaps = 6/634 (1%)
 Frame = -1

Query  2210  RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVL-SASESVFPLLSWGK  2034
             R+ WVLN P+PP   R +  S +K+ +           +    +L S  + VFP+  WG+
Sbjct  28    RSQWVLNAPDPPSPCRVVVDSMRKSFSNFREKISSFSDQSCGTLLLSGLQVVFPIFVWGR  87

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y++ K ++D LAGLT+ASLCIPQSIGYA LANL PQYGLYTSVVPPLIYAVMG+SREIA
Sbjct  88    NYTVAKFRNDFLAGLTIASLCIPQSIGYATLANLAPQYGLYTSVVPPLIYAVMGTSREIA  147

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSMV KL DP ++P GYT L+   T FAGIFQ AFG+ RLGFLVDFLSH
Sbjct  148   IGPVAVVSLLLSSMVQKLIDPFTDPIGYTKLIFLATLFAGIFQTAFGLFRLGFLVDFLSH  207

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             A+IVGF+AGAAIVIGLQQLK LFGI++FT KTD++SV+  ++ +LH+ PWNP N I+G S
Sbjct  208   ASIVGFVAGAAIVIGLQQLKGLFGITHFTTKTDIISVIKAVWEALHN-PWNPRNFILGGS  266

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL+FIL TRFLG++ +  FW  +++PL+SVILSTL+VYLTRA+ +GVKIVKHVKGGLNPS
Sbjct  267   FLAFILTTRFLGKRKKNFFWFASISPLVSVILSTLVVYLTRADKYGVKIVKHVKGGLNPS  326

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S+HQL FN PH+  V KIG IVAVVALTE+IAVG SFAS+KGY LDGNKEM++IG  NI 
Sbjct  327   SIHQLDFNNPHVADVAKIGLIVAVVALTESIAVGRSFASIKGYQLDGNKEMMSIGFTNII  386

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GSLTSCYVATGSFSR+AVN+ AGCES VSN+VMAVTVLISLQ LTKLLY+TP+AI+AS+I
Sbjct  387   GSLTSCYVATGSFSRTAVNYAAGCESLVSNIVMAVTVLISLQFLTKLLYYTPIAIIASVI  446

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGLI++NEAY IWKVDKLDFLACAGAF GVLFASVEIGLLVAV +SFAKI+L SI+
Sbjct  447   LSALPGLIDINEAYKIWKVDKLDFLACAGAFFGVLFASVEIGLLVAVVISFAKIILISIR  506

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             PG E LG+LPGTD LF  ++QYPMA+Q PGV ++R KS LLCFANA+F++ RI+  V  +
Sbjct  507   PGTETLGKLPGTD-LFCDVYQYPMAIQIPGVMILRIKSPLLCFANASFVRERIIKWVTRD  565

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
               S D+   S      L++ D SN++N+DTS I SL+ELY  ++S G Q  IANPRWQVI
Sbjct  566   DGSEDDKGNSKSTLYQLVILDTSNLVNIDTSGIASLEELYKCLSSHGKQLAIANPRWQVI  625

Query  413   HKLRLADFHNKIKGKVFLTIGEAIDACLVDKNMQ  312
             HKL++++F +KI G+V+LT+ EA+  C   KN Q
Sbjct  626   HKLKVSNFVSKIGGRVYLTVEEAVAGC---KNNQ  656



>ref|XP_006434037.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 ref|XP_006434039.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 ref|XP_006434041.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47277.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47279.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47281.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
Length=664

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/634 (65%), Positives = 515/634 (81%), Gaps = 7/634 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLG--TAFQRLRKRPVQAVLSASESVFPLLSW  2040
             ERA W+LN P+PP +  +L GS ++        ++  R+++   ++  S    +FP+L+W
Sbjct  28    ERARWLLNSPDPPSIWHELAGSIREAFVPRNKLSSSSRVKQTWRRSAFSFLRGLFPILNW  87

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
             G+ Y   K KSD++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MGSSRE
Sbjct  88    GRNYKASKFKSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYALMGSSRE  147

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L+S+++  ++DPA++P  Y  LV TVTFFAG+FQ+ FG+ RLGFLVDFL
Sbjct  148   IAIGPVAVVSMLLSALMQNVQDPAADPVAYRKLVFTVTFFAGVFQSVFGLFRLGFLVDFL  207

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliig  1500
             SHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDVVSVL  +F+SLHHS W P N ++G
Sbjct  208   SHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVVSVLGSVFSSLHHSYWYPLNFVLG  267

Query  1499  fsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLN  1320
              SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYLT+A+ HGVKIVKH+KGGLN
Sbjct  268   CSFLIFLLIARFIGRRNKKLFWLPAIAPLLSVILSTLIVYLTKADKHGVKIVKHIKGGLN  327

Query  1319  PSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVAN  1140
             PSS HQL    PH+ Q  KIG I AVVALTEAIAVG SFAS+KGYHLDGNKEM+A+G  N
Sbjct  328   PSSAHQLQLTGPHLGQTAKIGLISAVVALTEAIAVGRSFASIKGYHLDGNKEMVAMGFMN  387

Query  1139  IAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILAS  960
             I GSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+TVL+SL+L T LLY+TP+AILAS
Sbjct  388   IVGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAITVLLSLELFTSLLYYTPIAILAS  447

Query  959   IILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNS  780
             IILSALPGLI++NEA +I+KVDKLDFLAC GAF GVLFASVEIGLL AV +SFAKI+LN+
Sbjct  448   IILSALPGLIDINEAINIYKVDKLDFLACIGAFLGVLFASVEIGLLAAVTISFAKILLNA  507

Query  779   IQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVM  600
             ++PGIE  GRLP TD  +  I Q+PMA++TPG+  IR  S+L CFANANFI+ RI+  V 
Sbjct  508   VRPGIELQGRLPRTDT-YGDISQFPMAIKTPGILTIRINSALFCFANANFIRERIMRWVT  566

Query  599   EEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
             EEQ   DE +E++++ I  ++ DMSN MN+DTS I+ L+EL+ K+ S G++ V+A+PRWQ
Sbjct  567   EEQ---DELEETTKRTIQAVIIDMSNSMNIDTSGILVLEELHKKLASNGIELVMASPRWQ  623

Query  419   VIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             VIHKL+ A   ++I KG V+L++ EA++ACL  K
Sbjct  624   VIHKLKSAKLLDRIGKGCVYLSVAEAMEACLTSK  657



>ref|XP_003602002.1| Sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
 gb|AES72253.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=654

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/627 (66%), Positives = 510/627 (81%), Gaps = 5/627 (1%)
 Frame = -1

Query  2210  RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVL-SASESVFPLLSWGK  2034
             R+ WVLN PEPP        SF+KT +        L  +    +L S    VFP+L WG+
Sbjct  27    RSQWVLNAPEPPSPWHVALDSFRKTVSNYREKTSSLSDQSCGTLLLSVLHVVFPILVWGR  86

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y++ K + D LAGLT+ASLCIPQSIGYA LANL PQYGLYTSVVPPLIYAVMG+SREIA
Sbjct  87    SYTVAKFRKDFLAGLTIASLCIPQSIGYATLANLAPQYGLYTSVVPPLIYAVMGTSREIA  146

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSMV KL DP+++P GYT L+   T FAGIFQ +FG+ RLGFLVDFLSH
Sbjct  147   IGPVAVVSLLLSSMVQKLVDPSTDPIGYTKLIFLATLFAGIFQTSFGLFRLGFLVDFLSH  206

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AAIVGF+AGAAIVIGLQQLK LFGI++FT KTD++SVL  ++ + H+ PWNP+N I+G S
Sbjct  207   AAIVGFVAGAAIVIGLQQLKGLFGITHFTTKTDIISVLKAVWEAFHN-PWNPHNFILGGS  265

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL FIL TRF+G++ +KLFWL ++APL+SVILSTL+V+LTRA+ +GVKIVKHVKGGLNPS
Sbjct  266   FLVFILTTRFVGKRKKKLFWLASIAPLVSVILSTLVVFLTRADKNGVKIVKHVKGGLNPS  325

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S++QL FN+PH+  V KIG IVAVVALTE++AVG SFAS+KGY LDGNKEM++IG  NI 
Sbjct  326   SINQLDFNSPHVVDVAKIGLIVAVVALTESVAVGRSFASIKGYQLDGNKEMMSIGFTNII  385

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GSLTSCYVATGSFSR+AVN+ AGCES +SN+VMA+TV+ISLQ LT LLY+TP+AI+AS+I
Sbjct  386   GSLTSCYVATGSFSRTAVNYAAGCESLISNIVMAITVMISLQFLTNLLYYTPIAIIASVI  445

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGLI++NEAY IWKVDKLDFLACAGAF GVLFASVEIGLLVAV +SFAKI++ SI+
Sbjct  446   LSALPGLIDINEAYKIWKVDKLDFLACAGAFFGVLFASVEIGLLVAVVISFAKIIVISIR  505

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             P  E LG+LPGTD LF  + QYPMA+Q PGV +IR KS+LLCFANANF+K RI+  V   
Sbjct  506   PSTETLGKLPGTD-LFCDVDQYPMAIQIPGVMIIRMKSALLCFANANFVKERIIKWV--T  562

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             QK  ++ K +S+  I L++ D SN++N+DTS I S++ELY  +++ G Q  IANPRWQVI
Sbjct  563   QKGLEDDKGNSKSTIQLVILDTSNLVNIDTSGIASMEELYKCLSTHGKQLAIANPRWQVI  622

Query  413   HKLRLADFHNKIKGKVFLTIGEAIDAC  333
             HKL++++F +KI G+V+LT+ EA+ +C
Sbjct  623   HKLKVSNFVSKIGGRVYLTVEEAVASC  649



>gb|KDO80888.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
 gb|KDO80889.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
Length=664

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/635 (65%), Positives = 515/635 (81%), Gaps = 9/635 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQ---RLRKRPVQAVLSASESVFPLLS  2043
             ERA W+LN P+PP +  +L GS ++ A F         R+++   ++  S    +FP+L+
Sbjct  28    ERARWLLNSPDPPSIWHELAGSIRE-AFFPRNKLSSSSRVKQTWRRSAFSFLRGLFPILN  86

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y   K KSD++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MGSSR
Sbjct  87    WGRNYKASKFKSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYALMGSSR  146

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+S+L+S+++  ++DPA++P  Y  LV TVTFFAG+FQ+ FG+ RLGFLVDF
Sbjct  147   EIAIGPVAVVSMLLSALMQNVQDPAADPVAYRKLVFTVTFFAGVFQSVFGLFRLGFLVDF  206

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDVVSVL  +F+SLHHS W P N ++
Sbjct  207   LSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVVSVLGSVFSSLHHSYWYPLNFVL  266

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYLT+A+ HGVKIVKH+KGGL
Sbjct  267   GCSFLIFLLIARFIGRRNKKLFWLPAIAPLLSVILSTLIVYLTKADKHGVKIVKHIKGGL  326

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS HQL    PH+ Q  KIG I AVVALTEAIAVG SFAS+KGYHLDGNKEM+A+G  
Sbjct  327   NPSSAHQLQLTGPHLGQTAKIGLISAVVALTEAIAVGRSFASIKGYHLDGNKEMVAMGFM  386

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NI GSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+TVL+SL+L T LLY+TP+AILA
Sbjct  387   NIVGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAITVLLSLELFTSLLYYTPIAILA  446

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SIILSALPGLI++NEA +I+KVDKLDFLAC GAF GVLFASVEIGLL AV +SFAKI+LN
Sbjct  447   SIILSALPGLIDINEAINIYKVDKLDFLACIGAFLGVLFASVEIGLLAAVTISFAKILLN  506

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             +++PGIE  GRLP TD  +  I Q+PMA++TPG+  IR  S+L CFANANFI+ RI+  V
Sbjct  507   AVRPGIELQGRLPRTDT-YGDISQFPMAIKTPGILTIRINSALFCFANANFIRERIMRWV  565

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              EEQ   DE +E++++ I  ++ DMSN MN+DTS I+ L+EL+ K+ S G++ V+A+PRW
Sbjct  566   TEEQ---DELEETTKRTIQAVIIDMSNSMNIDTSGILVLEELHKKLASNGIELVMASPRW  622

Query  422   QVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             QVIHKL+ A   ++I KG V+L++ EA++ACL  K
Sbjct  623   QVIHKLKSAKLLDRIGKGCVYLSVAEAMEACLTSK  657



>gb|KHN44326.1| Sulfate transporter 2.1 [Glycine soja]
Length=653

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/624 (66%), Positives = 510/624 (82%), Gaps = 5/624 (1%)
 Frame = -1

Query  2210  RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVL-SASESVFPLLSWGK  2034
             R+ WVLN PEPP   R +  S  KT +        L  +P   +L S    +FP+L+WG+
Sbjct  28    RSQWVLNAPEPPSPWRVVADSVSKTISHYKHKLSSLTDQPCTTLLLSVLRVIFPILAWGR  87

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y+  K + D+LAGLT+ASLCIPQSIGYA LA+LDPQYGLYTSVVPPLIYAVMG+SREIA
Sbjct  88    NYTATKFRKDLLAGLTIASLCIPQSIGYATLAHLDPQYGLYTSVVPPLIYAVMGTSREIA  147

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSM+ KL DPA++P GYT L+L  T FAGIFQ +FG+ RLGFLVD LSH
Sbjct  148   IGPVAVVSLLLSSMMVKLVDPATDPVGYTKLILLATLFAGIFQTSFGLFRLGFLVDLLSH  207

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AAIVGF+AGAAIVIGLQQLK L GI++FT KTD+VSV+  ++ ++H+ PW+P N I+G S
Sbjct  208   AAIVGFVAGAAIVIGLQQLKGLLGITHFTTKTDIVSVMKAVWEAVHN-PWSPRNFILGCS  266

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL FIL TRFLG++ +KLFWL +++PL+SV++STL+V+LTRA+ +GVKIVKHVKGGLNPS
Sbjct  267   FLVFILTTRFLGKRKKKLFWLASISPLVSVVVSTLIVFLTRADKNGVKIVKHVKGGLNPS  326

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             SLHQL FN P+I +V KIG +VAVVALTE+IAVG SFAS+KGY LDGNKEM++IG+ NI 
Sbjct  327   SLHQLDFNNPYIGEVAKIGLVVAVVALTESIAVGRSFASIKGYQLDGNKEMMSIGLTNII  386

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GS TSCYVATGSFSR+AVN+ AGCE+ VSN+VMA+TVLISLQ LTKLLY+TP AILAS+I
Sbjct  387   GSFTSCYVATGSFSRTAVNYAAGCETLVSNIVMAITVLISLQFLTKLLYYTPTAILASVI  446

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGLI+++EAY IWKVDK+DFLACAGAF GVLFASVEIGLLVAV +SF+KI+L SI+
Sbjct  447   LSALPGLIDVSEAYKIWKVDKIDFLACAGAFFGVLFASVEIGLLVAVLISFSKIILISIR  506

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             PG E LG++PGTD LF  ++QYPMAV+ PGV +IR KS+LLCFANANF++ RI+  V EE
Sbjct  507   PGTETLGKIPGTD-LFCDVYQYPMAVKIPGVMIIRVKSALLCFANANFVRERIIKWVTEE  565

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             +   D  K +S   I L++ D SN++N+DTS I +L+EL+  ++S G Q  IANPRWQVI
Sbjct  566   ESEDD--KGNSRSTIQLVILDTSNLVNIDTSGITALEELHKSLSSQGKQLAIANPRWQVI  623

Query  413   HKLRLADFHNKIKGKVFLTIGEAI  342
             HKL++++F  KI G+VFLT+ EA+
Sbjct  624   HKLKVSNFVGKIGGRVFLTVEEAV  647



>ref|XP_007226968.1| hypothetical protein PRUPE_ppa002519mg [Prunus persica]
 gb|EMJ28167.1| hypothetical protein PRUPE_ppa002519mg [Prunus persica]
Length=663

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/632 (64%), Positives = 512/632 (81%), Gaps = 4/632 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ERA W+LN PEPPGL ++L    K      G  +   +K P   V S    +FP+LSWG+
Sbjct  28    ERAQWLLNSPEPPGLWQQLLHGIKSNVFPQGNNYSSKQKTPASRVFSFLRGLFPILSWGR  87

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K+DV+AGLTLASL +PQSIGYA LA LDPQYGLYTS+VPPL+Y++MGSSRE+A
Sbjct  88    NYKASKFKNDVMAGLTLASLSVPQSIGYANLAKLDPQYGLYTSIVPPLVYSLMGSSRELA  147

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+S+L++S+V K+EDP +NP  Y  L+ TVTFFAGIFQAAFGI RLGFLVDFLSH
Sbjct  148   IGPVAVVSMLLASLVQKIEDPVANPVAYRKLIFTVTFFAGIFQAAFGIFRLGFLVDFLSH  207

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AAIVGFMAGAAIVIGLQQLK L GI++FT  TDVVSVL  +F S+ H PW P N+++G +
Sbjct  208   AAIVGFMAGAAIVIGLQQLKGLLGINHFTTNTDVVSVLESVFNSIVHEPWYPLNIVLGCA  267

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL F+L+TRF+G++++KLFWLPA+APL+SV+LSTL+V+LT+A+ HGVKIVKH+KGGLNPS
Sbjct  268   FLIFLLLTRFIGKRNKKLFWLPAIAPLISVLLSTLIVFLTKADKHGVKIVKHIKGGLNPS  327

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S HQL    PH+ Q  K G I AV+AL EAIAVG SFAS+KGYHLDGNKEM+A+G  NIA
Sbjct  328   SAHQLQLGGPHVGQAAKAGLISAVIALAEAIAVGRSFASIKGYHLDGNKEMIAMGCMNIA  387

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GSLTSCYV+TGSFSR+AVNF AGCE+ VSN+VMA+TV++S++LLT+LLYFTP+AILASII
Sbjct  388   GSLTSCYVSTGSFSRTAVNFSAGCETVVSNIVMALTVILSVELLTRLLYFTPIAILASII  447

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGL+++  AY IWKVDKLDFLAC GAF GVLFAS EIGLL AV +SFAKI++NS++
Sbjct  448   LSALPGLVDITGAYHIWKVDKLDFLACIGAFFGVLFASAEIGLLAAVSISFAKILVNSLR  507

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             PGIE LGRLP TD +F  I+QYPMA +TP + +I   SSLLCFANAN ++ R++  V +E
Sbjct  508   PGIEVLGRLPRTD-IFCNINQYPMATKTPSILIIGINSSLLCFANANSVRERVMRSVTKE  566

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             +   ++ KE  + RI  ++ DMSN++NVDTS I++L+E+++K+ S G++  +ANPRWQVI
Sbjct  567   ENETEDQKE--KGRIQHVILDMSNVINVDTSGILALEEIHNKLFSYGIELAMANPRWQVI  624

Query  413   HKLRLADFHNKIKG-KVFLTIGEAIDACLVDK  321
             H+L++A   ++I G +VFLT+GEA+DACL  K
Sbjct  625   HRLKVAKLLDRIGGERVFLTVGEAVDACLNPK  656



>ref|XP_002513876.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF48459.1| sulfate transporter, putative [Ricinus communis]
Length=658

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/637 (65%), Positives = 515/637 (81%), Gaps = 17/637 (3%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA-----VLSASESVFPL  2049
             ERA+WV+N P+PPGL  +L  S K         F   +K P QA      +S  +S+FP+
Sbjct  29    ERANWVMNSPDPPGLLSELVASVK------AIVFPHGKKTPKQAGATKPAISFLQSLFPI  82

Query  2048  LSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGS  1869
             LSWG+ Y + K KSD++AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIY+VMGS
Sbjct  83    LSWGRGYRVSKFKSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVVPPLIYSVMGS  142

Query  1868  SREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLV  1689
             SREIAIGPVAV+S+L+SSM+  ++DP ++PA Y  LV TVTFFAG FQA FG+ RLGFLV
Sbjct  143   SREIAIGPVAVVSMLLSSMIQDIQDPVADPAAYRKLVFTVTFFAGTFQAIFGLFRLGFLV  202

Query  1688  DFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNl  1509
             DFLSHAAIVGFMAGAAIVIGLQQLK L GIS+FT KTDVVSVL  +FTS+ H PW+P N 
Sbjct  203   DFLSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTTKTDVVSVLHSVFTSIDH-PWSPLNF  261

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             ++G SFL F+L  RF+G++++K FWLPA+APL+SVILSTL+V+L +A+ HGV IVKH+K 
Sbjct  262   VLGCSFLIFLLFARFIGRRNKKFFWLPAIAPLISVILSTLIVFLAKADKHGVNIVKHIKE  321

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNPSS+H L FN PH+ Q  KIG I A++ALTEAIAVG SFAS+KGYHLDGNKEM+A+G
Sbjct  322   GLNPSSVHDLQFNGPHVGQTAKIGLISAIIALTEAIAVGRSFASIKGYHLDGNKEMVAMG  381

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TVL+SL+L T+LLY+TP+AI
Sbjct  382   FMNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVLLSLELFTRLLYYTPIAI  441

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLIN++E   IWKVDKLDF+AC GAF GVLFASVEIGLLVAV +SF KI+
Sbjct  442   LASIILSALPGLINIHEICHIWKVDKLDFIACIGAFFGVLFASVEIGLLVAVTISFLKIL  501

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             LNSI+PGIE+LGR+P TD  +  I+QYPMA++T G+  +R  S+LLCFANANFI+ RI+S
Sbjct  502   LNSIRPGIEELGRIPRTDT-YSDINQYPMAIKTSGILTVRINSALLCFANANFIRERIMS  560

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
              V E+    D+T++++  RI  ++ D+S + N+DT+ II+L+EL+ K+ +   + V+ANP
Sbjct  561   WVTEKD---DKTEDNTNGRIQAVILDLSTVTNIDTAGIIALEELHKKLLTHETELVLANP  617

Query  428   RWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             RWQV+HKLR+A F ++I + K+FLT+GEA+DA +  K
Sbjct  618   RWQVMHKLRVAKFLDRIGREKIFLTVGEAVDATVTTK  654



>ref|XP_011008597.1| PREDICTED: sulfate transporter 2.1 [Populus euphratica]
Length=652

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/631 (65%), Positives = 512/631 (81%), Gaps = 9/631 (1%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV--QAVLSASESVFPLLS  2043
             A +A WVLN PEPP L ++L GS ++T       F  ++ +    + V+S   ++FP+  
Sbjct  22    AGKAQWVLNAPEPPSLWQELTGSVRETVLPHARRFSTVKDKGSLSKTVISFLHTIFPIFC  81

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             W + Y     K+D+LAGLTLASLCIPQSIGYA LA LDPQYGLYTSV+PPLIYAVMG+SR
Sbjct  82    WCRNYKATNFKNDLLAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVIPPLIYAVMGTSR  141

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             +IAIGPVAV+SLL+SSM+ KLEDP +NP  Y +LVLT TFFAGIFQAAFG+ RLGFLVDF
Sbjct  142   DIAIGPVAVVSLLLSSMILKLEDPEANPIPYRNLVLTTTFFAGIFQAAFGLFRLGFLVDF  201

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGF++GAAIVIGLQQ+K L GI++FT KTDV+SV+  I+ ++HHS WNP+N I+
Sbjct  202   LSHAAIVGFVSGAAIVIGLQQMKGLLGIAHFTTKTDVISVMEAIWRAVHHS-WNPHNFIL  260

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL+FILITRF+G+++RKLFWLPA+APL+SV+LSTLLVYLTRA+ HGV I+KH+K GL
Sbjct  261   GCSFLTFILITRFVGRRNRKLFWLPAIAPLISVVLSTLLVYLTRADKHGVMIIKHIKRGL  320

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NP+S+HQL FN PHI +V KIG IVAVVALTEAIAVG SFAS+KGYH++GN+EM+A+G  
Sbjct  321   NPNSVHQLQFNNPHIGEVAKIGLIVAVVALTEAIAVGRSFASIKGYHINGNQEMVAMGFM  380

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NI GS TSCYVATGSFSRSAVNF AGCE+A+SN+VMA+TV+ISL+L T+LLY+TP+AILA
Sbjct  381   NILGSFTSCYVATGSFSRSAVNFSAGCETAMSNIVMAITVIISLELFTRLLYYTPIAILA  440

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             +IILSALPGL++L+E Y+IWK+DKLDFLACAGAF GVLFASVEIGLL AV +SF KI++ 
Sbjct  441   AIILSALPGLVDLHEVYNIWKIDKLDFLACAGAFIGVLFASVEIGLLAAVTISFVKIIII  500

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             SI+PG E LGRLP TD +F  + QYPMA + P V + R KS LLCFANANF+  +I+ L 
Sbjct  501   SIRPGAEVLGRLPETD-IFCDVDQYPMAAKNPQVLITRVKSGLLCFANANFVNEKIMKLA  559

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              EE++ +       ++ I +++ DMSN+ N+D S I SL EL+  + S G++  I NP+W
Sbjct  560   TEEEEGS-----KGKRTIQVVILDMSNLTNIDVSGIASLVELHKNLASSGMELAITNPKW  614

Query  422   QVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             QVIHKLR+A+F  KI G+VFLTIGEA+D CL
Sbjct  615   QVIHKLRVANFVTKIGGRVFLTIGEAVDECL  645



>ref|XP_007141139.1| hypothetical protein PHAVU_008G170700g [Phaseolus vulgaris]
 gb|ESW13133.1| hypothetical protein PHAVU_008G170700g [Phaseolus vulgaris]
Length=654

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/639 (65%), Positives = 513/639 (80%), Gaps = 12/639 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGT--AFQRLRKRPVQAVLSASESVFPLLSW  2040
             ER+ WVL+ P PP L +K+  S K+T    G    F   RK      +S  +++FP++SW
Sbjct  16    ERSQWVLDSPNPPPLWKKIFTSVKETILPRGNKFCFSSKRKTSRGHAVSCLQNLFPIISW  75

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
              + Y   K K D+LAGLTLASL IPQSIGYA LA + P+YGLYTSV+PPLIYA+MGSSRE
Sbjct  76    LRDYKASKFKDDLLAGLTLASLSIPQSIGYATLAKVAPEYGLYTSVIPPLIYALMGSSRE  135

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L+SS+VPK+EDP +NP  Y +LV TVTFF GIFQ AFG+ RLGFLVDFL
Sbjct  136   IAIGPVAVVSMLLSSLVPKVEDPVANPHAYRNLVFTVTFFTGIFQTAFGVFRLGFLVDFL  195

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPY  1515
             SHAA+VGFMAGAA++IGLQQLK L GIS+FT+KTD VSVL  ++ SLHH       WNP 
Sbjct  196   SHAALVGFMAGAAVIIGLQQLKGLLGISHFTSKTDAVSVLASVYKSLHHQIASGEKWNPL  255

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N + G SFL FILITRF+G+++RK FWLPA++PLLSVILSTL+VYL+RA+ HGV I+KHV
Sbjct  256   NFVFGCSFLIFILITRFIGRRNRKFFWLPALSPLLSVILSTLIVYLSRADKHGVNIIKHV  315

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGG+NPSSLHQL  + PH+ Q  KIG I AV+ALTEAIAVG SFAS+KGYHLDGNKEML+
Sbjct  316   KGGMNPSSLHQLQLHGPHVGQAAKIGLICAVIALTEAIAVGRSFASIKGYHLDGNKEMLS  375

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G  NIAGSLTSCYVATGSFSR+AVNF AGC++AVSN+VMAVTV ++L+L T+LLY+TPV
Sbjct  376   MGFMNIAGSLTSCYVATGSFSRTAVNFSAGCQTAVSNIVMAVTVFLALELFTRLLYYTPV  435

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILASIILSALPGLI+L+EA  IWKVDKLDFLAC GAF GVLFA+VEIGLLVAV +SFAK
Sbjct  436   AILASIILSALPGLIDLSEACYIWKVDKLDFLACLGAFLGVLFATVEIGLLVAVIISFAK  495

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARI  615
             I++ S++PGIE LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF++ RI
Sbjct  496   ILIQSVRPGIEVLGRVPRTEA-FCDVTQYPMAISTPGITVIRISSGSLCFANANFVRERI  554

Query  614   LSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIA  435
             L  V +++   D+ KE+S+ R+  ++ DM+N+MNVDTS I++L+EL+ ++ S GV+  + 
Sbjct  555   LKWVSQDE---DDLKETSKGRVQAVILDMTNLMNVDTSGILALEELHKRLLSRGVELAMV  611

Query  434   NPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             NPRW VIHKL+LA F +KI K  VFLT+GEA++ACL  K
Sbjct  612   NPRWLVIHKLKLAHFVDKIGKEWVFLTVGEAVEACLSAK  650



>ref|XP_009378551.1| PREDICTED: sulfate transporter 2.1-like [Pyrus x bretschneideri]
Length=710

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/644 (65%), Positives = 514/644 (80%), Gaps = 13/644 (2%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLS  2073
             L+K SS +    ER  WVLN PEPPGL  +L  S +KT +     +  L+ +P +++ +S
Sbjct  70    LEKNSSLV----ERTQWVLNGPEPPGLWHELMDSVRKTVSCCRRKYSSLKNQPTLKSAVS  125

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               + +FP+L WG+ Y++ K K D +AGLT+ASLCIPQSIGYA LA LDPQYGLYTSVVPP
Sbjct  126   VQQEIFPILVWGRSYNMSKFKHDFMAGLTIASLCIPQSIGYATLAQLDPQYGLYTSVVPP  185

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYAVMG+SREIAIGPVAV+SLL+ SM+ KL+DP ++P  YT LVLT TFF GIFQAAFG
Sbjct  186   LIYAVMGTSREIAIGPVAVVSLLLPSMIQKLQDPRADPIAYTKLVLTATFFTGIFQAAFG  245

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             + RLGFLVDFLSHAAIVGF+AGAAI+IGLQQLK L GI++F   TDV+SV+  ++TS HH
Sbjct  246   LFRLGFLVDFLSHAAIVGFVAGAAIIIGLQQLKGLLGITHFPTNTDVISVIEAVWTSFHH  305

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
              PW+P+N  +G SFL FIL++RFLG+K +KLFWLPA+APLLSVILSTL+VYLTR + HG+
Sbjct  306   -PWSPHNFFLGCSFLCFILMSRFLGKKTKKLFWLPAVAPLLSVILSTLIVYLTRGDKHGI  364

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
              IVKHVK GLNPSS++ L FN+P++  V K+G IVA+VAL EAIAVG SF++MKGYH+DG
Sbjct  365   NIVKHVKDGLNPSSVNLLQFNSPYVGDVAKVGLIVALVALAEAIAVGRSFSTMKGYHIDG  424

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+A+G  NI GS TSCYVATGSFSR+AVNF AGCE+ VSNVVMA+TV+ISLQLLTKL
Sbjct  425   NKEMMAMGFMNIVGSCTSCYVATGSFSRTAVNFSAGCETPVSNVVMAITVIISLQLLTKL  484

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP AILASIILSAL GLINL+E Y IWKVDKLDFLAC GAF GVLFAS+EIGLLVAV
Sbjct  485   LYYTPTAILASIILSALSGLINLSEVYKIWKVDKLDFLACIGAFFGVLFASMEIGLLVAV  544

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SF KI+L SI PG E LG+LP TD +F    QYPMAV+ PG+ +IR KS+L CFANAN
Sbjct  545   IISFTKIILISIGPGTETLGKLPRTD-IFCDTAQYPMAVKIPGIMIIRVKSALFCFANAN  603

Query  632   FIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCG  453
             F+K RI+  +    K  ++TKE+    I L++ DMSN++N+DTS I SL+EL   + S G
Sbjct  604   FVKERIVRWI--TAKKGEDTKEA----IQLVILDMSNLINIDTSGIASLEELQKNLISEG  657

Query  452   VQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
             ++  +ANPRW VIHKL+L++F  KI G+VF+T+GEA+DA   +K
Sbjct  658   IELAVANPRWLVIHKLKLSNFVEKIGGRVFVTVGEAVDARFSEK  701



>ref|XP_006399511.1| hypothetical protein EUTSA_v10012871mg [Eutrema salsugineum]
 gb|ESQ40964.1| hypothetical protein EUTSA_v10012871mg [Eutrema salsugineum]
Length=678

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/642 (64%), Positives = 512/642 (80%), Gaps = 8/642 (1%)
 Frame = -1

Query  2237  SSTLPPAA-----ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVL  2076
             SS   PA      +R+ W+L+ PEPP    +L+   K++       F+ LRK+P+ + +L
Sbjct  35    SSAAAPAGHHDQLDRSKWLLDCPEPPSTWHELKSQVKESFHTKAKKFKSLRKQPLPKRIL  94

Query  2075  SASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVP  1896
             S  ++VFP+ SW + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLY+SVVP
Sbjct  95    STLQAVFPIFSWCRNYKLAMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYSSVVP  154

Query  1895  PLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaaf  1716
             PLIYA+MG+SREIAIGPVAV+SLLISSM+ KL DP ++P GY  LVLT TFFAGIFQA+F
Sbjct  155   PLIYALMGTSREIAIGPVAVVSLLISSMLQKLIDPETDPLGYKKLVLTTTFFAGIFQASF  214

Query  1715  gILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLH  1536
             GI RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S  
Sbjct  215   GIFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQ  274

Query  1535  HSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHG  1356
                W+P+  I+G SFLSFILITRF+G+K++KLFWLPA+APL++V++STL+V+LT+A+ HG
Sbjct  275   QQ-WSPHTFILGCSFLSFILITRFIGKKNKKLFWLPAIAPLIAVVVSTLMVFLTKADEHG  333

Query  1355  VKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLD  1176
             VK VKH+KGGLNP S+H L FNTPH+ Q+ KI  IVAVVALTEAIAVG SFA +KGY LD
Sbjct  334   VKTVKHIKGGLNPISIHDLEFNTPHLGQIAKIALIVAVVALTEAIAVGRSFAGIKGYRLD  393

Query  1175  GNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTK  996
             GNKEM+AIG  N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV ++L+ LT+
Sbjct  394   GNKEMVAIGFMNVIGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFVALECLTR  453

Query  995   LLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVA  816
             LLY+TP+AILASIILSALPGLI++NEA  IWK+DK DFLA  GAF GVLFASVEIGLLVA
Sbjct  454   LLYYTPIAILASIILSALPGLIDINEAIHIWKIDKFDFLALIGAFFGVLFASVEIGLLVA  513

Query  815   VGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANA  636
             V +SFAKI+L SI+PGIE LGR+PGTD +F    QYPM+V+TPGV + R KS+LLCFANA
Sbjct  514   VVISFAKIILISIRPGIETLGRMPGTD-VFADTDQYPMSVKTPGVLIFRVKSALLCFANA  572

Query  635   NFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSC  456
             +FI+ RI+  V EE++       ++++ +  +V DMSN++NVDTS I +L EL++ +   
Sbjct  573   SFIEERIMGWVNEEEEDEYTKSNTTKRNVLFVVLDMSNLINVDTSGITALVELHNNLIQN  632

Query  455   GVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             GV+ VI NP+WQVIHKL  A F +KI GKV+LTIGEA+DAC 
Sbjct  633   GVELVIVNPKWQVIHKLNQAKFVDKIGGKVYLTIGEALDACF  674



>ref|XP_006428147.1| hypothetical protein CICLE_v10025101mg [Citrus clementina]
 ref|XP_006464259.1| PREDICTED: sulfate transporter 2.1-like [Citrus sinensis]
 gb|ESR41387.1| hypothetical protein CICLE_v10025101mg [Citrus clementina]
Length=657

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/633 (65%), Positives = 511/633 (81%), Gaps = 8/633 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ERA WVLN P+PPG  ++L  S ++T       F+         V +    +FP+L W +
Sbjct  26    ERAQWVLNAPKPPGFWQELVNSVRETFFPHRRKFKN-EHDGFNLVFTFLHGLFPILHWCR  84

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K ++D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYAVMG+SREIA
Sbjct  85    NYKASKFRNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAVMGTSREIA  144

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSM+ K++DP +NP  Y + VLT TFFAGIFQA+FG+ RLGFL+D LSH
Sbjct  145   IGPVAVVSLLLSSMIQKVQDPLANPIAYRNFVLTATFFAGIFQASFGLFRLGFLIDILSH  204

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AA+VGFMAGAAIVIGLQQLK L GI +FTNKTD +SV+  ++ SLHH+ W+P N I+G S
Sbjct  205   AAVVGFMAGAAIVIGLQQLKGLIGIPHFTNKTDAISVVKAVWNSLHHT-WSPQNFILGCS  263

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL FIL TR+LG+K RKLFWLPA+APL+SVILSTL V+LTRA+ HGVKIVKH+  GLNPS
Sbjct  264   FLCFILTTRYLGRKKRKLFWLPAIAPLVSVILSTLFVFLTRADKHGVKIVKHIDRGLNPS  323

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S+HQ+ F+  H+ +V KIGF+ A+VAL EAIAVG SFAS+KGY LDGNKEM+A+G  NI 
Sbjct  324   SVHQIQFHGQHVGEVAKIGFVAAIVALAEAIAVGRSFASIKGYRLDGNKEMVAMGFMNIV  383

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GS TSCYVATGSFSRSAVNF AGCES VSN+VMA+TVLISL+  T+LLY+TP+AILASII
Sbjct  384   GSFTSCYVATGSFSRSAVNFRAGCESTVSNIVMAITVLISLEFFTRLLYYTPMAILASII  443

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             +SALPGLI+ NE Y+IWKVDKLDFLAC GAF GVLFASVEIGLLVAV +SFAKI+L SIQ
Sbjct  444   MSALPGLIDFNEFYNIWKVDKLDFLACIGAFFGVLFASVEIGLLVAVTISFAKIILISIQ  503

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             PG EKLG+LPGTD LF  + QYPMAV+TPG+ +IR KS+LLCFANAN ++ RI+  + EE
Sbjct  504   PGTEKLGKLPGTD-LFCDVGQYPMAVKTPGILIIRVKSALLCFANANSVRERIMRWITEE  562

Query  593   QKSADETKESSEKRIA-----LIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
             ++  +E ++ S +R A     L++ D+SN+MN+DTS + SL+EL   + S G++  IANP
Sbjct  563   EEEEEEEEKESSQRKARKNTQLVLLDLSNMMNIDTSGLASLEELRKTLDSNGIELAIANP  622

Query  428   RWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             RWQVIHKL++A+F +KI+G++FLT+GEA+ +CL
Sbjct  623   RWQVIHKLKMANFVDKIRGRIFLTVGEAMASCL  655



>ref|XP_010090564.1| Sulfate transporter 2.1 [Morus notabilis]
 gb|EXB39770.1| Sulfate transporter 2.1 [Morus notabilis]
Length=677

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/636 (63%), Positives = 500/636 (79%), Gaps = 32/636 (5%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP--VQAVLSASESVFPLLSW  2040
             ER+ WVLN P+PPGL ++L  S ++T     + +    K     + V+S  + +FP+LSW
Sbjct  69    ERSRWVLNAPKPPGLCQELMDSVRETIASCKSKYHSSLKNHSFAKRVISIQQGIFPILSW  128

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
             G+ Y   K KSD++AGLT+ASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYAVMG+SR+
Sbjct  129   GRDYKATKFKSDLMAGLTIASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAVMGTSRD  188

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+SLLI SMV KL DP ++P  Y +LVLT TFF G+FQA+FG  RLGFLVDFL
Sbjct  189   IAIGPVAVVSLLIPSMVQKLVDPGADPIAYRNLVLTTTFFTGLFQASFGFFRLGFLVDFL  248

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliig  1500
             SHAAIVGFMAGAAI+IGLQQLK L GIS+FTNKTD++SV+  ++ S+HH P         
Sbjct  249   SHAAIVGFMAGAAIIIGLQQLKGLLGISHFTNKTDIISVIKAVWNSVHHYP---------  299

Query  1499  fsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLN  1320
                          G++++KLFWL A++PL+SVI+STL+V+LTR + HGVKIVKHVKGGLN
Sbjct  300   -------------GKRNKKLFWLAAISPLISVIISTLIVFLTRGDKHGVKIVKHVKGGLN  346

Query  1319  PSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVAN  1140
             PSSLH+L F +P + +V KIG IV VVALTEAIAVG SFASMKGYHLDGNKEM+A+G  N
Sbjct  347   PSSLHELQFKSPFVGEVAKIGLIVGVVALTEAIAVGRSFASMKGYHLDGNKEMVAMGFMN  406

Query  1139  IAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILAS  960
             I GS TSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TVL+SL+L TKLLY+TP AI+AS
Sbjct  407   IVGSFTSCYVATGSFSRTAVNFSAGCETLVSNIVMAITVLVSLELFTKLLYYTPTAIIAS  466

Query  959   IILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNS  780
             IILSALPGLINLN A  IWK+DKLDFLAC GAF GVLFASVEIGL  AV +SFAK++L S
Sbjct  467   IILSALPGLINLNAANHIWKLDKLDFLACIGAFFGVLFASVEIGLTAAVTISFAKVILIS  526

Query  779   IQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVM  600
             I+PG E LG+LPGTD LF  I QYPMAVQ PG+ ++R KS+LLCFANANFI+ RI S + 
Sbjct  527   IRPGTETLGKLPGTD-LFCDIQQYPMAVQLPGIMIMRLKSALLCFANANFIRERITSWIS  585

Query  599   EEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
             E+ +       ++++ I +++ DMS++MN+DTS I SL+EL   +TS G++  IANPRWQ
Sbjct  586   EDNEG------NAKRTILVLILDMSSLMNIDTSGIASLQELRKTLTSQGIELAIANPRWQ  639

Query  419   VIHKLRLADFHNKIKGKVFLTIGEAIDACLVD-KNM  315
             VIHKL+LA+F ++I+G+VFLT+GEA++A  +  KN+
Sbjct  640   VIHKLKLANFVSEIEGRVFLTVGEAVNATTISAKNI  675



>ref|XP_003531363.1| PREDICTED: sulfate transporter 2.1-like isoformX1 [Glycine max]
Length=652

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/652 (64%), Positives = 511/652 (78%), Gaps = 10/652 (2%)
 Frame = -1

Query  2264  EFSQTLQKTSSTLP----PAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRK  2097
             EFSQTLQ ++  LP      AER+ WVLN P PP     L  S + T +        +R 
Sbjct  5     EFSQTLQ-SNMALPANETSMAERSQWVLNAPAPPSTWHNLMASVRNTISSYQKMCSYIRG  63

Query  2096  RP-VQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQY  1920
             +P  + VLS   S+FP+L WG+ YS  K ++D+LAGLT+ASLCIPQSIGYA LA LDP+Y
Sbjct  64    QPGPKVVLSFLRSIFPILHWGRNYSPTKFRNDLLAGLTIASLCIPQSIGYATLAKLDPEY  123

Query  1919  GLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTff  1740
             GLYTSVVPPLIYA+MG+SREIAIGPVAV+SLL+SSM+ KL DPA +P GY  LV T TFF
Sbjct  124   GLYTSVVPPLIYALMGTSREIAIGPVAVVSLLLSSMIQKLIDPAIDPNGYRKLVFTTTFF  183

Query  1739  agifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVL  1560
             AGIFQAAFG+ RLGFLVDFLSHAAIVGFM GAAI+IGLQQLK LFGI++FTNKTD++SV+
Sbjct  184   AGIFQAAFGLFRLGFLVDFLSHAAIVGFMGGAAIIIGLQQLKGLFGINHFTNKTDIISVM  243

Query  1559  THIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVY  1380
               ++ S+ H PWNP N ++G SF  FIL TRFLG++++KLFWLPA++PL+SV+LSTL+V+
Sbjct  244   KSVWESVDH-PWNPRNFVLGCSFFIFILFTRFLGKRNKKLFWLPAISPLVSVMLSTLIVF  302

Query  1379  LTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFA  1200
             LTRA+  GV IV+H+KGGLNPSS++Q+  N+PHI  + KIG +VA VALTE++AVG SFA
Sbjct  303   LTRADKSGVNIVRHIKGGLNPSSINQIDLNSPHIGALAKIGLVVAAVALTESVAVGRSFA  362

Query  1199  SMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVL  1020
             SMKGYHLDGNKEM+++G  NI G  TSCYVATGSFSR+ VNF AGCE+  SN+VMA+ VL
Sbjct  363   SMKGYHLDGNKEMVSLGFMNIIGCFTSCYVATGSFSRTVVNFTAGCETLASNIVMAIVVL  422

Query  1019  ISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFAS  840
             ISLQ LTKLLYFTP AILASIILSALPGLI++NEAY IWKVDKLDFLAC GAF GVLFAS
Sbjct  423   ISLQCLTKLLYFTPTAILASIILSALPGLIDINEAYKIWKVDKLDFLACVGAFFGVLFAS  482

Query  839   VEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKS  660
             VE+GLLVAVG+SF KI+  SI  G E LGRLPGTD +F    QYPMAV+ PGV +IR KS
Sbjct  483   VELGLLVAVGISFTKIIWISIGAGTETLGRLPGTD-VFCDAQQYPMAVKIPGVAIIRVKS  541

Query  659   SLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKE  480
             SLLCF+NAN ++ RIL  +  E+   +  ++++   I L++ D SN++++DTS I SL+E
Sbjct  542   SLLCFSNANSVRERILKWISREEAKGN-IEDNTGSIIQLVILDTSNLVSIDTSGIASLEE  600

Query  479   LYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVD  324
             L+  + S G    IANPRWQVI+KL+  +F  +I G+VFLTIGEAID C +D
Sbjct  601   LHKSLVSSGKHLAIANPRWQVIYKLKATNFVTRIGGRVFLTIGEAID-CKLD  651



>ref|XP_007018861.1| STAS domain / Sulfate transporter family isoform 1 [Theobroma 
cacao]
 gb|EOY16086.1| STAS domain / Sulfate transporter family isoform 1 [Theobroma 
cacao]
Length=660

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/661 (62%), Positives = 517/661 (78%), Gaps = 21/661 (3%)
 Frame = -1

Query  2273  LPYE-FSQTLQKTSSTLPPAA--ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRL  2103
             LP E FS   Q+    L  A   ER  W++N P+PP   ++L  + +      G+ F   
Sbjct  4     LPDETFSVEEQQQQLDLEDAGRTERKKWLINSPDPPSFWQELVSAIR------GSVFPHG  57

Query  2102  RKRPVQA------VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAAL  1941
             RK    A       +S  + +FP+LSWG+ Y   K K D++AGLTLASL IPQSIGYA L
Sbjct  58    RKHSSSAGGRRATAMSFLQGLFPILSWGRTYKASKFKHDLMAGLTLASLSIPQSIGYANL  117

Query  1940  ANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSL  1761
             A +DPQYGLYTSVVPPLIYA+MGSSREIAIGPVAV+S+L+SSM+P L DPA++P GY  L
Sbjct  118   AKVDPQYGLYTSVVPPLIYALMGSSREIAIGPVAVVSMLLSSMIPNLVDPAADPNGYRRL  177

Query  1760  VLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNK  1581
             V TVTFFAG FQ  FG+ RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLK LFG+S+FT K
Sbjct  178   VFTVTFFAGTFQTIFGLFRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKGLFGMSHFTTK  237

Query  1580  TDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVI  1401
             TDV+SVL  +F S+ H  W P N ++G  FL F+L+ RF+G++++KLFW PA+APL+SVI
Sbjct  238   TDVISVLHSVFKSVQHE-WYPLNFVLGCLFLVFLLVARFIGRRNKKLFWFPAIAPLISVI  296

Query  1400  LSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAI  1221
             LSTL+VYLT+A+ HGVKIVKH+KGGLNPSSLHQL F  PH+ +  KIG I A+VALTEAI
Sbjct  297   LSTLIVYLTKADKHGVKIVKHIKGGLNPSSLHQLQFEGPHVAEAAKIGLITAIVALTEAI  356

Query  1220  AVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNV  1041
             AVG SFAS+KGYHLDGNKEM+A+G  N+AGSLTSCYVATGSFSR+AVNF AGC++ VSN+
Sbjct  357   AVGRSFASIKGYHLDGNKEMMAMGFMNLAGSLTSCYVATGSFSRTAVNFSAGCQTVVSNI  416

Query  1040  VMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAF  861
             VMA+TVL+SL+L T+LLY+TP+AILASIILSALPGLI+ NEA  IWKVDKLDFLAC GAF
Sbjct  417   VMAITVLLSLELFTRLLYYTPIAILASIILSALPGLIDFNEACYIWKVDKLDFLACIGAF  476

Query  860   AGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGV  681
              GVLFASVEIGLL AV +SFAKI+LNSI+P IE+LGRLP TD +F  I QYPMA++TPG+
Sbjct  477   FGVLFASVEIGLLAAVTISFAKILLNSIRPAIEQLGRLPRTD-IFCEIDQYPMAIKTPGI  535

Query  680   FVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTS  501
               +R  S+LLCFANANF++ RI+  V    +  +ET+E+++ R+ +++ DMSN+MN+DTS
Sbjct  536   LTLRVNSALLCFANANFLRERIIRCVT---EEENETEETAKGRVQILILDMSNVMNIDTS  592

Query  500   AIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACLVD  324
              I++L+EL++++ S G++  + N RWQ IHKL+LA F  KI  + +FLT+ EA++ CL  
Sbjct  593   GIVALEELHNELVSSGIRLAMVNLRWQAIHKLKLAKFMEKIGAEWIFLTVSEAVEECLAS  652

Query  323   K  321
             K
Sbjct  653   K  653



>ref|XP_003544185.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Glycine max]
Length=654

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/643 (65%), Positives = 521/643 (81%), Gaps = 12/643 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGT--AFQRLRKRPVQAVLSASESVFPLLSW  2040
             ER+ WVL+ P PP L +KL  S K+T    G    F   RK      LS  +++FP++SW
Sbjct  16    ERSQWVLDSPNPPPLWKKLFSSVKETILPHGNKFCFSSKRKTINGHALSCLQNLFPIISW  75

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
              + Y + K K D+LAGLTLASLCIPQSIGYA LA + P+YGLYTSVVPPLIYA+MGSSRE
Sbjct  76    LRDYKVSKFKDDLLAGLTLASLCIPQSIGYATLAKVAPEYGLYTSVVPPLIYAMMGSSRE  135

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L++S+VPK+EDP +NP  Y +LV TVTFF GIFQ AFG+ RLGFLVDFL
Sbjct  136   IAIGPVAVVSMLLASLVPKVEDPVTNPNAYRNLVFTVTFFTGIFQTAFGVFRLGFLVDFL  195

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS-----PWNPY  1515
             SHAA+VGFMAGAAI+IGLQQLK L G+S+FT+KTDVVSVL  ++ SLH+       WNP 
Sbjct  196   SHAALVGFMAGAAIIIGLQQLKGLLGLSHFTSKTDVVSVLASVYKSLHNQIAPGQKWNPL  255

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N ++G SFL FILITRF+G+++RKLFWLPA++PLLSVILSTL+VYL+RA+ HGV I+KHV
Sbjct  256   NFVLGCSFLIFILITRFIGRRNRKLFWLPAISPLLSVILSTLIVYLSRADKHGVNIIKHV  315

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGGLNPSSLHQL  + PH+ Q  KIG I +V+ALTEAIAVG SFAS+KGYHLDGNKEML+
Sbjct  316   KGGLNPSSLHQLQLHGPHVGQAAKIGLICSVIALTEAIAVGRSFASIKGYHLDGNKEMLS  375

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G+ NIAGSLTSCYVATGSFSR+AVNF AGC++AVSN+VMAVTV +SL+L T+LLY+TPV
Sbjct  376   MGIMNIAGSLTSCYVATGSFSRTAVNFSAGCQTAVSNIVMAVTVFLSLELFTRLLYYTPV  435

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILASI+LSALPGLI+L+EA  IWKVDKLDFLAC GAF GVLFA+VEIGLLVAV +SFAK
Sbjct  436   AILASIVLSALPGLIDLSEACYIWKVDKLDFLACIGAFLGVLFATVEIGLLVAVIISFAK  495

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARI  615
             I++ SI+PGIE LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF++ RI
Sbjct  496   ILIQSIRPGIEVLGRVPRTEA-FCDVTQYPMAISTPGIIVIRISSGSLCFANANFVRERI  554

Query  614   LSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIA  435
             L  V +++   D+ KE+++ R+  ++ DM+N+MNVDTS I++L+EL+ ++ S GV+  + 
Sbjct  555   LKWVSQDE---DDLKETTKGRVQAVILDMTNLMNVDTSGILALEELHKRLLSRGVELAMV  611

Query  434   NPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDKNMQA  309
             NPRW VIHKL+LA F +KI K  VFLT+GEA+DACL  K  +A
Sbjct  612   NPRWLVIHKLKLAHFVDKIGKEWVFLTVGEAVDACLATKIARA  654



>ref|XP_010061828.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Eucalyptus grandis]
Length=670

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/676 (62%), Positives = 519/676 (77%), Gaps = 22/676 (3%)
 Frame = -1

Query  2321  MAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFK  2142
             MA  P T   + +E ELP + S  +     T  P AERA WVL+ P+PP L   L  S +
Sbjct  1     MASLPDTD-SLKSEAELPPQTSFEI-----TSHPQAERAEWVLHSPDPPSLWHDLLVSVR  54

Query  2141  KTATFLGTAFQRLRKRPV---QAVLSASESVF----PLLSWGKQYSLVKLKSDVLAGLTL  1983
              T   L  +    +K P+   QA+  A+ S+F    P+L WG+ Y L K KSD++AGLTL
Sbjct  55    GT-LLLNNSNDDKKKSPLTDKQALCRAAASLFQGLFPILRWGRTYRLSKFKSDLMAGLTL  113

Query  1982  ASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPK  1803
             ASLCIPQSIGYA LA LDPQYGLYTSVVPPL+YA+MGSSREIAIGPVAV+SLL+SSM+ K
Sbjct  114   ASLCIPQSIGYANLAKLDPQYGLYTSVVPPLVYALMGSSREIAIGPVAVVSLLLSSMIQK  173

Query  1802  LEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQ  1623
             ++DP+++P  Y  LV T T FAG FQA FG+ RLGFLVDFLSHAAIVGFMAGAAI+IGLQ
Sbjct  174   IQDPSTDPGAYRRLVFTATLFAGTFQAIFGLFRLGFLVDFLSHAAIVGFMAGAAIIIGLQ  233

Query  1622  QLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRK  1443
             QLK L GIS+FT KTDVVSVL   F S+ H  W P N ++G SFL F+L  RF+G+K++K
Sbjct  234   QLKGLLGISHFTTKTDVVSVLESAFRSIRHQ-WYPLNFVLGCSFLIFLLFARFIGRKNKK  292

Query  1442  LFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVK  1263
             LFWLPA+APL+SV+LSTL+V+LT A+ HGVK+VKH+KGGLNP S HQL    PH+ Q  K
Sbjct  293   LFWLPAIAPLVSVVLSTLIVFLTSADKHGVKVVKHIKGGLNPISAHQLQLAGPHVGQSAK  352

Query  1262  IGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSA  1083
             IG I AVVALTEAIAVG SFAS+KGY +DGNKEM+A+G  N+AGSLTSCYVATGSFSR+A
Sbjct  353   IGLICAVVALTEAIAVGRSFASIKGYQIDGNKEMVAMGFMNVAGSLTSCYVATGSFSRTA  412

Query  1082  VNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIW  903
             VNF AGC++ VSN+VMAVTVLISL L TKLLY+TP+AILASIILSALPGLI++NEA  IW
Sbjct  413   VNFSAGCQTVVSNIVMAVTVLISLLLFTKLLYYTPIAILASIILSALPGLIDVNEALRIW  472

Query  902   KVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFM  723
             +VDKLDFLAC G F GVLF SVEIGLL AV +SF  I+L SI+PG E LGRLPGTD +F 
Sbjct  473   RVDKLDFLACIGTFLGVLFGSVEIGLLAAVAISFGNIILLSIRPGTELLGRLPGTD-VFC  531

Query  722   GIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIAL  543
              I QYPMA++TPGV +IR  S L+CFANANFI+ RI+  V EE    D+ K +  ++I +
Sbjct  532   DIRQYPMAIETPGVLLIRINSGLMCFANANFIRERIMRSVTEE----DDAKRTERRKIQV  587

Query  542   IVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKV  366
             +V DMSN+MN+DTS I +L+EL+  + S G++  +AN RWQVIHKL++A+F ++I K +V
Sbjct  588   VVLDMSNVMNIDTSGIAALEELHKMLVSVGLEVAMANIRWQVIHKLKVANFLDRIGKERV  647

Query  365   FLTIGEAID-ACLVDK  321
             FL++ EA++ +CL  K
Sbjct  648   FLSVREAVEYSCLYSK  663



>gb|ACK44507.1| AT5G10180-like protein [Arabidopsis arenosa]
Length=677

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/633 (65%), Positives = 512/633 (81%), Gaps = 12/633 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPG----LSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPL  2049
             +R+ W+L+ PEPP     L R+++GSF   A      F+ L+K+P+ + +LS  +++FP+
Sbjct  48    DRSKWLLDCPEPPSPWHELKRQVKGSFLTKAK----RFKSLQKQPLPKRILSILQAIFPI  103

Query  2048  LSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGS  1869
               W + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+
Sbjct  104   FGWCRNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYALMGT  163

Query  1868  SREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLV  1689
             SREIAIGPVAV+SLLISSM+ KL DP ++P GY  LVLT TFFAGIFQA+FG+ RLGFLV
Sbjct  164   SREIAIGPVAVVSLLISSMLQKLIDPETDPLGYKKLVLTTTFFAGIFQASFGLFRLGFLV  223

Query  1688  DFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNl  1509
             DFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S     W+P+  
Sbjct  224   DFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQQQ-WSPHTF  282

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             I+G SFLSFILITRF+G+K++KLFWLPA+APL++V++STL+V+LT+A+ HGVK VKH+KG
Sbjct  283   ILGCSFLSFILITRFIGKKYKKLFWLPAIAPLIAVVVSTLMVFLTKADEHGVKTVKHIKG  342

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNP S+H L FNTPH+ Q+ KIG I+A+VALTEAIAVG SFA +KGY LDGNKEM+AIG
Sbjct  343   GLNPISIHDLDFNTPHLGQIAKIGLIIAIVALTEAIAVGRSFAGIKGYRLDGNKEMVAIG  402

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV ++L+ LT+LLY+TP+AI
Sbjct  403   FMNVLGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFVALECLTRLLYYTPIAI  462

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLIN+NEA  IWKVDK DFLA  GAF GVLFASVEIGLLVAV +SFAKI+
Sbjct  463   LASIILSALPGLININEAIHIWKVDKFDFLALIGAFFGVLFASVEIGLLVAVVISFAKII  522

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             L SI+PGIE LGR+PGTD  F   +QYPM V+TPGV + R KS+LLCFANA+ I+ RI+ 
Sbjct  523   LISIRPGIETLGRMPGTDT-FADTNQYPMTVKTPGVLIFRVKSALLCFANASSIEERIMG  581

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
              V +E++  + TK + +++I  +V DMSN++NVDTS I +L EL +K+   GV+ VI NP
Sbjct  582   WV-DEEEEEENTKSNGKRKILFVVLDMSNLINVDTSGITALVELNNKLIQTGVELVIVNP  640

Query  428   RWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             +WQVIHKL  A F ++I GKV+LTIGEA+DAC 
Sbjct  641   KWQVIHKLNQAKFVSRIGGKVYLTIGEALDACF  673



>ref|XP_002871408.1| hypothetical protein ARALYDRAFT_908975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47667.1| hypothetical protein ARALYDRAFT_908975 [Arabidopsis lyrata subsp. 
lyrata]
Length=677

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/633 (65%), Positives = 512/633 (81%), Gaps = 12/633 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPG----LSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPL  2049
             +R+ W+L+ PEPP     L R+++GSF   A      F+ L+K+P+ + +LS  +++FP+
Sbjct  48    DRSKWLLDCPEPPSPWHELKRQVKGSFLTKAK----RFKSLQKQPLPKRILSILQAIFPI  103

Query  2048  LSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGS  1869
               W + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+
Sbjct  104   FGWCRNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYALMGT  163

Query  1868  SREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLV  1689
             SREIAIGPVAV+SLLISSM+ KL DP ++P GY  LVLT TFFAGIFQA+FG+ RLGFLV
Sbjct  164   SREIAIGPVAVVSLLISSMLQKLIDPETDPLGYKKLVLTTTFFAGIFQASFGLFRLGFLV  223

Query  1688  DFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNl  1509
             DFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S     W+P   
Sbjct  224   DFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQQQ-WSPRTF  282

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             I+G SFLSFILITRF+G+K++KLFWLPA+APL++V++STL+V+LT+A+ HGVK VKH+KG
Sbjct  283   ILGCSFLSFILITRFIGKKYKKLFWLPAIAPLIAVVVSTLMVFLTKADEHGVKTVKHIKG  342

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNP S+H L FNTPH+ Q+ KIG I+A+VALTEAIAVG SFA +KGY LDGNKEM+AIG
Sbjct  343   GLNPISIHDLDFNTPHLGQIAKIGLIIAIVALTEAIAVGRSFAGIKGYRLDGNKEMVAIG  402

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV ++L+ LT+LLY+TP+AI
Sbjct  403   FMNVLGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFVALECLTRLLYYTPIAI  462

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLIN+NEA  IWKVDK DFLA  GAF GVLFASVEIGLLVAV +SFAKI+
Sbjct  463   LASIILSALPGLININEAIHIWKVDKFDFLALIGAFFGVLFASVEIGLLVAVVISFAKII  522

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             L SI+PG+E LGR+PGTD  F   +QYPM V+TPGV + R KS+LLCFANA+ I+ RI+ 
Sbjct  523   LISIRPGVETLGRMPGTDT-FADSNQYPMTVKTPGVLIFRVKSALLCFANASSIEERIMG  581

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
              V +E++  + TK + +++I  +VFDMSN++NVDTS I +L EL +K+   GV+ VI NP
Sbjct  582   WV-DEEEEEENTKSNGKRKILFVVFDMSNLINVDTSGITALVELNNKLIQIGVELVIVNP  640

Query  428   RWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             +WQVIHKL  A F ++I GKV+LTIGEA+DAC 
Sbjct  641   KWQVIHKLNQAKFVSRIGGKVYLTIGEALDACF  673



>ref|XP_007163633.1| hypothetical protein PHAVU_001G250700g [Phaseolus vulgaris]
 gb|ESW35627.1| hypothetical protein PHAVU_001G250700g [Phaseolus vulgaris]
Length=653

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/624 (65%), Positives = 508/624 (81%), Gaps = 5/624 (1%)
 Frame = -1

Query  2210  RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGK  2034
             R+ WVLN PEPP   R +  S +KT +     F  LR +P    +LS  +  FP+L+WG+
Sbjct  28    RSQWVLNAPEPPSPWRVVADSVRKTISHYKQKFSSLRDQPFTTLLLSLLQLAFPILAWGR  87

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y+  K + D+LAGLT+ASLCIPQSIGYA LA+L PQYGLYTSVVPPL+YAVMG+SREIA
Sbjct  88    NYTATKFRKDLLAGLTIASLCIPQSIGYATLAHLAPQYGLYTSVVPPLVYAVMGTSREIA  147

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSM+ KL DPAS+P GYT L+L  T  AGIFQ +FG+ RLGFLVDFLSH
Sbjct  148   IGPVAVVSLLLSSMMEKLVDPASDPVGYTKLILLATLLAGIFQTSFGLFRLGFLVDFLSH  207

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AAIVGF+AGAAIVIGLQQLK LFGI++FT KTD+VSV+  ++ + H+ PWNP N  IG S
Sbjct  208   AAIVGFVAGAAIVIGLQQLKGLFGITHFTTKTDIVSVMKAVWEAFHN-PWNPRNFFIGCS  266

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL FIL TRF+G+K +K+FWL +++PL+SV+LSTL V+LT+A+ +GVKIVKHVKGGLNP 
Sbjct  267   FLVFILTTRFVGKKKKKVFWLASISPLVSVVLSTLFVFLTKADENGVKIVKHVKGGLNPI  326

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S+HQL F++P+I +V KI  +VAVVALTE+IAVG SFAS+ GY LDGNKEM++IG+ NI 
Sbjct  327   SIHQLDFSSPYIGEVAKIALVVAVVALTESIAVGRSFASINGYQLDGNKEMMSIGLTNII  386

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GS TSCYVATGSFSR+AVN+ AGCE+ VSN+VMA+TVL+SLQ LTKLLY+TP+AIL+S+I
Sbjct  387   GSFTSCYVATGSFSRTAVNYAAGCETLVSNIVMAITVLVSLQFLTKLLYYTPIAILSSVI  446

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGLI+++EAY IWKVDK+DFLACAGAF GVLFASVEIGLLVAV +SF+KI+L SI+
Sbjct  447   LSALPGLIDVSEAYKIWKVDKIDFLACAGAFFGVLFASVEIGLLVAVVISFSKIILISIR  506

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             PG E LG+LPGT+ LF  ++QYPMAV+ PGV +IR KS+LLCFANANF++ RI+  V EE
Sbjct  507   PGTETLGKLPGTN-LFCDVYQYPMAVKIPGVMIIRVKSALLCFANANFVRERIIKWVSEE  565

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             +   D  K +S   I L++ D SN++N+DTS I SL+EL+  ++S G Q  IANPRWQVI
Sbjct  566   ESEDD--KGNSRSTIQLVILDTSNLVNIDTSGIASLEELHKSLSSQGKQLAIANPRWQVI  623

Query  413   HKLRLADFHNKIKGKVFLTIGEAI  342
             HKL++++F  K  GKVFLT+ EA+
Sbjct  624   HKLKVSNFVAKFGGKVFLTVEEAL  647



>ref|XP_010025490.1| PREDICTED: LOW QUALITY PROTEIN: sulfate transporter 2.1, partial 
[Eucalyptus grandis]
Length=689

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/628 (64%), Positives = 501/628 (80%), Gaps = 4/628 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             ER+ W+   PEPP   R++    +      G+ F  L K+PV Q V    +++FP+L W 
Sbjct  57    ERSRWLTTAPEPPSAWREVVDYLRGIGLPSGSEFSSLNKKPVTQRVACVLKAIFPVLQWC  116

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y     K+D+L+GLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+S+EI
Sbjct  117   RGYKATHFKNDLLSGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAMMGTSKEI  176

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+S+LISSMV ++ DP + P  Y +LV T TFFAG+FQA  G+LRLGFLVDFLS
Sbjct  177   AIGPVAVVSMLISSMVTQIVDPGAEPVLYRNLVFTATFFAGVFQAVSGLLRLGFLVDFLS  236

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAA+VGFMAGAA+VIG QQLK L GI++FTN+TDVVSVL  ++ S HH  WNPYNL++G 
Sbjct  237   HAALVGFMAGAAVVIGFQQLKGLLGIAHFTNRTDVVSVLQSVWKSFHHDSWNPYNLLLGS  296

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             +FLSFILITRFLG+++RK F L A++PL+SV+L+T+LV++TRA+ HGVKI+KH+KGGLNP
Sbjct  297   AFLSFILITRFLGRRNRKFFCLAAISPLISVLLATVLVFVTRADEHGVKIIKHIKGGLNP  356

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S  QL F++P+I +V+K+G I+  +ALTEA+AVG SFA+MKGYHLDG+KEM+A+GV NI
Sbjct  357   ISAQQLQFSSPYIGEVIKVGLIIGAIALTEAMAVGRSFAAMKGYHLDGSKEMVALGVTNI  416

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS+TSCY ATGSFSR+AVNF AGCE+ VSN+VMA+TVL++L+L T+LLY+TPVAILASI
Sbjct  417   IGSITSCYTATGSFSRTAVNFSAGCETPVSNIVMAITVLMALELFTRLLYYTPVAILASI  476

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             IL+ALPGLI+L+EAY IWKVDK+DFLAC GAF GVLF SVEIGLLVAV +SF KI+L SI
Sbjct  477   ILAALPGLIDLHEAYHIWKVDKMDFLACIGAFVGVLFVSVEIGLLVAVTVSFVKIILISI  536

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             QPGIE LGRLPGTD  F  + QYPMA+  PGV V+R KSSLLCFANANFIK RI+     
Sbjct  537   QPGIETLGRLPGTDT-FCNVDQYPMAITIPGVMVVRVKSSLLCFANANFIKDRIMQSTGV  595

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E +   E K +  +   LI+ D+SN+M++DTS I SL+EL+  + S GV+  I NP+WQV
Sbjct  596   EDEG--ERKMNDFQTTQLIILDLSNLMSIDTSGIASLEELHKNLVSHGVEMAIVNPKWQV  653

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDAC  333
              HKLRLA + +KI GK FLTI +AIDAC
Sbjct  654   THKLRLAKWMSKIGGKAFLTIQDAIDAC  681



>gb|KCW62157.1| hypothetical protein EUGRSUZ_H04816 [Eucalyptus grandis]
Length=700

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/628 (64%), Positives = 501/628 (80%), Gaps = 4/628 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             ER+ W+   PEPP   R++    +      G+ F  L K+PV Q V    +++FP+L W 
Sbjct  68    ERSRWLTTAPEPPSAWREVVDYLRGIGLPSGSEFSSLNKKPVTQRVACVLKAIFPVLQWC  127

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y     K+D+L+GLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+S+EI
Sbjct  128   RGYKATHFKNDLLSGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAMMGTSKEI  187

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+S+LISSMV ++ DP + P  Y +LV T TFFAG+FQA  G+LRLGFLVDFLS
Sbjct  188   AIGPVAVVSMLISSMVTQIVDPGAEPVLYRNLVFTATFFAGVFQAVSGLLRLGFLVDFLS  247

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAA+VGFMAGAA+VIG QQLK L GI++FTN+TDVVSVL  ++ S HH  WNPYNL++G 
Sbjct  248   HAALVGFMAGAAVVIGFQQLKGLLGIAHFTNRTDVVSVLQSVWKSFHHDSWNPYNLLLGS  307

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             +FLSFILITRFLG+++RK F L A++PL+SV+L+T+LV++TRA+ HGVKI+KH+KGGLNP
Sbjct  308   AFLSFILITRFLGRRNRKFFCLAAISPLISVLLATVLVFVTRADEHGVKIIKHIKGGLNP  367

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S  QL F++P+I +V+K+G I+  +ALTEA+AVG SFA+MKGYHLDG+KEM+A+GV NI
Sbjct  368   ISAQQLQFSSPYIGEVIKVGLIIGAIALTEAMAVGRSFAAMKGYHLDGSKEMVALGVTNI  427

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS+TSCY ATGSFSR+AVNF AGCE+ VSN+VMA+TVL++L+L T+LLY+TPVAILASI
Sbjct  428   IGSITSCYTATGSFSRTAVNFSAGCETPVSNIVMAITVLMALELFTRLLYYTPVAILASI  487

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             IL+ALPGLI+L+EAY IWKVDK+DFLAC GAF GVLF SVEIGLLVAV +SF KI+L SI
Sbjct  488   ILAALPGLIDLHEAYHIWKVDKMDFLACIGAFVGVLFVSVEIGLLVAVTVSFVKIILISI  547

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             QPGIE LGRLPGTD  F  + QYPMA+  PGV V+R KSSLLCFANANFIK RI+     
Sbjct  548   QPGIETLGRLPGTDT-FCNVDQYPMAITIPGVMVVRVKSSLLCFANANFIKDRIMQSTGV  606

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E +   E K +  +   LI+ D+SN+M++DTS I SL+EL+  + S GV+  I NP+WQV
Sbjct  607   EDEG--ERKMNDFQTTQLIILDLSNLMSIDTSGIASLEELHKNLVSHGVEMAIVNPKWQV  664

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDAC  333
              HKLRLA + +KI GK FLTI +AIDAC
Sbjct  665   THKLRLAKWMSKIGGKAFLTIQDAIDAC  692



>gb|KCW68851.1| hypothetical protein EUGRSUZ_F02448 [Eucalyptus grandis]
Length=656

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/669 (62%), Positives = 513/669 (77%), Gaps = 22/669 (3%)
 Frame = -1

Query  2321  MAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFK  2142
             MA  P T   + +E ELP + S  +     T  P AERA WVL+ P+PP L   L  S K
Sbjct  1     MASLPDTD-SLKSEAELPPQTSFEI-----TSHPQAERAEWVLHSPDPPSLWHDLLVSKK  54

Query  2141  KTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQ  1962
                T         ++   +A  S  + +FP+L WG+ Y L K KSD++AGLTLASLCIPQ
Sbjct  55    SPLTD--------KQALCRAAASLFQGLFPILRWGRTYRLSKFKSDLMAGLTLASLCIPQ  106

Query  1961  SIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASN  1782
             SIGYA LA LDPQYGLYTSVVPPL+YA+MGSSREIAIGPVAV+SLL+SSM+ K++DP+++
Sbjct  107   SIGYANLAKLDPQYGLYTSVVPPLVYALMGSSREIAIGPVAVVSLLLSSMIQKIQDPSTD  166

Query  1781  PAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFG  1602
             P  Y  LV T T FAG FQA FG+ RLGFLVDFLSHAAIVGFMAGAAI+IGLQQLK L G
Sbjct  167   PGAYRRLVFTATLFAGTFQAIFGLFRLGFLVDFLSHAAIVGFMAGAAIIIGLQQLKGLLG  226

Query  1601  ISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAM  1422
             IS+FT KTDVVSVL   F S+ H  W P N ++G SFL F+L  RF+G+K++KLFWLPA+
Sbjct  227   ISHFTTKTDVVSVLESAFRSIRHQ-WYPLNFVLGCSFLIFLLFARFIGRKNKKLFWLPAI  285

Query  1421  APLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAV  1242
             APL+SV+LSTL+V+LT A+ HGVK+VKH+KGGLNP S HQL    PH+ Q  KIG I AV
Sbjct  286   APLVSVVLSTLIVFLTSADKHGVKVVKHIKGGLNPISAHQLQLAGPHVGQSAKIGLICAV  345

Query  1241  VALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGC  1062
             VALTEAIAVG SFAS+KGY +DGNKEM+A+G  N+AGSLTSCYVATGSFSR+AVNF AGC
Sbjct  346   VALTEAIAVGRSFASIKGYQIDGNKEMVAMGFMNVAGSLTSCYVATGSFSRTAVNFSAGC  405

Query  1061  ESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDF  882
             ++ VSN+VMAVTVLISL L TKLLY+TP+AILASIILSALPGLI++NEA  IW+VDKLDF
Sbjct  406   QTVVSNIVMAVTVLISLLLFTKLLYYTPIAILASIILSALPGLIDVNEALRIWRVDKLDF  465

Query  881   LACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPM  702
             LAC G F GVLF SVEIGLL AV +SF  I+L SI+PG E LGRLPGTD +F  I QYPM
Sbjct  466   LACIGTFLGVLFGSVEIGLLAAVAISFGNIILLSIRPGTELLGRLPGTD-VFCDIRQYPM  524

Query  701   AVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSN  522
             A++TPGV +IR  S L+CFANANFI+ RI+  V EE    D+ K +  ++I ++V DMSN
Sbjct  525   AIETPGVLLIRINSGLMCFANANFIRERIMRSVTEE----DDAKRTERRKIQVVVLDMSN  580

Query  521   IMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEA  345
             +MN+DTS I +L+EL+  + S G++  +AN RWQVIHKL++A+F ++I K +VFL++ EA
Sbjct  581   VMNIDTSGIAALEELHKMLVSVGLEVAMANIRWQVIHKLKVANFLDRIGKERVFLSVREA  640

Query  344   ID-ACLVDK  321
             ++ +CL  K
Sbjct  641   VEYSCLYSK  649



>ref|XP_009125320.1| PREDICTED: sulfate transporter 2.1 [Brassica rapa]
 emb|CDX85772.1| BnaA02g00410D [Brassica napus]
Length=677

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/629 (64%), Positives = 507/629 (81%), Gaps = 3/629 (0%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R+ W+L+ PEPP   ++L+   K++       F+ LRK+P+ + +L   ++VFP+  W 
Sbjct  47    DRSKWLLDCPEPPSPWQELKTQVKESYLTKAKKFKSLRKQPLPKRILFILQAVFPIFGWC  106

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+SREI
Sbjct  107   RNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYALMGTSREI  166

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+SSM+ KL DP ++P GY  LVLT TFFAGIFQA+FGI RLGFLVDFLS
Sbjct  167   AIGPVAVVSLLVSSMLQKLIDPETDPLGYKKLVLTTTFFAGIFQASFGIFRLGFLVDFLS  226

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S H   W+P+  I+G 
Sbjct  227   HAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCHQQ-WSPHTFILGC  285

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G+K++KLFWLPA+APL+SV++STL+V+LT+A+ HGVK VKH+KGGLNP
Sbjct  286   SFLSFILITRFIGKKNKKLFWLPAIAPLISVVVSTLMVFLTKADEHGVKTVKHIKGGLNP  345

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S++ L FNTPH+  + KIG IVA+VALTEAIAVG SFA +KGY LDGNKEM+AIG  N+
Sbjct  346   ISINDLEFNTPHLGHIAKIGLIVAIVALTEAIAVGRSFAGIKGYRLDGNKEMVAIGFMNV  405

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV ++L+ LT+LLY+TP+AILASI
Sbjct  406   IGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFVALECLTRLLYYTPIAILASI  465

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+++EA  IWK+DKLDFLA  GAF GVLF SVEIGLLVAV +SFAKI+L SI
Sbjct  466   ILSALPGLIDIDEAIHIWKIDKLDFLALIGAFFGVLFGSVEIGLLVAVVISFAKIILISI  525

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE LGR+PGTD  F    QYPM+V+TPGV + R KS+LLCFANA+ I+ RI+  + +
Sbjct  526   RPGIETLGRMPGTDT-FADTDQYPMSVKTPGVLIFRVKSALLCFANASSIEERIMGWIRQ  584

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  + TK ++++ I  +V DMSN++NVDTS I +L EL++ +   GV+ VI NP+W V
Sbjct  585   EEEGDENTKSNAKRNILFVVLDMSNLINVDTSGITALVELHNNLIQNGVELVIVNPKWTV  644

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL    F +KI GKV+LTIGEA+DAC 
Sbjct  645   IHKLNQTKFISKIGGKVYLTIGEAVDACF  673



>gb|ABK35754.1| sulfate transporter [Populus tremula x Populus alba]
Length=585

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/586 (68%), Positives = 491/586 (84%), Gaps = 8/586 (1%)
 Frame = -1

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
             + V+S   ++FP+  W + Y     K+D+LAGLTLASLCIPQSIGYA LA LDPQYGLYT
Sbjct  1     KTVISFLHAIFPIFCWCRSYKATNFKNDLLAGLTLASLCIPQSIGYATLAKLDPQYGLYT  60

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SV+PPLIYAVMG+SR+IAIGPVAV+SLL+SSM+ KL DP +NP  Y +LVLT TFFAGIF
Sbjct  61    SVIPPLIYAVMGTSRDIAIGPVAVVSLLLSSMISKLVDPVANPIPYRNLVLTTTFFAGIF  120

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QAAFG+ RLGFLVDFLSHAAIVGF+AGAA+VIGLQQ+K L GI++FTNKTDV+SV+  I+
Sbjct  121   QAAFGLFRLGFLVDFLSHAAIVGFVAGAAVVIGLQQMKGLLGITHFTNKTDVISVMEAIW  180

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              ++HHS WNP+N I+G SFL+FILITRF G+++RKLFWLPA+APL+SV+LSTLLVYLTRA
Sbjct  181   RAVHHS-WNPHNFILGCSFLTFILITRF-GRRNRKLFWLPAIAPLISVVLSTLLVYLTRA  238

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + HG+ I+KH+K GLNPSS+HQL FN+PHI +V KIG IVAVVALTEAIAVG SFAS+KG
Sbjct  239   DKHGIMIIKHIKRGLNPSSVHQLQFNSPHIGEVAKIGLIVAVVALTEAIAVGRSFASIKG  298

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             YH++GN+EM+A+G  NI GS TSCYVATGSFSRSAVNF AGCE+A+SN+VMA+TV+ISL+
Sbjct  299   YHINGNQEMVAMGFMNILGSFTSCYVATGSFSRSAVNFSAGCETAMSNIVMAITVIISLE  358

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             L T+LLY+TP+AILA+IILSALPGL++L+EAY+IWK+DKLDFLACAGAF GVLFASVEIG
Sbjct  359   LFTRLLYYTPIAILAAIILSALPGLVDLHEAYNIWKIDKLDFLACAGAFVGVLFASVEIG  418

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             LL AV +SF KI++ SI+PG E LGRLP TD +F  + QYPMA + P V VIR KS LLC
Sbjct  419   LLAAVTISFVKILIISIRPGAEVLGRLPETD-IFCDVDQYPMAAKNPQVLVIRVKSGLLC  477

Query  647   FANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDK  468
             FANANF+K +I+ L  EE     E     ++ + +++ DMSN+MN+D S I SL EL+  
Sbjct  478   FANANFVKEKIMKLATEE-----EEGRKGKRTVQVVILDMSNLMNIDVSGITSLVELHKN  532

Query  467   ITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             + S G++  I NP+WQVIHKLR+A+F  KI G+VFLTIGEA+DACL
Sbjct  533   LASSGMELAITNPKWQVIHKLRVANFVTKIGGRVFLTIGEAMDACL  578



>ref|NP_196580.1| sulfate transporter 2;1 [Arabidopsis thaliana]
 sp|O04722.1|SUT21_ARATH RecName: Full=Sulfate transporter 2.1; AltName: Full=AST68 [Arabidopsis 
thaliana]
 dbj|BAA20084.1| sulfate transporter [Arabidopsis thaliana]
 dbj|BAA20085.1| sulfate transporter [Arabidopsis thaliana]
 emb|CAB92059.1| sulfate transporter [Arabidopsis thaliana]
 gb|AAL32624.1| sulfate transporter [Arabidopsis thaliana]
 gb|AAM13334.1| sulfate transporter [Arabidopsis thaliana]
 gb|AED91505.1| sulfate transporter 2;1 [Arabidopsis thaliana]
Length=677

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/633 (65%), Positives = 512/633 (81%), Gaps = 12/633 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPG----LSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPL  2049
             +R+ W+L+ PEPP     L R+++GSF   A      F+ L+K+P  + +LS  +++FP+
Sbjct  48    DRSKWLLDCPEPPSPWHELKRQVKGSFLTKAK----KFKSLQKQPFPKQILSVLQAIFPI  103

Query  2048  LSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGS  1869
               W + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+
Sbjct  104   FGWCRNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYALMGT  163

Query  1868  SREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLV  1689
             SREIAIGPVAV+SLLISSM+ KL DP ++P GY  LVLT TFFAGIFQA+FG+ RLGFLV
Sbjct  164   SREIAIGPVAVVSLLISSMLQKLIDPETDPLGYKKLVLTTTFFAGIFQASFGLFRLGFLV  223

Query  1688  DFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNl  1509
             DFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S     W+P+  
Sbjct  224   DFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQQQ-WSPHTF  282

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             I+G SFLSFILITRF+G+K++KLFWLPA+APL++V++STL+V+LT+A+ HGVK V+H+KG
Sbjct  283   ILGCSFLSFILITRFIGKKYKKLFWLPAIAPLIAVVVSTLMVFLTKADEHGVKTVRHIKG  342

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNP S+  L FNTPH+ Q+ KIG I+A+VALTEAIAVG SFA +KGY LDGNKEM+AIG
Sbjct  343   GLNPMSIQDLDFNTPHLGQIAKIGLIIAIVALTEAIAVGRSFAGIKGYRLDGNKEMVAIG  402

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV ++L+ LT+LLY+TP+AI
Sbjct  403   FMNVLGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFVALECLTRLLYYTPIAI  462

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLIN+NEA  IWKVDK DFLA  GAF GVLFASVEIGLLVAV +SFAKI+
Sbjct  463   LASIILSALPGLININEAIHIWKVDKFDFLALIGAFFGVLFASVEIGLLVAVVISFAKII  522

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             L SI+PGIE LGR+PGTD  F   +QYPM V+TPGV + R KS+LLCFANA+ I+ RI+ 
Sbjct  523   LISIRPGIETLGRMPGTDT-FTDTNQYPMTVKTPGVLIFRVKSALLCFANASSIEERIMG  581

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
              V +E++  + TK +++++I  +V DMS+++NVDTS I +L EL++K+   GV+ VI NP
Sbjct  582   WV-DEEEEEENTKSNAKRKILFVVLDMSSLINVDTSGITALLELHNKLIKTGVELVIVNP  640

Query  428   RWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             +WQVIHKL  A F ++I GKV+LTIGEA+DAC 
Sbjct  641   KWQVIHKLNQAKFVDRIGGKVYLTIGEALDACF  673



>gb|KHN41503.1| Low affinity sulfate transporter 3 [Glycine soja]
Length=655

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/644 (65%), Positives = 521/644 (81%), Gaps = 13/644 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGT--AFQRLRKRPVQAVLSASESVFPLLSW  2040
             ER+ WVL+ P PP L +KL  S K+T    G    F   RK      LS  +++FP++SW
Sbjct  16    ERSQWVLDSPNPPPLWKKLFSSVKETILPHGNMFCFSSKRKTINGHALSCLQNLFPIISW  75

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
              + Y + K K D+LAGLTLASLCIPQSIGYA LA + P+YGLYTSVVPPLIYA+MGSSRE
Sbjct  76    LRDYKVSKFKDDLLAGLTLASLCIPQSIGYATLAKVAPEYGLYTSVVPPLIYAMMGSSRE  135

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L++S+VPK+EDP +NP  Y +LV TVTFF GIFQ AFG+ RLGFLVDFL
Sbjct  136   IAIGPVAVVSMLLASLVPKVEDPVTNPNAYRNLVFTVTFFTGIFQTAFGVFRLGFLVDFL  195

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS-----PWNPY  1515
             SHAA+VGFMAGAAI+IGLQQLK L G+S+FT+KTDVVSVL  ++ SLH+       WNP 
Sbjct  196   SHAALVGFMAGAAIIIGLQQLKGLLGLSHFTSKTDVVSVLASVYKSLHNQIAPGQKWNPL  255

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N ++G SFL FILITRF+G+++RKLFWLPA++PLLSVILSTL+VYL+RA+ HGV I+KHV
Sbjct  256   NFVLGCSFLIFILITRFIGRRNRKLFWLPAISPLLSVILSTLIVYLSRADKHGVNIIKHV  315

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGGLNPSSLHQL  + PH+ Q  KIG I +V+ALTEAIAVG SFAS+KGYHLDGNKEML+
Sbjct  316   KGGLNPSSLHQLQLHGPHVGQAAKIGLICSVIALTEAIAVGRSFASIKGYHLDGNKEMLS  375

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G+ NIAGSLTSCYVATGSFSR+AVNF AGC++AVSN+VMAVTV +SL+L T+LLY+TPV
Sbjct  376   MGIMNIAGSLTSCYVATGSFSRTAVNFSAGCQTAVSNIVMAVTVFLSLELFTRLLYYTPV  435

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILASI+LSALPGLI+L+EA  IWKVDKLDFLAC GAF GVLFA+VEIGLLVAV +SFAK
Sbjct  436   AILASIVLSALPGLIDLSEACYIWKVDKLDFLACIGAFLGVLFATVEIGLLVAVIISFAK  495

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR-  618
             I++ SI+PGIE LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF++ R 
Sbjct  496   ILIQSIRPGIEVLGRVPRTEA-FCDVTQYPMAISTPGIIVIRISSGSLCFANANFVRERQ  554

Query  617   ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVI  438
             IL  V +++   D+ KE+++ R+  ++ DM+N+MNVDTS I++L+EL+ ++ S GV+  +
Sbjct  555   ILKWVSQDE---DDLKETTKGRVQAVILDMTNLMNVDTSGILALEELHKRLLSRGVELAM  611

Query  437   ANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDKNMQA  309
              NPRW VIHKL+LA F +KI K  VFLT+GEA+DACL  K  +A
Sbjct  612   VNPRWLVIHKLKLAHFVDKIGKEWVFLTVGEAVDACLATKIARA  655



>emb|CDY40086.1| BnaC02g00440D [Brassica napus]
Length=677

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/629 (64%), Positives = 504/629 (80%), Gaps = 3/629 (0%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R+ W+L+ PEPP    +L+   K++       F+ LRK+P+ + +L   ++VFP+  W 
Sbjct  47    DRSKWLLDGPEPPSPWHELKTQVKESYLTKAKKFKSLRKQPLPKRILFILQAVFPIFGWC  106

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+SREI
Sbjct  107   RNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYALMGTSREI  166

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+SSM+ KL DP ++P  Y  LVLT TFFAGIFQA+FGI RLGFLVDFLS
Sbjct  167   AIGPVAVVSLLVSSMLQKLIDPETDPLSYKKLVLTTTFFAGIFQASFGIFRLGFLVDFLS  226

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S H   W+P+  I+G 
Sbjct  227   HAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCHQQ-WSPHTFILGC  285

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G+K++KLFWLPA+APL+SV++STL+V+LT+A+ HGVK VKH+KGGLNP
Sbjct  286   SFLSFILITRFIGKKNKKLFWLPAIAPLISVVVSTLMVFLTKADEHGVKTVKHIKGGLNP  345

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S++ L FNTPH+  + KIG IVA+VALTEAIAVG SFA +KGY LDGNKEM+AIG  N+
Sbjct  346   ISINDLEFNTPHLGHIAKIGLIVAIVALTEAIAVGRSFAGIKGYRLDGNKEMVAIGFMNV  405

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV I+L+ LT+LLY+TP+AILASI
Sbjct  406   IGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFIALECLTRLLYYTPIAILASI  465

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+++EA  IWK+DKLDFLA  GAF GVLF SVEIGLLVAV +SFAKI+L SI
Sbjct  466   ILSALPGLIDIDEAIHIWKIDKLDFLALIGAFFGVLFGSVEIGLLVAVVISFAKIILISI  525

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE LGR+PGTD  F    QYPM+V+TPGV + R KS+LLCFANA+ I+ RI+  + +
Sbjct  526   RPGIETLGRMPGTDT-FADTDQYPMSVKTPGVLIFRVKSALLCFANASSIEERIMGWIRQ  584

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  + TK  +++ I  +V DMSN++NVDTS I +L EL++ +   GV+ VI NP+W V
Sbjct  585   EEEGDENTKSDAKRNILFVVLDMSNLINVDTSGITALVELHNNLIQNGVELVIVNPKWTV  644

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL    F NKI GKV+LTIGEA+DAC 
Sbjct  645   IHKLNQTKFINKIGGKVYLTIGEALDACF  673



>ref|XP_006354019.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Solanum tuberosum]
Length=653

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/644 (63%), Positives = 506/644 (79%), Gaps = 16/644 (2%)
 Frame = -1

Query  2246  QKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVL-SA  2070
             Q  +ST     +R  W+L  P PP    +L  S KK          +  K+    V  S 
Sbjct  15    QVDASTDTARNQRTQWLLTSPNPPSFFHQLINSVKKNV-------DKTTKQSRNGVFFSF  67

Query  2069  SESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPL  1890
              + +FP+LSWG+ Y   K K DV+AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPL
Sbjct  68    LKGLFPILSWGRNYKGTKFKHDVMAGLTLASLCIPQSIGYANLAKLDPQYGLYTSVVPPL  127

Query  1889  IYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgI  1710
             IYAVMGSSREIAIGPVAV+SLLIS++V K+ DPA +   Y +LV T TFF G FQA FG+
Sbjct  128   IYAVMGSSREIAIGPVAVVSLLISALVSKIIDPAVDHIAYRNLVFTATFFTGAFQAVFGL  187

Query  1709  LRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS  1530
              RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI++FT KTDVVSVL  ++ SLH+ 
Sbjct  188   FRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGINHFTTKTDVVSVLEAVYKSLHNE  247

Query  1529  PWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVK  1350
             PW P N ++G SFL FIL+TRF+G++++KLFWLPA+APLLSV+LSTL+VYLT+A+ HGVK
Sbjct  248   PWFPLNFVLGCSFLIFILMTRFIGKRNKKLFWLPAIAPLLSVVLSTLIVYLTKADQHGVK  307

Query  1349  IVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGN  1170
             IVKH KGG+NPSSLHQL FN+PHI ++ KIG I A+VALTEAIAVG SFASMKGYHLDGN
Sbjct  308   IVKHFKGGINPSSLHQLQFNSPHIREIAKIGLICAIVALTEAIAVGRSFASMKGYHLDGN  367

Query  1169  KEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLL  990
             KEM+A+G  N+ GSLTSCY ATGSFSR+AVNF AGCE+ VSN+VMA+TVLISL+LLTKLL
Sbjct  368   KEMVAMGCMNLVGSLTSCYTATGSFSRTAVNFSAGCETVVSNIVMAITVLISLELLTKLL  427

Query  989   YFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVG  810
             Y+TP+AILASII+SALPGLI+++EA+ IWKVDK DF+ C  AF GVLF SVEIGL++AVG
Sbjct  428   YYTPLAILASIIISALPGLIDISEAFHIWKVDKTDFIICIAAFFGVLFGSVEIGLIIAVG  487

Query  809   LSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANF  630
             +SF KI+L +I+P +E  GRLPGTD  F  I Q+P+A +T G+ +IR  ++ LCFANANF
Sbjct  488   ISFGKIILGTIRPSVELQGRLPGTDT-FCDITQFPVATETQGILIIRVNNASLCFANANF  546

Query  629   IKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGV  450
             I+ RILS V         ++E S+ +I ++V DMS++M++DTS I++L+EL+ ++ S G+
Sbjct  547   IRGRILSTV------TSRSEEQSKGKIRILVLDMSSVMSIDTSGIVALEELHRELVSQGI  600

Query  449   QFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             Q  IANPRW+VI+KL++A F +++ KG +FL++G+A+DACL  K
Sbjct  601   QLAIANPRWKVINKLKVAKFVDELGKGWIFLSVGDAVDACLNTK  644



>gb|KHN29086.1| Sulfate transporter 2.1 [Glycine soja]
Length=630

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/632 (64%), Positives = 500/632 (79%), Gaps = 5/632 (1%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSW  2040
             AER+ WVLN P PP     L  S + T +        +R +P  + VLS   S+FP+L W
Sbjct  2     AERSQWVLNAPAPPSTWHNLMASVRNTISSYQKMCSYIRGQPGPKVVLSFLRSIFPILHW  61

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
             G+ YS  K ++D+LAGLT+ASLCIPQSIGYA LA LDP+YGLYTSVVPPLIYA+MG+SRE
Sbjct  62    GRNYSPTKFRNDLLAGLTIASLCIPQSIGYATLAKLDPEYGLYTSVVPPLIYALMGTSRE  121

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+SLL+SSM+ KL DPA +P GY  LV T TFFAGIFQAAFG+ RLGFLVDFL
Sbjct  122   IAIGPVAVVSLLLSSMIQKLIDPAIDPNGYRKLVFTTTFFAGIFQAAFGLFRLGFLVDFL  181

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliig  1500
             SHAAIVGFM GAAI+IGLQQLK LFGI++FTNKTD++SV+  ++ S+ H PWNP N ++G
Sbjct  182   SHAAIVGFMGGAAIIIGLQQLKGLFGINHFTNKTDIISVMKSVWESVDH-PWNPRNFVLG  240

Query  1499  fsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLN  1320
              SF  FIL TRFLG++++KLFWLPA++PL+SV+LSTL+V+LTRA+  GV IV+H+KGGLN
Sbjct  241   CSFFIFILFTRFLGKRNKKLFWLPAISPLVSVMLSTLIVFLTRADKSGVNIVRHIKGGLN  300

Query  1319  PSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVAN  1140
             PSS++Q+  N+PHI  + KIG +VA VALTE++AVG SFASMKGYHLDGNKEM+++G  N
Sbjct  301   PSSINQIDLNSPHIGALAKIGLVVAAVALTESVAVGRSFASMKGYHLDGNKEMVSLGFMN  360

Query  1139  IAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILAS  960
             I G  TSCYVATGSFSR+ VNF AGCE+  SN+VMA+ VLISLQ LTKLLYFTP AILAS
Sbjct  361   IIGCFTSCYVATGSFSRTVVNFTAGCETLASNIVMAIVVLISLQCLTKLLYFTPTAILAS  420

Query  959   IILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNS  780
             IILSALPGLI++NEAY IWKVDKLDFLAC GAF GVLFASVE+GLLVAVG+SF KI+  S
Sbjct  421   IILSALPGLIDINEAYKIWKVDKLDFLACVGAFFGVLFASVELGLLVAVGISFTKIIWIS  480

Query  779   IQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVM  600
             I  G E LGRLPGTD +F    QYPMAV+ PGV +IR KSSLLCF+NAN ++ RIL  + 
Sbjct  481   IGAGTETLGRLPGTD-VFCDAQQYPMAVKIPGVAIIRVKSSLLCFSNANSVRERILKWIS  539

Query  599   EEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
              E+   +  ++++   I L++ D SN++++DTS I SL+EL+  + S G    IANPRWQ
Sbjct  540   REEAKGN-IEDNTGSIIQLVILDTSNLVSIDTSGIASLEELHKSLVSSGKHLAIANPRWQ  598

Query  419   VIHKLRLADFHNKIKGKVFLTIGEAIDACLVD  324
             VI+KL+  +F  +I G+VFLTIGEAID C +D
Sbjct  599   VIYKLKATNFVTRIGGRVFLTIGEAID-CKLD  629



>ref|XP_004490361.1| PREDICTED: low affinity sulfate transporter 3-like [Cicer arietinum]
Length=654

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/640 (64%), Positives = 509/640 (80%), Gaps = 14/640 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRL---RKRPVQAVLSASESVFPLLS  2043
             E + WVL+ P PP L +KL  S K+T    G  F      +K   +   S  +S+FP+L 
Sbjct  16    ESSKWVLDSPNPPPLWKKLLSSVKETILPDGNKFCFFLSKKKTLHEHAFSFLQSLFPILV  75

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             W K Y+  K K D+LAGLTLASLCIPQS+GYA+LA +DPQYGLYTS+VPPLIYAVMGSSR
Sbjct  76    WLKDYTASKFKDDLLAGLTLASLCIPQSVGYASLAKVDPQYGLYTSIVPPLIYAVMGSSR  135

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             +IAIGPVAV+S+L+SS+V K+ DP +NP  Y   V TVTFF GIFQA FGI RLGFLVDF
Sbjct  136   DIAIGPVAVVSMLLSSLVTKVIDPVANPHAYRDFVFTVTFFTGIFQAGFGIFRLGFLVDF  195

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNP  1518
             LSHAA+VGFMAGAA++I LQQLK L GI++FT KTD VSVL  +F SLH        W+P
Sbjct  196   LSHAALVGFMAGAAVIISLQQLKGLLGITHFTTKTDAVSVLVSVFKSLHQQITSEEKWSP  255

Query  1517  YNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKH  1338
              N I+G SFL F+L+TRF+G++++KLFWLPA+APLLSVILSTL+VYL++A+  GV ++KH
Sbjct  256   LNFILGCSFLIFLLVTRFIGKRNKKLFWLPAIAPLLSVILSTLIVYLSKADKQGVNVIKH  315

Query  1337  VKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEML  1158
             VKGGLN SS+HQL F+  H+ Q VKIG + AV+ALTEA+AVG SFAS+KGYHLDGN+EML
Sbjct  316   VKGGLNQSSVHQLQFHGQHVGQAVKIGLVCAVIALTEAMAVGRSFASIKGYHLDGNREML  375

Query  1157  AIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTP  978
             ++G+ NIAGSLTSCYVATGSFSR+AVN+ AGC++AVSN+VMA+TV++ LQL  +LLY+TP
Sbjct  376   SMGIMNIAGSLTSCYVATGSFSRTAVNYSAGCQTAVSNIVMAITVILFLQLFARLLYYTP  435

Query  977   VAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFA  798
             +AILA+IILSALPGLI++NEA  IWKVDKLDFLAC GAF GVLFASVEIGLLVAV +SFA
Sbjct  436   MAILAAIILSALPGLIDVNEARYIWKVDKLDFLACIGAFVGVLFASVEIGLLVAVTISFA  495

Query  797   KIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR  618
             KI++ SI+PG+E LGR+P T+ +F  + QYPMAV TPG+ VIR  S  LCFANANF+K R
Sbjct  496   KILIQSIRPGVEILGRVPRTE-VFCDVTQYPMAVSTPGILVIRISSGSLCFANANFVKER  554

Query  617   ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVI  438
             IL  V+EE    D+ +E+S+  +  I+ DM+N+MNVDTS I++L+EL+ ++ S GV+  +
Sbjct  555   ILKWVVEE----DDIQETSKGNVRAIIMDMTNLMNVDTSGILALEELHKRLLSRGVELAM  610

Query  437   ANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
              NPRWQVIHKL+LA F +KI K  VFLT+GEA+DACL  K
Sbjct  611   VNPRWQVIHKLKLAHFVDKIGKQWVFLTVGEAVDACLSSK  650



>ref|XP_011027673.1| PREDICTED: low affinity sulfate transporter 3 [Populus euphratica]
Length=644

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/638 (63%), Positives = 509/638 (80%), Gaps = 16/638 (3%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLG------TAFQRLRKRPVQAVLSASESVFP  2052
             ERA WVLN P+PPGL ++L  S ++     G      TA ++ + R ++ +    + VFP
Sbjct  9     ERAQWVLNSPDPPGLLQELGSSVREIIFPRGKKHTSSTARRKQQSRAIEFL----QGVFP  64

Query  2051  LLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMG  1872
             +L WG+ Y     K+D+LAGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MG
Sbjct  65    ILGWGRDYEASMFKNDLLAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYAIMG  124

Query  1871  SSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFL  1692
             SSREIAIGPVAV+S+L+SSM+ +++DP ++P  Y + V TVT FAG FQA FG+ RLGFL
Sbjct  125   SSREIAIGPVAVVSMLLSSMIGEIQDPLADPVAYRNFVFTVTLFAGTFQAIFGLFRLGFL  184

Query  1691  VDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYN  1512
             VDFLSHA+IVGFM GAAIVIGLQQLK L GIS+FT KTDVVSVL   FTS+ H PW+P N
Sbjct  185   VDFLSHASIVGFMGGAAIVIGLQQLKGLLGISHFTTKTDVVSVLHSAFTSIDH-PWSPLN  243

Query  1511  liigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVK  1332
              ++G SFL F+LI RF+G++++KLFW PA+APL+SVILSTL+V+LT+A+ HGVKIV+H+K
Sbjct  244   FVLGCSFLIFLLIARFIGRRNKKLFWFPAIAPLVSVILSTLIVFLTKADKHGVKIVRHIK  303

Query  1331  GGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAI  1152
             GGLN SS+H L  + P + Q  KIG I A+VALTEAIAVG SFAS+KGYH+DGNKEMLA+
Sbjct  304   GGLNRSSVHDLQLSGPQLGQAAKIGLISAIVALTEAIAVGRSFASIKGYHIDGNKEMLAL  363

Query  1151  GVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVA  972
             G  NIAGSL+SCYVATGSFSR+AVNF AGC++ VSN+VM++TVL+SL++ T+LLY+TP A
Sbjct  364   GFMNIAGSLSSCYVATGSFSRTAVNFSAGCQTLVSNIVMSITVLVSLEVFTRLLYYTPTA  423

Query  971   ILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKI  792
             ILASIILSALPGLI++  AY IWKVDKLDF+AC GAF GVLFASVEIGLL AV +SFA+I
Sbjct  424   ILASIILSALPGLIDIRGAYYIWKVDKLDFIACIGAFFGVLFASVEIGLLAAVTISFARI  483

Query  791   MLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARIL  612
             +L++I+PGIE LGRLP  D ++  ++QYPMA++TPG+  +R  S+LLCFANANFI+ RIL
Sbjct  484   LLDAIRPGIEALGRLPRAD-VYCDMNQYPMAIKTPGILAVRINSALLCFANANFIRERIL  542

Query  611   SLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIAN  432
               V EE    +E KES+E+ I  ++ DMSN+MN+DT+ I++L EL+ ++     Q  IAN
Sbjct  543   RWVTEE---VNEIKESTERGIQAVILDMSNVMNIDTAGILALDELHKELLIHEAQLAIAN  599

Query  431   PRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             P+WQVIHKLRLA F ++I +G +FLT+ EA+DAC+  K
Sbjct  600   PKWQVIHKLRLAKFIDRIGRGWIFLTVSEAVDACVSSK  637



>ref|XP_010061827.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Eucalyptus grandis]
Length=674

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/680 (62%), Positives = 519/680 (76%), Gaps = 26/680 (4%)
 Frame = -1

Query  2321  MAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFK  2142
             MA  P T   + +E ELP + S  +     T  P AERA WVL+ P+PP L   L  S +
Sbjct  1     MASLPDTD-SLKSEAELPPQTSFEI-----TSHPQAERAEWVLHSPDPPSLWHDLLVSVR  54

Query  2141  KTATFLGTAFQRLRKRPV---QAVLSASESVF----PLLSWGKQYSLVKLKSDVLAGLTL  1983
              T   L  +    +K P+   QA+  A+ S+F    P+L WG+ Y L K KSD++AGLTL
Sbjct  55    GT-LLLNNSNDDKKKSPLTDKQALCRAAASLFQGLFPILRWGRTYRLSKFKSDLMAGLTL  113

Query  1982  ASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPK  1803
             ASLCIPQSIGYA LA LDPQYGLYTSVVPPL+YA+MGSSREIAIGPVAV+SLL+SSM+ K
Sbjct  114   ASLCIPQSIGYANLAKLDPQYGLYTSVVPPLVYALMGSSREIAIGPVAVVSLLLSSMIQK  173

Query  1802  LEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQ  1623
             ++DP+++P  Y  LV T T FAG FQA FG+ RLGFLVDFLSHAAIVGFMAGAAI+IGLQ
Sbjct  174   IQDPSTDPGAYRRLVFTATLFAGTFQAIFGLFRLGFLVDFLSHAAIVGFMAGAAIIIGLQ  233

Query  1622  QLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRK  1443
             QLK L GIS+FT KTDVVSVL   F S+ H  W P N ++G SFL F+L  RF+G+K++K
Sbjct  234   QLKGLLGISHFTTKTDVVSVLESAFRSIRHQ-WYPLNFVLGCSFLIFLLFARFIGRKNKK  292

Query  1442  LFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVK  1263
             LFWLPA+APL+SV+LSTL+V+LT A+ HGVK+VKH+KGGLNP S HQL    PH+ Q  K
Sbjct  293   LFWLPAIAPLVSVVLSTLIVFLTSADKHGVKVVKHIKGGLNPISAHQLQLAGPHVGQSAK  352

Query  1262  IGFIVAVVALT----EAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSF  1095
             IG I AVVALT    EAIAVG SFAS+KGY +DGNKEM+A+G  N+AGSLTSCYVATGSF
Sbjct  353   IGLICAVVALTFFLQEAIAVGRSFASIKGYQIDGNKEMVAMGFMNVAGSLTSCYVATGSF  412

Query  1094  SRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEA  915
             SR+AVNF AGC++ VSN+VMAVTVLISL L TKLLY+TP+AILASIILSALPGLI++NEA
Sbjct  413   SRTAVNFSAGCQTVVSNIVMAVTVLISLLLFTKLLYYTPIAILASIILSALPGLIDVNEA  472

Query  914   YSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTD  735
               IW+VDKLDFLAC G F GVLF SVEIGLL AV +SF  I+L SI+PG E LGRLPGTD
Sbjct  473   LRIWRVDKLDFLACIGTFLGVLFGSVEIGLLAAVAISFGNIILLSIRPGTELLGRLPGTD  532

Query  734   ALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEK  555
              +F  I QYPMA++TPGV +IR  S L+CFANANFI+ RI+  V EE    D+ K +  +
Sbjct  533   -VFCDIRQYPMAIETPGVLLIRINSGLMCFANANFIRERIMRSVTEE----DDAKRTERR  587

Query  554   RIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-  378
             +I ++V DMSN+MN+DTS I +L+EL+  + S G++  +AN RWQVIHKL++A+F ++I 
Sbjct  588   KIQVVVLDMSNVMNIDTSGIAALEELHKMLVSVGLEVAMANIRWQVIHKLKVANFLDRIG  647

Query  377   KGKVFLTIGEAID-ACLVDK  321
             K +VFL++ EA++ +CL  K
Sbjct  648   KERVFLSVREAVEYSCLYSK  667



>ref|XP_004304832.1| PREDICTED: sulfate transporter 2.1-like [Fragaria vesca subsp. 
vesca]
Length=710

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/644 (62%), Positives = 521/644 (81%), Gaps = 8/644 (1%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLS  2073
             L+K SS++    +R+ WVLN PEPPGL  +L  + ++T ++ G  +  L+ +P+ ++V+S
Sbjct  69    LEKNSSSV----DRSQWVLNGPEPPGLWHELMDTVRETTSYFGNKYSSLKSQPMLKSVVS  124

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               + +FP+L WG+ YS+ K K D++AGLT+ASLCIPQSIGYA LA LDPQYGLYTSVVPP
Sbjct  125   IQQEIFPILVWGRSYSISKFKHDLMAGLTIASLCIPQSIGYATLAKLDPQYGLYTSVVPP  184

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYA+MG+SREIAIGPVAV+SLL+ SM+ KL+DP ++P  YT LVLT TFF GIFQAAFG
Sbjct  185   LIYAIMGTSREIAIGPVAVVSLLLPSMLLKLQDPGADPIAYTKLVLTATFFTGIFQAAFG  244

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             I RLGFLVDFLSHAAIVGF+AGAAI+IGLQQLK L GI++F   TDV+SV+  +++S HH
Sbjct  245   IFRLGFLVDFLSHAAIVGFVAGAAIIIGLQQLKGLLGIAHFPTSTDVISVMEAVWSSFHH  304

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
              PWNP+N ++G SFL FILI+RF+G+K++KLFWLPA+APLLSVILSTL+VYLTRA+ HG+
Sbjct  305   -PWNPHNFMLGCSFLCFILISRFVGRKNKKLFWLPAIAPLLSVILSTLIVYLTRADKHGI  363

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             KIVKH+K GLNPSS+H L  N+P++  V K+G I+A+VALTEAIAVG SF+S+KGY ++G
Sbjct  364   KIVKHIKEGLNPSSVHLLQLNSPYVGDVAKVGLIIAIVALTEAIAVGKSFSSIKGYRING  423

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+++G  NI GSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV ISL+  T+L
Sbjct  424   NKEMMSMGFMNIVGSLTSCYVATGSFSRTAVNFSAGCETPVSNIVMAITVTISLEFFTRL  483

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LYFTP AILASIILSALPGLIN+NE Y+IWKVDKLDFLAC GAF GVLFASVEIGLL+AV
Sbjct  484   LYFTPTAILASIILSALPGLININEIYNIWKVDKLDFLACIGAFFGVLFASVEIGLLLAV  543

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SF KI+L SI+PG E LG+LPGTD +F    QYPMA+   G+ ++R KS+LLCFAN+N
Sbjct  544   AISFTKIILISIRPGTETLGQLPGTD-MFCDTEQYPMAITVSGIMIVRVKSALLCFANSN  602

Query  632   FIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCG  453
             F++ RI+  +   +K+      +++  I +++ DMSN++N+DTS I +L++L   + S G
Sbjct  603   FVRERIVRWI-AAKKAEGLKGNNTKDTIQVVILDMSNLINIDTSGIATLEDLQRNLLSEG  661

Query  452   VQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
             ++  +ANPRWQVIHKL++++F  KI G+VF+T+ EA+ A    K
Sbjct  662   IELAVANPRWQVIHKLKISNFIGKIGGRVFVTVAEAVAATFTGK  705



>ref|XP_003543772.1| PREDICTED: low affinity sulfate transporter 3-like [Glycine max]
Length=654

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/643 (66%), Positives = 516/643 (80%), Gaps = 12/643 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGT--AFQRLRKRPVQAVLSASESVFPLLSW  2040
             ER+ WVL+ P PP L +KL  S K+T    G    F   RK      LS  +++FP++SW
Sbjct  16    ERSQWVLDSPNPPPLWKKLFSSVKETILPHGNKFCFSSKRKTSHGHALSCLKNLFPIISW  75

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
                Y     K D+LAGLTLASLCIPQSIGYA LA + P+YGLYTSVVPPLIYA+MGSSRE
Sbjct  76    LTDYKASMFKDDLLAGLTLASLCIPQSIGYATLAKVAPEYGLYTSVVPPLIYAMMGSSRE  135

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L++S+VPK+EDP +NP  Y +LV TVTFF GIFQ AFG+ RLGFLVDFL
Sbjct  136   IAIGPVAVVSILLASLVPKVEDPVANPNAYRNLVFTVTFFTGIFQTAFGVFRLGFLVDFL  195

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPY  1515
             SHAA+VGFMAGAAI+IGLQQLK L G+S+FT+KTDVVSVL  ++ SLH+       WNP 
Sbjct  196   SHAALVGFMAGAAIIIGLQQLKGLLGLSHFTSKTDVVSVLASVYKSLHNQIASGEKWNPL  255

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N ++G SFL FILITRF+G+++RKLFWLPA++PLLSVILSTL+VYL+RA+ HGV I+KHV
Sbjct  256   NFVLGCSFLIFILITRFIGRRNRKLFWLPAISPLLSVILSTLIVYLSRADKHGVNIIKHV  315

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGGLNPSSLHQL F  PH+ Q  KIG I +V+ALTEAIAVG SFAS+KGYHLDGNKEML+
Sbjct  316   KGGLNPSSLHQLQFYGPHVGQAAKIGLICSVIALTEAIAVGRSFASIKGYHLDGNKEMLS  375

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G  NIAGSL+SCYVATGSFSR+AVNF AGC++AVSN+VMAVTV +SL+L T+LLY+TPV
Sbjct  376   MGFMNIAGSLSSCYVATGSFSRTAVNFSAGCQTAVSNIVMAVTVFVSLELFTRLLYYTPV  435

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILASIILSALPGLI+L+EA  IWKVDKLDFLAC GAF GVLFASVEIGLLVAV +SFAK
Sbjct  436   AILASIILSALPGLIDLSEACYIWKVDKLDFLACIGAFLGVLFASVEIGLLVAVIISFAK  495

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARI  615
             I++ SI+PGIE LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF++ RI
Sbjct  496   ILIQSIRPGIEVLGRVPRTEA-FCDVTQYPMAISTPGIIVIRISSGSLCFANANFVRERI  554

Query  614   LSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIA  435
             L  V +++   D+ KE+ + RI  ++ DM+N+MNVDTS I++L+EL+ ++ S G++  + 
Sbjct  555   LKWVSQDE---DDLKETPKGRIQAVILDMTNLMNVDTSGILALEELHKRLLSRGLELAMV  611

Query  434   NPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDKNMQA  309
             NPRW VIHKL+LA F +KI K  VFLT+GEA+DACL  K  +A
Sbjct  612   NPRWLVIHKLKLALFVDKIGKEWVFLTVGEAVDACLSTKIARA  654



>ref|XP_009122079.1| PREDICTED: sulfate transporter 2.1-like isoform X1 [Brassica 
rapa]
 emb|CDX69856.1| BnaA10g22050D [Brassica napus]
Length=676

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/641 (63%), Positives = 512/641 (80%), Gaps = 7/641 (1%)
 Frame = -1

Query  2240  TSSTLPPAAE---RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLS  2073
             +S+  PP  +   R+ W+L+ PEPP    +L+   K++       F+ L+K+P+ + +LS
Sbjct  35    SSAAAPPRQDQHDRSKWLLDCPEPPSPWHELKIQVKESFLTKAKRFKSLQKQPLPKRILS  94

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               ++VFP+  W + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLY+SV PP
Sbjct  95    ILQAVFPIFGWCRNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYSSVGPP  154

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYA+MG+SREIAIGPVAV+SLL+SSM+ +L DP ++P GY  LVLT TFFAGIFQA+FG
Sbjct  155   LIYALMGTSREIAIGPVAVVSLLLSSMLQELIDPETDPLGYKKLVLTTTFFAGIFQASFG  214

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             I RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S H 
Sbjct  215   IFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCHQ  274

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
               W+P+  I+G SFLSFILI RF+G++++KLFWLPA+APL+SV++STL+V+LT+A+ HGV
Sbjct  275   Q-WSPHTFILGCSFLSFILIARFIGKRNKKLFWLPAIAPLISVVVSTLMVFLTKADEHGV  333

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             K V+H++GGLNP S++ L FNTPH+  + KIG IVAVVALTEAIAVG SFA +KGY LDG
Sbjct  334   KTVRHIRGGLNPISINDLEFNTPHLGHIAKIGLIVAVVALTEAIAVGRSFAGIKGYRLDG  393

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+AIGV N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV I+L+ LT+L
Sbjct  394   NKEMVAIGVMNVLGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFIALECLTRL  453

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP+AILASIILSALPGLI++NEA  IWK+DKLDFLA  GAF GVLF SVEIGLLVAV
Sbjct  454   LYYTPIAILASIILSALPGLIDINEAIHIWKIDKLDFLALIGAFFGVLFGSVEIGLLVAV  513

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SFAKI+L SI+PGIE LGR+PGTD +F    QYPM+V+TPGV + R KS+LLCFANA+
Sbjct  514   VISFAKIILISIRPGIETLGRIPGTD-IFADTDQYPMSVKTPGVLICRVKSALLCFANAS  572

Query  632   FIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCG  453
              I+ RI+  + EE++  + TK + E++I  +V DMSN+MNVDTS I +L EL++ +   G
Sbjct  573   SIEERIMRWINEEEED-ENTKSNDERKILFVVLDMSNLMNVDTSGITALVELHNNLIQNG  631

Query  452   VQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             ++ VI NP+W V HKL  A F +KI G+V+LTIGEA+DAC 
Sbjct  632   IELVIVNPKWHVFHKLNQAKFVSKIGGRVYLTIGEALDACF  672



>ref|XP_004163495.1| PREDICTED: LOW QUALITY PROTEIN: sulfate transporter 2.1-like 
[Cucumis sativus]
Length=658

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/651 (63%), Positives = 513/651 (79%), Gaps = 18/651 (3%)
 Frame = -1

Query  2258  SQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAV  2079
             S T+  TS+     A+RA WV N P+PPG+ R L    ++T     T    L+ +   AV
Sbjct  16    STTVDNTST----PADRARWVANPPDPPGICRDLIDWLRQTMFPDPTKLFPLKNKTGTAV  71

Query  2078  LSAS-ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             L    + VFP+L WG+ Y+L K K+DVLAGLTLASLCIPQSIGYA LA LDPQYGLYTS+
Sbjct  72    LGRVLKGVFPILCWGQSYNLGKFKNDVLAGLTLASLCIPQSIGYANLAKLDPQYGLYTSI  131

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPL+YA++GSSREIAIGPVA+IS+L+ +M+ K++DPA++P  Y +LV T TFFAGIFQA
Sbjct  132   VPPLVYAILGSSREIAIGPVAIISMLLPTMIQKIQDPAADPFAYRNLVFTTTFFAGIFQA  191

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
             AFG+ RLGF+VDFLS AAIVGFM GAAIVIGLQQLK L GI++FTNKTD++SV+  +F S
Sbjct  192   AFGLFRLGFMVDFLSQAAIVGFMGGAAIVIGLQQLKGLLGITHFTNKTDIISVMEAVFAS  251

Query  1541  LHH---SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTR  1371
              HH     WNP N IIG SFLSFILIT+ LG+K++K+FWLPAMAPL+SVILSTLLV+LTR
Sbjct  252   FHHLNNDQWNPLNFIIGSSFLSFILITKLLGKKYKKVFWLPAMAPLVSVILSTLLVFLTR  311

Query  1370  AENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMK  1191
             A+ HGVKIVK V  GLNP S   +  +TPHI Q++    IVAVVALTEAIAVG S ASMK
Sbjct  312   ADEHGVKIVKRVPPGLNPISTQNIQIHTPHISQILNAALIVAVVALTEAIAVGRSLASMK  371

Query  1190  GYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISL  1011
             GY++DGNKEM+A+G  N+AGSLTSCY ATGS SRSAVNF AGCE+ VSNVVMAVTV+ISL
Sbjct  372   GYNIDGNKEMVALGFMNLAGSLTSCYTATGSLSRSAVNFSAGCETPVSNVVMAVTVMISL  431

Query  1010  QLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEI  831
             ++ TKLLYFTP AILASIILSALPGL+++++AY+IWK+DKLDFLAC  AF GVLF SVE 
Sbjct  432   KMFTKLLYFTPNAILASIILSALPGLVDIHQAYNIWKIDKLDFLACLAAFXGVLFLSVEF  491

Query  830   GLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLL  651
             GLL+++ +SFAKI++ SI+PG E LG++PGTD  F  IHQYPMA+ TPGV ++R KS LL
Sbjct  492   GLLLSLVISFAKIIVTSIKPGTEILGKIPGTDT-FCDIHQYPMALNTPGVLIVRVKSGLL  550

Query  650   CFANANFIKARILSLVMEEQKSADETKESSEKRIA-LIVFDMSNIMNVDTSAIISLKELY  474
             CFANANF+K RIL  +         ++E+S K I   +V D+SN+MN+DTS I SL+EL+
Sbjct  551   CFANANFVKDRILRFI--------SSQEASGKGITQFLVIDLSNLMNIDTSGIASLEELH  602

Query  473   DKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
               + + G++  IANP+WQVIHKL++++F  K+KG+VFL++GEA+DACL  K
Sbjct  603   KNLATSGIEMAIANPKWQVIHKLKVSNFIAKLKGRVFLSVGEAVDACLSAK  653



>ref|XP_010261213.1| PREDICTED: low affinity sulfate transporter 3-like [Nelumbo nucifera]
Length=666

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/632 (63%), Positives = 507/632 (80%), Gaps = 6/632 (1%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWG  2037
             AERA WVLN PEPP    +L+ +    A  L ++F + R   +  +LS  +S+FP+L WG
Sbjct  29    AERARWVLNTPEPPSSWHELKQTVFPRAQKLRSSFSQKRGGYI-CLLSVMKSIFPILQWG  87

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y+  K K+D++AGLTLASL IPQSIGYA+LA LDPQYGLYTSVVPPL+Y++MGSSREI
Sbjct  88    RNYTATKFKNDLMAGLTLASLSIPQSIGYASLAKLDPQYGLYTSVVPPLVYSLMGSSREI  147

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVA++S+L+SS+V K+ DP ++P  Y   V+T T FAG FQ AFG+ RLGFLVDFLS
Sbjct  148   AIGPVAIVSMLLSSLVQKVVDPVADPTAYRKFVITATLFAGFFQTAFGLFRLGFLVDFLS  207

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFMAGAAIVIGLQQLK L GI +FTNKTDV+SVL  +F S+ H PW+P N ++G 
Sbjct  208   HAAIVGFMAGAAIVIGLQQLKGLLGIDHFTNKTDVISVLVAVFRSIRH-PWSPLNFVLGC  266

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFL FIL  RF+G+K+RKLFW+PA+APL+SV+LSTL+V++TRA+ HGVKI+KH++GG+NP
Sbjct  267   SFLIFILAMRFVGRKNRKLFWVPALAPLISVVLSTLIVFVTRADKHGVKIIKHLEGGINP  326

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S+ ++  N PH+ +  KIG I A++ALTEAIAVG SFAS++GY LDGNKEM+A+GV NI
Sbjct  327   XSVKEIELNGPHVGEAAKIGLISAIIALTEAIAVGRSFASVRGYQLDGNKEMVAMGVMNI  386

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
             AGSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+ VL++LQ+LT LLYFTP+AILASI
Sbjct  387   AGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAIAVLVALQILTTLLYFTPIAILASI  446

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+ NEAY+IWKVDKLDFL+C GAF GVLF SVEIGLLVAV +SFAKI+LN I
Sbjct  447   ILSALPGLIDFNEAYNIWKVDKLDFLSCIGAFFGVLFGSVEIGLLVAVTISFAKIILNGI  506

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV--  603
             +P +E LG+LP TD +F   +QYPMAV+  G  +IR  SS LCFANANFI+ RI+  V  
Sbjct  507   RPSMEILGQLPTTD-IFCSTNQYPMAVKISGTLIIRIHSSYLCFANANFIRERIMRWVKE  565

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
                ++   E  E+++ RI +++FDMSN+MN+DTS I++L+ L  ++ S G++  IANP W
Sbjct  566   DGGEEGEKEANENTKMRIQVLIFDMSNLMNIDTSGILALEVLQKELVSHGIELAIANPCW  625

Query  422   QVIHKLRLADFHNKIKGK-VFLTIGEAIDACL  330
              VIHKL+LA F +KI G+ +FLTIGEA+D CL
Sbjct  626   HVIHKLKLAKFVDKIGGRSLFLTIGEAVDTCL  657



>ref|XP_003614966.1| Sulfate transporter-like protein [Medicago truncatula]
 gb|AES97924.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=654

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/639 (63%), Positives = 506/639 (79%), Gaps = 13/639 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGT--AFQRLRKRPVQAVLSASESVFPLLSW  2040
             ER+ WVL+ P PP L +KL  S K+T    G    F    K  +    S  +S+FP+L W
Sbjct  17    ERSKWVLDSPNPPPLWKKLFSSLKETLLPHGNKLCFSSKNKSFLALAYSFLQSLFPILVW  76

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
              K Y++ K K D+LAGLTLASLCIPQSIGYA+LA +DPQYGLYTS+VPPLIYAVMGSSR+
Sbjct  77    LKDYTISKFKDDLLAGLTLASLCIPQSIGYASLAKVDPQYGLYTSIVPPLIYAVMGSSRD  136

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L+SS+V  + DP +NP  Y   + TVTFF GIFQAAFGI RLGFLVDFL
Sbjct  137   IAIGPVAVVSMLLSSLVTNVIDPVANPHAYRDFIFTVTFFTGIFQAAFGIFRLGFLVDFL  196

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPY  1515
             SHAA+VGFMAGAAI+IGLQQLK L GI++FT KTD VSVL  ++ SLH        W+P 
Sbjct  197   SHAALVGFMAGAAIIIGLQQLKGLLGITHFTTKTDAVSVLVSVYKSLHQQITSEEKWSPL  256

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N ++G SFL F+L+TRF+ +K +KLFWLPA+APLLSVILSTL+VYL++A+  G+ I+KHV
Sbjct  257   NFVLGCSFLIFLLVTRFIARKKKKLFWLPAIAPLLSVILSTLIVYLSKADKQGINIIKHV  316

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGGLN SS+HQL F+  ++ Q  KIG + AV+ALTEA+AVG SFAS+KGY LDGN+EML+
Sbjct  317   KGGLNQSSVHQLQFHGQNVGQAAKIGLVCAVIALTEAMAVGRSFASIKGYQLDGNREMLS  376

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G+ NIAGSLTSCYVATGSFSR+AVNF AGC++AVSN+VMA+TV++ LQL  +LLY+TP+
Sbjct  377   MGIMNIAGSLTSCYVATGSFSRTAVNFSAGCQTAVSNIVMAITVILFLQLFARLLYYTPM  436

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILA+IILSALPGLI++NEA  IWKVDKLDFLAC GAF GVLFASVEIGLLVA+ +SFAK
Sbjct  437   AILAAIILSALPGLIDINEARYIWKVDKLDFLACIGAFVGVLFASVEIGLLVAISISFAK  496

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARI  615
             I++ SI+PG+E LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF+K RI
Sbjct  497   ILIQSIRPGVEILGRVPRTEA-FCDVTQYPMAISTPGIVVIRISSGSLCFANANFVKERI  555

Query  614   LSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIA  435
             L  V+EE    D+ +E+++  +  I+ DM+N+MNVDTS I++L+EL+ ++ S GV+  + 
Sbjct  556   LKWVVEE----DDIQETAKGNVRAIIMDMTNLMNVDTSGILALEELHKRLLSRGVELAMV  611

Query  434   NPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             NPRW VIHKL+LA F +KI K  VFLT+GEA+DACL  K
Sbjct  612   NPRWLVIHKLKLAHFVDKIGKQWVFLTVGEAVDACLSSK  650



>ref|XP_008453779.1| PREDICTED: low affinity sulfate transporter 3-like [Cucumis melo]
Length=658

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/648 (64%), Positives = 514/648 (79%), Gaps = 17/648 (3%)
 Frame = -1

Query  2252  TLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLS  2073
             T+ KTS++    A+RA WV N PEPPG+ R+L            T    L+ +   AV+ 
Sbjct  19    TVDKTSTS----ADRAQWVANPPEPPGICRELIQWLCDAMFPDPTKLFPLKNKTGTAVVG  74

Query  2072  AS-ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVP  1896
                + VFP+L WGK Y+L K K+D+LAGLTLASLCIPQSIGYA LA LDPQYGLYTS+VP
Sbjct  75    RLLKGVFPILCWGKSYNLGKFKNDILAGLTLASLCIPQSIGYANLAKLDPQYGLYTSIVP  134

Query  1895  PLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaaf  1716
             PL+YA++GSSREIAIGPVA+IS+L+ +M+ K++DPA++P  Y +LV T TFFAGIFQAAF
Sbjct  135   PLVYAILGSSREIAIGPVAIISMLLPTMIQKIQDPAADPFAYRNLVFTTTFFAGIFQAAF  194

Query  1715  gILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLH  1536
             G+ RLGFLVDFLS AAIVGFM GAAIVIGLQQLK L GI++FTNKTD++SV+  +F S H
Sbjct  195   GLFRLGFLVDFLSQAAIVGFMGGAAIVIGLQQLKGLLGITHFTNKTDIISVMEAVFASFH  254

Query  1535  H--SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             H    WNP N IIG SFLSFILIT+ LG+K++K+FWLPAMAPL+SVILSTLLV+LTRA+ 
Sbjct  255   HLNDQWNPLNFIIGTSFLSFILITKLLGKKYKKVFWLPAMAPLVSVILSTLLVFLTRADE  314

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
             HGVKIVK V  GLNP S   +  +TPHI Q++    IVAVVALTEAIAVG S ASMKGY+
Sbjct  315   HGVKIVKRVPPGLNPISTQNIQIHTPHISQILNAALIVAVVALTEAIAVGRSLASMKGYN  374

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             +DGNKEM+A+G  N+AGSLTSCY ATGS SRSAVNF AGCE+ VSNVVMAVTV+ISL++ 
Sbjct  375   IDGNKEMVALGFMNLAGSLTSCYTATGSLSRSAVNFSAGCETPVSNVVMAVTVMISLKMF  434

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             TKLLYFTP AILASIILSALPGL+++++AY+IWK+DKLDFLAC  AF GVLF SVE GLL
Sbjct  435   TKLLYFTPNAILASIILSALPGLVDIHQAYNIWKIDKLDFLACLAAFFGVLFLSVEFGLL  494

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +++ +SFAKI++ SI+PG E LG++PGTD  F  IHQYPMA+ TPGV ++R KS LLCFA
Sbjct  495   LSLVISFAKIIVISIKPGTEILGKIPGTDT-FCDIHQYPMALNTPGVLIVRVKSGLLCFA  553

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIA-LIVFDMSNIMNVDTSAIISLKELYDKI  465
             NANF+K RIL  +         ++E+S K IA  +V D+SN+MN+DTS I SL+EL++ +
Sbjct  554   NANFVKDRILRFI--------SSQEASGKGIAQFLVIDLSNLMNIDTSGIASLEELHNSL  605

Query  464   TSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
              + G++  +ANP+WQVIHKL++++F  K+KG+VFL++GEA+DACL  K
Sbjct  606   ATSGIEMAVANPKWQVIHKLKVSNFVAKLKGRVFLSVGEAVDACLSAK  653



>gb|ACO25294.1| low affinity sulfate transporter Bnst2-1 [Brassica napus]
Length=677

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/629 (64%), Positives = 502/629 (80%), Gaps = 3/629 (0%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R+ W+L+ PEPP   ++L+   K++       F+ LRK+P+ + +L   ++VFP+  W 
Sbjct  47    DRSKWLLDCPEPPSPWQELKTQVKESYLTKAKKFKSLRKQPLPKRILFILQAVFPIFGWC  106

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+SREI
Sbjct  107   RNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYALMGTSREI  166

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+SSM+ KL DP ++P GY  LVLT TFFAGIFQA+FGI RLGFLVDFLS
Sbjct  167   AIGPVAVVSLLVSSMLQKLIDPETDPLGYKKLVLTTTFFAGIFQASFGIFRLGFLVDFLS  226

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSV   ++ S H   W+P+  I+G 
Sbjct  227   HAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVPRAVWRSCHQQ-WSPHTFILGC  285

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G+K++KLFWLPA+APL+SV++STL+V+LT+A+ HGVK VKH+KGGLNP
Sbjct  286   SFLSFILITRFIGKKNKKLFWLPAIAPLISVVVSTLMVFLTKADEHGVKTVKHIKGGLNP  345

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S++ L FNTPH+  + KIG IVA+VALTEAIAVG SFA +KGY LDGNKEM+AIG  N+
Sbjct  346   ISINDLEFNTPHLGHIAKIGLIVAIVALTEAIAVGRSFAGIKGYRLDGNKEMVAIGFMNV  405

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV ++L+ LT+LLY+TP+AILASI
Sbjct  406   IGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFVALECLTRLLYYTPIAILASI  465

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+ +EA  IWK+DKLDFLA  GAF  VLF SVEIGLLVAV +SFAKI+L SI
Sbjct  466   ILSALPGLIDTDEAIHIWKIDKLDFLALIGAFFAVLFGSVEIGLLVAVVISFAKIILISI  525

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE LGR+PGTD  F    QYPM+V+TPGV + R KS+LLCFANA  I+ RI+  + +
Sbjct  526   RPGIETLGRMPGTDT-FADTDQYPMSVKTPGVLIFRVKSALLCFANAGSIEERIMGWIRQ  584

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  + TK ++++ I  +V DMSN++NVDTS I +L EL + +   GV+ VI NP+W V
Sbjct  585   EEEGDENTKSNAKRNILFVVLDMSNLINVDTSGITALVELNNNLIQNGVELVIVNPKWTV  644

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL    F +KI GKV+LTIGEA+DAC 
Sbjct  645   IHKLNQTKFISKIGGKVYLTIGEAVDACF  673



>ref|XP_002284234.2| PREDICTED: low affinity sulfate transporter 3 [Vitis vinifera]
 ref|XP_010664300.1| PREDICTED: low affinity sulfate transporter 3 [Vitis vinifera]
 ref|XP_010664301.1| PREDICTED: low affinity sulfate transporter 3 [Vitis vinifera]
 emb|CBI19121.3| unnamed protein product [Vitis vinifera]
Length=664

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/658 (63%), Positives = 513/658 (78%), Gaps = 15/658 (2%)
 Frame = -1

Query  2288  TAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATF-----L  2124
             T  L +P E  Q L     +     +RA WVLN PEPPGL  ++  S K +A F      
Sbjct  6     TETLSMPMEQQQQLNIEDGS---KTQRAEWVLNSPEPPGLCHEIVSSIK-SAVFPNGGKH  61

Query  2123  GTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAA  1944
              ++  +  +     V+S    +FP+L+WG+ Y   K ++D++AGLTLASL IPQSIGYA 
Sbjct  62    SSSSTKQTRSTAAGVVSFLYGLFPILTWGRNYKATKFRNDLMAGLTLASLSIPQSIGYAT  121

Query  1943  LANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTS  1764
             LANL PQYGLYTSVVPPL+YA+MGSSREIAIGPVAV+SLL+SSM+  + DP +N   Y  
Sbjct  122   LANLAPQYGLYTSVVPPLVYALMGSSREIAIGPVAVVSLLLSSMIQNVVDPVANAVAYRK  181

Query  1763  LVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTN  1584
             LVLTVTFFAG FQ  FG+ RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GIS+FT 
Sbjct  182   LVLTVTFFAGTFQFIFGLFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGISHFTT  241

Query  1583  KTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSV  1404
             KTDVVSVL  +F SLHH  W P N ++G SFL FIL TRF+G++++KLFWLPA+APL+SV
Sbjct  242   KTDVVSVLEAVFRSLHHQ-WYPLNFVLGCSFLIFILFTRFIGRRNKKLFWLPAIAPLISV  300

Query  1403  ILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEA  1224
             +LST +V+LT+A+ HGVKIVKH+K GLNP S H+L F+  H+ Q  KIG + A+VALTEA
Sbjct  301   VLSTAIVFLTKADEHGVKIVKHIKRGLNPISAHELQFSGQHVGQAAKIGLVSAIVALTEA  360

Query  1223  IAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSN  1044
             IAVG SFAS++GYHLDGNKEM+A+G  NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN
Sbjct  361   IAVGRSFASIRGYHLDGNKEMVAMGFMNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSN  420

Query  1043  VVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGA  864
             +VMA+ V +SL+LLT+LLYFTP+AILASIILSALPGLI++ EAY IWKVDK+DFLACAGA
Sbjct  421   IVMAIAVFLSLELLTRLLYFTPIAILASIILSALPGLIDIPEAYHIWKVDKMDFLACAGA  480

Query  863   FAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPG  684
             F GVLF SVEIGLL AV +SFAKI+LNSI+P +E LG+LPGTD +F  I+QYPMA++TPG
Sbjct  481   FFGVLFVSVEIGLLAAVTISFAKIILNSIRPSVEGLGKLPGTD-IFCDINQYPMAIKTPG  539

Query  683   VFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDT  504
             + ++R  S LLCFANANF++ RI+  V E+    +E KE+S++R   ++ DMS +MN+DT
Sbjct  540   ILIVRINSGLLCFANANFVRERIMKRVTEKD---EEGKENSKERTQAVILDMSTVMNIDT  596

Query  503   SAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             S I +L+E+Y+K+ S  +   +ANPRWQVIHKL+LA   +KI K  +FL++GEA+DAC
Sbjct  597   SGICALQEVYNKLVSHNIHLAVANPRWQVIHKLKLAKVVDKIGKDWIFLSVGEAVDAC  654



>ref|XP_002302276.1| Low affinity sulfate transporter 3 family protein [Populus trichocarpa]
 gb|EEE81549.1| Low affinity sulfate transporter 3 family protein [Populus trichocarpa]
Length=635

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/633 (63%), Positives = 506/633 (80%), Gaps = 10/633 (2%)
 Frame = -1

Query  2207  ASWVLNVPEPPGLSRKLEGSFKKTATFLG---TAFQRLRKRPVQAVLSASESVFPLLSWG  2037
             A WVLN P+PPGL ++L  S ++     G   T+    RK+  +A +   + VFP+L WG
Sbjct  2     AQWVLNSPDPPGLLQELGSSVREIIFPHGKKHTSSTARRKQQSRA-MEFLQGVFPILRWG  60

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y     K+D++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MGSSREI
Sbjct  61    RDYKASMFKNDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYAIMGSSREI  120

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+S+L+SSM+ +++DP ++P  Y + V TVT FAG FQA FG+ RLGFLVDFLS
Sbjct  121   AIGPVAVVSMLLSSMIGEIQDPLADPVAYRNFVFTVTLFAGTFQAIFGLFRLGFLVDFLS  180

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HA+IVGFM GAAIVIGLQQLK L GIS+FT KTDVVSVL   FTS+ H PW+P N ++G 
Sbjct  181   HASIVGFMGGAAIVIGLQQLKGLLGISHFTTKTDVVSVLHSAFTSIDH-PWSPLNFVLGC  239

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFL F+LI RF+G++++KLFW PA+APL+SVILSTL+V+LT+A+ HGVKIV+H+KGGLN 
Sbjct  240   SFLIFLLIARFIGRRNKKLFWFPAIAPLVSVILSTLIVFLTKADKHGVKIVRHIKGGLNR  299

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             SS+H L  + P + Q  KIG I A+VALTEAIAVG SFAS+KGYH+DGNKEMLA+G  NI
Sbjct  300   SSVHDLQLSGPQVGQAAKIGLISAIVALTEAIAVGRSFASIKGYHIDGNKEMLALGFMNI  359

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
             AGSL+SCYVATGSFSR+AVNF AGC++ VSN+VM++TVL+SL++ T+LLY+TP AILASI
Sbjct  360   AGSLSSCYVATGSFSRTAVNFSAGCQTLVSNIVMSITVLVSLEVFTRLLYYTPTAILASI  419

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI++  AY IWKVDKLDF+AC GAF GVLFASVEIGLL AV +SFA+I+LN+I
Sbjct  420   ILSALPGLIDIRGAYYIWKVDKLDFIACIGAFFGVLFASVEIGLLAAVTISFARILLNAI  479

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE LGRLP  D ++  ++QYPMAV+TPG+  +R  S+LLCFANANFI+ RIL  V E
Sbjct  480   RPGIEALGRLPRAD-VYCDMNQYPMAVKTPGILAVRINSALLCFANANFIRERILRWVTE  538

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E    +E KES+E  I  ++ DMSN+MN+DT+ I++L+EL+ ++     Q  IANP+WQV
Sbjct  539   E---VNEIKESTEGGIQAVILDMSNVMNIDTAGILALEELHKELLIHEAQLAIANPKWQV  595

Query  416   IHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             IHKLRLA F ++I +G +FLT+ EA+DAC+  K
Sbjct  596   IHKLRLAKFIDRIGRGWIFLTVSEAVDACVSSK  628



>ref|XP_004149160.1| PREDICTED: sulfate transporter 2.1-like [Cucumis sativus]
 gb|KGN53230.1| hypothetical protein Csa_4G031010 [Cucumis sativus]
Length=658

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/651 (63%), Positives = 513/651 (79%), Gaps = 18/651 (3%)
 Frame = -1

Query  2258  SQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAV  2079
             S T+  TS+     A+RA WV N P+PPG+ R L    ++T     T    L+ +   AV
Sbjct  16    STTVDNTST----PADRARWVANPPDPPGICRDLIDWLRQTMFPDPTKLFPLKNKTGTAV  71

Query  2078  LSAS-ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             L    + VFP+L WG+ Y+L K K+DVLAGLTLASLCIPQSIGYA LA LDPQYGLYTS+
Sbjct  72    LGRVLKGVFPILCWGQSYNLGKFKNDVLAGLTLASLCIPQSIGYANLAKLDPQYGLYTSI  131

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPL+YA++GSSREIAIGPVA+IS+L+ +M+ K++DPA++P  Y +LV T TFFAGIFQA
Sbjct  132   VPPLVYAILGSSREIAIGPVAIISMLLPTMIQKIQDPAADPFAYRNLVFTTTFFAGIFQA  191

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
             AFG+ RLGF+VDFLS AAIVGFM GAAIVIGLQQLK L GI++FTNKTD++SV+  +F S
Sbjct  192   AFGLFRLGFMVDFLSQAAIVGFMGGAAIVIGLQQLKGLLGITHFTNKTDIISVMEAVFAS  251

Query  1541  LHH---SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTR  1371
              HH     WNP N IIG SFLSFILIT+ LG+K++K+FWLPAMAPL+SVILSTLLV+LTR
Sbjct  252   FHHLNNDQWNPLNFIIGSSFLSFILITKLLGKKYKKVFWLPAMAPLVSVILSTLLVFLTR  311

Query  1370  AENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMK  1191
             A+ HGVKIVK V  GLNP S   +  +TPHI Q++    IVAVVALTEAIAVG S ASMK
Sbjct  312   ADEHGVKIVKRVPPGLNPISTQNIQIHTPHISQILNAALIVAVVALTEAIAVGRSLASMK  371

Query  1190  GYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISL  1011
             GY++DGNKEM+A+G  N+AGSLTSCY ATGS SRSAVNF AGCE+ VSNVVMAVTV+ISL
Sbjct  372   GYNIDGNKEMVALGFMNLAGSLTSCYTATGSLSRSAVNFSAGCETPVSNVVMAVTVMISL  431

Query  1010  QLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEI  831
             ++ TKLLYFTP AILASIILSALPGL+++++AY+IWK+DKLDFLAC  AF GVLF SVE 
Sbjct  432   KMFTKLLYFTPNAILASIILSALPGLVDIHQAYNIWKIDKLDFLACLAAFFGVLFLSVEF  491

Query  830   GLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLL  651
             GLL+++ +SFAKI++ SI+PG E LG++PGTD  F  IHQYPMA+ TPGV ++R KS LL
Sbjct  492   GLLLSLVISFAKIIVTSIKPGTEILGKIPGTDT-FCDIHQYPMALNTPGVLIVRVKSGLL  550

Query  650   CFANANFIKARILSLVMEEQKSADETKESSEKRIA-LIVFDMSNIMNVDTSAIISLKELY  474
             CFANANF+K RIL  +         ++E+S K I   +V D+SN+MN+DTS I SL+EL+
Sbjct  551   CFANANFVKDRILRFI--------SSQEASGKGITQFLVIDLSNLMNIDTSGIASLEELH  602

Query  473   DKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
               + + G++  IANP+WQVIHKL++++F  K+KG+VFL++GEA+DACL  K
Sbjct  603   KNLATSGIEMAIANPKWQVIHKLKVSNFVAKLKGRVFLSVGEAVDACLSAK  653



>emb|CDX96981.1| BnaC09g46440D [Brassica napus]
Length=676

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/641 (63%), Positives = 512/641 (80%), Gaps = 7/641 (1%)
 Frame = -1

Query  2240  TSSTLPPAAE---RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLS  2073
             +S+  PP  +   R+ W+L+ PEPP    +L+   K++       F+ L+K+P+ + +LS
Sbjct  35    SSAAAPPRQDQHDRSKWLLDCPEPPSPWHELKSQVKESFLTKAKRFKSLQKQPLPKRILS  94

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               ++VFP+  W + Y L+  K+D++AGLTLASLCIPQSIGYA LA LDPQYGLY+SVVPP
Sbjct  95    ILQAVFPIFGWCRNYKLIMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYSSVVPP  154

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYA+MG+SRE+AIGPVAV+SLL+SSM+ +L DP ++P GYT LVLT TFFAGIFQA+FG
Sbjct  155   LIYALMGTSREVAIGPVAVVSLLLSSMLQELIDPETDPLGYTKLVLTTTFFAGIFQASFG  214

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             I RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S H 
Sbjct  215   IFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRTVWRSCHQ  274

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
               W+P+  I+G SFLSFILI RF+G+K++KLFWLPA+APL+SV++STL+V+LT+A+ HGV
Sbjct  275   Q-WSPHTFILGCSFLSFILIARFIGKKNKKLFWLPAIAPLISVVVSTLMVFLTKADEHGV  333

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             K V+H+KGGLNP S++ L FNTPH+  + KIG IVAVVALTEAIAVG SFA +KGY LDG
Sbjct  334   KTVRHIKGGLNPISINDLEFNTPHLGHIAKIGLIVAVVALTEAIAVGRSFAGIKGYRLDG  393

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+AIG  N+ GSLTSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV ++L+ LT+L
Sbjct  394   NKEMVAIGFMNVLGSLTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFVALECLTRL  453

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP+AILASIILSALPGLI++NEA  IWK+DKLDFLA  GAF GVLF SVEIGLLVAV
Sbjct  454   LYYTPIAILASIILSALPGLIDINEAIHIWKIDKLDFLALIGAFFGVLFGSVEIGLLVAV  513

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SFAKI+L SI+PGIE LGR+PGTD +F    QYPM+V+TP V + R KS+LLCFANA+
Sbjct  514   VISFAKIILISIRPGIETLGRIPGTD-IFADTDQYPMSVKTPRVLICRVKSALLCFANAS  572

Query  632   FIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCG  453
              I+ RI+  + EE++  + T  + E++I  +V DMSN+MNVDTS I +L EL++ +   G
Sbjct  573   SIEERIMRWINEEEED-ENTMSNDERKILFVVLDMSNLMNVDTSGITALVELHNNLIQIG  631

Query  452   VQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             ++ VI NP+W V HKL  A F +KI G+V+LTI EA+DAC 
Sbjct  632   IELVIVNPKWHVFHKLNQAKFVSKIGGRVYLTIREALDACF  672



>ref|XP_009593440.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
tomentosiformis]
Length=651

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/650 (63%), Positives = 504/650 (78%), Gaps = 13/650 (2%)
 Frame = -1

Query  2261  FSQTLQK--TSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV  2088
             FS  LQ+   +ST     ER  W+L  P PP L  +   + K+T    G   ++ RK   
Sbjct  9     FSIELQQLDAASTDTARKERTQWLLTSPNPPSLCHEFINTVKETVLPHGKTTKQSRK---  65

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
              A  S  + +FP+L WG+ Y   K K D++AGLTLASLCIPQSIGYA LA LDPQYGLYT
Sbjct  66    GAFFSFMQGLFPILKWGRNYKATKFKHDLMAGLTLASLCIPQSIGYANLAKLDPQYGLYT  125

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SVVPPLIYA+MGSSREIAIGPVAV+SLL+ +MVPKL DPA +P  Y +LV T TFF G F
Sbjct  126   SVVPPLIYAMMGSSREIAIGPVAVVSLLLFAMVPKLVDPAVDPIAYRNLVFTATFFTGAF  185

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QA FG+ RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI++FT +TDVVSVL  +F
Sbjct  186   QAVFGLFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGINHFTTQTDVVSVLVAVF  245

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              S H+ PW P N I+G SFL FILITRF+G++++K+FWLPAMAPL+SVILSTL+VYL++A
Sbjct  246   KSFHNEPWFPLNFILGCSFLVFILITRFIGKRNKKMFWLPAMAPLVSVILSTLIVYLSKA  305

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + HGVKIVKH KGGL PSS+HQL F  PHI +V KIG I A+VALTEAIAVG SFAS+KG
Sbjct  306   DQHGVKIVKHFKGGLPPSSVHQLQFKDPHIGEVAKIGLICAIVALTEAIAVGRSFASIKG  365

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             YHLDGNKEM A+G  N+ GSLTSCY+ATGSFSR+AVNF AGCE+ VSN+VMA+TVLISL+
Sbjct  366   YHLDGNKEMTAMGCMNVVGSLTSCYIATGSFSRTAVNFSAGCETVVSNIVMAITVLISLE  425

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             LLTKLLY+TP+AILASII+SALPGLI++NEA  IWKVDK DF+ C   F GVLF SVEIG
Sbjct  426   LLTKLLYYTPLAILASIIISALPGLIDINEACHIWKVDKTDFIICIATFFGVLFGSVEIG  485

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             LL+AVG+SF KI++++I+P +E  GRLPGT   F  I Q+P+A +TPG+ +IR  ++ LC
Sbjct  486   LLIAVGISFGKIIVDTIRPSVELQGRLPGTYT-FCDITQFPVAAETPGILIIRVNNASLC  544

Query  647   FANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDK  468
             FANANFI+ R+L LV  +  S   TKE    ++ ++V DMSN+MNVDTS I++L+EL+ +
Sbjct  545   FANANFIRQRVLRLV--KHTSEGHTKE----KVNVLVLDMSNVMNVDTSGIVALEELHRE  598

Query  467   ITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             + S G+Q  IA+P W+VI+KL+ A   +KI KG +FLT+G+A+D CL  K
Sbjct  599   LVSQGIQLGIASPSWKVINKLKAAKLLDKIGKGWIFLTVGDAVDGCLNSK  648



>emb|CAG17931.1| plasma membrane sulphate transporter [Brassica oleracea var. 
viridis]
Length=677

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/629 (64%), Positives = 502/629 (80%), Gaps = 3/629 (0%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R+ W+L+ PEPP    +L+   K++       F+ LRK+P+ + +L   ++VFP+  W 
Sbjct  47    DRSKWLLDGPEPPSPWHELKTQVKESYLTKAKKFKSLRKQPLPKRILFILQAVFPIFGWC  106

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+SREI
Sbjct  107   RNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYALMGTSREI  166

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVA +SLL+SSM+ KL DP ++P  Y  LVLT TFFAGIFQA+FGI RLGFLVDFLS
Sbjct  167   AIGPVAAVSLLVSSMLQKLIDPETDPLSYKKLVLTTTFFAGIFQASFGIFRLGFLVDFLS  226

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQ+LK L GI+NFT  TD+VSVL  ++ S H   W+P+  I+G 
Sbjct  227   HAAIVGFMGGAAIVIGLQRLKGLLGITNFTTNTDIVSVLRAVWRSCHQQ-WSPHTFILGC  285

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G+K++KLFWLPA+APL+SV++STL+V+LT+A+ HGVK VKH+KGGLNP
Sbjct  286   SFLSFILITRFIGKKNKKLFWLPAIAPLISVVVSTLMVFLTKADEHGVKTVKHIKGGLNP  345

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S++ L FNTPH+  + KIG IVA+VALTEAIAVG SFA +KGY LDGNKEM+AIG  N+
Sbjct  346   ISINDLEFNTPHLGHIAKIGLIVAIVALTEAIAVGRSFAGIKGYRLDGNKEMVAIGFMNV  405

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGS SR+AVNF AGCE+A+SN+VMAVTV I+L+ LT+LLY+TP+AILASI
Sbjct  406   IGSFTSCYAATGSSSRTAVNFAAGCETAMSNIVMAVTVFIALECLTRLLYYTPIAILASI  465

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+++EA  IWK+DKLDFLA  GAF GVLF SVEIGLLVAV +SFAKI+L SI
Sbjct  466   ILSALPGLIDIDEAIHIWKIDKLDFLALIGAFFGVLFGSVEIGLLVAVVISFAKIILISI  525

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE LGR+PGTD  F    QYPM+V+TPGV + R KS+LLCFANA+ I+ RI+  + +
Sbjct  526   RPGIETLGRMPGTDT-FADTDQYPMSVKTPGVLIFRVKSALLCFANASSIEERIMGWIRQ  584

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  + TK  +++ I  +V DMSN++NVDTS I +L EL++ +   GV+ VI NP+W V
Sbjct  585   EEEGDENTKSDAKRNILFVVLDMSNLINVDTSGITALVELHNNLIQNGVELVIVNPKWTV  644

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL    F NKI GKV+LTIGEA+DAC 
Sbjct  645   IHKLNQTKFINKIGGKVYLTIGEALDACF  673



>ref|XP_010547619.1| PREDICTED: sulfate transporter 2.1 [Tarenaya hassleriana]
Length=687

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/629 (64%), Positives = 504/629 (80%), Gaps = 4/629 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             ER+ W+L+ PEPP    +L+   K T        + LR +PV + V    ++VFP+  W 
Sbjct  58    ERSKWLLDCPEPPSPWLELKNQVKGTIAPRAKRLKSLRSQPVPERVFVILKAVFPIFGWC  117

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             K Y     K+D++AGLTLASLCIPQSIGYA LA LDPQYGLY+SVVPPLIYA MG+SREI
Sbjct  118   KNYKASMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYSSVVPPLIYAFMGTSREI  177

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLLISSM+ KL DP ++P GY  LVLT TFFAG+FQA+FG+ RLGFLVDFLS
Sbjct  178   AIGPVAVVSLLISSMLQKLIDPETDPTGYKKLVLTATFFAGVFQASFGLFRLGFLVDFLS  237

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFMAGAAIVIGLQQLK L GISNFT KTD++SVL  ++ S     W+P+  I+G 
Sbjct  238   HAAIVGFMAGAAIVIGLQQLKGLLGISNFTTKTDIISVLRAVWHSCQQQ-WSPHTFILGS  296

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFL FILI RF+G+K +KLFW+PA+APL+SVI+ST +V++T+A+ HGVK V+H+KGGLNP
Sbjct  297   SFLIFILIARFIGKKKKKLFWIPAIAPLVSVIVSTFMVFITKADEHGVKTVRHIKGGLNP  356

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S+H L FN P I +V KIG IV+VVALTEAIAVG SFA +KGY LDGNKEM+AIG  NI
Sbjct  357   VSVHDLEFNNPRIGEVAKIGLIVSVVALTEAIAVGRSFAGIKGYRLDGNKEMVAIGFMNI  416

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGSFSR+AVN+ AG E+A+SN+VMAVTVL++LQ LTKLL++TP+AILAS+
Sbjct  417   LGSFTSCYTATGSFSRTAVNYAAGSETAMSNIVMAVTVLVALQCLTKLLFYTPIAILASV  476

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+LNEAY IWK+DK DFL+C GAF GVLFASVEIGLLVAV +SFAKI+L SI
Sbjct  477   ILSALPGLIDLNEAYRIWKLDKFDFLSCIGAFFGVLFASVEIGLLVAVAISFAKIILVSI  536

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE LGR+PGT+ +F    QYPMAV+ PGVF++R KS+LLCFANANFI+ RI+  V E
Sbjct  537   RPGIETLGRMPGTN-IFADTDQYPMAVKIPGVFIVRVKSALLCFANANFIRERIVRWVNE  595

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  D T+ +++  + L+V D+SN++N+DTS I +L+EL++ +T  GV+  I NP+W+V
Sbjct  596   EEEEQD-TEGNTQTNVFLVVLDVSNLINIDTSGIATLEELHNNLTKHGVELAIVNPKWEV  654

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL  A F ++I GKV+LTIGEA+DAC 
Sbjct  655   IHKLSQAKFVDRIGGKVYLTIGEALDACF  683



>gb|ABK35755.1| sulfate transporter [Populus tremula x Populus alba]
Length=585

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/586 (67%), Positives = 488/586 (83%), Gaps = 8/586 (1%)
 Frame = -1

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
             + V+S   ++FP+  W + Y     K+D+LAGLTLASLCIPQSIGYA LA LDPQYGLYT
Sbjct  1     KTVISFLHAIFPIFCWCRSYKATNFKNDLLAGLTLASLCIPQSIGYATLAKLDPQYGLYT  60

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SV+PPLIYAVMG+SR+IAIGPVA ++LL++SM+ KL DP +NP  Y +LVLT TFFAGIF
Sbjct  61    SVIPPLIYAVMGTSRDIAIGPVAAVTLLLTSMISKLVDPVANPIPYRNLVLTTTFFAGIF  120

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QAAFG+ RLGFLVDFLSHAAIVGF+AGAA+VIGLQQ+K L GI++FTNKTDV+SV+  I+
Sbjct  121   QAAFGLFRLGFLVDFLSHAAIVGFVAGAAVVIGLQQMKGLLGITHFTNKTDVISVMEAIW  180

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              ++HHS  NP+N I+G SFL+FILITRF G+++RKLFWLPA+APL+SV+LSTLLVYLTRA
Sbjct  181   RAVHHSR-NPHNFILGCSFLTFILITRF-GRRNRKLFWLPAIAPLISVVLSTLLVYLTRA  238

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + HG+ I+KH+K GLN SS+HQL FN+PHI +V KIG IVAVVALTEAIAVG SFAS+KG
Sbjct  239   DKHGIMIIKHIKRGLNRSSVHQLQFNSPHIGEVAKIGLIVAVVALTEAIAVGRSFASIKG  298

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             YH++GN+EM+A+G  NI GS TSCYVATGSFSRSAVNF AGCE+A+SN+VMA+TV+ISL+
Sbjct  299   YHINGNQEMVAMGFMNILGSFTSCYVATGSFSRSAVNFSAGCETAMSNIVMAITVIISLE  358

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             L T+LLY+TP+AILA+IILSALPGL++L+EAY+IWK+DKLDFLACAGAF GVLFASVEIG
Sbjct  359   LFTRLLYYTPIAILAAIILSALPGLVDLHEAYNIWKIDKLDFLACAGAFVGVLFASVEIG  418

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             LL AV +SF KI++ SI+PG E LGRLP TD +F  + QYPMA + P V VIR KS LLC
Sbjct  419   LLAAVTISFVKILIISIRPGAEVLGRLPETD-IFCDVDQYPMAAKNPQVLVIRVKSGLLC  477

Query  647   FANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDK  468
             FANANF+K +I+ L  EE     E     ++ + +++ DMSN+MN+D S I SL EL+  
Sbjct  478   FANANFVKEKIMKLATEE-----EEGRKGKRTVQVVILDMSNLMNIDVSGITSLVELHKN  532

Query  467   ITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             + S G++  I NP+WQVIHKLR+A+F  KI G+VFLTIGEA+DACL
Sbjct  533   LASSGMELAITNPKWQVIHKLRVANFVTKIGGRVFLTIGEAVDACL  578



>ref|XP_010261212.1| PREDICTED: low affinity sulfate transporter 3-like [Nelumbo nucifera]
Length=659

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/634 (63%), Positives = 508/634 (80%), Gaps = 6/634 (1%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWG  2037
             A RA WVLN PEPPG  R+L+ +    A  L ++  +  K   + VLS  +++FP+L WG
Sbjct  24    AVRAQWVLNTPEPPGAWRELKQTVFHRANKLRSSCSQ--KGVSKCVLSVLKNIFPILHWG  81

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y   K K+D++AGLTLASL IPQSIGYA+LA LDPQYGLYTSVVPPL+Y++MGSSREI
Sbjct  82    RNYKATKFKNDLMAGLTLASLSIPQSIGYASLAKLDPQYGLYTSVVPPLVYSLMGSSREI  141

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+S+L+SS+V K+ DP ++P  Y + V+TVTFFAG FQA FG+ RLGFLVDFLS
Sbjct  142   AIGPVAVVSMLLSSLVQKVIDPVADPTAYRNFVITVTFFAGFFQAVFGLFRLGFLVDFLS  201

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFMAGAAIVIGLQQLK L GI +FTNKTDV+SV+  +  SLHH PW+P N ++G 
Sbjct  202   HAAIVGFMAGAAIVIGLQQLKGLLGIDHFTNKTDVISVMQAVLRSLHH-PWSPLNFVLGC  260

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFL FIL  RF+G+K+RKLFW+PA+APL+SV+LSTL+V++TRA+ HGVKI+KH++GG+NP
Sbjct  261   SFLIFILAMRFVGRKNRKLFWVPALAPLISVVLSTLIVFVTRADKHGVKIIKHLEGGINP  320

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S+ ++  N PH+ +  KIG I A++ALTEAIAVG SFAS++GY LDGNKEM+A+GV NI
Sbjct  321   XSVKEIELNGPHVGEAAKIGLISAIIALTEAIAVGRSFASVRGYQLDGNKEMVAMGVMNI  380

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
             AGSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+ VL++LQ+LT LLYFTP+AILASI
Sbjct  381   AGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAIAVLVALQILTTLLYFTPIAILASI  440

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+ NEAY+IWKVDKLDFL+C GAF GVLF SVEIGLLVAV +SF K++LN+I
Sbjct  441   ILSALPGLIDFNEAYNIWKVDKLDFLSCIGAFFGVLFGSVEIGLLVAVTISFGKVILNAI  500

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +P +E LG+LPGTD +F   +QYPMAV+  G  +IR  SS  CFANANFI+ RI+  V E
Sbjct  501   RPSMEFLGQLPGTD-IFCSTNQYPMAVKISGTLIIRIHSSYFCFANANFIRERIMRWVKE  559

Query  596   EQKSADETKESSEK-RIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
             + +  +E    + K R  +++ DMSN+MN+DTS II+L+EL+ ++ S G++  IANP W 
Sbjct  560   DSEEGEEEVNGNTKMRAQVLILDMSNLMNIDTSGIIALEELHKELVSRGIELAIANPCWN  619

Query  419   VIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             +IHKL+LA F +KI  G  FLTIGEA++ CL  K
Sbjct  620   IIHKLKLAKFVDKIGGGSFFLTIGEAVNTCLGSK  653



>ref|XP_004237881.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Solanum lycopersicum]
Length=653

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/650 (61%), Positives = 504/650 (78%), Gaps = 17/650 (3%)
 Frame = -1

Query  2261  FSQTLQKTSSTLPPAA-ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQ  2085
             FS  LQ+  +    A  +R  W+L  P PP    +L  S KK          R  KR   
Sbjct  9     FSIELQQLDAATDTARNQRTQWLLASPNPPNFFHQLINSVKKNV-------DRTTKRSTN  61

Query  2084  AVL-SASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
              V  S  + +FP+LSWG+ Y     K D++AGLTLASLCIPQSIGYA LA LDPQYGLY 
Sbjct  62    GVFFSFLKGLFPILSWGRNYKCTMFKHDIMAGLTLASLCIPQSIGYANLAKLDPQYGLYA  121

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SVVPPLIYAVMGSSREIAIGPVAV+SLLIS+++ K+ DPA +P  Y +LV T TFF G F
Sbjct  122   SVVPPLIYAVMGSSREIAIGPVAVVSLLISALISKIIDPAVDPIAYRNLVFTATFFTGAF  181

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QA FG+ RLGFLVDFLSH AIVGFM GAAIVIGLQQLK L GI++FT KTDVVSVL  ++
Sbjct  182   QAVFGLFRLGFLVDFLSHPAIVGFMGGAAIVIGLQQLKGLLGINHFTTKTDVVSVLEAVY  241

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              SLH+ PW P N ++G SFL FIL+TRF+G++++KLFWLPAMAPLLSV+LSTL+VYLT+A
Sbjct  242   KSLHNEPWFPLNFVLGVSFLFFILMTRFIGKRNKKLFWLPAMAPLLSVVLSTLIVYLTKA  301

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + HGV IVKH KGG+NPSS+HQL FN+PHI ++ KIG   A+VALTEAIAVG SFAS++G
Sbjct  302   DQHGVNIVKHFKGGVNPSSVHQLQFNSPHIGEIAKIGLTCAIVALTEAIAVGRSFASIRG  361

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             YHLDGNKEM+AIG  N+ GSLTSCY ATGSFSR+AVN+ AGCE+ VSN+VMA+TVLISL+
Sbjct  362   YHLDGNKEMVAIGCMNLVGSLTSCYTATGSFSRTAVNYSAGCETVVSNIVMAITVLISLE  421

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             LLTKLLY+TP+AILASII+SALPGLI++ EA+ IWKVDK DF+ C  AF GVLF SVEIG
Sbjct  422   LLTKLLYYTPLAILASIIISALPGLIDITEAFHIWKVDKTDFIICIAAFLGVLFGSVEIG  481

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             L++AVG+SF KI+L +I+P +E  GRLPGTD  F  I Q+P+A +T GV VIR  ++ LC
Sbjct  482   LIIAVGISFGKIILGTIRPSVELQGRLPGTDT-FCDITQFPVATETQGVLVIRVNNASLC  540

Query  647   FANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDK  468
             FANANFI+ RILS+V       + ++E S+ ++ ++V DMS++M++DTS I++L+EL  +
Sbjct  541   FANANFIRGRILSIV------TNRSEEQSKGKLRILVLDMSSVMSIDTSGIVALEELNRE  594

Query  467   ITSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACLVDK  321
             + S G+Q  IANPRW+V++KL++A F +++  + +FL++G+A+DACL  K
Sbjct  595   LVSQGIQLAIANPRWEVMNKLKVAKFVDELGNRWIFLSVGDAVDACLNAK  644



>ref|XP_010105877.1| Low affinity sulfate transporter 3 [Morus notabilis]
 gb|EXC06696.1| Low affinity sulfate transporter 3 [Morus notabilis]
Length=686

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/676 (62%), Positives = 519/676 (77%), Gaps = 20/676 (3%)
 Frame = -1

Query  2312  APTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERA-SWVLNVPEPPGLSRKLEGSFKKT  2136
             A TT      EL+        + +T++T     +RA   +LN PEPP L  +L  S K+T
Sbjct  9     AETTYAGGAVELQQLDVIEDHVGRTATTTNDHQKRAHDCLLNSPEPPSLFHQLLSSIKRT  68

Query  2135  ATFLGTAFQRLRKRPVQA----------VLSASESVFPLLSWGKQYSLVKLKSDVLAGLT  1986
                   A Q+ +K   +           + S   S+FP+L  G+ Y   K K D++AGLT
Sbjct  69    IF----AEQKNKKHSSKGNGKSTTSSGRLFSVLMSLFPILRLGRNYKASKFKHDLMAGLT  124

Query  1985  LASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVP  1806
             LASL IPQSIGYA LA LDPQYGLYTSVVPPLIYA+MGSSREIAIGPVAV+SLL+SS+VP
Sbjct  125   LASLSIPQSIGYANLAKLDPQYGLYTSVVPPLIYALMGSSREIAIGPVAVVSLLLSSLVP  184

Query  1805  KLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGL  1626
             +++DPA++P  YT LV TVTFFAGIFQ AFG  RLGFL+DFLSHAAIVGFMAGAAIVIGL
Sbjct  185   EMQDPATDPVAYTKLVFTVTFFAGIFQTAFGFFRLGFLIDFLSHAAIVGFMAGAAIVIGL  244

Query  1625  QQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHR  1446
             QQL+ L GI++FT  TDVVSVL  +F S  + PW+P N++IG SFL F+L+ R +G++++
Sbjct  245   QQLRGLIGITHFTTNTDVVSVLKSVFKSFVNEPWHPLNIVIGCSFLIFLLVARHIGRRNK  304

Query  1445  KLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVV  1266
             KLFW+PA+APLLSVILSTL+VYLT+A+ HGVKIVKH+ GGLNPSSLHQL    PH+ Q  
Sbjct  305   KLFWVPAIAPLLSVILSTLIVYLTKADKHGVKIVKHINGGLNPSSLHQLQLKGPHVAQTA  364

Query  1265  KIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRS  1086
             K G I A++ALTEAIAVG SFAS+KGYHLDGN EMLA+G  N+AGSLTSCYVATGSFSR+
Sbjct  365   KAGLICAIIALTEAIAVGRSFASIKGYHLDGNTEMLAMGFMNLAGSLTSCYVATGSFSRT  424

Query  1085  AVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSI  906
             AVNF AGCE+ VSN+VMAVTV  SLQLLTKLLY+TP+ ILASIILSALPGLI++NEA+ I
Sbjct  425   AVNFSAGCETVVSNIVMAVTVFASLQLLTKLLYYTPMTILASIILSALPGLIDINEAFHI  484

Query  905   WKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALF  726
             WK+DKLDFLAC GAF GVLFASVEIGLL+AV +SFAKI+L+SI+PG+E LGR+P TD  F
Sbjct  485   WKLDKLDFLACIGAFFGVLFASVEIGLLIAVAISFAKILLHSIRPGVEVLGRIPRTDT-F  543

Query  725   MGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIA  546
               I QYPMA + PG+ +IR  S LLCFANANF++ RI+  V +E+   D T+E+ +  + 
Sbjct  544   CEISQYPMAAKAPGILIIRIDSGLLCFANANFVRERIIKWVADEE---DATEETVKNIVQ  600

Query  545   LIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKG-K  369
             ++V DMSN+MN+DTS I SL+EL+ K+ S G+   +ANP+WQVIHKL+LA F +KI G +
Sbjct  601   VVVLDMSNVMNIDTSGISSLEELHKKLLSHGIGLAVANPKWQVIHKLKLAKFVDKIGGER  660

Query  368   VFLTIGEAIDACLVDK  321
             VF T+GEA++ CL  K
Sbjct  661   VFFTVGEAVEGCLGSK  676



>ref|XP_009591937.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
tomentosiformis]
Length=662

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/654 (64%), Positives = 502/654 (77%), Gaps = 13/654 (2%)
 Frame = -1

Query  2273  LPYE-FSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRK  2097
             LP E FS  LQ+  +      +R  W+LN P PP    ++  S   T T L         
Sbjct  4     LPNESFSIELQQLDAD-DGRNQRTQWLLNSPAPPSFCNEIINSV--TETVLPQKNNNFSS  60

Query  2096  RPVQ----AVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLD  1929
                Q    AV S  + +FP+LSWG+ Y +   K D+LAGLTLASLCIPQSIGYA LANL+
Sbjct  61    NSKQYGGGAVSSFLQGLFPILSWGRNYKVKMFKHDLLAGLTLASLCIPQSIGYANLANLE  120

Query  1928  PQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTV  1749
             PQYGLYTSVVPPLIYAVMGSSRE+AIGPVAV+SLL+S+M+ ++ DPA +P  YTSLV TV
Sbjct  121   PQYGLYTSVVPPLIYAVMGSSRELAIGPVAVVSLLLSAMITEIVDPAVDPIAYTSLVFTV  180

Query  1748  TffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVV  1569
             TFFAG FQAAFG+LRLGFLVDFLSHAAIVGFM GAAIVIGLQQLK   GIS+FT KTDVV
Sbjct  181   TFFAGTFQAAFGLLRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGFIGISHFTTKTDVV  240

Query  1568  SVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTL  1389
             SVL  +FTS H+   +P N ++G SFL FIL TRF+G++++KLFWLPA+APLLSV+LSTL
Sbjct  241   SVLKAVFTSFHNETLSPLNFVLGCSFLIFILATRFIGKRNKKLFWLPAIAPLLSVLLSTL  300

Query  1388  LVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGG  1209
             +VYLT+A+ HGVKIVKH KGGLNPSS+HQL FN PH+ +V KIG I A+VALTEAIAVG 
Sbjct  301   MVYLTKADRHGVKIVKHFKGGLNPSSVHQLQFNGPHLGEVAKIGLICALVALTEAIAVGR  360

Query  1208  SFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAV  1029
             SFASMKGYHLDGNKEM+A+G  NI GSL+SCY ATGSFSR+AVNF AGCE+ VSN+VMA+
Sbjct  361   SFASMKGYHLDGNKEMVAMGFMNIVGSLSSCYTATGSFSRTAVNFSAGCETVVSNIVMAI  420

Query  1028  TVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVL  849
             TV ISL+LLTKLLY+TP+AILAS+ILSALPGLI++NEAY IWKVDK+DFL C GAF GVL
Sbjct  421   TVFISLELLTKLLYYTPLAILASVILSALPGLIDINEAYHIWKVDKMDFLVCIGAFFGVL  480

Query  848   FASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIR  669
             F SVEIGLLVAV +SFA+I++++I+   E  GRLPGT   F  I QYP A  T G+ +IR
Sbjct  481   FVSVEIGLLVAVSISFARIIVDTIRASTEVQGRLPGTTDTFCDITQYPGATGTSGILIIR  540

Query  668   TKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIIS  489
               S  LCFANA  I+ R+L LV E   S + TKE+    +  +V DMSN+M+VDTS I  
Sbjct  541   INSGSLCFANATSIRERMLKLVTEANGSEENTKEN----VHFLVLDMSNVMSVDTSGIAV  596

Query  488   LKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
             L+EL+ ++ S  +Q  IANPR +VI+K++ A   +K+ KG +FLTIG+AIDACL
Sbjct  597   LEELHRELVSRSIQLAIANPRLRVINKMKTAKCFDKLGKGWIFLTIGDAIDACL  650



>ref|XP_009345531.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Pyrus x bretschneideri]
Length=707

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/673 (62%), Positives = 531/673 (79%), Gaps = 13/673 (2%)
 Frame = -1

Query  2336  KYLAGMAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKL  2157
             K+L  MA  PT   E+ + +EL  +  Q  + TS      AERA W+L+ P+PPGL ++L
Sbjct  40    KFLTTMASLPT---EIFSTVELQQQHRQA-EDTSGR----AERAQWLLSSPDPPGLWQQL  91

Query  2156  EGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLAS  1977
                 K      G  + + +K P     S    +FP+LSWG+ Y   K K+DV+AGLTLAS
Sbjct  92    IHGIKSNLLPQGNTYSK-QKTPANRAFSLFRGLFPILSWGRNYKASKFKNDVMAGLTLAS  150

Query  1976  LCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLE  1797
             L +PQSIGYA LA LDPQYGLYTS+VPPLIY++MGSSRE+AIGPVAV+S+L+ S++ K+E
Sbjct  151   LSVPQSIGYANLAKLDPQYGLYTSIVPPLIYSLMGSSRELAIGPVAVVSMLLPSLIQKIE  210

Query  1796  DPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQL  1617
             DP +NP  Y +LV TVTFFAGIFQAAFGI RLGFLVDFLSHAAIVGFMAGAAI+IGLQQL
Sbjct  211   DPVANPIAYRNLVFTVTFFAGIFQAAFGIFRLGFLVDFLSHAAIVGFMAGAAIIIGLQQL  270

Query  1616  KPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLF  1437
             K L GIS+FT  TD++SVL  +F S+ H PW+P N+++G +FL F+LI RF+G++++KLF
Sbjct  271   KGLLGISHFTTNTDIISVLESVFDSIVHEPWHPLNIVLGCAFLIFLLIARFIGKRNKKLF  330

Query  1436  WLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIG  1257
             W+PA+APL+SVILSTL+VYLT+A+ HGV +VKH+KGGLNPSS HQL    PH+ Q  K G
Sbjct  331   WVPAIAPLISVILSTLIVYLTKADKHGVNVVKHIKGGLNPSSAHQLQLRGPHVGQAAKAG  390

Query  1256  FIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVN  1077
              I A++AL EAIAVG SFA++KGYHLDGNKEMLA+G  NIAGSLTSCYVATGSFSR+AVN
Sbjct  391   LISAIIALAEAIAVGRSFAAIKGYHLDGNKEMLAMGCMNIAGSLTSCYVATGSFSRTAVN  450

Query  1076  FYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKV  897
             F AGC++ VSN+VMA+TV++SL+LLT+LLYFTP+AILASIILSALPGLI++N AY IWKV
Sbjct  451   FSAGCQTVVSNIVMALTVILSLELLTRLLYFTPMAILASIILSALPGLIDINGAYHIWKV  510

Query  896   DKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGI  717
             DKLDFLAC GAF GVLF SVEIGLL AV +SFAKI++NS++PGI+ LG+LP TD +F  I
Sbjct  511   DKLDFLACVGAFLGVLFESVEIGLLAAVSISFAKILINSLRPGIDVLGKLPTTD-IFCNI  569

Query  716   HQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIV  537
             +QYPMA++TP + +I   SSLLCFANAN +K R+L  V +E+    + KE  ++RI  ++
Sbjct  570   NQYPMAIETPSILIIGINSSLLCFANANSVKERVLKWVTKEEDENGDPKE--KRRIQHVI  627

Query  536   FDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFL  360
              DMSN+MNVDTS I++L+E++ K+ S G+Q  +ANPRWQVIH+L+++   +KI G+ VFL
Sbjct  628   LDMSNVMNVDTSGILALEEIHKKLCSYGIQLAMANPRWQVIHRLKVSKLVDKIGGESVFL  687

Query  359   TIGEAIDACLVDK  321
             T+GEA++ACL  K
Sbjct  688   TVGEAVEACLTCK  700



>gb|KFK25313.1| hypothetical protein AALP_AA8G096500 [Arabis alpina]
Length=677

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/641 (62%), Positives = 503/641 (78%), Gaps = 7/641 (1%)
 Frame = -1

Query  2237  SSTLPPAA----ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLS  2073
             SS + PA     +R+ W+L  PEPP   ++L+   K +       F+ LRK+P+ + +LS
Sbjct  35    SSAVAPARQDQLDRSKWLLECPEPPSPWQELKRQVKDSFVTKAKKFKSLRKQPLPKRILS  94

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               ++VFP+  W + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPP
Sbjct  95    ILQAVFPIFGWCRNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPP  154

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYA MG+SREIAIGPVAV+SLLISSM+ KL DP ++P GYT LVLT TFFAGIFQA+FG
Sbjct  155   LIYAFMGTSREIAIGPVAVVSLLISSMLQKLIDPETDPLGYTKLVLTTTFFAGIFQASFG  214

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             + RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S   
Sbjct  215   LFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWKSCQQ  274

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
               W+P+  I+G SFLSFILITRF+G+K++KLFWLPA+APL++V++STL+V+LT+A+ HGV
Sbjct  275   Q-WSPHTFILGCSFLSFILITRFIGKKNKKLFWLPAIAPLIAVVVSTLMVFLTKADEHGV  333

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             K V+H+KGGLNP S+H + FNTPH+ Q+ KI  IV++VALTEAIAVG SFA +KGY LDG
Sbjct  334   KTVRHIKGGLNPISIHDIEFNTPHLGQIAKIALIVSLVALTEAIAVGKSFAGVKGYRLDG  393

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+AIG  N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+          + LT+ 
Sbjct  394   NKEMVAIGFMNVIGSFTSCYAATGSFSRTAVNFAAGCETAMSNIXXXXXXXXXXECLTRF  453

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP+AILASIILSALPGLI++NEA  IWK+DK DFLA  GAF GVLFASVEIGLLVAV
Sbjct  454   LYYTPIAILASIILSALPGLIDINEAIRIWKIDKFDFLALIGAFIGVLFASVEIGLLVAV  513

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SFAKI+L SI+PGIE LGR+PGTD  +    QYPM+V+TPGV + R KS+LLCFANA+
Sbjct  514   VISFAKIILISIRPGIETLGRMPGTDN-YADTDQYPMSVKTPGVLIFRIKSALLCFANAS  572

Query  632   FIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCG  453
             FI+ R++  + EE++  + TK  ++++I  +V DMSN++NVDTS I +L EL++ +   G
Sbjct  573   FIEERVMRWINEEEEENENTKSKAKRKILFVVLDMSNLINVDTSGITALMELHNNLIQNG  632

Query  452   VQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             V+ VI NP+WQVIHKL  A F +KI G+V+LTIGEA+DAC 
Sbjct  633   VELVIVNPKWQVIHKLNQAKFVSKIGGRVYLTIGEALDACF  673



>ref|XP_009781347.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
sylvestris]
Length=664

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/655 (63%), Positives = 502/655 (77%), Gaps = 13/655 (2%)
 Frame = -1

Query  2273  LPYE-FSQTLQK-TSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLR  2100
             LP E FS  LQ+  +  +    +R  W+LN P PP    +L  S   T T L        
Sbjct  4     LPNESFSIELQQLDADDVSGRNQRTQWLLNSPAPPSFCNELINSV--TETVLPQKKNNFS  61

Query  2099  KRPVQ----AVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANL  1932
                 Q    AVLS  + +FP+L WG+ Y     K D+LAGLTLASLCIPQSIGYA LANL
Sbjct  62    SNSKQYGGGAVLSFLQGLFPILGWGRNYKANMFKHDLLAGLTLASLCIPQSIGYANLANL  121

Query  1931  DPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLT  1752
              PQYGLYTSVVPPLIYAVMGSSRE+AIGPVAV+SLL+S+M+ ++ DPA +P  YTSLV T
Sbjct  122   APQYGLYTSVVPPLIYAVMGSSRELAIGPVAVVSLLLSAMITEIVDPAVDPIAYTSLVFT  181

Query  1751  VTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDV  1572
             VTFFAG FQAAFG+LRLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI++FT KTDV
Sbjct  182   VTFFAGTFQAAFGLLRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLIGINHFTTKTDV  241

Query  1571  VSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILST  1392
             VSVL  +FTS H+   +P N ++G SFL FIL TRF+G++++KLFWLPA+APLLSVILST
Sbjct  242   VSVLKAVFTSFHNETLSPLNFVLGCSFLIFILATRFIGKRNKKLFWLPAIAPLLSVILST  301

Query  1391  LLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVG  1212
             L+VYLT+A+ HGVKIVKH KGGLNPSS+HQL FN  H+ +V KIG I A+VALTEAIAVG
Sbjct  302   LMVYLTKADRHGVKIVKHFKGGLNPSSVHQLQFNGAHLGEVAKIGLICALVALTEAIAVG  361

Query  1211  GSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMA  1032
              SFASMKGYHLDGNKEM+A+G  NI GSL+SCY ATGSFSR+AVNF AGCE+ VSN+VMA
Sbjct  362   RSFASMKGYHLDGNKEMVAMGFMNIVGSLSSCYTATGSFSRTAVNFSAGCETVVSNIVMA  421

Query  1031  VTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGV  852
             +TV ISL+LLTKLLY+TP+AILAS+ILSALPGLI++NEAY IWKVDK+DFL C GAF GV
Sbjct  422   ITVFISLELLTKLLYYTPLAILASVILSALPGLIDINEAYHIWKVDKMDFLVCIGAFFGV  481

Query  851   LFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVI  672
             LF SVEIGLLVAV +SFA+I+L++I+   E  GRLPGT   F  I QYP A  T G+ +I
Sbjct  482   LFVSVEIGLLVAVSISFARIILDTIRASTEVQGRLPGTTDTFCDITQYPGATTTSGILII  541

Query  671   RTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAII  492
             R  S  LCFANA  I+ R+L LV E    A++++E+++  +  +V D+SN+MN+DTS I 
Sbjct  542   RINSGSLCFANATSIRERMLKLVTE----ANDSEENTKDNVHFLVLDVSNVMNLDTSGIA  597

Query  491   SLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
              L+EL+ ++ S  +Q  I NPR +VI+K++ A    K+ KG +FLTIG+AIDACL
Sbjct  598   VLEELHRELVSRTIQLAIGNPRLRVINKMKTAKCFEKLGKGWIFLTIGDAIDACL  652



>ref|XP_004252542.2| PREDICTED: low affinity sulfate transporter 3-like [Solanum lycopersicum]
Length=679

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/630 (64%), Positives = 496/630 (79%), Gaps = 5/630 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA-VLSASESVFPLLSWG  2037
             ER  W+LN PEP     +L  S  +T     T F     +  +A + S  + +FP+LSWG
Sbjct  41    ERIQWLLNSPEPLSFCNELINSVSETILPQKTIFFPSNSKQCKAGIFSFLQGLFPILSWG  100

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y     K+D+LAGLTLASLCIPQSIGYA LANL+PQYGLYTSVVPPLIYAVMGSSRE+
Sbjct  101   RNYKANMFKNDLLAGLTLASLCIPQSIGYANLANLEPQYGLYTSVVPPLIYAVMGSSREL  160

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+S+MV ++ DPA +P  YTSLV TVTFFAG FQAAFG+LRLGFLVDFLS
Sbjct  161   AIGPVAVVSLLLSAMVTEIVDPAVDPIAYTSLVFTVTFFAGTFQAAFGLLRLGFLVDFLS  220

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAI+IGLQQLK L GIS+FTNKTDVVSVL  +F S H    +P N I+G 
Sbjct  221   HAAIVGFMGGAAIIIGLQQLKGLIGISHFTNKTDVVSVLRAVFRSFHDEALSPMNFILGC  280

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFL FIL+TRF+G++++KLFWLPA+APLLSVI++TL+VYLT+A+ HGVKIVKH KGGLNP
Sbjct  281   SFLIFILVTRFIGKRNKKLFWLPAIAPLLSVIVATLMVYLTKADQHGVKIVKHFKGGLNP  340

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             SS HQL FN  H+ QV KIG I  +VALTEAIAVG SFASMKGYHLDGNKEM+A+G  NI
Sbjct  341   SSAHQLQFNGSHLGQVAKIGLICGLVALTEAIAVGRSFASMKGYHLDGNKEMVAMGFMNI  400

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GSLTSCY ATGSFSR+AVNF AGCE+ VSN+VMA+TV ISL+LLTKLLY+TP+AILAS+
Sbjct  401   VGSLTSCYTATGSFSRTAVNFSAGCETVVSNIVMAITVFISLELLTKLLYYTPLAILASV  460

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI++NEAY IWKVDK+DFL C GAF GVLF SVEIGLL+AVG+SFA+I+L++I
Sbjct  461   ILSALPGLIDINEAYHIWKVDKMDFLVCIGAFFGVLFVSVEIGLLIAVGISFARIVLDTI  520

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +   E  GRLPGT   F  I QYP A  T G+ +IR  S  LCFAN+  I+ R++ LV  
Sbjct  521   RASTEVQGRLPGTLDTFCDITQYPGATSTSGILIIRINSGSLCFANSTSIRERVMKLVTH  580

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
                + DE  E++++ +  +V D+SN+M+VDTS I+ ++EL+ ++ S  +Q  IANPR +V
Sbjct  581   TNGN-DE--ENTKENVHFVVLDLSNVMSVDTSGIVMIEELHRELVSQSIQLTIANPRLRV  637

Query  416   IHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
             I+K++ A   +K+ KG +FLTIG+A+DACL
Sbjct  638   INKMKTAKCFDKLGKGWIFLTIGDAVDACL  667



>ref|XP_008375005.1| PREDICTED: low affinity sulfate transporter 3 isoform X1 [Malus 
domestica]
Length=709

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/674 (63%), Positives = 532/674 (79%), Gaps = 15/674 (2%)
 Frame = -1

Query  2336  KYLAGMAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKL  2157
             K+L  MA  PT   E+ + +EL     Q   + +      AERA W+L+ P+PPGL ++L
Sbjct  40    KFLTTMASLPT---EVFSTVEL-----QQQHRHAEDTSGRAERAQWLLSSPDPPGLWQQL  91

Query  2156  EGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLAS  1977
                 K      G  + + +K P     S    +FP+LSWG+ Y   K K+DV+AGLTLAS
Sbjct  92    IHGIKSNLLPQGNRYSK-QKTPANRAFSLFRGLFPILSWGRNYKASKFKNDVMAGLTLAS  150

Query  1976  LCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLE  1797
             L +PQSIGYA LA LDPQYGLYTS+VPPLIY++MGSSRE+AIGPVAV+S+L+SS++ K+E
Sbjct  151   LSVPQSIGYANLAKLDPQYGLYTSIVPPLIYSLMGSSRELAIGPVAVVSMLLSSLIQKIE  210

Query  1796  DPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQL  1617
             DP +NP  Y +L+ TVTFFAGIFQAAFG+ RLGFLVDFLSHAAIVGFMAGAAIVIGLQQL
Sbjct  211   DPVANPIAYRNLLFTVTFFAGIFQAAFGLFRLGFLVDFLSHAAIVGFMAGAAIVIGLQQL  270

Query  1616  KPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLF  1437
             K L GIS+FT  TD++SVL  +F S+ H PW+P N+++G +FL F+LI RF+G++++KLF
Sbjct  271   KGLLGISHFTTNTDIISVLESVFDSIVHEPWHPLNIVLGCAFLIFLLIARFIGKRNKKLF  330

Query  1436  WLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIG  1257
             WLPA+APL+SVILSTL+VYLT+A+ HGV IVKH+KGGLNPSS HQL    PH+ Q  K G
Sbjct  331   WLPAIAPLISVILSTLIVYLTKADKHGVNIVKHIKGGLNPSSAHQLQLRGPHVRQAAKAG  390

Query  1256  FIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVN  1077
              I A++AL EAIAVG SFA++KGYHLDGNKEMLA+G  NIAGSLTSCYVATGSFSR+AVN
Sbjct  391   LISAIIALAEAIAVGRSFAAIKGYHLDGNKEMLAMGCMNIAGSLTSCYVATGSFSRTAVN  450

Query  1076  FYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKV  897
             F AGC++AVSN+VMA+TV++SL+LLT+LLYFTP+AILASIILSALPGLI++N AY IWKV
Sbjct  451   FSAGCQTAVSNIVMALTVILSLELLTRLLYFTPIAILASIILSALPGLIDINGAYHIWKV  510

Query  896   DKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGI  717
             DKLDFLAC GAF GVLFAS EIGLL AV +SFAKI++NS++PGIE LGRLP TD +F  I
Sbjct  511   DKLDFLACVGAFLGVLFASAEIGLLAAVSISFAKILINSLRPGIEVLGRLPTTD-IFCNI  569

Query  716   HQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEK-RIALI  540
             +QYPMA++TP + +I   SSLLCFANAN +K R+L  V +E+   DET +  EK RI  +
Sbjct  570   NQYPMAIETPSILIIGIXSSLLCFANANSVKERVLKWVTKEE---DETGDPKEKRRIQHV  626

Query  539   VFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VF  363
             + DMSN+MNVDTS I++L+E++ K+ S G+Q  +ANPRWQVIH+L+++   +KI G+ VF
Sbjct  627   ILDMSNVMNVDTSGILALEEIHKKLCSYGIQLAMANPRWQVIHRLKVSKLVDKIGGESVF  686

Query  362   LTIGEAIDACLVDK  321
             LT+GEA++ACL  K
Sbjct  687   LTVGEAVEACLTSK  700



>ref|XP_006300833.1| hypothetical protein CARUB_v10019923mg [Capsella rubella]
 gb|EOA33731.1| hypothetical protein CARUB_v10019923mg [Capsella rubella]
Length=657

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/631 (63%), Positives = 506/631 (80%), Gaps = 5/631 (1%)
 Frame = -1

Query  2222  PAAERAS-WVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKRPVQAVLSASESVFPL  2049
             PA E  S W+LN PEPP + ++L G  +K   +       + +      V S  +SVFP+
Sbjct  16    PAEEPTSRWLLNTPEPPSMWQELVGYIRKNVLSKKDNRRNKTKNSSSNPVYSCLKSVFPI  75

Query  2048  LSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGS  1869
             L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSVVPPLIY+ MGS
Sbjct  76    LIWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVVPPLIYSTMGS  135

Query  1868  SREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLV  1689
             SRE+AIGPVAV+SLL+SSMV  LEDP ++P  Y  +V TVTFFAG FQA FG+ RLGFLV
Sbjct  136   SRELAIGPVAVVSLLLSSMVRDLEDPVTDPIAYRKIVFTVTFFAGAFQAIFGLFRLGFLV  195

Query  1688  DFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNl  1509
             DFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTDVVSVL+ +F SLHHS W P N 
Sbjct  196   DFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDVVSVLSSVFHSLHHS-WQPLNF  254

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SVIL+TL+VYLT AE  GVKIVKH+K 
Sbjct  255   VIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVILATLIVYLTNAETRGVKIVKHIKP  314

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             G N  S++QL FN+PH+  +VKIG I A++ALTEAIAVG SFA++KGY LDGNKEM+A+G
Sbjct  315   GFNQPSVNQLQFNSPHLGHIVKIGLISAIIALTEAIAVGRSFATIKGYRLDGNKEMMAMG  374

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISLQ+LT+ LYFTP AI
Sbjct  375   CMNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLQVLTRFLYFTPTAI  434

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI+++ A  IWK+DKLDFL  A AF GVLFASVEIGLL+AVG+SFA+IM
Sbjct  435   LASIILSALPGLIDISGAIHIWKLDKLDFLVLAAAFFGVLFASVEIGLLLAVGISFARIM  494

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             L+SI+P IE LGRL  TD +F  I+QYPMA++TPG+  +R  S LLCFANANFI+ RIL+
Sbjct  495   LSSIRPNIEALGRLSKTD-IFGDINQYPMAIKTPGLLTLRISSPLLCFANANFIRDRILN  553

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
              V E ++  +E +  ++K + +++ DMS +M +DTS +++L+EL+ ++ S  ++ VIA+P
Sbjct  554   SVSEVEEEDNEQEVKNDKVLQVLILDMSCVMGIDTSGVVALEELHQELASNDIRLVIASP  613

Query  428   RWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             RW+++HKL+ A   +K+K + +F+T+GEA+D
Sbjct  614   RWRILHKLKRAKLEDKVKQENIFMTVGEAVD  644



>sp|P53393.1|SUT3_STYHA RecName: Full=Low affinity sulfate transporter 3 [Stylosanthes 
hamata]
 emb|CAA57831.1| low affinity sulphate transporter [Stylosanthes hamata]
Length=644

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/638 (63%), Positives = 511/638 (80%), Gaps = 14/638 (2%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWG  2037
             +ER+ WVLN P PP L++K  G  K    F  ++     K+  +AV S   S+FP+LSW 
Sbjct  10    SERSQWVLNSPNPPPLTKKFLGPLKDNKFFTSSS----SKKETRAV-SFLASLFPILSWI  64

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + YS  K K D+L+GLTLASL IPQSIGYA LA LDPQYGLYTSV+PP+IYA+MGSSREI
Sbjct  65    RTYSATKFKDDLLSGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPVIYALMGSSREI  124

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+S+L+SS+VPK+ DP ++P  Y +LV TVT FAGIFQ AFG+LRLGFLVDFLS
Sbjct  125   AIGPVAVVSMLLSSLVPKVIDPDAHPNDYRNLVFTVTLFAGIFQTAFGVLRLGFLVDFLS  184

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPYN  1512
             HAA+VGFMAGAAIVIGLQQLK L G+++FT KTD V+VL  ++TSLH        W+P N
Sbjct  185   HAALVGFMAGAAIVIGLQQLKGLLGLTHFTTKTDAVAVLKSVYTSLHQQITSSENWSPLN  244

Query  1511  liigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVK  1332
              +IG SFL F+L  RF+G++++K FWLPA+APLLSVILSTL+V+L++ + HGV I+KHV+
Sbjct  245   FVIGCSFLIFLLAARFIGRRNKKFFWLPAIAPLLSVILSTLIVFLSKGDKHGVNIIKHVQ  304

Query  1331  GGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAI  1152
             GGLNPSS+H+L  N PH+ Q  KIG I A++ALTEAIAVG SFA++KGYHLDGNKEMLA+
Sbjct  305   GGLNPSSVHKLQLNGPHVGQAAKIGLISAIIALTEAIAVGRSFANIKGYHLDGNKEMLAM  364

Query  1151  GVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVA  972
             G  NIAGSLTSCYV+TGSFSR+AVNF AGC++AVSN+VMAVTVL+ L+L T+LLY+TP+A
Sbjct  365   GCMNIAGSLTSCYVSTGSFSRTAVNFSAGCKTAVSNIVMAVTVLLCLELFTRLLYYTPMA  424

Query  971   ILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKI  792
             ILASIILSALPGLI++ EAY IWKVDK DFLAC GAF GVLF S+EIGLL+A+ +SFAKI
Sbjct  425   ILASIILSALPGLIDIGEAYHIWKVDKFDFLACLGAFFGVLFVSIEIGLLIALSISFAKI  484

Query  791   MLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARIL  612
             +L +I+PG+E LGR+P T+A +  + QYPMAV TPG+ VIR  S  LCFANA F++ RIL
Sbjct  485   LLQAIRPGVEVLGRIPTTEA-YCDVAQYPMAVTTPGILVIRISSGSLCFANAGFVRERIL  543

Query  611   SLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIAN  432
               V +E++  D  +E+++ R+  I+ DM+++ NVDTS I++L+EL+ K+ S GV+  + N
Sbjct  544   KWVEDEEQ--DNIEEAAKGRVQAIIIDMTDLTNVDTSGILALEELHKKLLSRGVELAMVN  601

Query  431   PRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             PRW+VIHKL++A+F +KI K +VFLT+ EA+DACL  +
Sbjct  602   PRWEVIHKLKVANFVDKIGKERVFLTVAEAVDACLSSR  639



>gb|ABB59582.1| putative sulfate transporter, partial [Populus tremula x Populus 
alba]
Length=622

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/601 (64%), Positives = 486/601 (81%), Gaps = 10/601 (2%)
 Frame = -1

Query  2120  TAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAAL  1941
             TA Q+ + R ++ +    + VFP+L WG+ Y   K K+D++AGLTLASL IPQSIGYA L
Sbjct  24    TARQKQQSRAIEFL----QGVFPILRWGRDYKASKFKNDLMAGLTLASLSIPQSIGYANL  79

Query  1940  ANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSL  1761
             A LDPQYGLYTSV+PPLIYA+MGSSREIAIGPVAV+S+L+SSM+ +++DP ++P  Y + 
Sbjct  80    AKLDPQYGLYTSVIPPLIYAIMGSSREIAIGPVAVVSMLLSSMIAEIQDPLADPVAYRNF  139

Query  1760  VLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNK  1581
             V TVT FAG FQA FG+ RLGFLVDFLSHA+IVGFM GAAIVIGLQQLK L GIS+FT K
Sbjct  140   VFTVTLFAGTFQALFGLFRLGFLVDFLSHASIVGFMGGAAIVIGLQQLKGLLGISHFTTK  199

Query  1580  TDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVI  1401
             TDVVSVL   FTS+ H PW+P N ++G SFL F+L  RF+G++++KLFW PA+APL+SVI
Sbjct  200   TDVVSVLHSAFTSIDH-PWSPLNFVLGCSFLIFLLFARFIGRRNKKLFWFPAIAPLVSVI  258

Query  1400  LSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAI  1221
             LSTL+V+LT+A+ HGVKIVKH+KGGLN SS+H L  + P + Q  KIG I A+VALTEAI
Sbjct  259   LSTLIVFLTKADKHGVKIVKHIKGGLNRSSVHDLQLSGPQVGQAAKIGLISAIVALTEAI  318

Query  1220  AVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNV  1041
             AVG SFAS+KGYH+DGNKEMLAIG  NIAGSL+SCYVATGSFSR+AVNF AGC++ VSN+
Sbjct  319   AVGRSFASIKGYHIDGNKEMLAIGFMNIAGSLSSCYVATGSFSRTAVNFSAGCQTLVSNI  378

Query  1040  VMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAF  861
             VM++TVL+SL++ T+LLY+TP AILASIILSALPGLI++  AY IWKVDKLDF+AC GAF
Sbjct  379   VMSITVLVSLEVFTRLLYYTPTAILASIILSALPGLIDIRGAYYIWKVDKLDFIACIGAF  438

Query  860   AGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGV  681
              GVLFASVEIGLL AV +SFA+I+LN+I+PGIE LGRLP  D ++  ++QYPMAV+TPG+
Sbjct  439   FGVLFASVEIGLLAAVTISFARILLNAIRPGIEALGRLPRAD-VYCDMNQYPMAVKTPGI  497

Query  680   FVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTS  501
               +R  S+LLCFANANFI+ RIL  V EE    +E KE +E  I  ++ DM N+MN+DT+
Sbjct  498   LAVRVNSALLCFANANFIRERILRWVTEE---VNEIKEGTEGGIKAVILDMPNVMNIDTA  554

Query  500   AIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVD  324
              I++L+EL+ ++     Q  IANP+WQVIHKLRLA F ++I +  +FLT+ EA+DAC+  
Sbjct  555   GILALEELHKELLVHEAQLAIANPKWQVIHKLRLAKFIDRIGREWIFLTVSEAVDACVSS  614

Query  323   K  321
             K
Sbjct  615   K  615



>gb|AAZ67600.1| 80A08_15 [Brassica rapa subsp. pekinensis]
Length=639

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/641 (62%), Positives = 503/641 (78%), Gaps = 17/641 (3%)
 Frame = -1

Query  2240  TSSTLPPAAE---RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLS  2073
             +S+  PP  +   R+ W+L+ PEPP    +L+   K++       F+ L+K+P+ + +LS
Sbjct  8     SSAAAPPRQDQHDRSKWLLDCPEPPSPWHELKIQVKESFLTKAKRFKSLQKQPLPKRILS  67

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               ++VFP+  W + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLY+SV PP
Sbjct  68    ILQAVFPIFGWCRNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYSSVGPP  127

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYA+MG+SREIAIGPVAV          +L DP ++P GY  LVLT TFFAGIFQA+FG
Sbjct  128   LIYALMGTSREIAIGPVAV----------ELIDPETDPLGYKKLVLTTTFFAGIFQASFG  177

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             I RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S H 
Sbjct  178   IFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCHQ  237

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
               W+P+  I+G SFLSFILI RF+G++++KLFWLPA+APL+SV++STL+V+LT+A+ HGV
Sbjct  238   Q-WSPHTFILGCSFLSFILIARFIGKRNKKLFWLPAIAPLISVVVSTLMVFLTKADEHGV  296

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             K V+H++GGLNP S++ L FNTPH+  + KIG IVAVVALTEAIAVG SFA +KGY LDG
Sbjct  297   KTVRHIRGGLNPISINDLEFNTPHLGHIAKIGLIVAVVALTEAIAVGRSFAGIKGYRLDG  356

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+AIGV N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV I+L+ LT+L
Sbjct  357   NKEMVAIGVMNVLGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFIALECLTRL  416

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP+AILASIILSALPGLI++NEA  IWK+DKLDFLA  GAF GVLF SVEIGLLVAV
Sbjct  417   LYYTPIAILASIILSALPGLIDINEAIHIWKIDKLDFLALIGAFFGVLFGSVEIGLLVAV  476

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SFAKI+L SI+PGIE LGR+PGTD +F    QYPM+V+TPGV + R KS+LLCFANA+
Sbjct  477   VISFAKIILISIRPGIETLGRIPGTD-IFADTDQYPMSVKTPGVLICRVKSALLCFANAS  535

Query  632   FIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCG  453
              I+ RI+  + EE++  + TK + E++I  +V DMSN+MNVDTS I +L EL++ +   G
Sbjct  536   SIEERIMRWINEEEED-ENTKSNDERKILFVVLDMSNLMNVDTSGITALVELHNNLIQNG  594

Query  452   VQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             ++ VI NP+W V HKL  A F +KI G+V+LTIGEA+DAC 
Sbjct  595   IELVIVNPKWHVFHKLNQAKFVSKIGGRVYLTIGEALDACF  635



>gb|ABB59581.1| putative sulfate transporter, partial [Populus tremula x Populus 
alba]
Length=622

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/601 (64%), Positives = 488/601 (81%), Gaps = 10/601 (2%)
 Frame = -1

Query  2120  TAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAAL  1941
             TA Q+ + R ++ +    + VFP+L WG+ Y   K K+D++AGLTLASL IPQSIGYA L
Sbjct  24    TARQKQQSRAIEFL----QGVFPILRWGRDYKASKFKNDLMAGLTLASLSIPQSIGYANL  79

Query  1940  ANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSL  1761
             A LDPQYGLYTSV+PPLIYA+MGSSREIAIGPVAV+S+L+SSM+ +++DP ++P  Y + 
Sbjct  80    AKLDPQYGLYTSVIPPLIYAIMGSSREIAIGPVAVVSMLLSSMIAEIQDPLADPVAYRNF  139

Query  1760  VLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNK  1581
             V TVT FAG FQA FG+ RLGFLVDFLSHA+IVGFM GAAIVIGLQQLK L GIS+FT K
Sbjct  140   VFTVTLFAGTFQALFGLFRLGFLVDFLSHASIVGFMGGAAIVIGLQQLKGLLGISHFTTK  199

Query  1580  TDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVI  1401
             TDVVSVL   FTS+ H PW+P N ++G SFL F+L  RF+G++++KLFW PA+APL+SVI
Sbjct  200   TDVVSVLHSAFTSIDH-PWSPLNFVLGCSFLIFLLFARFIGRRNKKLFWFPAIAPLVSVI  258

Query  1400  LSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAI  1221
             LSTL+V+LT+A+ HGVKIV+H+KGGLN SS+H L  + P + Q  KIG I A+VALTEAI
Sbjct  259   LSTLIVFLTKADKHGVKIVRHIKGGLNRSSVHDLQLSGPQVGQAAKIGLISAIVALTEAI  318

Query  1220  AVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNV  1041
             AVG SFAS+KGY++DGNKEMLAIG  NIAGSL+SCYVATGSFSR+AVNF AGC++ VSN+
Sbjct  319   AVGRSFASIKGYYIDGNKEMLAIGFMNIAGSLSSCYVATGSFSRTAVNFSAGCQTLVSNI  378

Query  1040  VMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAF  861
             VM++TVL+SL++ T+LLY+TP AILASIILSALPGLI++  AY IWKVDKLDF+AC GAF
Sbjct  379   VMSITVLVSLEVFTRLLYYTPTAILASIILSALPGLIDIRGAYYIWKVDKLDFIACIGAF  438

Query  860   AGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGV  681
              GVLFASVEIGLL AV +SFA+I+LN+I+PGIE LGRLP  D ++  ++QYPMAV+TPG+
Sbjct  439   FGVLFASVEIGLLAAVTISFARILLNAIRPGIEALGRLPRAD-VYCDMNQYPMAVKTPGI  497

Query  680   FVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTS  501
               +R  S+L CFANANFI+ RIL  V EE    +E KES+E  I  ++ D+SN+MN+DT+
Sbjct  498   LAVRINSALPCFANANFIRERILRWVTEE---VNEIKESTEGGIKAVILDVSNVMNIDTA  554

Query  500   AIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVD  324
              I++L+EL+ ++     Q  IANP+WQVIHKLRLA F ++I +G +FLT+ EA+DAC+  
Sbjct  555   GILALEELHKELLVHEAQLAIANPKWQVIHKLRLAKFIDRIGRGWIFLTVSEAVDACVSS  614

Query  323   K  321
             K
Sbjct  615   K  615



>ref|XP_010261211.1| PREDICTED: low affinity sulfate transporter 3-like [Nelumbo nucifera]
Length=658

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/638 (62%), Positives = 497/638 (78%), Gaps = 12/638 (2%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTA----TFLGTAF-QRLRKRPVQAVLSASESVFP  2052
             A R  WVLN P+PPGL  +L G+ KKT         ++F Q+L  R   ++L   + +FP
Sbjct  23    AVRTHWVLNAPDPPGLGHELVGTIKKTVFPRRNKSSSSFSQKLGSRYAVSLL---QGLFP  79

Query  2051  LLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMG  1872
             +L W + Y   K ++D++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MG
Sbjct  80    ILEWVRNYKATKFRNDLMAGLTLASLSIPQSIGYANLARLDPQYGLYTSVLPPLIYALMG  139

Query  1871  SSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFL  1692
             SSREIAIGPVAV+SLLISSM+PKL DP S+P  Y  LV T TFFAG+FQA FG+ RLGFL
Sbjct  140   SSREIAIGPVAVVSLLISSMIPKLVDPVSDPIAYRDLVFTSTFFAGVFQAVFGLFRLGFL  199

Query  1691  VDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYN  1512
             VDFLSHAA VGFM GAAIVIGLQQLK L GI++FT+KTDV+SV   ++ S+HH PW+P N
Sbjct  200   VDFLSHAASVGFMGGAAIVIGLQQLKGLLGINHFTDKTDVISVAEAVWRSIHH-PWSPLN  258

Query  1511  liigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVK  1332
               +G SFL FIL+ RFLG++++KLFWLP+++ LLSVILSTL+V+LTRA+ HG+KI+KH+K
Sbjct  259   AALGCSFLIFILMARFLGKRNKKLFWLPSISLLLSVILSTLIVFLTRADKHGIKILKHIK  318

Query  1331  GGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAI  1152
             GG+NPSS   L  N P++    K G I A+VAL E IA+G SFAS++GYHLDGNKEM A+
Sbjct  319   GGINPSSAKHLQLNGPNVGAAAKTGLISAIVALAEGIAIGRSFASIRGYHLDGNKEMAAM  378

Query  1151  GVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVA  972
             G  NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA TV +SLQL T+LLY+TP A
Sbjct  379   GFMNIAGSLTSCYVATGSFSRTAVNFSAGCETGVSNIVMAATVFLSLQLFTRLLYYTPTA  438

Query  971   ILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKI  792
             ILASIILSALPGLI+ NEAY+IWK+DKLDFLAC GAF GVLF SVEIGLL AV +S  +I
Sbjct  439   ILASIILSALPGLIDFNEAYNIWKIDKLDFLACIGAFFGVLFVSVEIGLLAAVTISIGRI  498

Query  791   MLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARIL  612
             +LN+I+PG E LG+LPGTD +F   +QYPMAV+T G+ +IR  S+ LCF NAN IK RI+
Sbjct  499   LLNAIRPGTEVLGKLPGTD-VFCSTNQYPMAVKTSGILIIRIHSAFLCFVNANSIKERIM  557

Query  611   SLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIAN  432
               V +E +  +E K+ ++ R  +++ D+S++MN+DTS I++L+EL++K+ S G+Q  I N
Sbjct  558   LWVNKEGQGEEEDKK-AKSRTQVLILDLSDLMNIDTSGILALEELHNKLVSLGIQLAITN  616

Query  431   PRWQVIHKLRLADFHNKIKG-KVFLTIGEAIDACLVDK  321
             P W VIHKL+ A+F NKI    VFLT  EA+DAC+  K
Sbjct  617   PWWYVIHKLKSANFVNKIGATSVFLTTVEAVDACVTSK  654



>ref|XP_002528970.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF33389.1| sulfate transporter, putative [Ricinus communis]
Length=590

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/567 (70%), Positives = 468/567 (83%), Gaps = 9/567 (2%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP--VQAVLSASESVFPLLS  2043
             AERA WVLN PEPP L R+L GS + T    G  FQ  + +    + V+S  +++FP+LS
Sbjct  25    AERAHWVLNPPEPPSLWRELMGSIRDTLLPNGRNFQSFKNQQYGFKTVVSVLQAIFPILS  84

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             W + Y   K K+D+LAGLTLASLCIPQ IGYA LA LDPQYGLYTSV+PPLIYA+MG+SR
Sbjct  85    WSRDYKATKFKNDLLAGLTLASLCIPQGIGYATLAKLDPQYGLYTSVIPPLIYALMGTSR  144

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+SLL+SSM+  +EDP +NP  Y +LVLT TFFAGIFQAAFG+ RLGFLVDF
Sbjct  145   EIAIGPVAVVSLLLSSMIQNVEDPTANPVAYRNLVLTTTFFAGIFQAAFGLFRLGFLVDF  204

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDV+SVL   + S+HHS WNP+N I+
Sbjct  205   LSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVISVLKATWISVHHS-WNPHNFIL  263

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFLSFIL TRFLG+K+++LFWLPA+APLLSV+LSTL+VYLTRA+ HGVKI+KH+KGGL
Sbjct  264   GCSFLSFILTTRFLGKKNKQLFWLPAIAPLLSVVLSTLIVYLTRADQHGVKIIKHIKGGL  323

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSSLHQL FN PHI +V KIG IVA++ALTEAIAVG SFAS+KGYHLDGNKEM+A+GV 
Sbjct  324   NPSSLHQLQFNDPHIGEVAKIGLIVAIIALTEAIAVGRSFASVKGYHLDGNKEMVAMGVM  383

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NI GS +SCYVATGSFSRSAVNF AGCE+AVSN+VMA TV+I L+LLT+LLYFTP+AILA
Sbjct  384   NIFGSFSSCYVATGSFSRSAVNFSAGCETAVSNIVMATTVIICLELLTRLLYFTPIAILA  443

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SIILSALPGLI+LNE Y IWKVDKLDFLAC GAF GVLFASVEIGLL AV +SF KI++ 
Sbjct  444   SIILSALPGLIDLNEIYKIWKVDKLDFLACIGAFFGVLFASVEIGLLAAVTISFMKIIII  503

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             SI PG E LGRLPGT  +F  + QYPMA++TP V +IR KS  LCFANANF+K +I+   
Sbjct  504   SIGPGTEILGRLPGTQ-VFGDVDQYPMAIKTPPVLIIRVKSGFLCFANANFVKEKIMKWA  562

Query  602   MEEQKSADETKESSEKRIALIVFDMSN  522
              E+     E +E+ +  I +++FDMS+
Sbjct  563   TEK-----EEEENRKTTIQVVIFDMSS  584



>gb|KEH34870.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=660

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/639 (64%), Positives = 491/639 (77%), Gaps = 18/639 (3%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R  W+LN P PP L +KL    K    F  +     +KR   + V+S    +FP+LS  
Sbjct  28    DRTQWMLNSPNPPPLWKKLITPLKNNKLFSSS-----KKRTCHEHVVSFFSGLFPILSLF  82

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             K Y   K K D LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREI
Sbjct  83    KNYDAFKFKDDFLAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGSSREI  142

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+SS+  K+ DP  N  GY + V TVT FAGIFQ AFG+ RLGFLVDFLS
Sbjct  143   AIGPVAVVSLLLSSLCHKVVDPDLNHDGYRNFVFTVTLFAGIFQVAFGVFRLGFLVDFLS  202

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS----PWNPYNl  1509
             HAA+VGFMAGAAI+IGLQQLK L GISNFTNK+DVVSVL  ++ SLHH      W P N 
Sbjct  203   HAALVGFMAGAAIMIGLQQLKGLLGISNFTNKSDVVSVLESVYKSLHHQIPSGEWYPLNF  262

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             +IG SFL F+L  RF+G++++KLFWLPA+APL+SVILST +VY+++A+ +GV IVKHVK 
Sbjct  263   VIGSSFLIFLLFARFMGKRNKKLFWLPAIAPLVSVILSTFIVYISKADKNGVNIVKHVKR  322

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             G+NPSS+HQL  N  H+ +  KIG I AV+ALTEA+AVG SFAS+KGYHLDGNKEMLA+G
Sbjct  323   GINPSSIHQLQLNGEHVGEAAKIGLISAVIALTEAMAVGRSFASIKGYHLDGNKEMLAMG  382

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               NIAGS TSCYVATGSFSR+AVNF A C+S+VSN+VMA+TV++ L+L T+LLY+TPVAI
Sbjct  383   CGNIAGSFTSCYVATGSFSRTAVNFSARCQSSVSNIVMAITVILCLELFTRLLYYTPVAI  442

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI++ EA  IWKVDK DFLAC GAF GVLF SVE GLLVAV +SFAKI+
Sbjct  443   LASIILSALPGLIDIREACYIWKVDKFDFLACIGAFFGVLFVSVETGLLVAVSISFAKIV  502

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             + SI+PGIE LGR+P T A F  + QYPMA  TPG+ VIR  S  LCFANAN ++ RIL 
Sbjct  503   IQSIRPGIEVLGRIPTTQA-FCDVSQYPMATSTPGILVIRISSGSLCFANANVVRERILK  561

Query  608   LVMEEQKSADETKES--SEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIA  435
              V EE    D+ KES  ++ R+  ++FDM+N+MNVDTS II L+EL+ ++ S G++F + 
Sbjct  562   WVTEE----DDLKESQTTKGRVQAVIFDMTNLMNVDTSGIIVLEELHKRLLSRGIKFAMV  617

Query  434   NPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             NPRW VIHKL++A F +KI K  VFLT+ EA++ACL  K
Sbjct  618   NPRWLVIHKLKVAHFVDKIGKEWVFLTVAEAVEACLSYK  656



>ref|XP_007136219.1| hypothetical protein PHAVU_009G028400g [Phaseolus vulgaris]
 gb|ESW08213.1| hypothetical protein PHAVU_009G028400g [Phaseolus vulgaris]
Length=654

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/637 (65%), Positives = 500/637 (78%), Gaps = 16/637 (3%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ER+ WVL  P PP L  KL    KK+  F    F   +K  +   +S  ES+FP+L W K
Sbjct  24    ERSLWVLEPPNPPPLWNKLFSPLKKSMFF----FSSKKKTYLGRAVSFLESLFPILCWFK  79

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K+D+LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIA
Sbjct  80    NYKASKFKNDLLAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGSSREIA  139

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS+VPK+ DPA +P  Y ++V TVT FAGIFQAAFGI RLGFLVDFLSH
Sbjct  140   IGPVAVVSLLLSSLVPKVVDPAVDPDAYRNVVFTVTLFAGIFQAAFGIFRLGFLVDFLSH  199

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPYNl  1509
             AA+VGFMAGAAI+IGLQQLK L G+++FTNKTDV+SVL  ++ SLH        W P N 
Sbjct  200   AALVGFMAGAAIIIGLQQLKGLLGVTHFTNKTDVISVLVSVYKSLHQQITSGEKWYPLNF  259

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             +IG SFL F+LI RF+G++++KLFWLPA+APLLSV+LST +VYL++A+  GV I+KHVKG
Sbjct  260   VIGCSFLIFLLIARFVGRRNKKLFWLPAIAPLLSVLLSTSIVYLSKADKSGVNIIKHVKG  319

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNPSS+H+L F+ PH+ Q  KIG I AV+ALTEAIAVG SFAS+KGYHLDGNKEMLA+G
Sbjct  320   GLNPSSVHKLQFHGPHVGQTAKIGLISAVIALTEAIAVGRSFASIKGYHLDGNKEMLAMG  379

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               NIAGSL+SCYVATGSFSR+AVNF AGC+++VSN+VMAVTV + L+L T+LLY+TP+AI
Sbjct  380   CMNIAGSLSSCYVATGSFSRTAVNFSAGCQTSVSNIVMAVTVFLCLELFTRLLYYTPMAI  439

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI++NEAY IWKVDK DFLAC GAF GVLF SVE GLLVAV +SFAKI+
Sbjct  440   LASIILSALPGLIDINEAYYIWKVDKFDFLACIGAFFGVLFVSVETGLLVAVSISFAKIL  499

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             + SI+PGIE LG++P T+A F  + QYPMA  TPG+ VIR  S  LCFANANF++ RIL 
Sbjct  500   IQSIRPGIEVLGQVPRTEA-FCDVSQYPMATSTPGILVIRISSGSLCFANANFVRERILK  558

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
              V+ E     E  E ++ ++  ++ DM N+MNVDTS I+ L+EL+ ++ S GV+  + NP
Sbjct  559   WVIME-----EENELAKGKVYAVILDMGNLMNVDTSGILVLEELHKRLLSRGVRLAMVNP  613

Query  428   RWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACLVDK  321
             RW VI KL++A F +KI  K VFLT+GEA+DACL  K
Sbjct  614   RWVVIWKLKVAQFVDKIGKKWVFLTVGEAVDACLSSK  650



>gb|EYU36527.1| hypothetical protein MIMGU_mgv1a002607mg [Erythranthe guttata]
Length=654

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/628 (63%), Positives = 491/628 (78%), Gaps = 8/628 (1%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWG  2037
             +ER+ W+LN P+PP   R++  S K+T  F G    + +       L   +++FP+L WG
Sbjct  22    SERSKWLLNSPDPPAPWREMFSSMKET-VFPGRRKGKQQLPRTNRALLFMQALFPILKWG  80

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             K Y     K+D+LAGLTLASLCIPQSIGYA LA +DPQYGLYTSVVPPLIYAVMGSSREI
Sbjct  81    KYYKASMFKNDLLAGLTLASLCIPQSIGYANLAKMDPQYGLYTSVVPPLIYAVMGSSREI  140

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+S+MV K+ DP S+ A Y   V TVTFF G FQ  FG+ RLGFLVDFLS
Sbjct  141   AIGPVAVVSLLLSAMVSKVVDPTSDAAAYRRTVFTVTFFTGFFQGLFGLFRLGFLVDFLS  200

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAA+VGF++GAAIVIGLQQLK L GIS+FT+KTDV+SV T +  +LHH  W P N ++G 
Sbjct  201   HAALVGFISGAAIVIGLQQLKGLLGISHFTSKTDVLSVFTAVLNALHHQ-WYPLNSVLGC  259

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFL FILITRFLGQ+++KLFWLPAMAPLLSV+LSTL+VYLT A+ HG+KIVKH KGGLNP
Sbjct  260   SFLIFILITRFLGQRNKKLFWLPAMAPLLSVVLSTLIVYLTEADKHGIKIVKHFKGGLNP  319

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             SSLHQL+F  PH+ +  KIG I A++ALTEAIAVG SFASMKGYHLDGNKEM+A+G  NI
Sbjct  320   SSLHQLNFGGPHVGEAAKIGLICALLALTEAIAVGRSFASMKGYHLDGNKEMVAMGFMNI  379

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GSLTSCY ATGSFSR+AVN+ AGCE+ +SN+VMA+TVLI L   TKLLY+TP+AILASI
Sbjct  380   VGSLTSCYTATGSFSRTAVNYSAGCETVISNIVMAITVLICLLFFTKLLYYTPLAILASI  439

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+LNEAY+IWKVDKLDF+ C GAF GVLF SVEIGLLVAV +SF KI+++SI
Sbjct  440   ILSALPGLIDLNEAYNIWKVDKLDFMVCLGAFFGVLFGSVEIGLLVAVVMSFGKIIVSSI  499

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +P  E LG L GTD LF  I QYPMA + PG+ + R  S   CFANA+FI+ RIL  V +
Sbjct  500   KPSTEVLGILTGTD-LFCNILQYPMANKLPGILITRINSGTFCFANASFIRERILRCVTD  558

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E       +ESS+ R+ +++ DM+N+MN+DTS I +L+EL+ K+T+ G++  + NPRWQV
Sbjct  559   E----SNIEESSKGRLQMLILDMTNVMNIDTSGIHALEELHKKVTARGLELAMVNPRWQV  614

Query  416   IHKLRLADFHNKI-KGKVFLTIGEAIDA  336
             + K++ + F  KI  G +FL+I +A+DA
Sbjct  615   VTKMKASKFIEKIGAGWIFLSISDAVDA  642



>ref|XP_010320152.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Solanum lycopersicum]
Length=631

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/650 (59%), Positives = 487/650 (75%), Gaps = 39/650 (6%)
 Frame = -1

Query  2261  FSQTLQKTSSTLPPAA-ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQ  2085
             FS  LQ+  +    A  +R  W+L  P PP    +L  S KK          R  KR   
Sbjct  9     FSIELQQLDAATDTARNQRTQWLLASPNPPNFFHQLINSVKKNV-------DRTTKRSTN  61

Query  2084  AVL-SASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
              V  S  + +FP+LSWG+ Y     K D++AGLTLASLCIPQSIGYA LA LDPQYGLY 
Sbjct  62    GVFFSFLKGLFPILSWGRNYKCTMFKHDIMAGLTLASLCIPQSIGYANLAKLDPQYGLYA  121

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SVVPPLIYAVMGSSREIAIGPVAV+SLLIS+++ K+ DPA +P  Y +LV T TFF G F
Sbjct  122   SVVPPLIYAVMGSSREIAIGPVAVVSLLISALISKIIDPAVDPIAYRNLVFTATFFTGAF  181

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QA FG+ RLGFLVDFLSH AIVGFM GAAIVIGLQQLK L GI++FT KTDVVSVL  ++
Sbjct  182   QAVFGLFRLGFLVDFLSHPAIVGFMGGAAIVIGLQQLKGLLGINHFTTKTDVVSVLEAVY  241

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              SLH+ P                      G++++KLFWLPAMAPLLSV+LSTL+VYLT+A
Sbjct  242   KSLHNEP----------------------GKRNKKLFWLPAMAPLLSVVLSTLIVYLTKA  279

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + HGV IVKH KGG+NPSS+HQL FN+PHI ++ KIG   A+VALTEAIAVG SFAS++G
Sbjct  280   DQHGVNIVKHFKGGVNPSSVHQLQFNSPHIGEIAKIGLTCAIVALTEAIAVGRSFASIRG  339

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             YHLDGNKEM+AIG  N+ GSLTSCY ATGSFSR+AVN+ AGCE+ VSN+VMA+TVLISL+
Sbjct  340   YHLDGNKEMVAIGCMNLVGSLTSCYTATGSFSRTAVNYSAGCETVVSNIVMAITVLISLE  399

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             LLTKLLY+TP+AILASII+SALPGLI++ EA+ IWKVDK DF+ C  AF GVLF SVEIG
Sbjct  400   LLTKLLYYTPLAILASIIISALPGLIDITEAFHIWKVDKTDFIICIAAFLGVLFGSVEIG  459

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             L++AVG+SF KI+L +I+P +E  GRLPGTD  F  I Q+P+A +T GV VIR  ++ LC
Sbjct  460   LIIAVGISFGKIILGTIRPSVELQGRLPGTDT-FCDITQFPVATETQGVLVIRVNNASLC  518

Query  647   FANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDK  468
             FANANFI+ RILS+V       + ++E S+ ++ ++V DMS++M++DTS I++L+EL  +
Sbjct  519   FANANFIRGRILSIV------TNRSEEQSKGKLRILVLDMSSVMSIDTSGIVALEELNRE  572

Query  467   ITSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACLVDK  321
             + S G+Q  IANPRW+V++KL++A F +++  + +FL++G+A+DACL  K
Sbjct  573   LVSQGIQLAIANPRWEVMNKLKVAKFVDELGNRWIFLSVGDAVDACLNAK  622



>ref|XP_010523328.1| PREDICTED: sulfate transporter 2.1-like [Tarenaya hassleriana]
Length=706

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/647 (61%), Positives = 498/647 (77%), Gaps = 21/647 (3%)
 Frame = -1

Query  2219  AAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLS  2043
             A ER+ W+L+ P PP    +L+   + T       F+ LR +P+ + V    ++VFP+L 
Sbjct  60    ANERSKWLLDCPAPPSPWLELKTQVRNTFVPRAKRFKSLRNKPIPERVFCILKAVFPILG  119

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             W + Y     K+D++A LTLASLCIPQSIGYA LA LDPQYGLY+SVVPPLIYA MG+SR
Sbjct  120   WCRNYKASMFKNDLMAVLTLASLCIPQSIGYATLAKLDPQYGLYSSVVPPLIYAFMGTSR  179

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+SLLISSM+ KL DP ++P GY  LVLT TFFAG+FQA+FG+ RLGFLVDF
Sbjct  180   EIAIGPVAVVSLLISSMLQKLTDPETDPIGYRKLVLTATFFAGVFQASFGLFRLGFLVDF  239

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SP---  1527
             LSHAAIVGFMAGAAIVIGLQQLK L GISNFT KT  V +  H    +       SP   
Sbjct  240   LSHAAIVGFMAGAAIVIGLQQLKGLLGISNFTTKT--VKITPHSIIIIVVSTIRISPLVF  297

Query  1526  --------WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTR  1371
                     W+P+  I+G SFL FIL+ RF+G+K++KLFW+PA+APL+SVI++T +V++T+
Sbjct  298   FFVCFLLQWSPHTFILGCSFLIFILLARFIGKKNKKLFWIPAIAPLVSVIVATFMVFITK  357

Query  1370  AENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMK  1191
             A+ HGVK V+H+KGGLNP S+H L F  PHI +V KIG IVAVVALTEAIAVG SFA +K
Sbjct  358   ADEHGVKTVRHIKGGLNPISMHDLEFTNPHIGEVAKIGLIVAVVALTEAIAVGRSFAGIK  417

Query  1190  GYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISL  1011
             GY LDGNKEM+AIG  N+ GS TSCY ATGSFSR+AVNF AG E+A+SN+VMAVTVL+ L
Sbjct  418   GYRLDGNKEMVAIGFMNVLGSFTSCYTATGSFSRTAVNFAAGSETAMSNIVMAVTVLVVL  477

Query  1010  QLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEI  831
             Q LT+LLY+TP+AILAS+ILSALPGLI+LNEAY IWK+DK DFL+C GAF GVLFASVEI
Sbjct  478   QCLTRLLYYTPIAILASVILSALPGLIDLNEAYRIWKLDKFDFLSCIGAFFGVLFASVEI  537

Query  830   GLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLL  651
             GLLVAV +SFAKI+L SI+PGIE LGR+PGT+ +F    QYPMAV+ PGVF++R KS+LL
Sbjct  538   GLLVAVAISFAKIILVSIRPGIETLGRMPGTN-IFADTDQYPMAVKIPGVFIVRVKSALL  596

Query  650   CFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYD  471
             CFANANFI+ R +  +   ++  ++ K + +K I L+  DMSN++N+DTS I +L EL++
Sbjct  597   CFANANFIRERYI-YIHTHRRGEEDKKGNMQKNILLVALDMSNLINIDTSGIEALVELHN  655

Query  470   KITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
              +T  GV+  I NP+W+VIHKL  A F ++I GKV++TIGEA+DAC+
Sbjct  656   NLTKYGVELAIVNPKWEVIHKLSQAKFVSRIGGKVYVTIGEALDACI  702



>ref|XP_006390036.1| hypothetical protein EUTSA_v10018230mg [Eutrema salsugineum]
 gb|ESQ27322.1| hypothetical protein EUTSA_v10018230mg [Eutrema salsugineum]
Length=674

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/630 (62%), Positives = 505/630 (80%), Gaps = 5/630 (1%)
 Frame = -1

Query  2225  PPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLL  2046
             P     + W+++ PEPP + ++L G  +     L     + +K+P   V S  +SVFP+L
Sbjct  36    PEEEPMSRWLIDTPEPPTICQELIGYVRTKV--LSKKRNKTKKKPSNPVYSCLKSVFPIL  93

Query  2045  SWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSS  1866
             +WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSVVPPLIY+ MGSS
Sbjct  94    TWGRQYKLNMFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVVPPLIYSTMGSS  153

Query  1865  REIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVD  1686
             RE+AIGPVAV+SLL+SS++ +L+DP ++P  Y ++V TVTFFAG+FQA FG+ RLGFLVD
Sbjct  154   RELAIGPVAVVSLLLSSLIRELQDPITDPIAYRNIVFTVTFFAGMFQAIFGLFRLGFLVD  213

Query  1685  FLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNli  1506
             FLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTDVVSVL+ +F SLHH PW P N +
Sbjct  214   FLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDVVSVLSSVFNSLHH-PWQPLNFV  272

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG SFL FIL+ RF+G++++KLFW+PA+APL++VIL+TL+VYLT AE  GVKIVK++K G
Sbjct  273   IGSSFLIFILLARFIGKRNKKLFWIPAIAPLIAVILATLIVYLTNAETRGVKIVKNIKPG  332

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             LN  S+++L FN+PH+ Q+ KIG I A++ALTEAIAVG SFA++KGY LDGNKEM+A+G 
Sbjct  333   LNRPSVNELQFNSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGYRLDGNKEMMAMGF  392

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
             +NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++LT+ LYFTP AIL
Sbjct  393   SNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVLTRFLYFTPTAIL  452

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLF SVEIGLL+AVG+SFA+IML
Sbjct  453   ASIILSALPGLIDISGALHIWKLDKLDFLVLLSAFFGVLFVSVEIGLLLAVGISFARIML  512

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
             +SI+P IE LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFANANFI+ RIL+ 
Sbjct  513   SSIRPNIEALGRLSRTD-IFGDINQYPMASKTQGLLTLRISSPLLCFANANFIRDRILNT  571

Query  605   VMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPR  426
             V E ++  DE +   E  + +++ DMS +M VDTS I++L+EL+ ++ S  ++ VIA+PR
Sbjct  572   VGEVKEEDDEQEVKVETVLQVVILDMSCVMGVDTSGIVALEELHQELASNNIRLVIASPR  631

Query  425   WQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             W+V+HKL+ +    K+K + +F+T+GEA++
Sbjct  632   WRVLHKLKRSTLEEKMKKENIFMTVGEAVE  661



>ref|XP_006287209.1| hypothetical protein CARUB_v10000384mg [Capsella rubella]
 gb|EOA20107.1| hypothetical protein CARUB_v10000384mg [Capsella rubella]
Length=677

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/629 (64%), Positives = 504/629 (80%), Gaps = 4/629 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R+ W+L+ PEPP    +L+   K +       F+ L+++P  + +LS  ++VFP+  W 
Sbjct  48    DRSKWLLDCPEPPSPWHELKSYVKGSILTKAKKFKSLQEQPFPKRILSILQAVFPIFGWC  107

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQ+GLYTSVVPPLIYA+MG+SREI
Sbjct  108   RNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQFGLYTSVVPPLIYALMGTSREI  167

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLLISSM+ KL DP  +P GY  LVLT TFFAGIFQA+FG+ RLGFLVDFLS
Sbjct  168   AIGPVAVVSLLISSMLQKLIDPEIDPVGYKKLVLTTTFFAGIFQASFGLFRLGFLVDFLS  227

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQQLK L GISNFT  TD+VSVL  ++ S     W+P+  I+G 
Sbjct  228   HAAIVGFMGGAAIVIGLQQLKGLLGISNFTTNTDIVSVLRAVWRSCQQQ-WSPHTFILGC  286

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G+K++KLFWLPA APL++V++STL+V+LT+A+ HGVK VKH+KGGLNP
Sbjct  287   SFLSFILITRFIGKKNKKLFWLPATAPLIAVVVSTLMVFLTKADEHGVKTVKHIKGGLNP  346

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S+H L FNTPH+ Q+ KIG I+A++ALTEAIAVG SFA +KGY LDGNKEM+AIG +N+
Sbjct  347   ISIHDLDFNTPHLGQIAKIGLIIAIIALTEAIAVGRSFAGIKGYRLDGNKEMMAIGFSNV  406

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGSFSR+AVNF AGCE+A+SN+VMAVTV ++L+ LT+LLY+TP+AILASI
Sbjct  407   IGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMAVTVFVALECLTRLLYYTPIAILASI  466

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI++NEA  IWKVDK DFLA  GAF GVLFASVE+GLLVAV +SFAKI+L S+
Sbjct  467   ILSALPGLIDINEAIHIWKVDKFDFLALVGAFFGVLFASVEVGLLVAVVISFAKIILISV  526

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE L R+PGTD +F   +QYPM V+TPGV V R KS+LLCFANA+ I+ RI+  V  
Sbjct  527   RPGIETLRRMPGTD-IFADTNQYPMTVKTPGVLVFRVKSALLCFANASSIEERIMGCV-N  584

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  +  K  ++++I  +V DMSN++N+DTS I +L EL++ +T  GV+ VI NP+W+V
Sbjct  585   EEEEEENIKSHAKRKILFVVLDMSNLINIDTSGITALVELHNNLTQAGVELVIVNPKWEV  644

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL  A F +KI GKV++TI EAIDAC 
Sbjct  645   IHKLNQARFISKIGGKVYMTIEEAIDACF  673



>gb|KDO80891.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
Length=607

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/583 (66%), Positives = 476/583 (82%), Gaps = 8/583 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQ---RLRKRPVQAVLSASESVFPLLS  2043
             ERA W+LN P+PP +  +L GS ++ A F         R+++   ++  S    +FP+L+
Sbjct  28    ERARWLLNSPDPPSIWHELAGSIRE-AFFPRNKLSSSSRVKQTWRRSAFSFLRGLFPILN  86

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y   K KSD++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MGSSR
Sbjct  87    WGRNYKASKFKSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYALMGSSR  146

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+S+L+S+++  ++DPA++P  Y  LV TVTFFAG+FQ+ FG+ RLGFLVDF
Sbjct  147   EIAIGPVAVVSMLLSALMQNVQDPAADPVAYRKLVFTVTFFAGVFQSVFGLFRLGFLVDF  206

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDVVSVL  +F+SLHHS W P N ++
Sbjct  207   LSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVVSVLGSVFSSLHHSYWYPLNFVL  266

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYLT+A+ HGVKIVKH+KGGL
Sbjct  267   GCSFLIFLLIARFIGRRNKKLFWLPAIAPLLSVILSTLIVYLTKADKHGVKIVKHIKGGL  326

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS HQL    PH+ Q  KIG I AVVALTEAIAVG SFAS+KGYHLDGNKEM+A+G  
Sbjct  327   NPSSAHQLQLTGPHLGQTAKIGLISAVVALTEAIAVGRSFASIKGYHLDGNKEMVAMGFM  386

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NI GSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+TVL+SL+L T LLY+TP+AILA
Sbjct  387   NIVGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAITVLLSLELFTSLLYYTPIAILA  446

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SIILSALPGLI++NEA +I+KVDKLDFLAC GAF GVLFASVEIGLL AV +SFAKI+LN
Sbjct  447   SIILSALPGLIDINEAINIYKVDKLDFLACIGAFLGVLFASVEIGLLAAVTISFAKILLN  506

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             +++PGIE  GRLP TD  +  I Q+PMA++TPG+  IR  S+L CFANANFI+ RI+  V
Sbjct  507   AVRPGIELQGRLPRTDT-YGDISQFPMAIKTPGILTIRINSALFCFANANFIRERIMRWV  565

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELY  474
              EEQ   DE +E++++ I  ++ DMSN MN+DTS I+ L+EL+
Sbjct  566   TEEQ---DELEETTKRTIQAVIIDMSNSMNIDTSGILVLEELH  605



>gb|AAZ08077.2| putative low affinity sulfate transporter [Brassica napus]
Length=653

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/643 (61%), Positives = 505/643 (79%), Gaps = 7/643 (1%)
 Frame = -1

Query  2258  SQTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA  2082
             S  +Q   +   PA E  S W++N+PEPP + ++  G  +     L     +++K+P   
Sbjct  2     SIEMQSHQAEAAPAEEPLSQWLINMPEPPTMWQEFVGYIRTNV--LSKKRNKMKKKPSNQ  59

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +SVFP+L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSV
Sbjct  60    VYSYLKSVFPILIWGRQYKLNMFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSV  119

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY++MGSSRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V T TFFAG FQA
Sbjct  120   VPPLIYSMMGSSRELAIGPVAVVSLLLSSMVSDLQDPVTDPIAYRKIVFTATFFAGAFQA  179

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
              FG+ RLGFL+DFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FT+KTDVVSVL+ +F S
Sbjct  180   IFGLFRLGFLMDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTSKTDVVSVLSSVFHS  239

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SVIL+TL+VYLT AE 
Sbjct  240   LHH-PWQPLNFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVILATLIVYLTNAET  298

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVK++K G N  S++QL FN PH+ QV KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  299   RGVKIVKNIKPGFNRPSVNQLEFNGPHLGQVAKIGIICAIIALTEAIAVGRSFATIKGYR  358

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G +NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV++SL++L
Sbjct  359   LDGNKEMMAMGFSNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMVSLEVL  418

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  419   TRFLYFTPTAILASIILSALPGLIDISGALHIWKLDKLDFLILVAAFLGVLFASVEIGLL  478

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SF +I+L+SI+P +E LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  479   LAVGISFTRIILSSIRPTVEALGRLSKTD-IFGDINQYPMATKTQGLLTLRISSPLLCFA  537

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRI-ALIVFDMSNIMNVDTSAIISLKELYDKI  465
             NANFI+ RIL+ + + ++  D+ +E    ++  +++ DMS +M +DTS +++L+EL+ ++
Sbjct  538   NANFIRDRILNSIQKVEEGEDDEQEVKRAKVLQVVILDMSCVMGLDTSGVVALEELHQEL  597

Query  464   TSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
              S   Q VIA+PRW+V HKL+ A    K+K + +F+T+GEA+D
Sbjct  598   ASNDTQLVIASPRWRVFHKLKRAKLEEKVKKENIFMTVGEAVD  640



>gb|KHN09143.1| Low affinity sulfate transporter 3 [Glycine soja]
Length=647

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/637 (65%), Positives = 502/637 (79%), Gaps = 17/637 (3%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ER+ WVLN P PP L  KL    KKT +F    F   +K  +   +S  ES+FP+L+W  
Sbjct  18    ERSIWVLNPPNPPPLRNKLFSPLKKTVSF----FSSKKKTCLGHAVSFLESLFPILTWFT  73

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K D+LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIA
Sbjct  74    NYKASKFKEDLLAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGSSREIA  133

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS+VPK+ DPA +P  Y ++V TVT FAGIFQAAFGI RLGFLVDFLSH
Sbjct  134   IGPVAVVSLLLSSLVPKVVDPAVDPDAYRNVVFTVTLFAGIFQAAFGIFRLGFLVDFLSH  193

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPYNl  1509
             AA+VGFMAGAAI+IGLQQLK L GI++FTNKTDV+SVL  ++ SLH        W P N 
Sbjct  194   AALVGFMAGAAIMIGLQQLKGLLGITHFTNKTDVISVLESVYKSLHQQITSGEKWYPLNF  253

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             +IG SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYL++A+ +GV I+KHVKG
Sbjct  254   VIGCSFLIFLLIARFVGRRNKKLFWLPAIAPLLSVILSTLIVYLSKADKNGVNIIKHVKG  313

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNPSS+ QL F+ P + Q  KIG I AV+ALTEAIAVG SFAS+KGYHLDGNKEMLA+G
Sbjct  314   GLNPSSVQQLQFHGPQVGQAAKIGLISAVIALTEAIAVGRSFASIKGYHLDGNKEMLAMG  373

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               NIAGSL+SCYVATGSFSR+AVNF AGC+++VSN+VMAVTV + L+L T+LLY+TPVAI
Sbjct  374   CMNIAGSLSSCYVATGSFSRTAVNFSAGCQTSVSNIVMAVTVFLCLELFTRLLYYTPVAI  433

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI+++EA  IWKVDK DFLAC GAF GVLF SVEIGLLVAV +SFAKI+
Sbjct  434   LASIILSALPGLIDISEACYIWKVDKFDFLACIGAFLGVLFESVEIGLLVAVSISFAKIL  493

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             + SI+PGIE LGR+P T+A F  + QYPMA  TPG+ VIR  S  LCFANANF++ RIL 
Sbjct  494   IQSIRPGIEVLGRVPRTEA-FCDVSQYPMATSTPGMLVIRISSGSLCFANANFVRERILK  552

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
              V EE+       E ++ R+  ++ DMSN+MNVDTS I+ L+EL+ ++ S GVQ  + NP
Sbjct  553   WVAEEE------NELAKGRVQAVILDMSNLMNVDTSGILILEELHKRLLSRGVQLAMVNP  606

Query  428   RWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             RW VIHKL++A F +KI +  VFLT+ EA+DACL  K
Sbjct  607   RWLVIHKLKVAHFVDKIGRQWVFLTVAEAVDACLSSK  643



>ref|XP_003526596.1| PREDICTED: low affinity sulfate transporter 3-like [Glycine max]
Length=653

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/637 (65%), Positives = 502/637 (79%), Gaps = 17/637 (3%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ER+ WVLN P PP L  KL    KKT +F    F   +K  +   +S  ES+FP+L+W  
Sbjct  24    ERSIWVLNPPNPPPLRNKLFSPLKKTVSF----FSSKKKTCLGHAVSFLESLFPILTWFT  79

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K D+LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIA
Sbjct  80    NYKASKFKEDLLAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGSSREIA  139

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS+VPK+ DPA +P  Y ++V TVT FAGIFQAAFGI RLGFLVDFLSH
Sbjct  140   IGPVAVVSLLLSSLVPKVVDPAVDPDAYRNVVFTVTLFAGIFQAAFGIFRLGFLVDFLSH  199

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPYNl  1509
             AA+VGFMAGAAI+IGLQQLK L GI++FTNKTDV+SVL  ++ SLH        W P N 
Sbjct  200   AALVGFMAGAAIMIGLQQLKGLLGITHFTNKTDVISVLESVYKSLHQQITSGEKWYPLNF  259

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             +IG SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYL++A+ +GV I+KHVKG
Sbjct  260   VIGCSFLIFLLIARFVGRRNKKLFWLPAIAPLLSVILSTLIVYLSKADKNGVNIIKHVKG  319

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNPSS+ QL F+ P + Q  KIG I AV+ALTEAIAVG SFAS+KGYHLDGNKEMLA+G
Sbjct  320   GLNPSSVQQLQFHGPQVGQAAKIGLISAVIALTEAIAVGRSFASIKGYHLDGNKEMLAMG  379

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               NIAGSL+SCYVATGSFSR+AVNF AGC+++VSN+VMAVTV + L+L T+LLY+TPVAI
Sbjct  380   CMNIAGSLSSCYVATGSFSRTAVNFSAGCQTSVSNIVMAVTVFLCLELFTRLLYYTPVAI  439

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI+++EA  IWKVDK DFLAC GAF GVLF SVEIGLLVAV +SFAKI+
Sbjct  440   LASIILSALPGLIDISEACYIWKVDKFDFLACIGAFLGVLFESVEIGLLVAVSISFAKIL  499

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             + SI+PGIE LGR+P T+A F  + QYPMA  TPG+ VIR  S  LCFANANF++ RIL 
Sbjct  500   IQSIRPGIEVLGRVPRTEA-FCDVSQYPMATSTPGMLVIRISSGSLCFANANFVRERILK  558

Query  608   LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
              V EE+       E ++ R+  ++ DMSN+MNVDTS I+ L+EL+ ++ S GVQ  + NP
Sbjct  559   WVAEEE------NELAKGRVQAVILDMSNLMNVDTSGILILEELHKRLLSRGVQLAMVNP  612

Query  428   RWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             RW VIHKL++A F +KI +  VFLT+ EA+DACL  K
Sbjct  613   RWLVIHKLKVAHFVDKIGRQWVFLTVAEAVDACLSSK  649



>ref|XP_009804329.1| PREDICTED: low affinity sulfate transporter 3-like [Nicotiana 
sylvestris]
Length=651

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/651 (63%), Positives = 501/651 (77%), Gaps = 15/651 (2%)
 Frame = -1

Query  2261  FSQTLQK--TSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV  2088
             FS  LQ+   +ST     ER  W+L  P PP L  +L  + K+T    G   ++ RK   
Sbjct  9     FSIELQQLDAASTDTARKERTQWLLTSPNPPSLCHELINTVKETVLPHGKTTKQSRK---  65

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
              A  S  + +FP+L WG+ Y   K K D++AGLTLASLCIPQSIGYA LA LDPQYGLYT
Sbjct  66    GAFFSFMQGLFPILKWGRNYKATKFKHDLMAGLTLASLCIPQSIGYANLAKLDPQYGLYT  125

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SVVPPLIYAVMGSSREIAIGPVAV+SLL+S+MVPKL DPA +   Y +LV T TFF G F
Sbjct  126   SVVPPLIYAVMGSSREIAIGPVAVVSLLLSAMVPKLVDPAVDSIAYRNLVFTATFFTGAF  185

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QA FG+ RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI++FT +TDVVSVL  +F
Sbjct  186   QAVFGLFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGINHFTTQTDVVSVLEAVF  245

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              S +  PW P N IIG SFL FILITRF+G++++K+FWLPAMAPL SVILSTL+VYLT A
Sbjct  246   RSFNKEPWFPLNFIIGCSFLVFILITRFIGKRNKKMFWLPAMAPLASVILSTLIVYLTNA  305

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + HGVKIVKH KGG  PSS+HQL F  PHI +V KIG I A+VALTEAIAVG SFAS+KG
Sbjct  306   DQHGVKIVKHFKGGHPPSSVHQLQFKDPHIGEVAKIGLICAIVALTEAIAVGRSFASIKG  365

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             YHLDGNKEM A+G  N+ GSLTSCY+ATGSFSR+AVNF AG E+ VSN+VMA+TVL+SL+
Sbjct  366   YHLDGNKEMTAMGCMNLVGSLTSCYIATGSFSRTAVNFSAGSETVVSNIVMAITVLLSLE  425

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             LLTKLLY+TP+AILASII+SALPGLI++NEA  IWKVDK DF+ C   F GVLF SVEIG
Sbjct  426   LLTKLLYYTPLAILASIIISALPGLIDINEACHIWKVDKTDFIICIATFFGVLFGSVEIG  485

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             LL+AVG+SF KI++++I+P +E  GRLPGT   F  I Q+P+A +TPG+ +IR  ++ LC
Sbjct  486   LLIAVGISFGKIIVDTIRPSVELQGRLPGTYT-FCDITQFPVATETPGILIIRVNNASLC  544

Query  647   FANANFIKARILSLVMEEQKSADETKESS-EKRIALIVFDMSNIMNVDTSAIISLKELYD  471
             FANANFI+ RIL LV         T E   +++I ++V DMSN+MNVDTS I++L+ELY 
Sbjct  545   FANANFIRQRILRLV-------KHTSEGHIQEKINVLVLDMSNVMNVDTSGIVALEELYR  597

Query  470   KITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             ++ S G+Q  IA+P W+VI+KL+ A+F +K+ KG +FLT+G+A+D CL  K
Sbjct  598   ELISQGMQLGIASPSWKVINKLKAANFLDKLGKGWIFLTVGDAVDGCLTSK  648



>ref|XP_010428901.1| PREDICTED: sulfate transporter 2.2 [Camelina sativa]
Length=657

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/633 (62%), Positives = 504/633 (80%), Gaps = 9/633 (1%)
 Frame = -1

Query  2222  PAAERAS-WVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA---VLSASESVF  2055
             PA E  S W+++ P PP + ++L G  +K    L     R  K    +   V S  +SVF
Sbjct  16    PAEEPISRWLVDTPVPPSMWQELAGYIRKN--LLSKKDNRRNKTKNSSSNPVYSCLKSVF  73

Query  2054  PLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVM  1875
             P+L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSVVPPLIY+ M
Sbjct  74    PILIWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVVPPLIYSTM  133

Query  1874  GSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGF  1695
             GSSRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V TVTFFAG FQA FG+ RLGF
Sbjct  134   GSSRELAIGPVAVVSLLLSSMVRDLQDPVTDPVAYRKIVFTVTFFAGAFQAIFGLFRLGF  193

Query  1694  LVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPY  1515
             LVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTD+VSVL+ +F SLHH PW P 
Sbjct  194   LVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDIVSVLSSVFHSLHH-PWQPL  252

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SV+L+TL+VYLT+AE  GVKIVKH+
Sbjct  253   NFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVVLATLIVYLTKAETRGVKIVKHI  312

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             K G N  S++QL F++PH+ Q+VKIG I A++ALTEAIAVG SFA++KGY LDGNKEM+A
Sbjct  313   KPGFNQPSVNQLQFSSPHLGQIVKIGLISAIIALTEAIAVGRSFATIKGYRLDGNKEMMA  372

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G  NIAGS TSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++LT+ LYFTP 
Sbjct  373   MGFMNIAGSFTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVLTRFLYFTPT  432

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILASIILSALPGLI+++ A  IWK+DKLDFL  A AF GVLFASVEIGLL+AVG+SF +
Sbjct  433   AILASIILSALPGLIDISGALHIWKLDKLDFLVLAAAFFGVLFASVEIGLLLAVGISFTR  492

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARI  615
             IML+SI+P IE LGRL  TD +F  I+QYPMA++TPG+  +R  S LLCFANANFI+ RI
Sbjct  493   IMLSSIRPNIEALGRLSKTD-IFGDINQYPMAIKTPGLLTLRISSPLLCFANANFIRDRI  551

Query  614   LSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIA  435
             L+ V E ++  +E +   +K + +++ D+S +M +DTS +++L+EL+ ++ S  ++ VIA
Sbjct  552   LNSVREVEEEENEQEVPKDKVLQVLILDISCVMGIDTSGVVALEELHKELASNDIRLVIA  611

Query  434   NPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             +PRW+++HKL+ A    K+K + +F+T+GEA+D
Sbjct  612   SPRWRILHKLKRAKLEEKVKEENIFMTVGEAVD  644



>ref|XP_010453042.1| PREDICTED: sulfate transporter 2.1 [Camelina sativa]
Length=689

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/631 (63%), Positives = 509/631 (81%), Gaps = 8/631 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTA--FQRLRKRPV-QAVLSASESVFPLLS  2043
             +R+ W+L+ PEPP    +++   K    FL  A  F+ L+K+P+ + +LS  ++VFP+  
Sbjct  60    DRSKWLLDCPEPPSPWHEIKSYVK--GYFLNKAKRFKSLQKQPLPKRILSILQAVFPIFG  117

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             W + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+SR
Sbjct  118   WCRNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYALMGTSR  177

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+SLLISSM+ KL DP  +P GY  LV+T TFFAGIFQA+FG+ RLGFLVDF
Sbjct  178   EIAIGPVAVVSLLISSMLQKLIDPEVDPLGYKKLVITTTFFAGIFQASFGLFRLGFLVDF  237

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S     W+P+  I+
Sbjct  238   LSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQQQ-WSPHTFIL  296

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFLSFILITRF+G+K++KLFWLPA+APL++V++ST++V+LT+A+ HGVK VKH+KGGL
Sbjct  297   GCSFLSFILITRFIGKKNKKLFWLPAIAPLIAVVVSTIMVFLTKADEHGVKTVKHIKGGL  356

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NP S+H L FNTPH+ Q+ KIG I+A++ALTEAIAVG SFA +KGY LDGNKEM+AIG +
Sbjct  357   NPISIHDLDFNTPHLGQIAKIGLIIAIIALTEAIAVGRSFAGIKGYRLDGNKEMMAIGFS  416

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+VM+VTV ++L+ LT+LLY+TP+AILA
Sbjct  417   NVIGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMSVTVFVALECLTRLLYYTPIAILA  476

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SIILSALPGLI++NEA  IWK+DK DFLA  GAF GVLFASVEIGLLVAV +SFAKI+L 
Sbjct  477   SIILSALPGLIDINEAVHIWKLDKFDFLALIGAFIGVLFASVEIGLLVAVVISFAKIILI  536

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             S++PGIE L R+PGTD +F   +QYPM V+TPGV + R KS+LLCFANA+ I+ RI+  V
Sbjct  537   SVRPGIETLRRMPGTD-IFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIEERIMGCV  595

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
               E++  +  K +++++I  +V DMSN++NVDTS I +L EL++ +T  GV+ VI NP+W
Sbjct  596   -NEEEEEENIKSNAKRKILFVVLDMSNLINVDTSGITALAELHNNLTQAGVELVIVNPKW  654

Query  422   QVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             +VIHKL  A F +KI GKV++TI EA+DAC 
Sbjct  655   EVIHKLNQARFVSKIGGKVYMTIEEALDACF  685



>ref|XP_009106442.1| PREDICTED: sulfate transporter 2.2 [Brassica rapa]
Length=653

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/640 (61%), Positives = 503/640 (79%), Gaps = 7/640 (1%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLS  2073
             +Q   +   PA E  S W++N+PEPP + ++  G  +     L     +++K+    V S
Sbjct  5     MQSHQAEAAPAEEPLSQWLINMPEPPTIWQEFVGYIRTNV--LSKKRNKMKKKSSNPVYS  62

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               +SVFP+L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSVVPP
Sbjct  63    YLKSVFPILIWGRQYKLNMFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVVPP  122

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIY++MGSSRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V T TFFAG FQA FG
Sbjct  123   LIYSMMGSSRELAIGPVAVVSLLLSSMVSDLQDPVTDPIAYRKIVFTATFFAGAFQAIFG  182

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             + RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FT+KTDVVSVL+ +F SLHH
Sbjct  183   LFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTSKTDVVSVLSSVFHSLHH  242

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
              PW P N +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SVIL+TL+VYLT AE  GV
Sbjct  243   -PWQPLNFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVILATLIVYLTNAETRGV  301

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             KIVK++K G N  S++QL FN PH+ QV KIG I A++ALTEAIAVG SFA++KGY LDG
Sbjct  302   KIVKNIKPGFNRPSVNQLEFNGPHLGQVAKIGIICAIIALTEAIAVGRSFATIKGYRLDG  361

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+A+G +NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV++SL++LT+ 
Sbjct  362   NKEMMAMGFSNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMVSLEVLTRF  421

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL+AV
Sbjct  422   LYFTPTAILASIILSALPGLIDISGALHIWKLDKLDFLVLVAAFLGVLFASVEIGLLLAV  481

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
             G+SF +I+L+SI+P +E LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFANAN
Sbjct  482   GISFTRIILSSIRPTVEALGRLSKTD-IFGDINQYPMATKTQGLLTLRISSPLLCFANAN  540

Query  632   FIKARILSLVMEEQKSADETKESSEKRI-ALIVFDMSNIMNVDTSAIISLKELYDKITSC  456
             FI+ RIL+ + + ++  D+ +E    ++  +++ DMS +M +DTS +++L+EL+ ++ S 
Sbjct  541   FIRDRILNSIQKVEEGEDDEQEVKRAKVLQVVILDMSCVMGLDTSGVVALEELHQELASN  600

Query  455   GVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
               Q VIA+PRW+V HKL+ A    K+K + +F+T+GEA+D
Sbjct  601   DTQLVIASPRWRVFHKLKRAKLEEKVKKENIFMTVGEAVD  640



>ref|XP_010491674.1| PREDICTED: sulfate transporter 2.1-like isoform X3 [Camelina 
sativa]
Length=692

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/629 (63%), Positives = 505/629 (80%), Gaps = 4/629 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R+ W+L+ PEPP    +++   K +       F+ L+K+P+ +  LS  ++VFP+  W 
Sbjct  63    DRSKWLLDCPEPPSPWHEVKSYVKGSFLTKLKRFKSLQKQPLPKRTLSILQAVFPIFGWC  122

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+SREI
Sbjct  123   RNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAMMGTSREI  182

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLLISSM+ KL DP  +P GY  LV+T TFFAGIFQA+FG+ RLGFLVDFLS
Sbjct  183   AIGPVAVVSLLISSMLQKLIDPEIDPLGYKKLVITTTFFAGIFQASFGLFRLGFLVDFLS  242

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S     W+P+  I+G 
Sbjct  243   HAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQQQ-WSPHTFILGC  301

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G+K++KLFWLPA APL++V++STL+V+LT+A+ HGVK VKH+KGGLNP
Sbjct  302   SFLSFILITRFIGKKNKKLFWLPATAPLIAVVVSTLMVFLTKADEHGVKTVKHIKGGLNP  361

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S+H L FNTPH+ Q+ KIG I+A++ALTEAIAVG SFA +KGY LDGNKEM+AIG +N+
Sbjct  362   ISIHDLDFNTPHLGQIAKIGLIIAIIALTEAIAVGRSFAGIKGYRLDGNKEMMAIGFSNV  421

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGSFSR+AVNF AGCE+A+SN+VM+VTV ++L+ LT+LLY+TP+AILASI
Sbjct  422   IGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMSVTVFVALECLTRLLYYTPIAILASI  481

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI++NEA  IWKVDK DFLA  GAF GVLFASVEIGLLVAV +SFAKI+L S+
Sbjct  482   ILSALPGLIDINEAIHIWKVDKFDFLALIGAFIGVLFASVEIGLLVAVVISFAKIILISV  541

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE L R+PGTD +F   +QYPM V+TPGV + R KS+LLCFANA+ I+ RI+  V  
Sbjct  542   RPGIETLRRMPGTD-IFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIEERIMGCV-N  599

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  +  K +++++I  +V DMSN++NVDTS I +L EL++ +T  GV+ V+ NP+W+V
Sbjct  600   EEEEEENIKSNAKRKILFVVLDMSNLINVDTSGITALAELHNNLTQAGVELVLVNPKWEV  659

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL  A F +KI GKV++TI EAIDAC 
Sbjct  660   IHKLNQAGFVSKIGGKVYMTIEEAIDACF  688



>ref|XP_010491673.1| PREDICTED: sulfate transporter 2.1-like isoform X2 [Camelina 
sativa]
Length=692

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/629 (63%), Positives = 505/629 (80%), Gaps = 4/629 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R+ W+L+ PEPP    +++   K +       F+ L+K+P+ +  LS  ++VFP+  W 
Sbjct  63    DRSKWLLDCPEPPSPWHEVKSYVKGSFLTKLKRFKSLQKQPLPKRTLSILQAVFPIFGWC  122

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+SREI
Sbjct  123   RNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAMMGTSREI  182

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLLISSM+ KL DP  +P GY  LV+T TFFAGIFQA+FG+ RLGFLVDFLS
Sbjct  183   AIGPVAVVSLLISSMLQKLIDPEIDPLGYKKLVITTTFFAGIFQASFGLFRLGFLVDFLS  242

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S     W+P+  I+G 
Sbjct  243   HAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQQQ-WSPHTFILGC  301

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G+K++KLFWLPA APL++V++STL+V+LT+A+ HGVK VKH+KGGLNP
Sbjct  302   SFLSFILITRFIGKKNKKLFWLPATAPLIAVVVSTLMVFLTKADEHGVKTVKHIKGGLNP  361

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S+H L FNTPH+ Q+ KIG I+A++ALTEAIAVG SFA +KGY LDGNKEM+AIG +N+
Sbjct  362   ISIHDLDFNTPHLGQIAKIGLIIAIIALTEAIAVGRSFAGIKGYRLDGNKEMMAIGFSNV  421

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGSFSR+AVNF AGCE+A+SN+VM+VTV ++L+ LT+LLY+TP+AILASI
Sbjct  422   IGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMSVTVFVALECLTRLLYYTPIAILASI  481

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI++NEA  IWKVDK DFLA  GAF GVLFASVEIGLLVAV +SFAKI+L S+
Sbjct  482   ILSALPGLIDINEAIHIWKVDKFDFLALIGAFIGVLFASVEIGLLVAVVISFAKIILISV  541

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE L R+PGTD +F   +QYPM V+TPGV + R KS+LLCFANA+ I+ RI+  V  
Sbjct  542   RPGIETLRRMPGTD-IFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIEERIMGCV-N  599

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  +  K +++++I  +V DMSN++NVDTS I +L EL++ +T  GV+ V+ NP+W+V
Sbjct  600   EEEEEENIKSNAKRKILFVVLDMSNLINVDTSGITALAELHNNLTQAGVELVLVNPKWEV  659

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL  A F +KI GKV++TI EAIDAC 
Sbjct  660   IHKLNQAGFVSKIGGKVYMTIEEAIDACF  688



>ref|XP_010416764.1| PREDICTED: sulfate transporter 2.2-like [Camelina sativa]
Length=654

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/641 (61%), Positives = 502/641 (78%), Gaps = 8/641 (1%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA---V  2079
             LQ      P     + W+++ P PP + ++L G  +K    L     R  K    +   V
Sbjct  5     LQSHHEDGPSEEPISRWLVDTPVPPSMWQELAGYIRKNV--LSKKDNRRNKTKSSSSNPV  62

Query  2078  LSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVV  1899
              S  +S+FP+L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSVV
Sbjct  63    YSCLKSLFPILIWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVV  122

Query  1898  PPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaa  1719
             PPLIY+ MGSSRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V TVTFFAG FQA 
Sbjct  123   PPLIYSTMGSSRELAIGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTVTFFAGAFQAI  182

Query  1718  fgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSL  1539
             FG+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTD+VSVL+ +F SL
Sbjct  183   FGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDIVSVLSSVFHSL  242

Query  1538  HHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENH  1359
             HH PW P N +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SV+L+TL+VYLT AE  
Sbjct  243   HH-PWQPLNFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVVLATLIVYLTNAETR  301

Query  1358  GVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHL  1179
             GVKIVKH+K G N  S++QL F++PH+ Q+VKIG I A++ALTEAIAVG SFA++KGY L
Sbjct  302   GVKIVKHIKPGFNQPSVNQLQFSSPHLGQIVKIGLISAIIALTEAIAVGRSFATIKGYRL  361

Query  1178  DGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLT  999
             DGNKEM+A+G  NIAGS TSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++LT
Sbjct  362   DGNKEMMAMGFMNIAGSFTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVLT  421

Query  998   KLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLV  819
             + LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL  A AF GVLFASVEIGLL+
Sbjct  422   RFLYFTPTAILASIILSALPGLIDISGALHIWKLDKLDFLVLAAAFFGVLFASVEIGLLL  481

Query  818   AVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFAN  639
             AVG+SF +I+L+SI+P IE LGRL  TD +F  I+QYPMA +TPG+  +R  S LLCFAN
Sbjct  482   AVGISFTRIVLSSIRPNIEALGRLSKTD-IFGDINQYPMATKTPGLLTLRISSPLLCFAN  540

Query  638   ANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITS  459
             ANFI+ RIL+ V E ++  +E +   +K + +++ DMS +M +DTS +++L+EL+ ++ S
Sbjct  541   ANFIRDRILNSVREVEEEDNEQEVPKDKVLQVLILDMSCVMGIDTSGVVALEELHKELAS  600

Query  458   CGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
               ++ VIA+PRW+++HKL+ A    K+K + +F+T+GEA+D
Sbjct  601   NDIRLVIASPRWRILHKLKRAKLEEKVKEENIFMTVGEAVD  641



>ref|XP_010491672.1| PREDICTED: sulfate transporter 2.1-like isoform X1 [Camelina 
sativa]
Length=706

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/629 (63%), Positives = 505/629 (80%), Gaps = 4/629 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             +R+ W+L+ PEPP    +++   K +       F+ L+K+P+ +  LS  ++VFP+  W 
Sbjct  77    DRSKWLLDCPEPPSPWHEVKSYVKGSFLTKLKRFKSLQKQPLPKRTLSILQAVFPIFGWC  136

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y L   K+D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYA+MG+SREI
Sbjct  137   RNYKLTMFKNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAMMGTSREI  196

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLLISSM+ KL DP  +P GY  LV+T TFFAGIFQA+FG+ RLGFLVDFLS
Sbjct  197   AIGPVAVVSLLISSMLQKLIDPEIDPLGYKKLVITTTFFAGIFQASFGLFRLGFLVDFLS  256

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S     W+P+  I+G 
Sbjct  257   HAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQQQ-WSPHTFILGC  315

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSFILITRF+G+K++KLFWLPA APL++V++STL+V+LT+A+ HGVK VKH+KGGLNP
Sbjct  316   SFLSFILITRFIGKKNKKLFWLPATAPLIAVVVSTLMVFLTKADEHGVKTVKHIKGGLNP  375

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
              S+H L FNTPH+ Q+ KIG I+A++ALTEAIAVG SFA +KGY LDGNKEM+AIG +N+
Sbjct  376   ISIHDLDFNTPHLGQIAKIGLIIAIIALTEAIAVGRSFAGIKGYRLDGNKEMMAIGFSNV  435

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS TSCY ATGSFSR+AVNF AGCE+A+SN+VM+VTV ++L+ LT+LLY+TP+AILASI
Sbjct  436   IGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMSVTVFVALECLTRLLYYTPIAILASI  495

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI++NEA  IWKVDK DFLA  GAF GVLFASVEIGLLVAV +SFAKI+L S+
Sbjct  496   ILSALPGLIDINEAIHIWKVDKFDFLALIGAFIGVLFASVEIGLLVAVVISFAKIILISV  555

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +PGIE L R+PGTD +F   +QYPM V+TPGV + R KS+LLCFANA+ I+ RI+  V  
Sbjct  556   RPGIETLRRMPGTD-IFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIEERIMGCV-N  613

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E++  +  K +++++I  +V DMSN++NVDTS I +L EL++ +T  GV+ V+ NP+W+V
Sbjct  614   EEEEEENIKSNAKRKILFVVLDMSNLINVDTSGITALAELHNNLTQAGVELVLVNPKWEV  673

Query  416   IHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             IHKL  A F +KI GKV++TI EAIDAC 
Sbjct  674   IHKLNQAGFVSKIGGKVYMTIEEAIDACF  702



>ref|XP_010926257.1| PREDICTED: low affinity sulfate transporter 3-like [Elaeis guineensis]
Length=661

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/655 (61%), Positives = 500/655 (76%), Gaps = 20/655 (3%)
 Frame = -1

Query  2264  EFSQTLQKTSSTL--PPAA--------ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTA  2115
             EFSQ LQ+   +    PA+           S VLN PEPP L  +L  + +   +    +
Sbjct  5     EFSQRLQEEMGSFASEPASVTKHGGEEPTESLVLNTPEPPSLWDELTSAARGAVS---VS  61

Query  2114  FQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALAN  1935
              Q+    P++ ++SA  S+FP+L W + Y L   +SD++AGLTLASL IPQSIGYA LA 
Sbjct  62    RQKKSSSPLKCIISALYSLFPILRWARNYDLKSFRSDLMAGLTLASLGIPQSIGYANLAK  121

Query  1934  LDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVL  1755
             L PQYGLYTSVVPPLIYAVMGSSR+IAIGPVAV+SLL+SSM+ K+ DP+ +P  Y  LV 
Sbjct  122   LSPQYGLYTSVVPPLIYAVMGSSRDIAIGPVAVVSLLVSSMIQKVVDPSVDPNAYKKLVF  181

Query  1754  TVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTD  1575
             T TFFAGIFQA+FGI RLGFLVDFLSHAAIVGFM GAAIVIG QQLK L GIS+FTN TD
Sbjct  182   TATFFAGIFQASFGIFRLGFLVDFLSHAAIVGFMGGAAIVIGFQQLKGLLGISHFTNNTD  241

Query  1574  VVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILS  1395
             VVSV+  +  +++H PW+P N ++G SFL FILITRFL ++++KLFWL A+APLLSVILS
Sbjct  242   VVSVIKAVLVAVNH-PWHPDNFLLGCSFLIFILITRFLARRNKKLFWLAAVAPLLSVILS  300

Query  1394  TLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAV  1215
             TL+V++TRA+  GVKI++HV GGLNPSS  Q+    P   +  KIG + AV+ALTEAIAV
Sbjct  301   TLMVFVTRADKRGVKIIQHVDGGLNPSSAKQIQLTGPFAGECAKIGLLCAVIALTEAIAV  360

Query  1214  GGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVM  1035
             G SFAS KGY +DGNKEMLA+G  N+AGSL+SCYVATGSFSR+AVN  AGC++ +SN+VM
Sbjct  361   GRSFASTKGYQIDGNKEMLAMGFMNVAGSLSSCYVATGSFSRTAVNVSAGCKTTISNIVM  420

Query  1034  AVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAG  855
             A+TV I+L+LLT+LLY+TPVAILASIILSALPGL+++ EA SIW+VDK+DFLAC GAF G
Sbjct  421   AITVFIALELLTRLLYYTPVAILASIILSALPGLVDIKEACSIWEVDKMDFLACIGAFLG  480

Query  854   VLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFV  675
             VLF SVEIGLL+AV +SF +I++NSI+P IE LGR+ GTD +F  + QYP A +TPG+ +
Sbjct  481   VLFGSVEIGLLIAVTISFIRIIINSIRPRIEMLGRIQGTD-IFCSMRQYPKATETPGILI  539

Query  674   IRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAI  495
             I  +SS LCF NANFI+ RI   ++EEQ   D+T E   K +   V DMSN+MN+DTS I
Sbjct  540   IHIESSFLCFMNANFIRERITRQILEEQ---DDT-EKGGKSLQSAVIDMSNVMNIDTSGI  595

Query  494   ISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDAC  333
              +L+EL+ K+TS  +Q  IANP WQVIHK++LA   +KI G  +FLT+G+A++AC
Sbjct  596   TALEELHKKLTSVNIQLAIANPGWQVIHKMKLARLVDKIGGTWIFLTVGKAVEAC  650



>gb|KHN26070.1| Low affinity sulfate transporter 3 [Glycine soja]
Length=573

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/576 (69%), Positives = 482/576 (84%), Gaps = 11/576 (2%)
 Frame = -1

Query  2015  LKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAV  1836
              K D+LAGLTLASLCIPQSIGYA LA + P+YGLYTSVVPPLIYA+MGSSREIAIGPVAV
Sbjct  2     FKDDLLAGLTLASLCIPQSIGYATLAKVAPEYGLYTSVVPPLIYAMMGSSREIAIGPVAV  61

Query  1835  ISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGF  1656
             +S+L++S+VPK+EDP +NP  Y +LV TVTFF GIFQ AFG+ RLGFLVDFLSHAA+VGF
Sbjct  62    VSMLLASLVPKVEDPVANPNAYRNLVFTVTFFTGIFQTAFGVFRLGFLVDFLSHAALVGF  121

Query  1655  MAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPYNliigfsf  1491
             MAGAAI+IGLQQLK L G+S+FT+KTDVVSVL  ++ SLH+       WNP N ++G SF
Sbjct  122   MAGAAIIIGLQQLKGLLGLSHFTSKTDVVSVLASVYKSLHNQIASGEKWNPLNFVLGCSF  181

Query  1490  lsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSS  1311
             L FILITRF+G+++RKLFWLPA++PLLSVILSTL+VYL+RA+ HGV I+KHVKGGLNPSS
Sbjct  182   LIFILITRFIGRRNRKLFWLPAISPLLSVILSTLIVYLSRADKHGVNIIKHVKGGLNPSS  241

Query  1310  LHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAG  1131
             LHQL F  PH+ Q  KIG I +V+ALTEAIAVG SFAS+KGYHLDGNKEML++G  NIAG
Sbjct  242   LHQLQFYGPHVGQAAKIGLICSVIALTEAIAVGRSFASIKGYHLDGNKEMLSMGFMNIAG  301

Query  1130  SLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIIL  951
             SL+SCYVATGSFSR+AVNF AGC++AVSN+VMA+TV +SL+L T+LLY+TPVAILASIIL
Sbjct  302   SLSSCYVATGSFSRTAVNFSAGCQTAVSNIVMAITVFVSLELFTRLLYYTPVAILASIIL  361

Query  950   SALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQP  771
             SALPGLI+L+EA  IWKVDKLDFLAC GAF GVLFASVEIGLLVAV +SFAKI++ SI+P
Sbjct  362   SALPGLIDLSEACYIWKVDKLDFLACIGAFLGVLFASVEIGLLVAVIISFAKILIQSIRP  421

Query  770   GIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR-ILSLVMEE  594
             GIE LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF++ R IL  V ++
Sbjct  422   GIEVLGRVPRTEA-FCDVTQYPMAISTPGIIVIRISSGSLCFANANFVRERQILKWVSQD  480

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             +   D+ KE+ + RI  ++ DM+N+MNVDTS I++L+EL+ ++ S G++  + NPRW VI
Sbjct  481   E---DDLKETPKGRIQAVILDMTNLMNVDTSGILALEELHKRLLSRGLELAMVNPRWLVI  537

Query  413   HKLRLADFHNKI-KGKVFLTIGEAIDACLVDKNMQA  309
             HKL+LA F +KI K  VFLT+GEA+DACL  K  +A
Sbjct  538   HKLKLALFVDKIGKEWVFLTVGEAVDACLSTKIARA  573



>ref|XP_010471997.1| PREDICTED: sulfate transporter 2.2-like [Camelina sativa]
Length=654

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/640 (61%), Positives = 503/640 (79%), Gaps = 6/640 (1%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA--VL  2076
             LQ      P     + W+++ P PP + ++L G  +K   F     +R + +   +  V 
Sbjct  5     LQSHHEDGPSEEPISRWLVDTPVPPSMWQELAGYIRKN-VFSKKDNRRNKTKSSSSNPVY  63

Query  2075  SASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVP  1896
             S  +S+FP+L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSVVP
Sbjct  64    SCLKSLFPILIWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVVP  123

Query  1895  PLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaaf  1716
             PLIY+ MGSSRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V TVTFFAG FQA F
Sbjct  124   PLIYSTMGSSRELAIGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTVTFFAGAFQAIF  183

Query  1715  gILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLH  1536
             G+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTD+VSVL+ +F SLH
Sbjct  184   GLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDIVSVLSSVFHSLH  243

Query  1535  HSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHG  1356
             H PW P N +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SV+L+TL+VYLT+AE  G
Sbjct  244   H-PWQPLNFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVVLATLIVYLTKAETRG  302

Query  1355  VKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLD  1176
             VKIVKH+K G N  S++QL F++PH+ Q+VKIG I A++ALTEAIAVG SFA++KGY LD
Sbjct  303   VKIVKHIKPGFNQPSVNQLQFSSPHLGQIVKIGLISAIIALTEAIAVGRSFATIKGYRLD  362

Query  1175  GNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTK  996
             GNKEM+A+G  NIAGS TSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++LT+
Sbjct  363   GNKEMMAMGFMNIAGSFTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVLTR  422

Query  995   LLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVA  816
              LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL  A AF GVLFASVEIGLL+A
Sbjct  423   FLYFTPTAILASIILSALPGLIDISGALHIWKLDKLDFLVLAAAFFGVLFASVEIGLLLA  482

Query  815   VGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANA  636
             VG+SF +IML+SI+P IE LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFANA
Sbjct  483   VGISFTRIMLSSIRPNIEALGRLSKTD-IFGDINQYPMATKTLGLLTLRISSPLLCFANA  541

Query  635   NFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSC  456
             NFI+ RIL+ V E ++  +E +   +K + +++ DMS +M +DTS +++L+EL+ ++ S 
Sbjct  542   NFIRDRILNSVREVEEEDNEQEVPKDKVLQVLILDMSCVMGIDTSGVVALEELHKELASN  601

Query  455   GVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
              ++ VIA+PRW+++HKL+ A    K+K + + +T+GEA+D
Sbjct  602   DIRLVIASPRWRILHKLKRAKLEEKVKEENIVMTVGEAVD  641



>emb|CDX87488.1| BnaA07g33850D [Brassica napus]
Length=640

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/642 (60%), Positives = 495/642 (77%), Gaps = 18/642 (3%)
 Frame = -1

Query  2258  SQTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA  2082
             S  +Q   +   PA E  S W++N+PEPP + ++  G  +     L     +++K+    
Sbjct  2     SIEMQSHQAEAAPAEEPLSQWLINMPEPPTIWQEFVGYIRTNV--LSKKRNKMKKKSSNP  59

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +SVFP+L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSV
Sbjct  60    VYSYLKSVFPILIWGRQYKLNMFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSV  119

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY++MGSSRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V T TFFAG    
Sbjct  120   VPPLIYSMMGSSRELAIGPVAVVSLLLSSMVSDLQDPVTDPIAYRKIVFTATFFAGA---  176

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
                   LGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTDVVSVL+ +F S
Sbjct  177   ------LGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDVVSVLSSVFHS  230

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SVIL+TL+VYLT AE 
Sbjct  231   LHH-PWQPLNFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVILATLIVYLTNAET  289

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVK++K G N  S++QL FN PH+ QV KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  290   RGVKIVKNIKPGFNRPSVNQLEFNGPHLGQVAKIGIICAIIALTEAIAVGRSFATIKGYR  349

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G +NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV++SL++L
Sbjct  350   LDGNKEMMAMGFSNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMVSLEVL  409

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  410   TRFLYFTPTAILASIILSALPGLIDISGALHIWKLDKLDFLVLVAAFLGVLFASVEIGLL  469

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SF +I+L+SI+P +E LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  470   LAVGISFTRIILSSIRPTVEALGRLSKTD-IFGDINQYPMATKTQGLLTLRISSPLLCFA  528

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKIT  462
             NANFI+ R++S+   E+   DE +    K + +++ DMS +M +DTS +++L+EL+ ++ 
Sbjct  529   NANFIRDRLISV---EEGEDDEQEVKRAKVLQVVILDMSCVMGLDTSGVVALEELHQELA  585

Query  461   SCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             S   Q VIA+PRW+V HKL+ A    K+K + +F+T+GEA+D
Sbjct  586   SNDTQLVIASPRWRVFHKLKRAKLEEKVKKENIFMTVGEAVD  627



>ref|XP_006585288.1| PREDICTED: sulfate transporter 2.1-like isoform X2 [Glycine max]
Length=625

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/609 (64%), Positives = 479/609 (79%), Gaps = 9/609 (1%)
 Frame = -1

Query  2264  EFSQTLQKTSSTLP----PAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRK  2097
             EFSQTLQ ++  LP      AER+ WVLN P PP     L  S + T +        +R 
Sbjct  5     EFSQTLQ-SNMALPANETSMAERSQWVLNAPAPPSTWHNLMASVRNTISSYQKMCSYIRG  63

Query  2096  RP-VQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQY  1920
             +P  + VLS   S+FP+L WG+ YS  K ++D+LAGLT+ASLCIPQSIGYA LA LDP+Y
Sbjct  64    QPGPKVVLSFLRSIFPILHWGRNYSPTKFRNDLLAGLTIASLCIPQSIGYATLAKLDPEY  123

Query  1919  GLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTff  1740
             GLYTSVVPPLIYA+MG+SREIAIGPVAV+SLL+SSM+ KL DPA +P GY  LV T TFF
Sbjct  124   GLYTSVVPPLIYALMGTSREIAIGPVAVVSLLLSSMIQKLIDPAIDPNGYRKLVFTTTFF  183

Query  1739  agifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVL  1560
             AGIFQAAFG+ RLGFLVDFLSHAAIVGFM GAAI+IGLQQLK LFGI++FTNKTD++SV+
Sbjct  184   AGIFQAAFGLFRLGFLVDFLSHAAIVGFMGGAAIIIGLQQLKGLFGINHFTNKTDIISVM  243

Query  1559  THIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVY  1380
               ++ S+ H PWNP N ++G SF  FIL TRFLG++++KLFWLPA++PL+SV+LSTL+V+
Sbjct  244   KSVWESVDH-PWNPRNFVLGCSFFIFILFTRFLGKRNKKLFWLPAISPLVSVMLSTLIVF  302

Query  1379  LTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFA  1200
             LTRA+  GV IV+H+KGGLNPSS++Q+  N+PHI  + KIG +VA VALTE++AVG SFA
Sbjct  303   LTRADKSGVNIVRHIKGGLNPSSINQIDLNSPHIGALAKIGLVVAAVALTESVAVGRSFA  362

Query  1199  SMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVL  1020
             SMKGYHLDGNKEM+++G  NI G  TSCYVATGSFSR+ VNF AGCE+  SN+VMA+ VL
Sbjct  363   SMKGYHLDGNKEMVSLGFMNIIGCFTSCYVATGSFSRTVVNFTAGCETLASNIVMAIVVL  422

Query  1019  ISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFAS  840
             ISLQ LTKLLYFTP AILASIILSALPGLI++NEAY IWKVDKLDFLAC GAF GVLFAS
Sbjct  423   ISLQCLTKLLYFTPTAILASIILSALPGLIDINEAYKIWKVDKLDFLACVGAFFGVLFAS  482

Query  839   VEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKS  660
             VE+GLLVAVG+SF KI+  SI  G E LGRLPGTD +F    QYPMAV+ PGV +IR KS
Sbjct  483   VELGLLVAVGISFTKIIWISIGAGTETLGRLPGTD-VFCDAQQYPMAVKIPGVAIIRVKS  541

Query  659   SLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKE  480
             SLLCF+NAN ++ RIL  +  E+   +  ++++   I L++ D SN++++DTS I SL+E
Sbjct  542   SLLCFSNANSVRERILKWISREEAKGN-IEDNTGSIIQLVILDTSNLVSIDTSGIASLEE  600

Query  479   LYDKITSCG  453
             L+  + S G
Sbjct  601   LHKSLVSSG  609



>emb|CAM33601.1| plasma membrane sulphate transporter [Brassica oleracea var. 
viridis]
Length=653

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/643 (61%), Positives = 504/643 (78%), Gaps = 7/643 (1%)
 Frame = -1

Query  2258  SQTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA  2082
             S  +Q   +   PA E  S W++N+PEPP + ++  G  +     L     +++K+    
Sbjct  2     SIEMQSHQAEAAPAEEPLSQWLINMPEPPTMWQEFVGYIRTNV--LSKKRNKMKKKSSNP  59

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +SVFP+L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSV
Sbjct  60    VYSYLKSVFPILIWGRQYKLNMFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSV  119

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY++MGSSRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V T TF AG FQA
Sbjct  120   VPPLIYSMMGSSRELAIGPVAVVSLLLSSMVSDLQDPVTDPIAYRKIVFTTTFIAGAFQA  179

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
              FG+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTDVVSVL+ +F S
Sbjct  180   IFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDVVSVLSSVFHS  239

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SVIL+TL+VYLT A+ 
Sbjct  240   LHH-PWQPLNFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVILATLIVYLTNADT  298

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVK++K G N  S++QL FN PH+ QV KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  299   RGVKIVKNIKPGFNRPSVNQLEFNGPHLGQVAKIGIICAIIALTEAIAVGRSFATIKGYR  358

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G +NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV++SL++L
Sbjct  359   LDGNKEMMAMGFSNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMVSLEVL  418

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  419   TRFLYFTPTAILASIILSALPGLIDISGALHIWKLDKLDFLVLVAAFLGVLFASVEIGLL  478

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SF +I+L+SI+P +E LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  479   LAVGISFTRIILSSIRPTVEALGRLSKTD-IFGDINQYPMATKTQGLLTLRISSPLLCFA  537

Query  641   NANFIKARIL-SLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKI  465
             NANFI+ RIL S+   E++  DE +    K + +++ DMS +M +DTS +++L+EL+ ++
Sbjct  538   NANFIRDRILNSIQKVEEEEDDEQEVKRAKVLQVVILDMSCVMGLDTSGVVALEELHQEL  597

Query  464   TSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
              S   Q VIA+PRW+V+HKL+LA    K+K + +F+T+GEA+D
Sbjct  598   ASNDTQLVIASPRWRVLHKLKLAKLEEKVKKENIFMTVGEAVD  640



>gb|KFK42184.1| hypothetical protein AALP_AA2G222200 [Arabis alpina]
Length=661

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/646 (60%), Positives = 507/646 (78%), Gaps = 10/646 (2%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAER--ASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA  2082
             Q  Q       PA E+  + W+++ PEPP + ++L   + +T       + R + +   +
Sbjct  6     QNQQSHQEEAGPAEEQPVSRWLISTPEPPTMWQELV-KYIRTNVLSKKNYMRNKTKNSSS  64

Query  2081  --VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
               V S  +SVFP+L+WG+QY L   K D++AGLTLASLC+PQSIGYA LA LDP+YGLYT
Sbjct  65    NPVYSCLKSVFPILNWGRQYKLNMFKKDLMAGLTLASLCVPQSIGYANLAGLDPEYGLYT  124

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SVVPPLIY+ MGSSRE+AIGPVAV+SLL+SSMV +L+DP ++P  Y  ++ TVTFFAG F
Sbjct  125   SVVPPLIYSTMGSSRELAIGPVAVVSLLLSSMVSELQDPVTDPIAYRKIIFTVTFFAGAF  184

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QA FG+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTN+TD+VSVL+ +F
Sbjct  185   QAIFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNQTDIVSVLSSVF  244

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              SLHH PW P N +IG +FL FIL+ RF+G++++KLFW+PAMAPL+SVIL+TL+VYLT A
Sbjct  245   HSLHH-PWQPLNFVIGSTFLIFILLARFIGKRNKKLFWIPAMAPLISVILATLIVYLTNA  303

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             E+ GVKIVKH+K G N  S++QL FN+PH+  +VKIG I A++ALTEAIAVG SFA++KG
Sbjct  304   ESRGVKIVKHIKPGFNRPSVNQLQFNSPHLGHIVKIGLISAIIALTEAIAVGRSFATIKG  363

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             Y LDGNKEM+A+G  NIAGS TSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL+
Sbjct  364   YRLDGNKEMMAMGFMNIAGSFTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLE  423

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             +LT+ LYFTP AILASIILSALPG+I+++ AY IWK+DKLDFL    AF GVLFASVEIG
Sbjct  424   VLTRFLYFTPTAILASIILSALPGIIDVSGAYHIWKLDKLDFLVLIAAFFGVLFASVEIG  483

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             LL+AVG+SFA+IML+SI+P IE LGRL  TD +F  I+QYPMA +TPG+  +R  S LLC
Sbjct  484   LLLAVGISFARIMLSSIRPNIEALGRLSRTD-IFGDINQYPMANKTPGLLTLRISSPLLC  542

Query  647   FANANFIKARILS--LVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELY  474
             FANANFI+ RIL+    + E++  ++ +   EK   L++ DMS +M VDTS +++L+EL+
Sbjct  543   FANANFIRDRILNSVKEVVEEEDEEDQEVKKEKVPQLVILDMSCVMGVDTSGLVALEELH  602

Query  473   DKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
              ++ S  ++ VIA+P+W+V+HKL+ A    K+K + + +T+ EA+D
Sbjct  603   QELASNNIRLVIASPKWRVLHKLKRAKLDEKMKKENICMTVREAVD  648



>emb|CDP01189.1| unnamed protein product [Coffea canephora]
Length=646

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/638 (61%), Positives = 483/638 (76%), Gaps = 16/638 (3%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRL--RKRPVQAVLSASESVFPLLSW  2040
             ER  W+LN P+PPG   ++  S ++T    GT       +K       S  + +FP+L W
Sbjct  16    ERTGWLLNSPDPPGFFHEIFSSTRRTILPHGTRNHSSLPKKSSASKAFSFLQGLFPILEW  75

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
             G+ Y   K K D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPP IYA MGSSRE
Sbjct  76    GRNYRATKFKRDLMAGLTLASLCIPQSIGYANLAKLDPQYGLYTSVVPPFIYAFMGSSRE  135

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+SLL+SS++ K+ DPA +P GY  LV T TFF G FQA FG+ RLGFLVDFL
Sbjct  136   IAIGPVAVVSLLLSSLIQKVVDPAVDPVGYRRLVFTATFFTGTFQAVFGLFRLGFLVDFL  195

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliig  1500
             SHA +VGFM GAAIVIGLQQLK L GIS+FT KTDV+SVL           W P N ++G
Sbjct  196   SHATVVGFMGGAAIVIGLQQLKGLLGISHFTTKTDVISVL---------KAWYPLNFVLG  246

Query  1499  fsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLN  1320
              SFL FILITRF+G+++RKLFWLPA+APL+SVILSTL VYLT+A+ HG+ IVKH KGGLN
Sbjct  247   CSFLIFILITRFIGRRNRKLFWLPAIAPLVSVILSTLFVYLTKADKHGINIVKHFKGGLN  306

Query  1319  PSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVAN  1140
             PSS+H+L FN+ H+ +  KIG I AV+ALTEAIAVG SFAS+KGYHLDGNKEM+A+G  N
Sbjct  307   PSSVHELQFNSTHVAEAAKIGIICAVIALTEAIAVGRSFASVKGYHLDGNKEMVAMGFMN  366

Query  1139  IAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILAS  960
             I GSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA TVL+SLQL T+LLY+TP+AILAS
Sbjct  367   IIGSLTSCYVATGSFSRTAVNFTAGCETVVSNIVMATTVLVSLQLFTRLLYYTPLAILAS  426

Query  959   IILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNS  780
             IILSALPGLI++NEAY+IWKVDKLDF+ C GAF GVLF SVEIGLLVAV +SF K+++ S
Sbjct  427   IILSALPGLIDINEAYNIWKVDKLDFIVCVGAFLGVLFHSVEIGLLVAVVISFVKVIVGS  486

Query  779   IQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVM  600
             I+P  E LGR+PGT   F  + QYPMA + PG+ +IR  S  LCFANAN    R   L+ 
Sbjct  487   IRPSTEVLGRVPGTST-FSNVIQYPMATKVPGLLIIRINSGSLCFANAN--SIRERILLR  543

Query  599   EEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
               +   DE +E+ +  I ++V D+SN+M +DTSAII+L+EL+ ++ S G++   A+P+WQ
Sbjct  544   ILRLLGDENEENGKDNIRVLVLDISNVMGIDTSAIIALEELHRELVSRGIELAFASPKWQ  603

Query  419   VIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDKNMQA  309
             V+ KL+LA F +K+ +G+ FL + +AID    D NM A
Sbjct  604   VMSKLKLAKFVDKVGRGRFFLNVEDAIDV-FFDPNMSA  640



>ref|XP_004301932.1| PREDICTED: low affinity sulfate transporter 3-like [Fragaria 
vesca subsp. vesca]
Length=657

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/631 (63%), Positives = 504/631 (80%), Gaps = 13/631 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ERA WVL  PEPPG  +KL  S K      G  +         + +S  + +FP+LSWG+
Sbjct  30    ERAQWVLKSPEPPGPWQKLLHSVKANVFPQGKKY---------SAVSFFKGLFPILSWGR  80

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K+D++AGLTLASL IPQSIGYA LA LDPQYGLYTS+VPPL+Y++MGSSRE+A
Sbjct  81    NYKASKFKNDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSIVPPLVYSLMGSSRELA  140

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS++ K+EDP  NP  Y +LV TVTFFAGIFQAAFGI RLGFLVDFLSH
Sbjct  141   IGPVAVVSLLLSSLLQKIEDPTVNPVAYRNLVFTVTFFAGIFQAAFGIFRLGFLVDFLSH  200

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AAIVGFM GAAIVIGLQQLK L GIS FT  TDV+SVL  +F S+ H PW P N+++G +
Sbjct  201   AAIVGFMGGAAIVIGLQQLKGLLGISKFTTNTDVISVLECVFKSIIHEPWYPLNIVLGCA  260

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL F+LI RF+G+K++KLFWLPA+APL+SV+LSTL+VY T+A+ HGVKIVKH+K GL PS
Sbjct  261   FLIFLLIARFIGKKNKKLFWLPAIAPLISVVLSTLIVYFTKADRHGVKIVKHIKSGLMPS  320

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S HQL    PH+ Q  K G I A++AL EAIAVG SFAS+KGYHLDGNK+M+A+G  NIA
Sbjct  321   SAHQLQLTGPHVGQAAKAGLISAIIALAEAIAVGRSFASIKGYHLDGNKDMMAMGCMNIA  380

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GSL+SCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV++SL+LLT+LLYFTP AILASII
Sbjct  381   GSLSSCYVATGSFSRTAVNFSAGCETVVSNIVMALTVIVSLELLTRLLYFTPTAILASII  440

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             LSALPGLI++NEAY IWKVDKLDFLAC GAF GVLFAS EIGLL+AV +SFAKI++N+++
Sbjct  441   LSALPGLIDINEAYHIWKVDKLDFLACIGAFLGVLFASAEIGLLLAVSISFAKILINALR  500

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             PGIE LGRLP +D +F  + QYPMA++TP + +I   SSLLCFANAN ++ R++  V +E
Sbjct  501   PGIEVLGRLPRSD-IFCNMSQYPMAIKTPSILIIGINSSLLCFANANSVRERVMKWVTKE  559

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
             +   DE ++ +   I  ++ DMSN+MNVDTS I++L+E++ K+ S G++  +ANPRWQVI
Sbjct  560   EDETDEKEKGTN--IQHVILDMSNVMNVDTSGILALEEIHKKLLSHGIELAVANPRWQVI  617

Query  413   HKLRLADFHNKI-KGKVFLTIGEAIDACLVD  324
             H+L+LA   +KI + ++FLT+ EA+DACL++
Sbjct  618   HRLKLAKLVDKIGEERIFLTVSEAVDACLMN  648



>gb|AAM20714.1| sulfate transporter, putative [Arabidopsis thaliana]
Length=658

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/642 (61%), Positives = 497/642 (77%), Gaps = 5/642 (1%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKRPVQA  2082
             Q  Q       PA E  S W++N PEPP + ++L G  +            + +      
Sbjct  6     QNHQSHHEEASPAEEPMSRWLINTPEPPSMWQELIGYIRTNVLAKKKHKRNKTKNSSSNL  65

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +S FP+LSWG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSV
Sbjct  66    VYSCLKSAFPILSWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSV  125

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY+ MG+SRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V TVTFFAG FQA
Sbjct  126   VPPLIYSTMGTSRELAIGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTVTFFAGAFQA  185

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
              FG+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+++FTNKTDVVSVL+ +F S
Sbjct  186   IFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLTHFTNKTDVVSVLSSVFHS  245

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RF+G+++ KLFW+PAMAPL+SV+L+TL+VYL+ AE+
Sbjct  246   LHH-PWQPLNFVIGSSFLIFILLARFIGKRNNKLFWIPAMAPLISVVLATLIVYLSNAES  304

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVKH+K G N  S++QL F +PH+ Q+ KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  305   RGVKIVKHIKPGFNQLSVNQLQFKSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGYR  364

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++L
Sbjct  365   LDGNKEMMAMGFMNIAGSLSSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVL  424

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  425   TRFLYFTPTAILASIILSALPGLIDVSGALHIWKLDKLDFLVLIAAFFGVLFASVEIGLL  484

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SFA+IML+SI+P IE LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  485   LAVGISFARIMLSSIRPSIEALGRLSKTD-IFGDINQYPMANKTAGLLTLRISSPLLCFA  543

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKIT  462
             NANFI+ RIL+ V E +   +E +   E  + +++ DMS +M VDTS + +L+EL+ ++ 
Sbjct  544   NANFIRDRILNSVQEIEGEENEQEVLKENGLQVVILDMSCVMGVDTSGVFALEELHQELA  603

Query  461   SCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             S  ++ VIA+PRW+V+HKL+ A    KIK + +++T+GEA+D
Sbjct  604   SNDIRLVIASPRWRVLHKLKRAKLDEKIKTENIYMTVGEAVD  645



>dbj|BAA25174.1| sulfate transporter [Arabidopsis thaliana]
Length=658

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/642 (61%), Positives = 497/642 (77%), Gaps = 5/642 (1%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKRPVQA  2082
             Q  Q       PA E  S W++N PEPP + ++L G  +            + +      
Sbjct  6     QNHQSHHEEASPAEEPMSRWLINTPEPPSMWQELIGYIRTNVLAKKKHKRNKTKNSSSNL  65

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +S FP+LSWG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSV
Sbjct  66    VYSCLKSAFPILSWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSV  125

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY+ MG+SRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V TVTFFAG FQA
Sbjct  126   VPPLIYSTMGTSRELAIGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTVTFFAGAFQA  185

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
              FG+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+++FTNKTDVVSVL+ +F S
Sbjct  186   IFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLTHFTNKTDVVSVLSSVFHS  245

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RF+G+++ KLFW+PAMAPL+SV+L+TL+VYL+ AE+
Sbjct  246   LHH-PWQPLNFVIGSSFLIFILLARFIGKRNNKLFWIPAMAPLISVVLATLIVYLSNAES  304

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVKH+K G N  S++QL F +PH+ Q+ KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  305   RGVKIVKHIKPGFNQLSVNQLQFKSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGYR  364

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++L
Sbjct  365   LDGNKEMMAMGFMNIAGSLSSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVL  424

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  425   TRFLYFTPTAILASIILSALPGLIDVSGALHIWKLDKLDFLVLIAAFFGVLFASVEIGLL  484

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SFA+IML+SI+P IE LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  485   LAVGISFARIMLSSIRPSIEALGRLSKTD-IFGDINQYPMANKTAGLLTLRISSPLLCFA  543

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKIT  462
             NANFI+ RIL+ V E +   +E +   E  + +++ DMS +M VDTS + +L+EL+ ++ 
Sbjct  544   NANFIRDRILNSVQEIEGEENEQEVLKENGLQVVILDMSCMMGVDTSGVFALEELHQELA  603

Query  461   SCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             S  ++ VIA+PRW+V+HKL+ A    KIK + +++T+GEA+D
Sbjct  604   SNDIRLVIASPRWRVLHKLKRAKLDEKIKTENIYMTVGEAVD  645



>dbj|BAA12811.1| sulfate transporter [Arabidopsis thaliana]
Length=658

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/642 (61%), Positives = 497/642 (77%), Gaps = 5/642 (1%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKRPVQA  2082
             Q  Q       PA E  S W++N PEPP + ++L G  +            + +      
Sbjct  6     QNHQSHHEEASPAEEPMSRWLINTPEPPSMWQELIGYIRTNVLAKKKHKRNKTKNSSSNL  65

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +S FP+LSWG+QY L   + D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSV
Sbjct  66    VYSCLKSAFPILSWGRQYKLNLFRKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSV  125

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY+ MG+SRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V TVTFFAG FQA
Sbjct  126   VPPLIYSTMGTSRELAIGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTVTFFAGAFQA  185

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
              FG+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+++FTNKTDVVSVL+ +F S
Sbjct  186   IFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLTHFTNKTDVVSVLSSVFHS  245

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RF+G+++ KLFW+PAMAPL+SV+L+TL+VYL+ AE+
Sbjct  246   LHH-PWQPLNFVIGSSFLIFILLARFIGKRNNKLFWIPAMAPLISVVLATLIVYLSNAES  304

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVKH+K G N  S++QL F +PH+ Q+ KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  305   RGVKIVKHIKPGFNQLSVNQLQFKSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGYR  364

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++L
Sbjct  365   LDGNKEMMAMGFMNIAGSLSSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVL  424

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  425   TRFLYFTPTAILASIILSALPGLIDVSGALHIWKLDKLDFLVLIAAFFGVLFASVEIGLL  484

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SFA+IML+SI+P IE LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  485   LAVGISFARIMLSSIRPSIEALGRLSKTD-IFGDINQYPMANKTAGLLTLRISSPLLCFA  543

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKIT  462
             NANFI+ RIL+ V E +   +E +   E  + +++ DMS +M VDTS + +L+EL+ ++ 
Sbjct  544   NANFIRDRILNSVQEIEGEENEQEVLKENGLQVVILDMSCVMGVDTSGVFALEELHQELA  603

Query  461   SCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             S  ++ VIA+PRW+V+HKL+ A    KIK + +++T+GEA+D
Sbjct  604   SNDIRLVIASPRWRVLHKLKRAKLDEKIKTENIYMTVGEAVD  645



>ref|NP_565165.2| sulfate transporter 2;2 [Arabidopsis thaliana]
 sp|P92946.3|SUT22_ARATH RecName: Full=Sulfate transporter 2.2; AltName: Full=AST56; AltName: 
Full=AtH14 [Arabidopsis thaliana]
 gb|AEE36054.1| sulfate transporter 2.2 [Arabidopsis thaliana]
Length=677

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/642 (61%), Positives = 497/642 (77%), Gaps = 5/642 (1%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKRPVQA  2082
             Q  Q       PA E  S W++N PEPP + ++L G  +            + +      
Sbjct  25    QNHQSHHEEASPAEEPMSRWLINTPEPPSMWQELIGYIRTNVLAKKKHKRNKTKNSSSNL  84

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +S FP+LSWG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSV
Sbjct  85    VYSCLKSAFPILSWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSV  144

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY+ MG+SRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V TVTFFAG FQA
Sbjct  145   VPPLIYSTMGTSRELAIGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTVTFFAGAFQA  204

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
              FG+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+++FTNKTDVVSVL+ +F S
Sbjct  205   IFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLTHFTNKTDVVSVLSSVFHS  264

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RF+G+++ KLFW+PAMAPL+SV+L+TL+VYL+ AE+
Sbjct  265   LHH-PWQPLNFVIGSSFLIFILLARFIGKRNNKLFWIPAMAPLISVVLATLIVYLSNAES  323

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVKH+K G N  S++QL F +PH+ Q+ KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  324   RGVKIVKHIKPGFNQLSVNQLQFKSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGYR  383

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++L
Sbjct  384   LDGNKEMMAMGFMNIAGSLSSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVL  443

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  444   TRFLYFTPTAILASIILSALPGLIDVSGALHIWKLDKLDFLVLIAAFFGVLFASVEIGLL  503

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SFA+IML+SI+P IE LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  504   LAVGISFARIMLSSIRPSIEALGRLSKTD-IFGDINQYPMANKTAGLLTLRISSPLLCFA  562

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKIT  462
             NANFI+ RIL+ V E +   +E +   E  + +++ DMS +M VDTS + +L+EL+ ++ 
Sbjct  563   NANFIRDRILNSVQEIEGEENEQEVLKENGLQVVILDMSCVMGVDTSGVFALEELHQELA  622

Query  461   SCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             S  ++ VIA+PRW+V+HKL+ A    KIK + +++T+GEA+D
Sbjct  623   SNDIRLVIASPRWRVLHKLKRAKLDEKIKTENIYMTVGEAVD  664



>ref|XP_004155745.1| PREDICTED: LOW QUALITY PROTEIN: low affinity sulfate transporter 
3-like [Cucumis sativus]
Length=669

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/645 (59%), Positives = 495/645 (77%), Gaps = 24/645 (4%)
 Frame = -1

Query  2222  PAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP--------------VQ  2085
             P A+ + W+LN P+PP    ++ G   +TA       +  RK P               +
Sbjct  26    PGAQTSEWLLNSPDPPTFWEQIVGVINETAIP-----RSCRKNPNKKVSSSSSEKQSIFK  80

Query  2084  AVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTS  1905
              +++  + VFP+L   + Y   K K+D++AGLTLASLCIPQSIGYA LA LDPQ+GLYTS
Sbjct  81    TIITLLQRVFPILKLARNYKASKFKNDLMAGLTLASLCIPQSIGYANLAKLDPQFGLYTS  140

Query  1904  VVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifq  1725
             VVPPLIYA MGSSREIAIGPVAV+SLL+SSM+ +++DP ++P  Y  LV TVT FAGIFQ
Sbjct  141   VVPPLIYAFMGSSREIAIGPVAVVSLLLSSMLQEIQDPVADPVAYRRLVFTVTLFAGIFQ  200

Query  1724  aafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFT  1545
             A+FG+LRLGFLVDFLSHAAIVGFMAGAAI+IGLQQ+K L  ISNFT KTDVVSVL  +  
Sbjct  201   ASFGLLRLGFLVDFLSHAAIVGFMAGAAILIGLQQMKGLLAISNFTTKTDVVSVLKSVVR  260

Query  1544  SLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAE  1365
             S+H + W P N++IG SFL F+L+ RF+G++++KLFW+ A+APL+SVILSTL+V+++RA+
Sbjct  261   SVHQT-WYPLNIVIGCSFLIFLLVARFIGRRNKKLFWVSAIAPLISVILSTLIVFVSRAD  319

Query  1364  NHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGY  1185
              HGVKIVK VK GLNP S+HQL  N+  +    K G I A++ALTEAIAVG SFAS+KGY
Sbjct  320   KHGVKIVKEVKEGLNPISIHQLQLNSTTVGLAAKSGLIAALIALTEAIAVGRSFASIKGY  379

Query  1184  HLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQL  1005
             ++DGNKEM+AIG  NI GSLTSCY+ATGSFSR+AVN+ AGCES +SN+VMA+TV+++LQ 
Sbjct  380   NIDGNKEMIAIGFMNIIGSLTSCYIATGSFSRTAVNYSAGCESVLSNIVMAITVMVTLQF  439

Query  1004  LTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGL  825
              T+ LYFTP+AILASIILSALPGL+++NEA  IWKVDKLDFLAC GAF GVLF SVE GL
Sbjct  440   FTRFLYFTPMAILASIILSALPGLVDINEAVRIWKVDKLDFLACLGAFLGVLFHSVEFGL  499

Query  824   LVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCF  645
             LVAVG+SFAKI+L SI+PG E++GRLP +D +F    Q+PMA +T G  +IR  S+LLCF
Sbjct  500   LVAVGISFAKILLISIRPGTEEVGRLPRSD-MFCNRKQFPMATKTQGFSIIRINSALLCF  558

Query  644   ANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKI  465
             ANA+FI+ RI+ LV E++   D   +   K+   +V DM N+M++DTS II L+EL+ ++
Sbjct  559   ANASFIRDRIMRLVEEDEDGDDIAIKDQPKQ---LVVDMCNVMSIDTSGIIVLEELHKRL  615

Query  464   TSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
                G+Q  IA+P+W+VIHKL+   F  +I+G+VFL++GEA+D+C+
Sbjct  616   LLHGIQLTIASPKWEVIHKLKXTKFVERIEGRVFLSVGEAVDSCI  660



>ref|XP_004500603.1| PREDICTED: low affinity sulfate transporter 3-like [Cicer arietinum]
Length=678

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/636 (62%), Positives = 491/636 (77%), Gaps = 14/636 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ER+ W+LN P PP L +KL    K    F    F    +   +   S   ++FP+LS  K
Sbjct  48    ERSQWILNSPNPPPLWKKLISPLKNKKHF----FSSKNRTCNEHAFSFIGNLFPILSLFK  103

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K D LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIA
Sbjct  104   NYDAFKFKDDFLAGLTLASLSIPQSIGYANLARLDPQYGLYTSVVPPLIYAVMGSSREIA  163

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS+  K+ DP ++   Y + V TVT FAGIFQ AFG+ RLGFLVDFLSH
Sbjct  164   IGPVAVVSLLLSSLCQKVVDPVAHHDDYRNFVFTVTLFAGIFQVAFGVFRLGFLVDFLSH  223

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS----PWNPYNli  1506
             AA+VGFMAGAAI+IGLQQLK L GISNFT K+DVVSV+  ++ SLHH      W P N +
Sbjct  224   AALVGFMAGAAIIIGLQQLKGLLGISNFTKKSDVVSVVESVYKSLHHQIPSGEWYPLNFV  283

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG SFL F+LI RF+G++++KLFWLPA+APL+SVILST +VY+++A+ +GV IV HVK G
Sbjct  284   IGSSFLIFLLIARFMGKRNKKLFWLPAIAPLVSVILSTFIVYISKADKNGVNIVTHVKRG  343

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             LNP+S+HQL  N PH+ Q  KIG I AV+ALTEA+AVG SFAS+KGYHLDGNKEMLA+G 
Sbjct  344   LNPTSVHQLQLNGPHVGQAAKIGLISAVIALTEAMAVGRSFASIKGYHLDGNKEMLAMGC  403

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              NIAGS TSCYVATGSFSR+AVNF A C+S++SN+VMAVTV++ L+L T+LLY+TP+AIL
Sbjct  404   MNIAGSFTSCYVATGSFSRTAVNFSARCQSSISNIVMAVTVILCLELFTRLLYYTPMAIL  463

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ASIILSALPGLI++ EA  IWKVDK+DFLAC GAF GVLF SVE GL+VAV +SF KI++
Sbjct  464   ASIILSALPGLIDIREACYIWKVDKVDFLACIGAFFGVLFVSVETGLIVAVSISFGKIVI  523

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
              SI+PGIE LGR+P T+A F  + QYP+A  TPG+ VIR  S  LCFAN+N ++ RIL  
Sbjct  524   QSIRPGIEVLGRIPRTEA-FCDVSQYPIATSTPGILVIRISSGSLCFANSNVVRERILKW  582

Query  605   VMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPR  426
             + +E    DE KE+++ R+  ++ DM+N+MNVDTS II L+EL+ ++ S G++F + NPR
Sbjct  583   ITQE----DELKETTKGRVQAVILDMTNLMNVDTSGIIILEELHKRLLSRGIKFAMVNPR  638

Query  425   WQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             W VIHKL++A+F +KI K  VFLT+GEA+DACL  K
Sbjct  639   WLVIHKLKVANFVDKIGKEWVFLTVGEAMDACLSYK  674



>ref|XP_004140372.1| PREDICTED: low affinity sulfate transporter 3-like [Cucumis sativus]
 gb|KGN51012.1| hypothetical protein Csa_5G407060 [Cucumis sativus]
Length=669

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/645 (59%), Positives = 495/645 (77%), Gaps = 24/645 (4%)
 Frame = -1

Query  2222  PAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP--------------VQ  2085
             P A+ + W+LN P+PP    ++ G   +TA       +  RK P               +
Sbjct  26    PGAQTSEWLLNSPDPPTFWEQIVGVINETAIP-----RSCRKNPNKKVSSSSSEKQSIFK  80

Query  2084  AVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTS  1905
              +++  + VFP+L   + Y   K K+D++AGLTLASLCIPQSIGYA LA LDPQ+GLYTS
Sbjct  81    TIITLLQRVFPILKLARNYKASKFKNDLMAGLTLASLCIPQSIGYANLAKLDPQFGLYTS  140

Query  1904  VVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifq  1725
             VVPPLIYA MGSSREIAIGPVAV+SLL+SSM+ +++DP ++P  Y  LV TVT FAGIFQ
Sbjct  141   VVPPLIYAFMGSSREIAIGPVAVVSLLLSSMLQEIQDPVADPVAYRRLVFTVTLFAGIFQ  200

Query  1724  aafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFT  1545
             A+FG+LRLGFLVDFLSHAAIVGFMAGAAI+IGLQQ+K L  ISNFT KTDVVSVL  +  
Sbjct  201   ASFGLLRLGFLVDFLSHAAIVGFMAGAAILIGLQQMKGLLAISNFTTKTDVVSVLKSVVR  260

Query  1544  SLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAE  1365
             S+H + W P N++IG SFL F+L+ RF+G++++KLFW+ A+APL+SVILSTL+V+++RA+
Sbjct  261   SVHQT-WYPLNIVIGCSFLIFLLVARFIGRRNKKLFWVSAIAPLISVILSTLIVFVSRAD  319

Query  1364  NHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGY  1185
              HGVKIVK VK GLNP S+HQL  N+  +    K G I A++ALTEAIAVG SFAS+KGY
Sbjct  320   KHGVKIVKEVKEGLNPISIHQLQLNSTTVGLAAKSGLIAALIALTEAIAVGRSFASIKGY  379

Query  1184  HLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQL  1005
             ++DGNKEM+AIG  NI GSLTSCY+ATGSFSR+AVN+ AGCES +SN+VMA+TV+++LQ 
Sbjct  380   NIDGNKEMIAIGFMNIIGSLTSCYIATGSFSRTAVNYSAGCESVLSNIVMAITVMVTLQF  439

Query  1004  LTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGL  825
              T+ LYFTP+AILASIILSALPGL+++NEA  IWKVDKLDFLAC GAF GVLF SVE GL
Sbjct  440   FTRFLYFTPMAILASIILSALPGLVDINEAVRIWKVDKLDFLACLGAFLGVLFHSVEFGL  499

Query  824   LVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCF  645
             LVAVG+SFAKI+L SI+PG E++GRLP +D +F    Q+PMA +T G  +IR  S+LLCF
Sbjct  500   LVAVGISFAKILLISIRPGTEEVGRLPRSD-MFCNRKQFPMATKTQGFSIIRINSALLCF  558

Query  644   ANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKI  465
             ANA+FI+ RI+ LV E++   D   +   K+   +V DM N+M++DTS II L+EL+ ++
Sbjct  559   ANASFIRDRIMRLVEEDEDGDDIAIKDQPKQ---LVVDMCNVMSIDTSGIIVLEELHKRL  615

Query  464   TSCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
                G+Q  IA+P+W+VIHKL+   F  +I+G+VFL++GEA+D+C+
Sbjct  616   LLHGIQLTIASPKWEVIHKLKKTKFVERIEGRVFLSVGEAVDSCI  660



>ref|XP_006596331.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Glycine max]
Length=611

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/596 (66%), Positives = 487/596 (82%), Gaps = 11/596 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGT--AFQRLRKRPVQAVLSASESVFPLLSW  2040
             ER+ WVL+ P PP L +KL  S K+T    G    F   RK      LS  +++FP++SW
Sbjct  16    ERSQWVLDSPNPPPLWKKLFSSVKETILPHGNKFCFSSKRKTINGHALSCLQNLFPIISW  75

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
              + Y + K K D+LAGLTLASLCIPQSIGYA LA + P+YGLYTSVVPPLIYA+MGSSRE
Sbjct  76    LRDYKVSKFKDDLLAGLTLASLCIPQSIGYATLAKVAPEYGLYTSVVPPLIYAMMGSSRE  135

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L++S+VPK+EDP +NP  Y +LV TVTFF GIFQ AFG+ RLGFLVDFL
Sbjct  136   IAIGPVAVVSMLLASLVPKVEDPVTNPNAYRNLVFTVTFFTGIFQTAFGVFRLGFLVDFL  195

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS-----PWNPY  1515
             SHAA+VGFMAGAAI+IGLQQLK L G+S+FT+KTDVVSVL  ++ SLH+       WNP 
Sbjct  196   SHAALVGFMAGAAIIIGLQQLKGLLGLSHFTSKTDVVSVLASVYKSLHNQIAPGQKWNPL  255

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N ++G SFL FILITRF+G+++RKLFWLPA++PLLSVILSTL+VYL+RA+ HGV I+KHV
Sbjct  256   NFVLGCSFLIFILITRFIGRRNRKLFWLPAISPLLSVILSTLIVYLSRADKHGVNIIKHV  315

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGGLNPSSLHQL  + PH+ Q  KIG I +V+ALTEAIAVG SFAS+KGYHLDGNKEML+
Sbjct  316   KGGLNPSSLHQLQLHGPHVGQAAKIGLICSVIALTEAIAVGRSFASIKGYHLDGNKEMLS  375

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G+ NIAGSLTSCYVATGSFSR+AVNF AGC++AVSN+VMAVTV +SL+L T+LLY+TPV
Sbjct  376   MGIMNIAGSLTSCYVATGSFSRTAVNFSAGCQTAVSNIVMAVTVFLSLELFTRLLYYTPV  435

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILASI+LSALPGLI+L+EA  IWKVDKLDFLAC GAF GVLFA+VEIGLLVAV +SFAK
Sbjct  436   AILASIVLSALPGLIDLSEACYIWKVDKLDFLACIGAFLGVLFATVEIGLLVAVIISFAK  495

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARI  615
             I++ SI+PGIE LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF++ RI
Sbjct  496   ILIQSIRPGIEVLGRVPRTEA-FCDVTQYPMAISTPGIIVIRISSGSLCFANANFVRERI  554

Query  614   LSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             L  V +++   D+ KE+++ R+  ++ DM+N+MNVDTS I++L+EL+ ++ S GV+
Sbjct  555   LKWVSQDE---DDLKETTKGRVQAVILDMTNLMNVDTSGILALEELHKRLLSRGVE  607



>gb|AAL67130.2| putative sulfate transporter protein [Arabidopsis thaliana]
Length=658

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/642 (61%), Positives = 496/642 (77%), Gaps = 5/642 (1%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKRPVQA  2082
             Q  Q       PA E  S W++N PEPP + ++L G  +            + +      
Sbjct  6     QNHQSHHEEASPAEEPMSRWLINTPEPPSMWQELIGYIRTNVLAKKKHKRNKTKNSSSNL  65

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +S FP+LSWG+QY L   K D++AGLTLASLCIPQSIGYA LA  DP+YGLYTSV
Sbjct  66    VYSCLKSAFPILSWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGPDPEYGLYTSV  125

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY+ MG+SRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V TVTFFAG FQA
Sbjct  126   VPPLIYSTMGTSRELAIGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTVTFFAGAFQA  185

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
              FG+ RLGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+++FTNKTDVVSVL+ +F S
Sbjct  186   IFGLFRLGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLTHFTNKTDVVSVLSSVFHS  245

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RF+G+++ KLFW+PAMAPL+SV+L+TL+VYL+ AE+
Sbjct  246   LHH-PWQPLNFVIGSSFLIFILLARFIGKRNNKLFWIPAMAPLISVVLATLIVYLSNAES  304

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVKH+K G N  S++QL F +PH+ Q+ KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  305   RGVKIVKHIKPGFNQLSVNQLQFKSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGYR  364

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++L
Sbjct  365   LDGNKEMMAMGFMNIAGSLSSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVL  424

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  425   TRFLYFTPTAILASIILSALPGLIDVSGALHIWKLDKLDFLVLIAAFFGVLFASVEIGLL  484

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SFA+IML+SI+P IE LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  485   LAVGISFARIMLSSIRPSIEALGRLSKTD-IFGDINQYPMANKTAGLLTLRISSPLLCFA  543

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKIT  462
             NANFI+ RIL+ V E +   +E +   E  + +++ DMS +M VDTS + +L+EL+ ++ 
Sbjct  544   NANFIRDRILNSVQEIEGEENEQEVLKENGLQVVILDMSCVMGVDTSGVFALEELHQELA  603

Query  461   SCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             S  ++ VIA+PRW+V+HKL+ A    KIK + +++T+GEA+D
Sbjct  604   SNDIRLVIASPRWRVLHKLKRAKLDEKIKTENIYMTVGEAVD  645



>ref|XP_011098127.1| PREDICTED: low affinity sulfate transporter 3 [Sesamum indicum]
Length=658

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/647 (61%), Positives = 499/647 (77%), Gaps = 14/647 (2%)
 Frame = -1

Query  2264  EFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATF-LGTAFQRLRKRPV  2088
             E  Q     ++T   A+ERA W+L+ P PP   ++L  S K+T  F      Q    RPV
Sbjct  17    ELKQMDGHDAATTAAASERAKWLLSSPNPPAPWQELSSSIKETVCFPAAKNGQPQANRPV  76

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
               +    + +FP+L WG+ Y   K K+DV+AGLTLASLCIPQSIGYA LA LDPQYGLYT
Sbjct  77    LFL----QGLFPILKWGRNYKATKFKNDVMAGLTLASLCIPQSIGYANLAKLDPQYGLYT  132

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             SVVPPLIYA+MGSSREIAIGPVAV+SLL+S+M+ KL DP  +PA Y  ++ TVTFF G F
Sbjct  133   SVVPPLIYALMGSSREIAIGPVAVVSLLLSAMISKLVDPNVDPAAYLRIIFTVTFFTGTF  192

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QA FG+ RLGFL+DFLSHAAIVGFM GAAIVIGLQQLK L G+++FT KTDVVSVL  + 
Sbjct  193   QALFGLFRLGFLIDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLTHFTTKTDVVSVLGAVV  252

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              +LH   W P N ++G SFL FIL TRF+G++++KLFW+PAMAPL SVILSTL+VYLT+A
Sbjct  253   KALHEE-WYPLNFVLGCSFLIFILTTRFIGRRNKKLFWIPAMAPLFSVILSTLIVYLTKA  311

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + HGVKIVKH KGGLN SS+HQL+F  P++ +  KIG I +++ALTEAIAVG SFAS+KG
Sbjct  312   DRHGVKIVKHFKGGLNLSSVHQLNFGGPYVGEAAKIGLICSLIALTEAIAVGRSFASIKG  371

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             YHLDGNKEM+A+G  NI GSLTSCY ATGSFSR+AVNF AGCE+ VSN+VMA+TVLISL 
Sbjct  372   YHLDGNKEMVAMGFMNIVGSLTSCYTATGSFSRTAVNFTAGCETVVSNIVMAITVLISLL  431

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             L T+LLY+TP+AILASIILSALPGLI++N AY+IWKVDKLDF+ C GAF GVLF SVEIG
Sbjct  432   LFTRLLYYTPLAILASIILSALPGLIDVNAAYNIWKVDKLDFVVCLGAFFGVLFGSVEIG  491

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             LLVAVG+SF KI+L+SI+P  E LG LPGTD +F    QYPMA + PG+ + R  S+ LC
Sbjct  492   LLVAVGISFGKIILSSIKPSTEVLGNLPGTD-IFCNTVQYPMATKLPGISIFRINSATLC  550

Query  647   FANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDK  468
             FANANFI+ RIL  V      AD+ +E+++  I +++ DM+N+MN+DTS I +++EL+ +
Sbjct  551   FANANFIRERILKWV------ADDMEETTKGGIRVMILDMTNVMNIDTSGIHAMEELHKE  604

Query  467   ITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
             + S G++  +ANPRWQVI K+++A   +KI  G +F ++ +A+DA L
Sbjct  605   LISQGIELAVANPRWQVISKMKVAKLVDKIGSGWIFFSVADAVDASL  651



>ref|XP_008780885.1| PREDICTED: low affinity sulfate transporter 3-like [Phoenix dactylifera]
Length=647

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/625 (63%), Positives = 491/625 (79%), Gaps = 11/625 (2%)
 Frame = -1

Query  2204  SWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYS  2025
             SWVLN PEPP L  +L    +KT        Q+     ++  +SA   +FP+L WG+ Y 
Sbjct  22    SWVLNTPEPPSLWDELTSVVRKTIV----PRQKKSSSLLKCSISALYGLFPILRWGRNYD  77

Query  2024  LVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGP  1845
                 KSD++AGLTLASL IPQSIGYA LA L PQYGLYTSVVPPLIYAVMGSSR+IAIGP
Sbjct  78    FKSFKSDLMAGLTLASLGIPQSIGYANLAKLSPQYGLYTSVVPPLIYAVMGSSRDIAIGP  137

Query  1844  VAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAI  1665
             VAV+SLL+SSM+ K+ DP+ +P  Y  LV T TFFAGIFQA+FG+ RLGFLVDFLSHAAI
Sbjct  138   VAVVSLLLSSMIQKVVDPSVDPNAYRKLVFTATFFAGIFQASFGLFRLGFLVDFLSHAAI  197

Query  1664  VGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsfls  1485
             VGFM GAAIVIG QQLK L GIS+FTNKTDVVSV+  +  +++  PW+P N ++G SFL 
Sbjct  198   VGFMGGAAIVIGFQQLKGLLGISHFTNKTDVVSVIKAVLVAVNQ-PWHPDNFLLGCSFLI  256

Query  1484  filITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLH  1305
             FILITRF+ ++++KLFWL A+APLLSVILSTL+V++TRA+ HGVKI++HV GGLNPSS  
Sbjct  257   FILITRFISRRNKKLFWLAAVAPLLSVILSTLMVFVTRADKHGVKIIQHVDGGLNPSSAK  316

Query  1304  QLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSL  1125
             Q+ F  P++ +  KIG I AV+ALTEAIAVG SFASMKGY LDGNKEMLA+G  N+AGSL
Sbjct  317   QIQFTGPYVGKCAKIGLICAVIALTEAIAVGRSFASMKGYQLDGNKEMLAMGFTNVAGSL  376

Query  1124  TSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSA  945
             TSCYVATGSFSR+AVN  AGC++ +SN+VMA+TV I+L+LLT+LLY+TPVAILASIILSA
Sbjct  377   TSCYVATGSFSRTAVNVSAGCKTTISNIVMAITVFIALELLTRLLYYTPVAILASIILSA  436

Query  944   LPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGI  765
             LPGLI++ EA SIW+VDK+DFLAC GAF GVLF SVEIGLL+AV +SF +I+++SI+P I
Sbjct  437   LPGLIDIKEACSIWEVDKMDFLACLGAFLGVLFGSVEIGLLIAVAISFFRIIISSIRPRI  496

Query  764   EKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKS  585
             E LGR+ GTD +F  + QYP   +TPG+ +I  +SS LCF NANFI+ R++  +++E+  
Sbjct  497   EMLGRIQGTD-IFCSMRQYPKTTETPGILIIHIESSFLCFMNANFIRERVMRWILDER--  553

Query  584   ADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKL  405
              D+T E + K +   V DMSN+MN+DTS I  L+E++ K+TS  +Q  IANP WQVIHK+
Sbjct  554   -DDT-EKAGKSLQSAVIDMSNVMNIDTSGITVLEEIHKKLTSVNIQLAIANPAWQVIHKM  611

Query  404   RLADFHNKIKGK-VFLTIGEAIDAC  333
             +LA   +KI G  +FLT+GEA++AC
Sbjct  612   KLARLVDKIGGTWIFLTVGEAVEAC  636



>emb|CDX88403.1| BnaC06g38470D [Brassica napus]
Length=644

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/643 (60%), Positives = 498/643 (77%), Gaps = 16/643 (2%)
 Frame = -1

Query  2258  SQTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA  2082
             S  +Q   +   PA E  S W++N+PEPP + ++  G  +     L     +++K+P   
Sbjct  2     SIEMQSHQAEAAPAEEPLSQWLINMPEPPTMWQEFVGYIRTNV--LSKKRNKMKKKPSNQ  59

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             V S  +SVFP+L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSV
Sbjct  60    VYSYLKSVFPILIWGRQYKLNMFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSV  119

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIY++MGSSRE+AIGPVAV+SLL+SSMV  L+DP ++P  Y  +V T TFFAG    
Sbjct  120   VPPLIYSMMGSSRELAIGPVAVVSLLLSSMVRDLQDPVTDPIAYRKIVFTATFFAGA---  176

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
                   LGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTDV+SVL+ +F S
Sbjct  177   ------LGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDVISVLSSVFHS  230

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             LHH PW P N +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SVIL+TL+VYLT A+ 
Sbjct  231   LHH-PWQPLNFVIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVILATLIVYLTNADT  289

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
              GVKIVK +K G N  S++QL FN PH+ QV KIG I A++ALTEAIAVG SFA++KGY 
Sbjct  290   RGVKIVKTIKPGFNRPSVNQLEFNGPHLGQVAKIGIICAIIALTEAIAVGRSFATIKGYR  349

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G +NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV++SL++L
Sbjct  350   LDGNKEMMAMGFSNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMVSLEVL  409

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL
Sbjct  410   TRFLYFTPTAILASIILSALPGLIDISGALHIWKLDKLDFLVLVAAFLGVLFASVEIGLL  469

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AVG+SF +I+L+SI+P +E LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFA
Sbjct  470   LAVGISFTRIILSSIRPTVEALGRLSKTD-IFGDINQYPMATKTQGLLTLRISSPLLCFA  528

Query  641   NANFIKARILSLVMEEQKSADETKE-SSEKRIALIVFDMSNIMNVDTSAIISLKELYDKI  465
             NANFI+ RIL+ + + ++  D+ +E    K + +++ DMS +M +DTS +++L+EL+ ++
Sbjct  529   NANFIRDRILNSIQKVEEEEDDEQEIKRAKVLQVVILDMSCVMGLDTSGVVALEELHQEL  588

Query  464   TSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
              S     VIA+PRW+V+HKL+LA    K+K + +F+T+GEA+D
Sbjct  589   ASNDTHLVIASPRWRVLHKLKLAKLEEKVKKENIFMTVGEAVD  631



>ref|XP_008460487.1| PREDICTED: LOW QUALITY PROTEIN: low affinity sulfate transporter 
3 [Cucumis melo]
Length=671

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/643 (59%), Positives = 495/643 (77%), Gaps = 20/643 (3%)
 Frame = -1

Query  2222  PAAERASWVLNVPEPPGLSRKLEGSFKKTA-------------TFLGTAFQRLRKRPVQA  2082
             P A+ + W+LN P PP    ++ G+  + A             + LG+  Q + K     
Sbjct  26    PGAQTSEWLLNSPNPPTFWEQIVGAINENAIPRSCIKNPNKKVSSLGSGKQSIFK----T  81

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
             +++  + VFP+L   + Y   K K+D++AGLTLASL IPQSIGYA LA LDPQ+GLYTSV
Sbjct  82    IVTLLQRVFPILKLARNYKASKFKNDLMAGLTLASLSIPQSIGYANLAKLDPQFGLYTSV  141

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIYA MGSSREIAIGPVAV+SLL+SSM+ +++DP ++P  Y  LV TVT FAGIFQA
Sbjct  142   VPPLIYAFMGSSREIAIGPVAVVSLLLSSMLQEIQDPVADPVAYRRLVFTVTLFAGIFQA  201

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
             +FG+LRLGFLVDFLSHAAIVGFMAGAAI+IGLQQ+K L  ISNFT KTDVVSVL  +  S
Sbjct  202   SFGLLRLGFLVDFLSHAAIVGFMAGAAILIGLQQMKGLLAISNFTTKTDVVSVLESVVKS  261

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
             +H + W P N+++G SFL F+L+ RF+G++++KLFW+ A+APL+SVILSTL+V+++RA+ 
Sbjct  262   VHQT-WYPLNIVLGCSFLIFLLVARFIGRRNKKLFWVSAIAPLISVILSTLIVFVSRADK  320

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
             HGVKIVK VK GLNP S+HQL  N+  +    K G I AV+ALTEAIAVG SFAS+KGY+
Sbjct  321   HGVKIVKEVKEGLNPISIHQLQLNSSTVGLAAKSGLIAAVIALTEAIAVGRSFASIKGYN  380

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             +DGNKEM+AIG  NI GSLTSCY+ATGSFSR+AVN+ AGCES +SN+VMA+TV+++LQ  
Sbjct  381   IDGNKEMIAIGFMNIIGSLTSCYIATGSFSRTAVNYSAGCESVLSNIVMAITVMVTLQFF  440

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T+ LYFTP+AILASIILSALPGL+++NEA  IWKVDKLDFLAC GAF GVLF SVE GLL
Sbjct  441   TRFLYFTPMAILASIILSALPGLVDINEAVHIWKVDKLDFLACLGAFLGVLFHSVEFGLL  500

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             VAVG+SFAKI+L SI+PG E++GRLP +D +F  + Q+PMA +T G  +IR  S LLCFA
Sbjct  501   VAVGISFAKILLISIRPGAEEVGRLPRSD-MFCNMKQFPMATKTQGFSIIRINSPLLCFA  559

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKIT  462
             NA+FI+ RI+ LV EE +  D  +++ +     +V DM N+M++DTS +I L+EL+ ++ 
Sbjct  560   NASFIRDRIMRLV-EEDEDGDYXRKTIKDHPKQLVVDMCNVMSIDTSGVIVLEELHKRLL  618

Query  461   SCGVQFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDAC  333
               G+Q  IA+P+W+VIHKL+   F  KI+G+VF+++GEA+D+C
Sbjct  619   LHGIQLSIASPKWEVIHKLKKTKFVEKIEGRVFISVGEAVDSC  661



>ref|XP_006434038.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47278.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
Length=603

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/569 (66%), Positives = 465/569 (82%), Gaps = 6/569 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLG--TAFQRLRKRPVQAVLSASESVFPLLSW  2040
             ERA W+LN P+PP +  +L GS ++        ++  R+++   ++  S    +FP+L+W
Sbjct  28    ERARWLLNSPDPPSIWHELAGSIREAFVPRNKLSSSSRVKQTWRRSAFSFLRGLFPILNW  87

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
             G+ Y   K KSD++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MGSSRE
Sbjct  88    GRNYKASKFKSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYALMGSSRE  147

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L+S+++  ++DPA++P  Y  LV TVTFFAG+FQ+ FG+ RLGFLVDFL
Sbjct  148   IAIGPVAVVSMLLSALMQNVQDPAADPVAYRKLVFTVTFFAGVFQSVFGLFRLGFLVDFL  207

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliig  1500
             SHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDVVSVL  +F+SLHHS W P N ++G
Sbjct  208   SHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVVSVLGSVFSSLHHSYWYPLNFVLG  267

Query  1499  fsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLN  1320
              SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYLT+A+ HGVKIVKH+KGGLN
Sbjct  268   CSFLIFLLIARFIGRRNKKLFWLPAIAPLLSVILSTLIVYLTKADKHGVKIVKHIKGGLN  327

Query  1319  PSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVAN  1140
             PSS HQL    PH+ Q  KIG I AVVALTEAIAVG SFAS+KGYHLDGNKEM+A+G  N
Sbjct  328   PSSAHQLQLTGPHLGQTAKIGLISAVVALTEAIAVGRSFASIKGYHLDGNKEMVAMGFMN  387

Query  1139  IAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILAS  960
             I GSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+TVL+SL+L T LLY+TP+AILAS
Sbjct  388   IVGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAITVLLSLELFTSLLYYTPIAILAS  447

Query  959   IILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNS  780
             IILSALPGLI++NEA +I+KVDKLDFLAC GAF GVLFASVEIGLL AV +SFAKI+LN+
Sbjct  448   IILSALPGLIDINEAINIYKVDKLDFLACIGAFLGVLFASVEIGLLAAVTISFAKILLNA  507

Query  779   IQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVM  600
             ++PGIE  GRLP TD  +  I Q+PMA++TPG+  IR  S+L CFANANFI+ RI+  V 
Sbjct  508   VRPGIELQGRLPRTDT-YGDISQFPMAIKTPGILTIRINSALFCFANANFIRERIMRWVT  566

Query  599   EEQKSADETKESSEKRIALIVFDMSNIMN  513
             EEQ   DE +E++++ I  ++ DMS+ +N
Sbjct  567   EEQ---DELEETTKRTIQAVIIDMSSKLN  592



>ref|XP_002306322.2| Early nodulin 70 family protein [Populus trichocarpa]
 gb|EEE93318.2| Early nodulin 70 family protein [Populus trichocarpa]
Length=611

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/631 (61%), Positives = 479/631 (76%), Gaps = 50/631 (8%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP--VQAVLSASESVFPLLS  2043
             AE + WVLN PEPP L R+L  S ++T    G  F  L+ +    + V+S  +++FP+ S
Sbjct  22    AEMSQWVLNAPEPPSLWRELMDSARETVLPRGKRFPYLKDKDGLSKTVISVLQAMFPIFS  81

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             W + Y+  KL++D+LAGLTLASLCIPQSIGYA LA LDPQYGLYTSV+PPLIYAVMG+SR
Sbjct  82    WCRHYNATKLRNDLLAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVIPPLIYAVMGTSR  141

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             +IAIGPVAV+SLL+SSMVPKLEDP +NP  Y +LVLT TFFAGIFQAAFG+ RLGFLVDF
Sbjct  142   DIAIGPVAVVSLLMSSMVPKLEDPEANPIAYRNLVLTTTFFAGIFQAAFGLFRLGFLVDF  201

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGF++GAAIVIGLQQ+K L GI++FTNKTDV+SV+  I+ S+H   WNP+N I+
Sbjct  202   LSHAAIVGFVSGAAIVIGLQQMKGLLGIAHFTNKTDVISVMQAIWRSVHQY-WNPHNFIL  260

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFLSFI +TRF+G+++RKLFWLPA APL+SV+LSTLLVYLTRA+ HG           
Sbjct  261   GCSFLSFIKLTRFVGKRNRKLFWLPATAPLISVVLSTLLVYLTRADKHG-----------  309

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
                                            EA AVG SFAS+KGYH++GN+EM+A G  
Sbjct  310   -------------------------------EATAVGRSFASIKGYHINGNQEMVAFGFM  338

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NI GS TSCYVATGSFSRSAVNF AGCE+A+SN+VMA+TV+ISL+L T+LLYFTP+A+L+
Sbjct  339   NILGSFTSCYVATGSFSRSAVNFSAGCETAMSNIVMAITVIISLELFTRLLYFTPIAVLS  398

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             +IILSALPGL++ +EAY IWKVDKLDFL C GAF GVLFASVEIGLL AV +SF KI++ 
Sbjct  399   AIILSALPGLVDPHEAYYIWKVDKLDFLVCIGAFFGVLFASVEIGLLAAVIISFVKIIIF  458

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             SI+PG E+LGRLPGTD +F  ++QYPMAV+     +IR KS LLCFANANF+K +I+   
Sbjct  459   SIRPGTEELGRLPGTD-IFCDVNQYPMAVKNSKALIIRLKSGLLCFANANFVKEKIMKWA  517

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              EE+    E     ++ + +++ DMSN+MN+D S I SL EL + + S G++  I NP+W
Sbjct  518   TEEE----ENDSQGKRTVQVVILDMSNLMNIDMSGIASLLELQNNLASGGMELAITNPKW  573

Query  422   QVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
             QVIHKLRLA+F  K+ G+VFLT+GEA+DACL
Sbjct  574   QVIHKLRLANFVTKMGGRVFLTVGEAVDACL  604



>ref|XP_011074142.1| PREDICTED: low affinity sulfate transporter 3-like [Sesamum indicum]
Length=654

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/630 (62%), Positives = 485/630 (77%), Gaps = 11/630 (2%)
 Frame = -1

Query  2216  AERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWG  2037
             +ERA W+L  P+PP    +L  S K+T        Q    R    +    +++FP+L WG
Sbjct  25    SERAKWLLTSPDPPAPWHQLFSSIKQTLLPQPKPKQPRPNRSFLFM----QTLFPILKWG  80

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             K Y     K+D+LAGLTLASLCIPQSIGYA LA +DPQYGLYTSV+PPLIYAVMGSSREI
Sbjct  81    KNYKAAMFKNDLLAGLTLASLCIPQSIGYANLAKMDPQYGLYTSVIPPLIYAVMGSSREI  140

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+S+M+ K+ DP+ +P  Y   V TVTFF G FQ  FG+ RLGFLVDFLS
Sbjct  141   AIGPVAVVSLLLSAMISKVIDPSVDPVTYRRTVFTVTFFTGAFQTLFGVFRLGFLVDFLS  200

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAAIVIGLQQLK L G+S+FT+KTDVVSV   +  +LH   W P N ++G 
Sbjct  201   HAAIVGFMGGAAIVIGLQQLKGLLGLSHFTSKTDVVSVFGAVIKALHQQ-WYPLNAVLGC  259

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFL FILITRF+GQ++RKLFWLPAMAPL SVILSTL+VYL++A+ HG+KIVKH KGGLNP
Sbjct  260   SFLIFILITRFIGQRNRKLFWLPAMAPLFSVILSTLIVYLSKADEHGIKIVKHFKGGLNP  319

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             +S+HQL+F  PH+ +  KIG I A++ALTEAIAVG SFAS+KGYHLDGNKEM+A+G  N+
Sbjct  320   TSVHQLNFGGPHVGEAAKIGLICALIALTEAIAVGRSFASIKGYHLDGNKEMVAMGFMNV  379

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GSLTSCY ATGSFSR+AVN+ AGCE+ VSN+VM++TVLI L   TKLLY+TP+AILASI
Sbjct  380   IGSLTSCYTATGSFSRTAVNYSAGCETVVSNIVMSITVLICLLFFTKLLYYTPLAILASI  439

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             ILSALPGLI+L+ AY+IWKVDKLDF+ C GAF GVLF SVEIGLLVAV +SF KIM++SI
Sbjct  440   ILSALPGLIDLHAAYNIWKVDKLDFMVCLGAFLGVLFGSVEIGLLVAVIVSFGKIMVSSI  499

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +P  E +GRLPGTD LF  I QYP+A +  G+ + R  S  LCFANA+FI+ RIL  V +
Sbjct  500   KPSTEVVGRLPGTD-LFCNIVQYPVANKISGILITRINSGTLCFANASFIRERILRSVTD  558

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E    + T ESS+ R+ ++V DM+N+MN+DTS I +++ELY ++ + G++  + NPRWQV
Sbjct  559   E----NNTDESSKGRLHVLVLDMTNVMNIDTSGIHAMEELYKQLIAQGIELAVVNPRWQV  614

Query  416   IHKLRLADFHNKIKGK-VFLTIGEAIDACL  330
             I K++ A F  KI    +FLTIG+A+D  L
Sbjct  615   ITKMKAAKFVEKIGANWIFLTIGDAVDVAL  644



>ref|XP_002887712.1| hypothetical protein ARALYDRAFT_316712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63971.1| hypothetical protein ARALYDRAFT_316712 [Arabidopsis lyrata subsp. 
lyrata]
Length=649

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/643 (60%), Positives = 496/643 (77%), Gaps = 16/643 (2%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTATFLGTAFQR--LRKRPVQ  2085
             Q  Q       P  E  S W++N PEPP + ++L G + +T        +R   +     
Sbjct  6     QNHQSHHEEAGPTEEPISRWLINTPEPPSMWQELAG-YIRTNVLAKKKHRRNNTKNSSSN  64

Query  2084  AVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTS  1905
              V S  +SVFP+LSWG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTS
Sbjct  65    PVYSCLKSVFPILSWGRQYKLNFFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTS  124

Query  1904  VVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifq  1725
             VVPPLIY+ MG+SRE+AIGPVAV+SLL+SSMV  ++DP ++P  Y  +V TVTFFAG   
Sbjct  125   VVPPLIYSTMGTSRELAIGPVAVVSLLLSSMVRDIQDPVTDPIAYRKIVFTVTFFAGA--  182

Query  1724  aafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFT  1545
                    LGFLVDFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTDVVSV++ +F 
Sbjct  183   -------LGFLVDFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDVVSVVSSVFH  235

Query  1544  SLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAE  1365
             SLHH PW P N +IG +FL FIL+ RF+G++++KLFW+PAMAPL+SV+L+TL+VYLT AE
Sbjct  236   SLHH-PWQPLNFVIGSAFLIFILLARFIGKRNKKLFWIPAMAPLISVVLATLIVYLTNAE  294

Query  1364  NHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGY  1185
               GVKIVKH+K G N  S++QL F +PH+ Q+ KIG I A++ALTEAIAVG SFA++KGY
Sbjct  295   TRGVKIVKHIKPGFNQLSVNQLQFKSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGY  354

Query  1184  HLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQL  1005
              LDGNKEM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++
Sbjct  355   RLDGNKEMMAMGFMNIAGSLSSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEV  414

Query  1004  LTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGL  825
             LT+ LYFTP AILASIILSALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGL
Sbjct  415   LTRFLYFTPTAILASIILSALPGLIDVSSALHIWKLDKLDFLVLIAAFFGVLFASVEIGL  474

Query  824   LVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCF  645
             L+AVG+SFA+IML+SI+P IE LGRL  TD +F  I+QYPMA +TPG+  +R  S LLCF
Sbjct  475   LLAVGISFARIMLSSIRPNIEALGRLSKTD-IFGDINQYPMANKTPGLLTLRISSPLLCF  533

Query  644   ANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKI  465
             ANANFI+ RIL+ V E ++  +E + + E  + +++ DMS +M VDTS +++L+EL+ ++
Sbjct  534   ANANFIRDRILNSVREVEEEENEQEVTKENGLQVVILDMSYVMGVDTSGVVALEELHQEL  593

Query  464   TSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
              S  ++ V+A+PRW+V+HK + A    K+K + +++T+GEA+D
Sbjct  594   ASNDIRLVVASPRWRVLHKWKRAKLDEKLKSENIYMTVGEAVD  636



>emb|CBK55661.1| sulphate transporter [Astragalus drummondii]
Length=662

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/641 (63%), Positives = 495/641 (77%), Gaps = 15/641 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ER+ W+LN P PP L +KL  S K    FL +      K   Q V S   S+FP+LS   
Sbjct  24    ERSLWLLNPPNPPPLGKKLISSLKNNKFFLSSK----NKTCHQHVASFLRSLFPILSLFG  79

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K D+LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIA
Sbjct  80    NYDAFKFKDDLLAGLTLASLSIPQSIGYAILAKLDPQYGLYTSVVPPLIYAVMGSSREIA  139

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS+V K+ DP  N  GY ++V TVT FAGIFQ AFG+ RLGFLVDFLSH
Sbjct  140   IGPVAVVSLLLSSLVQKVVDPNVNHDGYRNVVFTVTLFAGIFQVAFGVFRLGFLVDFLSH  199

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS----PWNPYNli  1506
             AA+VGFMAGAAI+IGLQQLK L GIS+FTNKTDVVSVL  ++ SLH       W P N +
Sbjct  200   AALVGFMAGAAIMIGLQQLKGLLGISHFTNKTDVVSVLESVYKSLHQQITSGEWYPLNFV  259

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG SFL F+L  RF+G++++KLFWLPA+APL SVILST +VY+++A+ +GV IVKHVK G
Sbjct  260   IGSSFLIFLLSARFIGKRNKKLFWLPAIAPLASVILSTFIVYISKADKNGVNIVKHVKPG  319

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             LNP+S+HQL  +  H+ Q  KIG I AV+ALTEA+AVG SFAS+KGYHLDGNKEMLA+G 
Sbjct  320   LNPNSVHQLQLSGEHVGQAAKIGLISAVIALTEAMAVGRSFASIKGYHLDGNKEMLAMGC  379

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              NIAGS +SCYVATGSFSR+AVNF AGC+++VSN+VMA+TV++ L+L T+LLY+TP+AIL
Sbjct  380   MNIAGSFSSCYVATGSFSRTAVNFSAGCKTSVSNIVMAITVILCLELFTRLLYYTPMAIL  439

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ASIILSALPGLI++ EA  IWKVDK DFLAC GAF GVLF SVE+GLLVAV +SFAKI++
Sbjct  440   ASIILSALPGLIDIREACYIWKVDKFDFLACIGAFFGVLFQSVEVGLLVAVSISFAKIVI  499

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
              SI+PGIE LGR+P T+A F  + QYPMA  TPG+ VIR  S  LCFANAN ++ RIL  
Sbjct  500   QSIRPGIEILGRIPRTEA-FCNVSQYPMATSTPGILVIRISSGSLCFANANAVRERILKW  558

Query  605   VMEE-----QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFV  441
             V +E     ++S +  +E++   +  ++ DM+N+MNVDTS I++L+EL+ ++ S GVQF 
Sbjct  559   VTQEDDELKERSTNFQEETTRGSVQAVILDMTNMMNVDTSGILALEELHKRLISRGVQFA  618

Query  440   IANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             + NPRW VIHKL+LA F +K+ K  +FLT+ EA+DAC+  K
Sbjct  619   MVNPRWLVIHKLKLAHFVDKMGKEWIFLTVAEAVDACMSYK  659



>emb|CBK55653.1| sulphate transporter [Astragalus racemosus]
Length=662

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/638 (63%), Positives = 495/638 (78%), Gaps = 15/638 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ER+ W+LN P PP L +KL  S K    FL +      K   Q V S   S+FP+LS   
Sbjct  24    ERSLWLLNPPNPPPLGKKLISSLKNNKFFLSSK----NKTCHQHVASFLRSLFPILSLFG  79

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K D+LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIA
Sbjct  80    NYDAFKFKDDLLAGLTLASLSIPQSIGYAILAKLDPQYGLYTSVVPPLIYAVMGSSREIA  139

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS+V K+ DP  N  GY ++V TVT FAGIFQ AFG+ RLGFLVDFLSH
Sbjct  140   IGPVAVVSLLLSSLVQKVVDPNVNHDGYRNVVFTVTLFAGIFQVAFGVFRLGFLVDFLSH  199

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS----PWNPYNli  1506
             AA+VGFMAGAAI+IGLQQLK L GIS+FTNKTDVVSVL  ++ SLH       W P N +
Sbjct  200   AALVGFMAGAAIMIGLQQLKGLLGISHFTNKTDVVSVLESVYKSLHQQITSGEWYPLNFV  259

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG SFL F+LI RF+G++++KLFWLPA+APL+SVILS+ +VY+++A+ +GV IVKHVK G
Sbjct  260   IGSSFLIFLLIARFIGKRNKKLFWLPAIAPLVSVILSSFIVYISKADKNGVNIVKHVKPG  319

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             LNP+S HQL  +  H+ Q  KIG I AV+ALTEA+AVG SFAS+KGYHLDGNKEMLA+G 
Sbjct  320   LNPNSAHQLQLSGEHVGQAAKIGLISAVIALTEAMAVGRSFASIKGYHLDGNKEMLAMGC  379

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              NIAGS +SCYVATGSFSR+AVNF AGC+++VSN+VMA+TV++ L+L T+LLY+TP+AIL
Sbjct  380   MNIAGSFSSCYVATGSFSRTAVNFSAGCKTSVSNIVMAITVILCLKLFTRLLYYTPMAIL  439

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ASIILSALPGLI++ EA  IWKVDK DFLAC GAF GVLF SVE+GLLVAV +SFAKI++
Sbjct  440   ASIILSALPGLIDIREACYIWKVDKFDFLACIGAFFGVLFQSVEVGLLVAVSISFAKIVI  499

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
              SI+PGIE LGR+P T+A F  + QYPMA  TPG+ VIR  S  LCFANAN ++ RIL  
Sbjct  500   QSIRPGIEILGRIPSTEA-FCNVSQYPMATSTPGILVIRISSGSLCFANANAVRERILKW  558

Query  605   VMEE-----QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFV  441
             V +E     ++S +  +E++   +  ++ DM+N+MNVDTS I++L+EL+ ++ S GVQF 
Sbjct  559   VTQEDDELQERSTNFQEETTRGSVQAVILDMTNMMNVDTSGILALEELHKRLISRGVQFA  618

Query  440   IANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACL  330
             + NPRW VIHKL+LA F +K+  + +FLT+ EA+DAC+
Sbjct  619   MVNPRWLVIHKLKLAHFVDKMGNEWIFLTVAEAVDACM  656



>emb|CBK55658.1| sulphate transporter [Astragalus bisulcatus]
Length=662

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/638 (62%), Positives = 494/638 (77%), Gaps = 15/638 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ER+ W+LN P PP L +KL  S K    FL +      K   Q V S   S+FP+LS   
Sbjct  24    ERSLWLLNPPNPPPLGKKLISSLKNNKFFLSSK----NKTCHQHVASFLRSLFPILSLFG  79

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K D+LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIA
Sbjct  80    NYDAFKFKDDLLAGLTLASLSIPQSIGYAILAKLDPQYGLYTSVVPPLIYAVMGSSREIA  139

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS+V K+ DP  N  GY ++V TVT FAGIFQ AFG+ RLGFLVDFLSH
Sbjct  140   IGPVAVVSLLLSSLVQKVVDPNVNHDGYRNVVFTVTLFAGIFQVAFGVFRLGFLVDFLSH  199

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS----PWNPYNli  1506
             AA+VGFMAGAAI+IGLQQLK L GIS+FTNKTDVVSVL  ++ SLH       W P N +
Sbjct  200   AALVGFMAGAAIMIGLQQLKGLLGISHFTNKTDVVSVLESVYKSLHQQITSGEWYPLNFV  259

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG SFL F+L  RF+G++++KLFWLPA+APL+SVILS  +VY+++A+ +GV IVKHVK G
Sbjct  260   IGSSFLIFLLSARFIGKRNKKLFWLPAIAPLVSVILSNFIVYISKADKNGVNIVKHVKPG  319

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             LNP+S HQL  +  H+ Q  KIG I AV+ALTEA+AVG SFAS+KGYHLDGNKEMLA+G 
Sbjct  320   LNPNSAHQLQLSGEHVGQAAKIGLISAVIALTEAMAVGRSFASIKGYHLDGNKEMLAMGC  379

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              NIAGS +SCYVATGSFSR+AVNF AGC+++VSN+VMA+TV++ L+L T+LLY+TP+AIL
Sbjct  380   MNIAGSFSSCYVATGSFSRTAVNFSAGCKTSVSNIVMAITVILCLKLFTRLLYYTPMAIL  439

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ASIILSALPGLI++ EA  IWKVDK DFLAC GAF GVLF SVE+GLLVAV +SFAKI++
Sbjct  440   ASIILSALPGLIDIREACYIWKVDKFDFLACIGAFFGVLFQSVEVGLLVAVSISFAKIVI  499

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
              SI+PGIE LGR+P T+A F  + QYPMA  +PG+ VIR  S  LCFANAN ++ RIL  
Sbjct  500   QSIRPGIEILGRIPSTEA-FCNVSQYPMATSSPGILVIRISSGSLCFANANAVRERILKW  558

Query  605   VMEE-----QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFV  441
             V +E     ++S++  +E++   +  ++ DM+N+MNVDTS I++L+EL+ ++ S GVQF 
Sbjct  559   VTQEDDELQERSSNFQEETTRGSVQAVILDMTNMMNVDTSGILALEELHKRLISLGVQFA  618

Query  440   IANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACL  330
             + NPRW VIHKL+LA F +K+  + +FLT+ EA+DAC+
Sbjct  619   MVNPRWLVIHKLKLAHFVDKMGNEWIFLTVAEAVDACM  656



>ref|XP_010534060.1| PREDICTED: sulfate transporter 2.2 isoform X1 [Tarenaya hassleriana]
Length=652

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/622 (62%), Positives = 496/622 (80%), Gaps = 9/622 (1%)
 Frame = -1

Query  2198  VLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLV  2019
             +++ PEPP L ++L    + +     ++ +     PV   L   +S+FP+L+WG+ Y L 
Sbjct  27    LMDSPEPPTLWQELVRFIRTSVFSKKSSKKDKNSNPVLFCL---KSIFPILTWGRHYKLN  83

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
               K DV+AGLTLASL IPQSIGYA LA LDP+YGLYTSVVPPLIYA MGSSREIAIGPVA
Sbjct  84    MFKKDVMAGLTLASLSIPQSIGYANLAKLDPEYGLYTSVVPPLIYATMGSSREIAIGPVA  143

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+SSM+  L+DP ++P  Y +LV TVT FAG FQA FG+ RLGFLVDFLSHAA+VG
Sbjct  144   VVSLLLSSMIQNLQDPVADPLAYRNLVFTVTLFAGTFQAIFGLFRLGFLVDFLSHAALVG  203

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FMAGAAIVIGLQQLK L G+S+FT+KTD+VSVL  +F SLHH PW+P N +IG SFL FI
Sbjct  204   FMAGAAIVIGLQQLKGLLGLSHFTDKTDIVSVLGSVFHSLHH-PWHPLNFVIGCSFLIFI  262

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L+ RF+G++ +KLFW+PA+APL+SVIL+TL+V+LT+A+  GVKIVKH+K G+N SS+ QL
Sbjct  263   LLARFIGKRKKKLFWIPAIAPLISVILATLIVFLTKADKRGVKIVKHIKRGINRSSVSQL  322

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             H   P++  +VKIG I AV+ALTEAIAVG SFAS+KGYHLDGNKEM+A+G  NIAGSLTS
Sbjct  323   HLTGPNLGHLVKIGLISAVIALTEAIAVGRSFASIKGYHLDGNKEMMAMGFMNIAGSLTS  382

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSR+AVNF AGCE+ +SN+VMA+TV+ +L+L+T+LLY+TP AILASIILSALP
Sbjct  383   CYVATGSFSRTAVNFSAGCETTMSNIVMAITVIAALELMTRLLYYTPTAILASIILSALP  442

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GL++++ A+ IWK+DKLDFL C  AF GVLFASVEIGLLVAV +SFAKI+L+SI+PG+E 
Sbjct  443   GLVDVSGAHHIWKLDKLDFLVCLSAFLGVLFASVEIGLLVAVIISFAKILLSSIRPGVEA  502

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LGRLP TD +F  I+QYPMA +TPG+F +R  S +LCFANANFI+ RIL+ + +E +   
Sbjct  503   LGRLPRTD-VFCNINQYPMASKTPGIFTVRVSSPMLCFANANFIRDRILNAIGDEDEHEG  561

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
             +TK+ S   + ++V DMS +M+VDTS +I+++++   + S  +Q VIANPRW+V+HKL+ 
Sbjct  562   DTKKES---VRVVVLDMSWVMSVDTSGLIAIEQIQKGLISKSIQLVIANPRWRVLHKLKQ  618

Query  398   ADFHNKI-KGKVFLTIGEAIDA  336
               F  +  K  +F T+GEA+D+
Sbjct  619   TKFEERTQKQSIFFTVGEAVDS  640



>ref|XP_008652499.1| PREDICTED: low affinity sulfate transporter 3 [Zea mays]
 tpg|DAA43990.1| TPA: hypothetical protein ZEAMMB73_140973 [Zea mays]
Length=705

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/638 (58%), Positives = 480/638 (75%), Gaps = 12/638 (2%)
 Frame = -1

Query  2225  PPAAERASWVLNVPEPPGLSRKLEGSFKKT-----ATFLGTAFQRLRKRPVQAVLSASES  2061
             PP  + A  VLN P PP L  +L G   K                        VL+A + 
Sbjct  64    PP--DTAKLVLNSPSPPSLREELVGVVGKAFRPRAHAGAAAGAGGRPPPRRAWVLTALQC  121

Query  2060  VFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYA  1881
             VFP+L WG+ Y+L   +SDV+AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYA
Sbjct  122   VFPVLQWGRSYTLESFRSDVMAGLTLASLGIPQSIGYANLAKLDPQYGLYTSVVPPLIYA  181

Query  1880  VMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRL  1701
             VMG+SREIAIGPVAV+SLL+SSM+ K+ DPA++PA Y SLV TVTF AG+FQ +FG+ RL
Sbjct  182   VMGTSREIAIGPVAVVSLLLSSMIQKVVDPAADPATYRSLVFTVTFLAGVFQVSFGLFRL  241

Query  1700  GFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWN  1521
             GFLVDFLSHAAIVGFM GAAIVIG+QQLK L G+++FTN TDVVSVL  + ++L H PW+
Sbjct  242   GFLVDFLSHAAIVGFMGGAAIVIGMQQLKGLLGLAHFTNSTDVVSVLKAVCSALRHDPWH  301

Query  1520  PYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVK  1341
             P N +IG SFL FIL TRF+G++++KLFWL A++PLLSVILST  VY TRA+ HGVKI++
Sbjct  302   PGNFLIGCSFLIFILTTRFIGRRYKKLFWLSAISPLLSVILSTAAVYATRADRHGVKIIQ  361

Query  1340  HVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEM  1161
              V  GLNPSS+ Q+H N PH  +  KI  I AV+ALTEAIAVG SFAS++GY LDGNKEM
Sbjct  362   KVHAGLNPSSVKQIHLNGPHTTECAKIAVICAVIALTEAIAVGRSFASVRGYRLDGNKEM  421

Query  1160  LAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFT  981
             LA+G +N+AGSL+SCYVATGSFSR+AVNF AG  S VSN+VM++TV ++L+L  KLLY+T
Sbjct  422   LAMGFSNVAGSLSSCYVATGSFSRTAVNFSAGARSTVSNIVMSITVFVTLELFMKLLYYT  481

Query  980   PVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSF  801
             P+A+LASIILSALPGLI++ EA SIWK+DK+DFL C GAF GVLF SVEIGL VA+G+SF
Sbjct  482   PMAVLASIILSALPGLIDIKEACSIWKIDKMDFLTCLGAFVGVLFGSVEIGLAVALGISF  541

Query  800   AKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKA  621
             AKI++ S++P +E LGRL GTD +F  + QYP+A  TP V  IR  +S LCF NA  +K 
Sbjct  542   AKIIIQSLRPQVEILGRLQGTD-IFCSVRQYPVACLTPTVLPIRVDTSFLCFINATSVKE  600

Query  620   RILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFV  441
             RI   V E     + +   + +RI  +V DMS+++N+DTS + +L+E++ ++ S G+Q  
Sbjct  601   RITEWVWE---GVETSNGKARERIQAVVLDMSSVVNIDTSGLTALEEIHKELVSLGLQMA  657

Query  440   IANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
             IA+P W+ + K++++   +++ +  +F+T+GEA++ACL
Sbjct  658   IASPGWKAVQKMKVSQVVDRVGQDWIFMTVGEAVEACL  695



>ref|XP_006596332.1| PREDICTED: low affinity sulfate transporter 3-like isoform X3 
[Glycine max]
Length=595

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/570 (66%), Positives = 465/570 (82%), Gaps = 11/570 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGT--AFQRLRKRPVQAVLSASESVFPLLSW  2040
             ER+ WVL+ P PP L +KL  S K+T    G    F   RK      LS  +++FP++SW
Sbjct  16    ERSQWVLDSPNPPPLWKKLFSSVKETILPHGNKFCFSSKRKTINGHALSCLQNLFPIISW  75

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
              + Y + K K D+LAGLTLASLCIPQSIGYA LA + P+YGLYTSVVPPLIYA+MGSSRE
Sbjct  76    LRDYKVSKFKDDLLAGLTLASLCIPQSIGYATLAKVAPEYGLYTSVVPPLIYAMMGSSRE  135

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L++S+VPK+EDP +NP  Y +LV TVTFF GIFQ AFG+ RLGFLVDFL
Sbjct  136   IAIGPVAVVSMLLASLVPKVEDPVTNPNAYRNLVFTVTFFTGIFQTAFGVFRLGFLVDFL  195

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS-----PWNPY  1515
             SHAA+VGFMAGAAI+IGLQQLK L G+S+FT+KTDVVSVL  ++ SLH+       WNP 
Sbjct  196   SHAALVGFMAGAAIIIGLQQLKGLLGLSHFTSKTDVVSVLASVYKSLHNQIAPGQKWNPL  255

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N ++G SFL FILITRF+G+++RKLFWLPA++PLLSVILSTL+VYL+RA+ HGV I+KHV
Sbjct  256   NFVLGCSFLIFILITRFIGRRNRKLFWLPAISPLLSVILSTLIVYLSRADKHGVNIIKHV  315

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGGLNPSSLHQL  + PH+ Q  KIG I +V+ALTEAIAVG SFAS+KGYHLDGNKEML+
Sbjct  316   KGGLNPSSLHQLQLHGPHVGQAAKIGLICSVIALTEAIAVGRSFASIKGYHLDGNKEMLS  375

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G+ NIAGSLTSCYVATGSFSR+AVNF AGC++AVSN+VMAVTV +SL+L T+LLY+TPV
Sbjct  376   MGIMNIAGSLTSCYVATGSFSRTAVNFSAGCQTAVSNIVMAVTVFLSLELFTRLLYYTPV  435

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILASI+LSALPGLI+L+EA  IWKVDKLDFLAC GAF GVLFA+VEIGLLVAV +SFAK
Sbjct  436   AILASIVLSALPGLIDLSEACYIWKVDKLDFLACIGAFLGVLFATVEIGLLVAVIISFAK  495

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARI  615
             I++ SI+PGIE LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF++ RI
Sbjct  496   ILIQSIRPGIEVLGRVPRTEA-FCDVTQYPMAISTPGIIVIRISSGSLCFANANFVRERI  554

Query  614   LSLVMEEQKSADETKESSEKRIALIVFDMS  525
             L  V +++   D+ KE+++ R+  ++ DM+
Sbjct  555   LKWVSQDE---DDLKETTKGRVQAVILDMT  581



>ref|XP_009404428.1| PREDICTED: sulfate transporter 2.1 [Musa acuminata subsp. malaccensis]
Length=649

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/624 (61%), Positives = 477/624 (76%), Gaps = 14/624 (2%)
 Frame = -1

Query  2198  VLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLV  2019
             VLN P+PP L ++L GS +      G     L K  +    S    +FP+L WG+ Y+L 
Sbjct  28    VLNAPQPPSLWQELSGSVRGAIFPRGNQPSSLTKWAI----SVLHGLFPVLHWGRNYNLK  83

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
               +SD++AGLTLASL IPQSIGYA LA LDPQYGLYTS VPPLIYAVMG+SR+IAIGPVA
Sbjct  84    SFRSDLMAGLTLASLGIPQSIGYANLAKLDPQYGLYTSFVPPLIYAVMGTSRDIAIGPVA  143

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             VISLL+SSM  K+ DP+ +P  Y  LV+T TFFAG+FQA+FG  RLGF+VDFLSHA IVG
Sbjct  144   VISLLLSSMAQKVVDPSVDPTAYRKLVITSTFFAGVFQASFGFFRLGFIVDFLSHATIVG  203

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FM GAAIVIGLQQLK L GIS+FTN TDVVSV+  ++ ++HHS W+P N +IG SFL FI
Sbjct  204   FMGGAAIVIGLQQLKGLLGISHFTNNTDVVSVVKAVWVAVHHS-WHPDNFLIGCSFLIFI  262

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             LI RF+G + RKLFWL A+ PLLSVI+STLLV+LTRA+ HGVKI++ VK GLNPSS+  +
Sbjct  263   LIVRFIGMRKRKLFWLSAITPLLSVIISTLLVFLTRADKHGVKIIQKVKEGLNPSSVKDI  322

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
                  H+ +  KIG I A++ALTEAIAVG SFA++KGY LDGNKEM+A+GV N+AGS++S
Sbjct  323   QLTGSHVAESAKIGLICAIIALTEAIAVGRSFAAVKGYQLDGNKEMVAMGVMNLAGSMSS  382

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSR+AVN  AGC++ VSN+VMA+TV ISLQLL KLLY+TPV ILASIILSALP
Sbjct  383   CYVATGSFSRTAVNVSAGCKTTVSNIVMAITVFISLQLLMKLLYYTPVTILASIILSALP  442

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI++ EAY+IWK+DK+DFLAC GAF GVLF SVEIGLL AV +SFAKI++++++P +E 
Sbjct  443   GLIDIKEAYNIWKIDKMDFLACFGAFLGVLFGSVEIGLLTAVLISFAKIIISALRPSVEM  502

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LGR+ GTD  F  + QYP A +TP + ++R  S  LCF NANFI+ RI++ V E + +  
Sbjct  503   LGRIQGTDT-FCSMRQYPSAAETPNLMILRIDSPFLCFMNANFIRERIVNWVTEGRNAMK  561

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
             E  +S       ++ DM+N++N+DTS I +L+E+Y K+ S  VQ  + NP WQVIHK++L
Sbjct  562   EETKS-------VIIDMTNVINIDTSGISALEEIYKKLASASVQLAVVNPGWQVIHKMKL  614

Query  398   ADFHNKIKGK-VFLTIGEAIDACL  330
             A     I G  +FLT+GEA++ACL
Sbjct  615   ARLVEMIGGAWIFLTVGEAVEACL  638



>ref|XP_006300834.1| hypothetical protein CARUB_v10019923mg [Capsella rubella]
 gb|EOA33732.1| hypothetical protein CARUB_v10019923mg [Capsella rubella]
Length=591

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/568 (66%), Positives = 457/568 (80%), Gaps = 4/568 (1%)
 Frame = -1

Query  2222  PAAERAS-WVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKRPVQAVLSASESVFPL  2049
             PA E  S W+LN PEPP + ++L G  +K   +       + +      V S  +SVFP+
Sbjct  16    PAEEPTSRWLLNTPEPPSMWQELVGYIRKNVLSKKDNRRNKTKNSSSNPVYSCLKSVFPI  75

Query  2048  LSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGS  1869
             L WG+QY L   K D++AGLTLASLCIPQSIGYA LA LDP+YGLYTSVVPPLIY+ MGS
Sbjct  76    LIWGRQYKLNLFKKDLMAGLTLASLCIPQSIGYANLAGLDPEYGLYTSVVPPLIYSTMGS  135

Query  1868  SREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLV  1689
             SRE+AIGPVAV+SLL+SSMV  LEDP ++P  Y  +V TVTFFAG FQA FG+ RLGFLV
Sbjct  136   SRELAIGPVAVVSLLLSSMVRDLEDPVTDPIAYRKIVFTVTFFAGAFQAIFGLFRLGFLV  195

Query  1688  DFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNl  1509
             DFLSHAA+VGFMAGAAIVIGLQQLK LFG+S+FTNKTDVVSVL+ +F SLHHS W P N 
Sbjct  196   DFLSHAALVGFMAGAAIVIGLQQLKGLFGLSHFTNKTDVVSVLSSVFHSLHHS-WQPLNF  254

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             +IG SFL FIL+ RFLG++++KLFW+PAMAPL+SVIL+TL+VYLT AE  GVKIVKH+K 
Sbjct  255   VIGSSFLIFILLARFLGKRNKKLFWIPAMAPLISVILATLIVYLTNAETRGVKIVKHIKP  314

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             G N  S++QL FN+PH+  +VKIG I A++ALTEAIAVG SFA++KGY LDGNKEM+A+G
Sbjct  315   GFNQPSVNQLQFNSPHLGHIVKIGLISAIIALTEAIAVGRSFATIKGYRLDGNKEMMAMG  374

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               NIAGSLTSCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISLQ+LT+ LYFTP AI
Sbjct  375   CMNIAGSLTSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLQVLTRFLYFTPTAI  434

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI+++ A  IWK+DKLDFL  A AF GVLFASVEIGLL+AVG+SFA+IM
Sbjct  435   LASIILSALPGLIDISGAIHIWKLDKLDFLVLAAAFFGVLFASVEIGLLLAVGISFARIM  494

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             L+SI+P IE LGRL  TD +F  I+QYPMA++TPG+  +R  S LLCFANANFI+ RIL+
Sbjct  495   LSSIRPNIEALGRLSKTD-IFGDINQYPMAIKTPGLLTLRISSPLLCFANANFIRDRILN  553

Query  608   LVMEEQKSADETKESSEKRIALIVFDMS  525
              V E ++  +E +  ++K + +++ DMS
Sbjct  554   SVSEVEEEDNEQEVKNDKVLQVLILDMS  581



>ref|XP_004985352.1| PREDICTED: low affinity sulfate transporter 3-like [Setaria italica]
Length=656

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/631 (59%), Positives = 483/631 (77%), Gaps = 6/631 (1%)
 Frame = -1

Query  2198  VLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLV  2019
             VLN P PP L  +L G   K      +     R  P    L+A + VFP+L WG+ Y+L 
Sbjct  28    VLNSPSPPSLREELVGVVGKAFRPRASGGAGGRAPPCAWALTALQCVFPVLQWGRSYTLK  87

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
               +SDV+AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMG+SREIAIGPVA
Sbjct  88    DFRSDVMAGLTLASLGIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGTSREIAIGPVA  147

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+SSM+  + DPA++PA Y SLV TVTF AG+FQ +FG+ RLGFLVDFLSHAAIVG
Sbjct  148   VVSLLLSSMIQNVVDPAADPATYRSLVFTVTFLAGVFQVSFGLFRLGFLVDFLSHAAIVG  207

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FMAGAAIVIGLQQLK L G+S+FTN TD+VSV+  + ++LH  PW+P N +IG SFL FI
Sbjct  208   FMAGAAIVIGLQQLKGLLGLSHFTNSTDIVSVIKAVCSALH-DPWHPGNFLIGCSFLIFI  266

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L TRF+G+K++KLFWL A++PL+SVILST  VY TRA+ HGVKI++ V  G+NPSS  Q+
Sbjct  267   LTTRFIGRKYKKLFWLSAISPLISVILSTAAVYATRADKHGVKIIQKVHAGINPSSAKQI  326

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             H N PH  +  KI  I AV+ALTEAIAVG SFAS++GY LDGNKEMLA+G +N+AGSL+S
Sbjct  327   HLNGPHTSECAKIAIICAVIALTEAIAVGRSFASVRGYKLDGNKEMLAMGFSNVAGSLSS  386

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSR+AVNF AG  S +SN++M++TV I+L+L  K LY+TP+A+LASIILSALP
Sbjct  387   CYVATGSFSRTAVNFSAGARSTMSNIIMSITVFITLELFMKFLYYTPMAVLASIILSALP  446

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI++ EA +IWKVDK+DF+ C GAF GVLF SVEIGL VA+ +SFAKI++ S++P +E 
Sbjct  447   GLIDIKEACNIWKVDKMDFVTCLGAFVGVLFGSVEIGLAVAIAISFAKIIIQSLRPQVEV  506

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LGRL GT+ +F  I QYP+A +TP V  IR  +S +CF NA FIK RI+  V EE +++D
Sbjct  507   LGRLQGTN-IFCSIRQYPVACRTPTVLTIRIDTSFMCFINATFIKERIIEWVREEVEASD  565

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
                  + +RI  +V DMS+++N+DTS + +L+EL+ ++ S G+Q  I++P W  + K+++
Sbjct  566   ---GKARERIQAVVLDMSSVVNIDTSGLTALEELHKELVSLGIQMAISSPGWNAVQKMKV  622

Query  398   ADFHNKI-KGKVFLTIGEAIDACLVDKNMQA  309
             +   ++I +  +FLT+GEA++ACL ++   A
Sbjct  623   SRVVDRIGEDWIFLTVGEAVEACLTEQKGTA  653



>gb|KCW68852.1| hypothetical protein EUGRSUZ_F02448 [Eucalyptus grandis]
Length=553

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/568 (66%), Positives = 442/568 (78%), Gaps = 16/568 (3%)
 Frame = -1

Query  2321  MAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFK  2142
             MA  P T   + +E ELP + S   + TS    P AERA WVL+ P+PP L   L  S K
Sbjct  1     MASLPDTD-SLKSEAELPPQTS--FEITSH---PQAERAEWVLHSPDPPSLWHDLLVSKK  54

Query  2141  KTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQ  1962
                T         ++   +A  S  + +FP+L WG+ Y L K KSD++AGLTLASLCIPQ
Sbjct  55    SPLTD--------KQALCRAAASLFQGLFPILRWGRTYRLSKFKSDLMAGLTLASLCIPQ  106

Query  1961  SIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASN  1782
             SIGYA LA LDPQYGLYTSVVPPL+YA+MGSSREIAIGPVAV+SLL+SSM+ K++DP+++
Sbjct  107   SIGYANLAKLDPQYGLYTSVVPPLVYALMGSSREIAIGPVAVVSLLLSSMIQKIQDPSTD  166

Query  1781  PAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFG  1602
             P  Y  LV T T FAG FQA FG+ RLGFLVDFLSHAAIVGFMAGAAI+IGLQQLK L G
Sbjct  167   PGAYRRLVFTATLFAGTFQAIFGLFRLGFLVDFLSHAAIVGFMAGAAIIIGLQQLKGLLG  226

Query  1601  ISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAM  1422
             IS+FT KTDVVSVL   F S+ H  W P N ++G SFL F+L  RF+G+K++KLFWLPA+
Sbjct  227   ISHFTTKTDVVSVLESAFRSIRHQ-WYPLNFVLGCSFLIFLLFARFIGRKNKKLFWLPAI  285

Query  1421  APLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAV  1242
             APL+SV+LSTL+V+LT A+ HGVK+VKH+KGGLNP S HQL    PH+ Q  KIG I AV
Sbjct  286   APLVSVVLSTLIVFLTSADKHGVKVVKHIKGGLNPISAHQLQLAGPHVGQSAKIGLICAV  345

Query  1241  VALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGC  1062
             VALTEAIAVG SFAS+KGY +DGNKEM+A+G  N+AGSLTSCYVATGSFSR+AVNF AGC
Sbjct  346   VALTEAIAVGRSFASIKGYQIDGNKEMVAMGFMNVAGSLTSCYVATGSFSRTAVNFSAGC  405

Query  1061  ESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDF  882
             ++ VSN+VMAVTVLISL L TKLLY+TP+AILASIILSALPGLI++NEA  IW+VDKLDF
Sbjct  406   QTVVSNIVMAVTVLISLLLFTKLLYYTPIAILASIILSALPGLIDVNEALRIWRVDKLDF  465

Query  881   LACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPM  702
             LAC G F GVLF SVEIGLL AV +SF  I+L SI+PG E LGRLPGTD +F  I QYPM
Sbjct  466   LACIGTFLGVLFGSVEIGLLAAVAISFGNIILLSIRPGTELLGRLPGTD-VFCDIRQYPM  524

Query  701   AVQTPGVFVIRTKSSLLCFANANFIKAR  618
             A++TPGV +IR  S L+CFANANFI+ R
Sbjct  525   AIETPGVLLIRINSGLMCFANANFIRER  552



>ref|XP_002465703.1| hypothetical protein SORBIDRAFT_01g044100 [Sorghum bicolor]
 gb|EER92701.1| hypothetical protein SORBIDRAFT_01g044100 [Sorghum bicolor]
Length=660

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/665 (57%), Positives = 495/665 (74%), Gaps = 16/665 (2%)
 Frame = -1

Query  2321  MAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFK  2142
             M  +  + VE TA + + ++ S   Q+         + A  VLN P PP L  +L G   
Sbjct  1     MEASSASAVESTATVSV-FDVSSNKQR--------PDTAKLVLNSPSPPSLREELVGVVG  51

Query  2141  KTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQ  1962
             K A          R      +L+A + VFP+L WG+ Y+L   +SDV+AGLTLASL IPQ
Sbjct  52    K-AFRPRPPGGGGRAPRCPWILTALQCVFPVLQWGRTYTLKSFRSDVMAGLTLASLGIPQ  110

Query  1961  SIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASN  1782
             SIGYA LA LDPQYGLYTSVVPPLIYAVMG+SREIAIGPVAV+SLL+SSM+ K+ DPA++
Sbjct  111   SIGYANLAKLDPQYGLYTSVVPPLIYAVMGTSREIAIGPVAVVSLLLSSMIQKVVDPAAD  170

Query  1781  PAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFG  1602
             PA Y SLV TVTF AG+FQ +FG+ RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L G
Sbjct  171   PATYRSLVFTVTFLAGVFQVSFGLFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLG  230

Query  1601  ISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAM  1422
             +S+FTN TDVVSV+  + ++LH  PW+P N +IG SFL FIL TRF+G++++KLFWL A+
Sbjct  231   LSHFTNSTDVVSVVKAVCSALH-DPWHPGNFLIGCSFLIFILTTRFIGRRYKKLFWLSAI  289

Query  1421  APLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAV  1242
             +PLLSVILST  VY TRA+ HGVKI++ V  GLNPSS  Q+H N PH  +  KI  I AV
Sbjct  290   SPLLSVILSTAAVYATRADKHGVKIIQKVHAGLNPSSAKQIHLNGPHATECAKIAVICAV  349

Query  1241  VALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGC  1062
             +ALTEAIAVG SFAS++GY LDGNKEMLA+G +N+AGSL+SCYVATGSFSR+AVNF AG 
Sbjct  350   IALTEAIAVGRSFASVRGYKLDGNKEMLAMGFSNVAGSLSSCYVATGSFSRTAVNFSAGA  409

Query  1061  ESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDF  882
              S VSN+VM++TV ++L+L  KLLY+TP+A+LASIILSALPGLI++ EA +IWK+DK+DF
Sbjct  410   RSTVSNIVMSITVFVALELFMKLLYYTPMAVLASIILSALPGLIDIKEACNIWKIDKMDF  469

Query  881   LACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPM  702
             L C GAF GVLF SVEIGL VA+ +SFAKI++ SI+P +E LGRL GT+ +F  + QYP+
Sbjct  470   LICLGAFVGVLFGSVEIGLAVALAISFAKIIIQSIRPQVEVLGRLQGTN-IFCSVRQYPV  528

Query  701   AVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSN  522
             A QTP V  IR  +S LCF NA FIK RI+  V EE    +     + +RI  +V DMS+
Sbjct  529   ACQTPTVLPIRMDTSFLCFINATFIKERIIEWVREE---VENPNGKARERIQAVVLDMSS  585

Query  521   IMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEA  345
             ++N+DTS + +L+E++ ++ S G+Q  IA+P W+ + K++++   +++ +  +F+T+GEA
Sbjct  586   VVNIDTSGLTALEEIHKELVSLGIQMAIASPGWKAVQKMKVSRVVDRVGEDWIFMTVGEA  645

Query  344   IDACL  330
             ++ACL
Sbjct  646   VEACL  650



>dbj|BAJ85215.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91944.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/650 (59%), Positives = 486/650 (75%), Gaps = 17/650 (3%)
 Frame = -1

Query  2243  KTSSTLPPAA-------ERASWVLNVPEPPGLSRKLEG----SFKKTATFLGTAFQRLRK  2097
             +T+ T+P +A       + A  VLN P PP L  +L G    +F+      G A    R 
Sbjct  11    ETAVTVPSSAFDVSRRPDTAGLVLNSPRPPSLREELVGVVGKAFRPRGAGTGGAGGDRRP  70

Query  2096  RPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYG  1917
                  VL+A ++VFP+L WG+ Y+L   +SDV+AGLTLASL IPQSIGYA LA LDPQYG
Sbjct  71    PRFAWVLTALQAVFPVLQWGRTYTLKSFRSDVMAGLTLASLGIPQSIGYANLAKLDPQYG  130

Query  1916  LYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffa  1737
             LYTSVVPPLIYAVMG+SREIAIGPVAV+SLL+SSMV K+ DPA +P  Y +LV TVTF A
Sbjct  131   LYTSVVPPLIYAVMGTSREIAIGPVAVVSLLLSSMVQKVVDPAVDPVTYRTLVFTVTFLA  190

Query  1736  gifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLT  1557
             G+FQ +FG+ RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L G+S FTN TDVV+V  
Sbjct  191   GVFQVSFGLFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLSRFTNSTDVVAVAK  250

Query  1556  HIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYL  1377
              +F++LH  PW+P N  IG SFL FIL TRF+G+K++KLFWL A++PLLSVILST  VY 
Sbjct  251   AVFSALH-DPWHPGNFFIGCSFLIFILATRFIGRKYKKLFWLSAISPLLSVILSTAAVYA  309

Query  1376  TRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFAS  1197
             T+A+ HGVKI++ V  GLNPSS+  +  N P+  +  KI  I AV+ALTEAIAVG SFA+
Sbjct  310   TKADKHGVKIIREVHAGLNPSSVKLIQLNGPYTTECAKIAIICAVIALTEAIAVGRSFAT  369

Query  1196  MKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLI  1017
             ++GY LDGNKEM+A+G +N+AGSL+SCYVATGSFSR+AVNF AG  S VSN+VMA TV I
Sbjct  370   IRGYKLDGNKEMIAMGFSNVAGSLSSCYVATGSFSRTAVNFSAGARSTVSNIVMAATVFI  429

Query  1016  SLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASV  837
             +L+   KLLY+TP+A+LASIILSALPGLI++ EA +IW+VDK+DFL C GAF GVLF SV
Sbjct  430   ALEFFMKLLYYTPMAVLASIILSALPGLIDIREACNIWRVDKMDFLICLGAFLGVLFGSV  489

Query  836   EIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSS  657
             EIGL VA+ +SFAKI++ S++P +E LGRL GT+ +F  + QYP+A +TP V VIR  +S
Sbjct  490   EIGLGVALAISFAKIIIQSLRPQVEVLGRLQGTN-IFCSVRQYPVACRTPAVQVIRIDTS  548

Query  656   LLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKEL  477
              LCF NA FIK RI+  V  E    D + E   +R+  +V DMSN++N+DTS ++ L+E+
Sbjct  549   FLCFTNATFIKERIMEWVRAE---VDTSNEKVRERVQSVVLDMSNVVNIDTSGLVGLEEI  605

Query  476   YDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
             + ++ S G+Q  IA+P WQ I K++LA   ++I +  +FLT+GEA++ CL
Sbjct  606   HKELASLGIQMAIASPGWQAIQKMKLAHVVDRIGEDWIFLTVGEAVEGCL  655



>ref|XP_006651130.1| PREDICTED: low affinity sulfate transporter 3-like, partial [Oryza 
brachyantha]
Length=596

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/584 (63%), Positives = 465/584 (80%), Gaps = 6/584 (1%)
 Frame = -1

Query  2078  LSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVV  1899
             L+A +SVFP+L WG+ YS    KSDV+AGLTLASL IPQSIGYA LA LDPQYGLYTSVV
Sbjct  8     LTALQSVFPVLQWGRTYSFKSFKSDVMAGLTLASLGIPQSIGYANLAKLDPQYGLYTSVV  67

Query  1898  PPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaa  1719
             PPLIYAVMG+SREIAIGPVAV+SLL+SSMV K+ DPA++PA Y +LV TVTF AG+FQ +
Sbjct  68    PPLIYAVMGTSREIAIGPVAVVSLLLSSMVSKIVDPAADPATYRALVFTVTFLAGVFQVS  127

Query  1718  fgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSL  1539
             FG+ RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLK L G+S+FTN TD+VSV+  + ++L
Sbjct  128   FGLFRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKGLLGLSHFTNSTDIVSVIKAVCSAL  187

Query  1538  HHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENH  1359
                PW+P N +IG SFL FIL TRF+G++++KLFWL A++PLLSVILST  VY TRA+ H
Sbjct  188   RD-PWHPGNFLIGCSFLIFILSTRFIGRRYKKLFWLSAISPLLSVILSTAAVYATRADRH  246

Query  1358  GVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHL  1179
             GVKI++ V  GLNPSS  QL  + P+     K   I AV+ALTEAIAVG SFAS++GY L
Sbjct  247   GVKIIQRVHAGLNPSSAGQLRLSGPYTVDCAKTAIICAVIALTEAIAVGRSFASIRGYKL  306

Query  1178  DGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLT  999
             DGNKEM+A+G +N+AGSL+SCYVATGSFSR+AVNF AG  S VSN+VM++TV I+L+LL 
Sbjct  307   DGNKEMIAMGCSNVAGSLSSCYVATGSFSRTAVNFSAGARSTVSNIVMSITVFIALELLM  366

Query  998   KLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLV  819
             K LY+TPVA+LASIILSALPGLI++ EA+SIWKVDK+DFL C GAF GVLF SVEIGL V
Sbjct  367   KSLYYTPVAVLASIILSALPGLIDIKEAFSIWKVDKMDFLTCLGAFVGVLFGSVEIGLAV  426

Query  818   AVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFAN  639
             A+ +SFAKI++ S++P +E LGRL GT ++F  I QYP+A + P V  IR  +S LCF N
Sbjct  427   ALAISFAKIIIQSLRPQVEVLGRLQGT-SIFCSIRQYPVACRIPAVLTIRIDTSFLCFIN  485

Query  638   ANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITS  459
             + FIK RI+  + +E ++ D   E S +R+  +V DMSN++N+DTS I +L+E++ ++ S
Sbjct  486   STFIKERIVEWIRDEVETPD---EKSRERVQSLVLDMSNVVNIDTSGISALEEIHKELVS  542

Query  458   CGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACL  330
              G+Q  IA+P WQ I K+++A   +++ G  +FLT+GEA++AC+
Sbjct  543   LGIQMAIASPGWQAIQKMKMAGVVDRVGGDWIFLTVGEAVEACV  586



>ref|XP_006434040.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|ESR47280.1| hypothetical protein CICLE_v10000521mg [Citrus clementina]
 gb|KDO80890.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
Length=523

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/520 (68%), Positives = 435/520 (84%), Gaps = 5/520 (1%)
 Frame = -1

Query  1877  MGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLG  1698
             MGSSREIAIGPVAV+S+L+S+++  ++DPA++P  Y  LV TVTFFAG+FQ+ FG+ RLG
Sbjct  1     MGSSREIAIGPVAVVSMLLSALMQNVQDPAADPVAYRKLVFTVTFFAGVFQSVFGLFRLG  60

Query  1697  FLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNP  1518
             FLVDFLSHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDVVSVL  +F+SLHHS W P
Sbjct  61    FLVDFLSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVVSVLGSVFSSLHHSYWYP  120

Query  1517  YNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKH  1338
              N ++G SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYLT+A+ HGVKIVKH
Sbjct  121   LNFVLGCSFLIFLLIARFIGRRNKKLFWLPAIAPLLSVILSTLIVYLTKADKHGVKIVKH  180

Query  1337  VKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEML  1158
             +KGGLNPSS HQL    PH+ Q  KIG I AVVALTEAIAVG SFAS+KGYHLDGNKEM+
Sbjct  181   IKGGLNPSSAHQLQLTGPHLGQTAKIGLISAVVALTEAIAVGRSFASIKGYHLDGNKEMV  240

Query  1157  AIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTP  978
             A+G  NI GSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+TVL+SL+L T LLY+TP
Sbjct  241   AMGFMNIVGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAITVLLSLELFTSLLYYTP  300

Query  977   VAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFA  798
             +AILASIILSALPGLI++NEA +I+KVDKLDFLAC GAF GVLFASVEIGLL AV +SFA
Sbjct  301   IAILASIILSALPGLIDINEAINIYKVDKLDFLACIGAFLGVLFASVEIGLLAAVTISFA  360

Query  797   KIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR  618
             KI+LN+++PGIE  GRLP TD  +  I Q+PMA++TPG+  IR  S+L CFANANFI+ R
Sbjct  361   KILLNAVRPGIELQGRLPRTDT-YGDISQFPMAIKTPGILTIRINSALFCFANANFIRER  419

Query  617   ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVI  438
             I+  V EEQ   DE +E++++ I  ++ DMSN MN+DTS I+ L+EL+ K+ S G++ V+
Sbjct  420   IMRWVTEEQ---DELEETTKRTIQAVIIDMSNSMNIDTSGILVLEELHKKLASNGIELVM  476

Query  437   ANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             A+PRWQVIHKL+ A   ++I KG V+L++ EA++ACL  K
Sbjct  477   ASPRWQVIHKLKSAKLLDRIGKGCVYLSVAEAMEACLTSK  516



>gb|AAN59769.1| Putative sulfate transporter [Oryza sativa Japonica Group]
 gb|EAZ25921.1| hypothetical protein OsJ_09764 [Oryza sativa Japonica Group]
Length=660

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/632 (59%), Positives = 479/632 (76%), Gaps = 9/632 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA---VLSASESVFPLLS  2043
             + A  VL+ P+PPG+  +  G  +K      +      + P       L+A ++VFP+L 
Sbjct  24    DTARLVLSSPKPPGVREEFVGVVRKAFRPRASGGGGAGRTPPARWGWALTALQTVFPVLQ  83

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y+    +SDV+AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMG+SR
Sbjct  84    WGRTYNFKLFRSDVMAGLTLASLGIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGTSR  143

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+SLL+SSMV K+ DPA +P  Y +LV TVTF AG+FQ +FG+ RLGFLVDF
Sbjct  144   EIAIGPVAVVSLLLSSMVSKIVDPAVDPVTYRALVFTVTFLAGVFQVSFGLFRLGFLVDF  203

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFMAGAAIVIGLQQLK L G+S+FTN TDVVSV+  + ++L   PW+P N +I
Sbjct  204   LSHAAIVGFMAGAAIVIGLQQLKGLLGLSHFTNSTDVVSVIKAVCSALRD-PWHPGNFLI  262

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL FIL TRF+G++++KLFWL A++PLLSVILST  VY TRA+ HGVKI++ V  GL
Sbjct  263   GCSFLIFILATRFIGRRYKKLFWLSAISPLLSVILSTAAVYATRADKHGVKIIQRVHAGL  322

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS  QL  + P+     K   I AV+ALTEAIAVG SFAS++GY LDGNKEM+A+G +
Sbjct  323   NPSSASQLRLSGPYTVDCAKTAIICAVIALTEAIAVGRSFASIRGYKLDGNKEMIAMGCS  382

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             N+AGSL+SCYVATGSFSR+AVNF AG  S VSN+VM++TV I+L+LL K LY+TP+A+LA
Sbjct  383   NVAGSLSSCYVATGSFSRTAVNFSAGARSTVSNIVMSITVFIALELLMKSLYYTPIAVLA  442

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SIILSALPGLI++ EA SIWKVDK+DFL C GAF GVLF SVEIGL VA+ +SFAKI++ 
Sbjct  443   SIILSALPGLIDIKEALSIWKVDKMDFLTCLGAFVGVLFGSVEIGLAVALAISFAKIIIQ  502

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             SI+P +E LGRL GT+ +F  I QYP+A + P V  IR  +S LCF N+ FIK RI+  +
Sbjct  503   SIRPQVEVLGRLQGTN-IFCSIRQYPVACRIPSVLTIRIDTSFLCFINSTFIKERIIEWI  561

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              EE +++D   E + +R+  +V DMSN++N+DTS I +L+E++ ++ S  +Q  IA P W
Sbjct  562   REEVETSD---EKARERVQSVVLDMSNVVNIDTSGISALEEIHKELASLSIQMAIAGPGW  618

Query  422   QVIHKLRLADFHNKIKGK-VFLTIGEAIDACL  330
             Q I K++LA   +++ G  +FLT+GEA++AC+
Sbjct  619   QAIQKMKLAGVVDQVGGDWIFLTVGEAVEACV  650



>ref|XP_010905915.1| PREDICTED: low affinity sulfate transporter 3-like [Elaeis guineensis]
Length=564

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/558 (64%), Positives = 452/558 (81%), Gaps = 5/558 (1%)
 Frame = -1

Query  2000  LAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLI  1821
             +AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAV+SLL+
Sbjct  1     MAGLTLASLGIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVVSLLL  60

Query  1820  SSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAA  1641
             SSM+ KL DP  +P  Y  LV T TFFAGIFQAAFG+ RLGFLVDFLSHA IVGFM GAA
Sbjct  61    SSMLQKLADPQVDPVSYRKLVFTSTFFAGIFQAAFGLFRLGFLVDFLSHAVIVGFMGGAA  120

Query  1640  IVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFL  1461
             IVI LQQLK L GI++FT KTDVVSV+  ++ + H   W+P N  +G SFL F+LITRF+
Sbjct  121   IVISLQQLKGLLGIAHFTTKTDVVSVIEAVWNAFHQH-WHPENFYLGCSFLVFLLITRFI  179

Query  1460  GQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPH  1281
             G+++ KLFWLPA+APL+SVILSTLLV++TRA+ HGV  ++H+KGGLNPSS  QL F   +
Sbjct  180   GRRNNKLFWLPAIAPLISVILSTLLVFMTRADKHGVITIQHIKGGLNPSSAKQLQFTGQY  239

Query  1280  IPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATG  1101
               +  K+G I A++ALTEA+AVG SFAS++GYHLDGNKEM+A+G  NIAGSL+SCY+ATG
Sbjct  240   AAECAKVGLICAIIALTEAVAVGRSFASIRGYHLDGNKEMVAMGFMNIAGSLSSCYLATG  299

Query  1100  SFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLN  921
             SFSR+AVN+ AGC++AVSN+VMA+TV  +L+LLT+LLY+TP+AILASIILS+L GLI++ 
Sbjct  300   SFSRTAVNYSAGCKTAVSNIVMAITVFAALELLTRLLYYTPIAILASIILSSLLGLIDIG  359

Query  920   EAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPG  741
             EAY+IW+VDK+DFLAC GAF G+LF SVEIGLL+AV +SF++I+LN I+P IE LGR+ G
Sbjct  360   EAYAIWEVDKVDFLACLGAFFGILFGSVEIGLLIAVAISFSRIILNLIRPQIEMLGRIQG  419

Query  740   TDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESS  561
             TD +F  I QYPMA Q  G+ ++R  SS L F NAN IK RI    ++E +  DE +E+ 
Sbjct  420   TD-IFCSIKQYPMANQESGLLILRMDSSFLYFVNANMIKERIAKYCVKEGQ--DEIEENP  476

Query  560   EKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNK  381
             ++RI  +V DMSN+ N+DT+ I +L+EL+ K+ + G+Q V+ANP W +IHK++LA F + 
Sbjct  477   KERIQSVVIDMSNVKNIDTTGIAALEELHKKLDTLGIQLVMANPGWLLIHKMKLASFVDL  536

Query  380   IKGK-VFLTIGEAIDACL  330
             I  K +FLT+GEA++ACL
Sbjct  537   IGEKWIFLTVGEAVEACL  554



>gb|EEC74682.1| hypothetical protein OsI_10373 [Oryza sativa Indica Group]
Length=660

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/632 (59%), Positives = 479/632 (76%), Gaps = 9/632 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA---VLSASESVFPLLS  2043
             + A  VL+ P+PPG+  +  G  +K      +      + P       L+A ++VFP+L 
Sbjct  24    DTARLVLSSPKPPGVREEFVGVVRKAFRPRASGGGGAGRTPPARWGWALTALQTVFPVLQ  83

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y+    +SDV+AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMG+SR
Sbjct  84    WGRTYNFKLFRSDVMAGLTLASLGIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGTSR  143

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+SLL+SSMV K+ DPA +P  Y +LV TVTF AG+FQ +FG+ RLGFLVDF
Sbjct  144   EIAIGPVAVVSLLLSSMVSKIVDPAVDPVTYRALVFTVTFLAGVFQVSFGLFRLGFLVDF  203

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFMAGAAIVIGLQQLK L G+S+FTN TDVVSV+  + ++L   PW+P N +I
Sbjct  204   LSHAAIVGFMAGAAIVIGLQQLKGLLGLSHFTNSTDVVSVIKAVCSALRD-PWHPGNFLI  262

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL FIL TRF+G++++KLFWL A++PLLSVILST  VY TRA+ HGVKI++ V  GL
Sbjct  263   GCSFLIFILATRFIGRRYKKLFWLSAISPLLSVILSTAAVYATRADKHGVKIIQRVHAGL  322

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS  QL  + P+     K   I AV+ALTEAIAVG SFAS++GY LDGNKEM+A+G +
Sbjct  323   NPSSASQLRLSGPYTVDCAKTAIICAVIALTEAIAVGRSFASIRGYKLDGNKEMIAMGCS  382

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             N+AGSL+SCYVATGSFSR+AVNF AG  S VSN+VM++TV I+L+LL K LY+TP+A+LA
Sbjct  383   NVAGSLSSCYVATGSFSRTAVNFSAGARSTVSNIVMSITVFIALELLMKSLYYTPIAVLA  442

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SIILSALPGLI++ EA SIWKVDK+DFL C GAF GVLF SVEIGL V++ +SFAKI++ 
Sbjct  443   SIILSALPGLIDIKEALSIWKVDKMDFLTCLGAFVGVLFGSVEIGLAVSLAISFAKIIIQ  502

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
             SI+P +E LGRL GT+ +F  I QYP+A + P V  IR  +S LCF N+ FIK RI+  +
Sbjct  503   SIRPQVEVLGRLQGTN-IFCSIRQYPVACRIPSVLTIRIDTSFLCFINSTFIKERIIEWI  561

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              EE +++D   E + +R+  +V DMSN++N+DTS I +L+E++ ++ S  +Q  IA P W
Sbjct  562   REEVETSD---EKARERVQSVVLDMSNVVNIDTSGISALEEIHKELASLSIQMAIAGPGW  618

Query  422   QVIHKLRLADFHNKIKGK-VFLTIGEAIDACL  330
             Q I K++LA   +++ G  +FLT+GEA++AC+
Sbjct  619   QAIQKMKLAGVVDQVGGDWIFLTVGEAVEACV  650



>ref|XP_008809316.1| PREDICTED: LOW QUALITY PROTEIN: low affinity sulfate transporter 
3-like [Phoenix dactylifera]
Length=562

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/557 (64%), Positives = 450/557 (81%), Gaps = 6/557 (1%)
 Frame = -1

Query  2000  LAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLI  1821
             +AGLTLASL IPQSIGYA+LA LDPQYGLYTSV+PPLIYAVMGSSRE+AIGPVAV+SLL+
Sbjct  1     MAGLTLASLGIPQSIGYASLAKLDPQYGLYTSVIPPLIYAVMGSSRELAIGPVAVVSLLL  60

Query  1820  SSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAA  1641
             SSM+ KL DP  +P  Y  LV T TFFAGIFQAAFG+ RLGFLVDFLSHAA VGFM GAA
Sbjct  61    SSMLQKLADPRVDPESYRKLVFTSTFFAGIFQAAFGLFRLGFLVDFLSHAATVGFMGGAA  120

Query  1640  IVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFL  1461
             IVI LQQLK L GI++FT KTDVVSV+  +  ++H  PW+P N+ +G SFL F+LITRF+
Sbjct  121   IVISLQQLKGLLGIAHFTTKTDVVSVMEAVQNAIHQ-PWHPENVYLGCSFLIFLLITRFI  179

Query  1460  GQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPH  1281
             G++ +KLFWLPA+APL+SVILSTLLV++TRA+ HGV  ++H+KGGLNPSS   L F   +
Sbjct  180   GRRIKKLFWLPAIAPLISVILSTLLVFMTRADKHGVITIQHIKGGLNPSSAKLLQFTGQN  239

Query  1280  IPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATG  1101
             +    K+G I A++ALTEA+AVG SFAS+KGYHLDGNKEM+A+G  NIAGSL+SCY+ATG
Sbjct  240   VAPCAKVGLICAIIALTEAMAVGRSFASIKGYHLDGNKEMVAMGFMNIAGSLSSCYIATG  299

Query  1100  SFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLN  921
             SFSR+AVN  AGC++AVSN+VMA+TV  +L+LLT+LLY+TPVAILASIILS+L GLI++ 
Sbjct  300   SFSRTAVNCSAGCKTAVSNIVMAITVFAALELLTRLLYYTPVAILASIILSSLXGLIDIG  359

Query  920   EAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPG  741
             EAY+IW+VDK+DFLAC GAF GVLF SVEIGLL+AV +SF++I+ N I+P ++ LGR+ G
Sbjct  360   EAYAIWEVDKVDFLACLGAFIGVLFGSVEIGLLIAVAISFSRIIWNLIRPQVDILGRIQG  419

Query  740   TDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESS  561
             TD +F  I QYPMA Q  G+ ++R  SS L F NAN IK RI   V EEQ   DE +E+ 
Sbjct  420   TD-IFCSIKQYPMAKQASGLLILRIDSSFLYFVNANMIKERIAKWVKEEQ---DEIEENP  475

Query  560   EKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNK  381
             ++RI  +V DMSN+ N+DT+ I +L+EL+ K+ S G+Q V+ANP W VIHK++LA   + 
Sbjct  476   KERIKSVVIDMSNVKNIDTTGIAALEELHKKLDSLGIQLVMANPGWLVIHKMKLASLVDM  535

Query  380   IKGK-VFLTIGEAIDAC  333
             I  K +FLT+GEA++AC
Sbjct  536   IGEKWIFLTVGEAVEAC  552



>ref|XP_009345532.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Pyrus x bretschneideri]
Length=696

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/604 (63%), Positives = 475/604 (79%), Gaps = 12/604 (2%)
 Frame = -1

Query  2336  KYLAGMAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKL  2157
             K+L  MA  PT   E+ + +EL  +  Q  + TS      AERA W+L+ P+PPGL ++L
Sbjct  40    KFLTTMASLPT---EIFSTVELQQQHRQA-EDTSGR----AERAQWLLSSPDPPGLWQQL  91

Query  2156  EGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLAS  1977
                 K      G  + + +K P     S    +FP+LSWG+ Y   K K+DV+AGLTLAS
Sbjct  92    IHGIKSNLLPQGNTYSK-QKTPANRAFSLFRGLFPILSWGRNYKASKFKNDVMAGLTLAS  150

Query  1976  LCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLE  1797
             L +PQSIGYA LA LDPQYGLYTS+VPPLIY++MGSSRE+AIGPVAV+S+L+ S++ K+E
Sbjct  151   LSVPQSIGYANLAKLDPQYGLYTSIVPPLIYSLMGSSRELAIGPVAVVSMLLPSLIQKIE  210

Query  1796  DPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQL  1617
             DP +NP  Y +LV TVTFFAGIFQAAFGI RLGFLVDFLSHAAIVGFMAGAAI+IGLQQL
Sbjct  211   DPVANPIAYRNLVFTVTFFAGIFQAAFGIFRLGFLVDFLSHAAIVGFMAGAAIIIGLQQL  270

Query  1616  KPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLF  1437
             K L GIS+FT  TD++SVL  +F S+ H PW+P N+++G +FL F+LI RF+G++++KLF
Sbjct  271   KGLLGISHFTTNTDIISVLESVFDSIVHEPWHPLNIVLGCAFLIFLLIARFIGKRNKKLF  330

Query  1436  WLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIG  1257
             W+PA+APL+SVILSTL+VYLT+A+ HGV +VKH+KGGLNPSS HQL    PH+ Q  K G
Sbjct  331   WVPAIAPLISVILSTLIVYLTKADKHGVNVVKHIKGGLNPSSAHQLQLRGPHVGQAAKAG  390

Query  1256  FIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVN  1077
              I A++AL EAIAVG SFA++KGYHLDGNKEMLA+G  NIAGSLTSCYVATGSFSR+AVN
Sbjct  391   LISAIIALAEAIAVGRSFAAIKGYHLDGNKEMLAMGCMNIAGSLTSCYVATGSFSRTAVN  450

Query  1076  FYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKV  897
             F AGC++ VSN+VMA+TV++SL+LLT+LLYFTP+AILASIILSALPGLI++N AY IWKV
Sbjct  451   FSAGCQTVVSNIVMALTVILSLELLTRLLYFTPMAILASIILSALPGLIDINGAYHIWKV  510

Query  896   DKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGI  717
             DKLDFLAC GAF GVLF SVEIGLL AV +SFAKI++NS++PGI+ LG+LP TD +F  I
Sbjct  511   DKLDFLACVGAFLGVLFESVEIGLLAAVSISFAKILINSLRPGIDVLGKLPTTD-IFCNI  569

Query  716   HQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIV  537
             +QYPMA++TP + +I   SSLLCFANAN +K R+L  V +E+    + KE  ++RI  ++
Sbjct  570   NQYPMAIETPSILIIGINSSLLCFANANSVKERVLKWVTKEEDENGDPKE--KRRIQHVI  627

Query  536   FDMS  525
              DMS
Sbjct  628   LDMS  631



>gb|KEH28061.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=559

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/539 (65%), Positives = 433/539 (80%), Gaps = 8/539 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGT--AFQRLRKRPVQAVLSASESVFPLLSW  2040
             ER+ WVL+ P PP L +KL  S K+T    G    F    K  +    S  +S+FP+L W
Sbjct  17    ERSKWVLDSPNPPPLWKKLFSSLKETLLPHGNKLCFSSKNKSFLALAYSFLQSLFPILVW  76

Query  2039  GKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSRE  1860
              K Y++ K K D+LAGLTLASLCIPQSIGYA+LA +DPQYGLYTS+VPPLIYAVMGSSR+
Sbjct  77    LKDYTISKFKDDLLAGLTLASLCIPQSIGYASLAKVDPQYGLYTSIVPPLIYAVMGSSRD  136

Query  1859  IAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFL  1680
             IAIGPVAV+S+L+SS+V  + DP +NP  Y   + TVTFF GIFQAAFGI RLGFLVDFL
Sbjct  137   IAIGPVAVVSMLLSSLVTNVIDPVANPHAYRDFIFTVTFFTGIFQAAFGIFRLGFLVDFL  196

Query  1679  SHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPY  1515
             SHAA+VGFMAGAAI+IGLQQLK L GI++FT KTD VSVL  ++ SLH        W+P 
Sbjct  197   SHAALVGFMAGAAIIIGLQQLKGLLGITHFTTKTDAVSVLVSVYKSLHQQITSEEKWSPL  256

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N ++G SFL F+L+TRF+ +K +KLFWLPA+APLLSVILSTL+VYL++A+  G+ I+KHV
Sbjct  257   NFVLGCSFLIFLLVTRFIARKKKKLFWLPAIAPLLSVILSTLIVYLSKADKQGINIIKHV  316

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGGLN SS+HQL F+  ++ Q  KIG + AV+ALTEA+AVG SFAS+KGY LDGN+EML+
Sbjct  317   KGGLNQSSVHQLQFHGQNVGQAAKIGLVCAVIALTEAMAVGRSFASIKGYQLDGNREMLS  376

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G+ NIAGSLTSCYVATGSFSR+AVNF AGC++AVSN+VMA+TV++ LQL  +LLY+TP+
Sbjct  377   MGIMNIAGSLTSCYVATGSFSRTAVNFSAGCQTAVSNIVMAITVILFLQLFARLLYYTPM  436

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAK  795
             AILA+IILSALPGLI++NEA  IWKVDKLDFLAC GAF GVLFASVEIGLLVA+ +SFAK
Sbjct  437   AILAAIILSALPGLIDINEARYIWKVDKLDFLACIGAFVGVLFASVEIGLLVAISISFAK  496

Query  794   IMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR  618
             I++ SI+PG+E LGR+P T+A F  + QYPMA+ TPG+ VIR  S  LCFANANF+K R
Sbjct  497   ILIQSIRPGVEILGRVPRTEA-FCDVTQYPMAISTPGIVVIRISSGSLCFANANFVKER  554



>ref|XP_010534061.1| PREDICTED: sulfate transporter 2.2 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/604 (61%), Positives = 476/604 (79%), Gaps = 8/604 (1%)
 Frame = -1

Query  2225  PPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLL  2046
             P  +     +++ PEPP L ++L    + +     ++ +     PV   L   +S+FP+L
Sbjct  18    PSHSGGGQLLMDSPEPPTLWQELVRFIRTSVFSKKSSKKDKNSNPVLFCL---KSIFPIL  74

Query  2045  SWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSS  1866
             +WG+ Y L   K DV+AGLTLASL IPQSIGYA LA LDP+YGLYTSVVPPLIYA MGSS
Sbjct  75    TWGRHYKLNMFKKDVMAGLTLASLSIPQSIGYANLAKLDPEYGLYTSVVPPLIYATMGSS  134

Query  1865  REIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVD  1686
             REIAIGPVAV+SLL+SSM+  L+DP ++P  Y +LV TVT FAG FQA FG+ RLGFLVD
Sbjct  135   REIAIGPVAVVSLLLSSMIQNLQDPVADPLAYRNLVFTVTLFAGTFQAIFGLFRLGFLVD  194

Query  1685  FLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNli  1506
             FLSHAA+VGFMAGAAIVIGLQQLK L G+S+FT+KTD+VSVL  +F SLHH PW+P N +
Sbjct  195   FLSHAALVGFMAGAAIVIGLQQLKGLLGLSHFTDKTDIVSVLGSVFHSLHH-PWHPLNFV  253

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG SFL FIL+ RF+G++ +KLFW+PA+APL+SVIL+TL+V+LT+A+  GVKIVKH+K G
Sbjct  254   IGCSFLIFILLARFIGKRKKKLFWIPAIAPLISVILATLIVFLTKADKRGVKIVKHIKRG  313

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             +N SS+ QLH   P++  +VKIG I AV+ALTEAIAVG SFAS+KGYHLDGNKEM+A+G 
Sbjct  314   INRSSVSQLHLTGPNLGHLVKIGLISAVIALTEAIAVGRSFASIKGYHLDGNKEMMAMGF  373

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              NIAGSLTSCYVATGSFSR+AVNF AGCE+ +SN+VMA+TV+ +L+L+T+LLY+TP AIL
Sbjct  374   MNIAGSLTSCYVATGSFSRTAVNFSAGCETTMSNIVMAITVIAALELMTRLLYYTPTAIL  433

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ASIILSALPGL++++ A+ IWK+DKLDFL C  AF GVLFASVEIGLLVAV +SFAKI+L
Sbjct  434   ASIILSALPGLVDVSGAHHIWKLDKLDFLVCLSAFLGVLFASVEIGLLVAVIISFAKILL  493

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
             +SI+PG+E LGRLP TD +F  I+QYPMA +TPG+F +R  S +LCFANANFI+ RIL+ 
Sbjct  494   SSIRPGVEALGRLPRTD-VFCNINQYPMASKTPGIFTVRVSSPMLCFANANFIRDRILNA  552

Query  605   VMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPR  426
             + +E +   +TK+ S   + ++V DMS +M+VDTS +I+++++   + S  +Q +  N  
Sbjct  553   IGDEDEHEGDTKKES---VRVVVLDMSCVMSVDTSGLIAIEQIQKGLISKSIQVLKKNFN  609

Query  425   WQVI  414
              Q++
Sbjct  610   TQLL  613



>ref|XP_008375006.1| PREDICTED: low affinity sulfate transporter 3 isoform X2 [Malus 
domestica]
Length=664

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/605 (63%), Positives = 476/605 (79%), Gaps = 14/605 (2%)
 Frame = -1

Query  2336  KYLAGMAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKL  2157
             K+L  MA  PT   E+ + +EL     Q   + +      AERA W+L+ P+PPGL ++L
Sbjct  40    KFLTTMASLPT---EVFSTVEL-----QQQHRHAEDTSGRAERAQWLLSSPDPPGLWQQL  91

Query  2156  EGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLAS  1977
                 K      G  + + +K P     S    +FP+LSWG+ Y   K K+DV+AGLTLAS
Sbjct  92    IHGIKSNLLPQGNRYSK-QKTPANRAFSLFRGLFPILSWGRNYKASKFKNDVMAGLTLAS  150

Query  1976  LCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLE  1797
             L +PQSIGYA LA LDPQYGLYTS+VPPLIY++MGSSRE+AIGPVAV+S+L+SS++ K+E
Sbjct  151   LSVPQSIGYANLAKLDPQYGLYTSIVPPLIYSLMGSSRELAIGPVAVVSMLLSSLIQKIE  210

Query  1796  DPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQL  1617
             DP +NP  Y +L+ TVTFFAGIFQAAFG+ RLGFLVDFLSHAAIVGFMAGAAIVIGLQQL
Sbjct  211   DPVANPIAYRNLLFTVTFFAGIFQAAFGLFRLGFLVDFLSHAAIVGFMAGAAIVIGLQQL  270

Query  1616  KPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLF  1437
             K L GIS+FT  TD++SVL  +F S+ H PW+P N+++G +FL F+LI RF+G++++KLF
Sbjct  271   KGLLGISHFTTNTDIISVLESVFDSIVHEPWHPLNIVLGCAFLIFLLIARFIGKRNKKLF  330

Query  1436  WLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIG  1257
             WLPA+APL+SVILSTL+VYLT+A+ HGV IVKH+KGGLNPSS HQL    PH+ Q  K G
Sbjct  331   WLPAIAPLISVILSTLIVYLTKADKHGVNIVKHIKGGLNPSSAHQLQLRGPHVRQAAKAG  390

Query  1256  FIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVN  1077
              I A++AL EAIAVG SFA++KGYHLDGNKEMLA+G  NIAGSLTSCYVATGSFSR+AVN
Sbjct  391   LISAIIALAEAIAVGRSFAAIKGYHLDGNKEMLAMGCMNIAGSLTSCYVATGSFSRTAVN  450

Query  1076  FYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKV  897
             F AGC++AVSN+VMA+TV++SL+LLT+LLYFTP+AILASIILSALPGLI++N AY IWKV
Sbjct  451   FSAGCQTAVSNIVMALTVILSLELLTRLLYFTPIAILASIILSALPGLIDINGAYHIWKV  510

Query  896   DKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGI  717
             DKLDFLAC GAF GVLFAS EIGLL AV +SFAKI++NS++PGIE LGRLP TD +F  I
Sbjct  511   DKLDFLACVGAFLGVLFASAEIGLLAAVSISFAKILINSLRPGIEVLGRLPTTD-IFCNI  569

Query  716   HQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEK-RIALI  540
             +QYPMA++TP + +I   SSLLCFANAN +K R+L  V +E+   DET +  EK RI  +
Sbjct  570   NQYPMAIETPSILIIGIXSSLLCFANANSVKERVLKWVTKEE---DETGDPKEKRRIQHV  626

Query  539   VFDMS  525
             + DMS
Sbjct  627   ILDMS  631



>ref|XP_004985353.1| PREDICTED: low affinity sulfate transporter 3-like isoform X1 
[Setaria italica]
Length=655

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/664 (57%), Positives = 487/664 (73%), Gaps = 32/664 (5%)
 Frame = -1

Query  2267  YEFSQTLQKTSSTL---PPAAER--------ASWVLNVPEPPGLSRKLEGSFKKTATFLG  2121
             ++FSQ +   +S L   P A+E         A  VL  PEPP L  +L G  +K      
Sbjct  4     WQFSQGVHPNTSKLAIEPMASEASVPKREGFADLVLQGPEPPSLWYELIGMLRK-----A  58

Query  2120  TAFQRLRKRPVQAVLSAS--ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYA  1947
               ++   K    +V + S   S+FP+L W K YSL   +SDV+AGLTLASL IPQSIGYA
Sbjct  59    VRYRSADKHFTLSVCAMSILHSLFPILEWSKSYSLKSFRSDVMAGLTLASLSIPQSIGYA  118

Query  1946  ALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYT  1767
              LA LDPQYGLYTS VPPL+YAVMG+SREIAIGPVAV+SLL+SSMV K+ DPA + A Y 
Sbjct  119   NLAKLDPQYGLYTSAVPPLVYAVMGTSREIAIGPVAVVSLLLSSMVQKIADPAIDLASYR  178

Query  1766  SLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFT  1587
              ++ TVTF  G+FQ AFG+LRLGFLVDFLSHAAI GFM GAAIVIGLQQLK L G+S+FT
Sbjct  179   KMIFTVTFLTGVFQFAFGLLRLGFLVDFLSHAAITGFMGGAAIVIGLQQLKGLLGLSHFT  238

Query  1586  NKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLS  1407
             + TD+VSV   ++ S+H  PW+P N  IG SF  FIL  RF+G+K++KLFW+ A+AP+LS
Sbjct  239   SNTDIVSVTRAVWVSVHE-PWHPENFFIGCSFFLFILGMRFIGRKNKKLFWVSAIAPVLS  297

Query  1406  VILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTE  1227
             V LSTL+VY+TRA+N GVKI++ V  G+N SS+ Q++ N P++ +  KI  I AV+ALTE
Sbjct  298   VALSTLMVYMTRADNRGVKIIQKVDAGINSSSVKQINLNGPYVTECAKIALICAVIALTE  357

Query  1226  AIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVS  1047
             AIAVG SF+ + GY LDGNKEM+A+G  N+AGSL+SCYVATGSFSR+AVNF AGC++AVS
Sbjct  358   AIAVGRSFSVINGYKLDGNKEMVAMGFMNVAGSLSSCYVATGSFSRTAVNFTAGCKTAVS  417

Query  1046  NVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAG  867
             NVVMA TV+++L+LL KLL++TPV+ILASIILSALPGLIN++E   +WKVDK+DFL C G
Sbjct  418   NVVMAATVMVALELLMKLLFYTPVSILASIILSALPGLINVHEICILWKVDKMDFLTCMG  477

Query  866   AFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTP  687
             +F GVLF SVEIGL VAVG+SFAK++++S++P ++ LGRL GT+ +F  I QYPM  QTP
Sbjct  478   SFLGVLFGSVEIGLSVAVGVSFAKVIVHSVRPQVQILGRLRGTN-IFCNIKQYPMVCQTP  536

Query  686   GVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVD  507
              V   R  +S LCF NANFI+ RI   V E+            + I  +V DMSN++N+D
Sbjct  537   AVLTTRIDTSFLCFINANFIRERITGWVTEKL-----------EEIRSVVLDMSNVVNID  585

Query  506   TSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
             T+ + +L+EL+ ++ S G+Q  IA+P WQVIHK++LA   +   +  +FLT+GEA++ACL
Sbjct  586   TAGLAALEELHKELVSRGIQMAIASPGWQVIHKMKLAQLIDGTGEAWIFLTVGEAVEACL  645

Query  329   VDKN  318
              +K 
Sbjct  646   ANKK  649



>gb|EMT09908.1| hypothetical protein F775_52532 [Aegilops tauschii]
Length=651

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/606 (60%), Positives = 464/606 (77%), Gaps = 20/606 (3%)
 Frame = -1

Query  2102  RKRPVQA--VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLD  1929
             R+RP +   VL+A ++VFP+L WG+ Y+L   +SDV+AGLTLASL IPQSIGYA LA LD
Sbjct  41    RRRPPRWAWVLAALQAVFPVLQWGRTYTLKSFRSDVMAGLTLASLGIPQSIGYANLAKLD  100

Query  1928  PQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTV  1749
             PQYGLYTSVVPPLIYAVMG+SREIAIGPVAV+SLL+SSMV K+ DPA +P  Y +LV TV
Sbjct  101   PQYGLYTSVVPPLIYAVMGTSREIAIGPVAVVSLLLSSMVQKVVDPAVDPVTYRTLVFTV  160

Query  1748  TffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVV  1569
             TF AG+FQ +FG+ RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L G+S FTN TDVV
Sbjct  161   TFLAGVFQVSFGLFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLSRFTNSTDVV  220

Query  1568  SVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTL  1389
             +V   +F++L H PW+P N  IG SFL FIL TRF+G+K++KLFWL A++PLLSVILST 
Sbjct  221   AVAKAVFSAL-HDPWHPGNFFIGCSFLIFILATRFIGRKYKKLFWLSAISPLLSVILSTA  279

Query  1388  LVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALT-------  1230
              VY T+A+ HGVKI++ V  GLNPSS+  +  N P+  +  KI  I AV+ALT       
Sbjct  280   AVYATKADKHGVKIIREVHAGLNPSSVKLIQLNGPYTTECAKIAVICAVIALTVLIIIIT  339

Query  1229  -----EAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAG  1065
                  EAIAVG SFA+++GY LDGNKEM+A+G +N+AGSL+SCYVATGSFSR+AVNF AG
Sbjct  340   RKIQQEAIAVGRSFATIRGYKLDGNKEMIAMGFSNVAGSLSSCYVATGSFSRTAVNFSAG  399

Query  1064  CESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLD  885
               S VSN+VMA TV I+L+   KLLY+TP+A+LASIILSALPGLI++ EA +IW+VDK+D
Sbjct  400   ARSTVSNIVMAATVFIALEFFMKLLYYTPMAVLASIILSALPGLIDIREACNIWRVDKMD  459

Query  884   FLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYP  705
             FL C GAF GVLF SVEIGL VA+ +SFAKI++ S++P +E LGRL GT+  F  + QYP
Sbjct  460   FLICLGAFLGVLFGSVEIGLGVALAISFAKIIIQSLRPQVEVLGRLQGTNT-FCSVRQYP  518

Query  704   MAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMS  525
             +A +TP V VIR  +S LCF NA FIK RI+  V  E    D + E   +R+  +V DMS
Sbjct  519   VACRTPAVQVIRIDTSFLCFINATFIKERIMEWVRAE---VDTSNEKVRERVHSVVLDMS  575

Query  524   NIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGE  348
             N++N+DTS ++ L+E++ ++ S G+Q  IA+P WQ I K++LA   ++I +  +FLT+GE
Sbjct  576   NVVNIDTSGLVGLEEIHKELASLGIQMAIASPGWQAIQKMKLAHVVDRIGEDWIFLTVGE  635

Query  347   AIDACL  330
             A++ CL
Sbjct  636   AVEGCL  641



>ref|XP_003558598.1| PREDICTED: low affinity sulfate transporter 3-like [Brachypodium 
distachyon]
Length=662

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/635 (60%), Positives = 481/635 (76%), Gaps = 14/635 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKK-----TATFLGTAFQRLRKRPVQAVLSASESVFPL  2049
             + A  VLN P PP    +L G   K     +A   GT   R   R    VL+A ++VFP+
Sbjct  25    DTAGLVLNSPTPPTFREELVGVLGKAFRPQSANGGGTGGHRSPPR-WGWVLTALQAVFPV  83

Query  2048  LSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGS  1869
             L WGK Y+L   KSDV+AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMG+
Sbjct  84    LQWGKSYTLKSFKSDVMAGLTLASLGIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGT  143

Query  1868  SREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLV  1689
             SREIAIGPVAV+SLL+S+MV K+ DPA++PA Y +LV TVTF AG+FQ +FG+ RLGFLV
Sbjct  144   SREIAIGPVAVVSLLLSTMVQKVVDPAADPATYRTLVFTVTFLAGVFQVSFGLFRLGFLV  203

Query  1688  DFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNl  1509
             DFLSHAAIVGFMAGAAIVIGLQQLK L G+S FTN TDVVSV   + ++LH  PW+P N 
Sbjct  204   DFLSHAAIVGFMAGAAIVIGLQQLKGLLGLSRFTNSTDVVSVFKAVCSALH-DPWHPGNF  262

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
              IG SFL FIL TRF+G++++KLFWL A++PLLSVILST  VY T+A+ HGVKI+K+V  
Sbjct  263   FIGCSFLIFILATRFIGRRYKKLFWLSAISPLLSVILSTAAVYATKADEHGVKIIKNVHA  322

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNPSS  Q+  N P+  +  KI  I A++ALTEAIAVG SFAS++GY LDGNKEM+A+G
Sbjct  323   GLNPSSAKQIQLNGPYTTECAKIAIICAIIALTEAIAVGRSFASIRGYKLDGNKEMIAMG  382

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
              +N+AGSL+SCYVATGSFSR+AVNF AG  S VSN+VMA TV I+L+   KLLY+TP+A+
Sbjct  383   FSNVAGSLSSCYVATGSFSRTAVNFSAGARSTVSNIVMAATVFIALEFFMKLLYYTPMAV  442

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI++ EA +IWKVD++DFL C GAF GVLF SVE GL VA+ +SFAKI+
Sbjct  443   LASIILSALPGLIDIREACNIWKVDRMDFLICLGAFLGVLFQSVETGLGVALAISFAKII  502

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILS  609
             + SI+P +E LGRL GT+ +F  I QYP+A +TP V VIR  +S LCF NA+FIK RI+ 
Sbjct  503   IQSIRPQVEILGRLQGTN-IFCSIRQYPVACRTPAVQVIRIDTSFLCFINASFIKERIIE  561

Query  608   LVMEE-QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIAN  432
              V  E + S  + KE+ +     +V DMSN++N+DTS ++ L+E++ ++ S G+Q  IA+
Sbjct  562   WVRSEVETSNGKAKETVQS----VVLDMSNVVNIDTSGLVGLEEIHKELASLGIQMAIAS  617

Query  431   PRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACL  330
             P WQ I K++L    ++I  + +FLT+GEA++A L
Sbjct  618   PGWQAIQKMKLGRVVDRIGEEWIFLTVGEAVEASL  652



>gb|AAF17693.1|AC009243_20 F28K19.21 [Arabidopsis thaliana]
Length=711

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/699 (53%), Positives = 474/699 (68%), Gaps = 85/699 (12%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAERAS-WVLNVPEPPGLSRKLEGSFKKTA-TFLGTAFQRLRKRPVQA  2082
             Q  Q       PA E  S W++N PEPP + ++L G  +            + +      
Sbjct  25    QNHQSHHEEASPAEEPMSRWLINTPEPPSMWQELIGYIRTNVLAKKKHKRNKTKNSSSNL  84

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQ--------------------  1962
             V S  +S FP+LSWG+QY L   K D++AGLTLASLCIPQ                    
Sbjct  85    VYSCLKSAFPILSWGRQYKLNLFKKDLMAGLTLASLCIPQVTLSTNFIKKRKKTLLTNCN  144

Query  1961  ---------SIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMV  1809
                      SIGYA LA LDP+YGLYTSVVPPLIY+ MG+SRE+AIGPVAV+SLL+SSMV
Sbjct  145   RYIFNFMLQSIGYANLAGLDPEYGLYTSVVPPLIYSTMGTSRELAIGPVAVVSLLLSSMV  204

Query  1808  PKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIG  1629
               L+DP ++P  Y  +V TVT              LGFLVDFLSHAA+VGFMAGAAIVIG
Sbjct  205   RDLQDPVTDPIAYRKIVFTVT--------------LGFLVDFLSHAALVGFMAGAAIVIG  250

Query  1628  LQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH--------------SPWNPYNliigfsf  1491
             LQQLK LFG+++FTNKTDVVSVL+ +F SLHH                W P N +IG SF
Sbjct  251   LQQLKGLFGLTHFTNKTDVVSVLSSVFHSLHHPVRTVFSYFFLSSSFQWQPLNFVIGSSF  310

Query  1490  lsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSS  1311
             L FIL+ RF+            MAPL+SV+L+TL+VYL+ AE+ GVKIVKH+K G N  S
Sbjct  311   LIFILLARFI----------VTMAPLISVVLATLIVYLSNAESRGVKIVKHIKPGFNQLS  360

Query  1310  LHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAG  1131
             ++QL F +PH+ Q+ KIG I A++ALTEAIAVG SFA++KGY LDGNKEM+A+G  NIAG
Sbjct  361   VNQLQFKSPHLGQIAKIGLISAIIALTEAIAVGRSFATIKGYRLDGNKEMMAMGFMNIAG  420

Query  1130  SLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIIL  951
             SL+SCYVATGSFSR+AVNF AGCE+ VSN+VMA+TV+ISL++LT+ LYFTP AILASIIL
Sbjct  421   SLSSCYVATGSFSRTAVNFSAGCETVVSNIVMAITVMISLEVLTRFLYFTPTAILASIIL  480

Query  950   SALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQP  771
             SALPGLI+++ A  IWK+DKLDFL    AF GVLFASVEIGLL+AVG+SFA+IML+SI+P
Sbjct  481   SALPGLIDVSGALHIWKLDKLDFLVLIAAFFGVLFASVEIGLLLAVGISFARIMLSSIRP  540

Query  770   GIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR---------  618
              IE LGRL  TD +F  I+QYPMA +T G+  +R  S LLCFANANFI+ R         
Sbjct  541   SIEALGRLSKTD-IFGDINQYPMANKTAGLLTLRISSPLLCFANANFIRDRSLINIYLLL  599

Query  617   -----ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCG  453
                  IL+ V E +   +E +   E  + +++ DMS +M VDTS + +L+EL+ ++ S  
Sbjct  600   FFFFLILNSVQEIEGEENEQEVLKENGLQVVILDMSCVMGVDTSGVFALEELHQELASND  659

Query  452   VQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAID  339
             ++ VIA+PRW+V+HKL+ A    KIK + +++T+GEA+D
Sbjct  660   IRLVIASPRWRVLHKLKRAKLDEKIKTENIYMTVGEAVD  698



>ref|XP_009389865.1| PREDICTED: low affinity sulfate transporter 3-like [Musa acuminata 
subsp. malaccensis]
Length=673

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/652 (57%), Positives = 468/652 (72%), Gaps = 27/652 (4%)
 Frame = -1

Query  2258  SQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP---V  2088
             S ++    S +   +E +  VLN PEPP   ++L G  ++       A      RP    
Sbjct  27    SASVPDHGSKVSARSETSLLVLNAPEPPPPWQELSGRVRR-------AVLAEVNRPSSLT  79

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
             +  +S    +FP+L WG+ Y     + D++AGLTLASL IPQSIGYA LA LDPQ+GLY+
Sbjct  80    KCFVSVLRGLFPILRWGRHYDRKSFRRDLMAGLTLASLGIPQSIGYANLAKLDPQFGLYS  139

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             S VPPLIYAVMG+SR+IAIGPVAV+SLL+SSM  KL DP ++P  Y SLVLT TFFAGIF
Sbjct  140   SFVPPLIYAVMGTSRDIAIGPVAVVSLLLSSMTQKLVDPYTHPETYRSLVLTATFFAGIF  199

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             QA+FG  RLGF+VDFLSHA IVGF  GAAIVIGLQQLK L GI++FT+ TDVVSV+  ++
Sbjct  200   QASFGFFRLGFVVDFLSHATIVGFTGGAAIVIGLQQLKGLLGINHFTSNTDVVSVIKAVW  259

Query  1547  TSLHHS------PWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLL  1386
              ++H         WNP N +IG SFL  ILI R +G + RKLFWL A+ PLLSVILSTLL
Sbjct  260   FAVHQPVSIASFDWNPDNFLIGCSFLVLILIVRSIGLRKRKLFWLAAIIPLLSVILSTLL  319

Query  1385  VYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGS  1206
             VYLTRA+ HGVKI++ VK GLNPSS+ Q+    P I +  KIG I A++ALTEA+AVG S
Sbjct  320   VYLTRADKHGVKIIRQVKEGLNPSSVKQIQLTGPFIGETAKIGLICAIIALTEAVAVGRS  379

Query  1205  FASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVT  1026
             FA+++GY LDGNKEM+A+G  NIAGSL+SCYVATGSFSR+AVN  AGCE+ VSN+VMA+T
Sbjct  380   FAAVRGYQLDGNKEMVAMGFMNIAGSLSSCYVATGSFSRTAVNVSAGCETTVSNMVMAIT  439

Query  1025  VLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLF  846
             V  SLQLL KLLY+TPV ILASIILSALPGLI++ EA  IW+VDK+DFLAC GAF GVLF
Sbjct  440   VFASLQLLMKLLYYTPVTILASIILSALPGLIDIKEACRIWRVDKMDFLACLGAFLGVLF  499

Query  845   ASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRT  666
              SVEIGLL AV +SFAKI+++++ P  E LGR+ GTD +F  + QYP AV+TP + ++R 
Sbjct  500   GSVEIGLLTAVIISFAKIIVSALVPKTEMLGRIQGTD-IFCSMRQYPSAVETPNLLILRI  558

Query  665   KSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISL  486
              S  L F NAN +K RI + +         T          +V DMSN+ ++DTS I ++
Sbjct  559   DSPFLHFMNANSVKERIFARI---------TGGCDATMTRFVVLDMSNVTHIDTSGIPAV  609

Query  485   KELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDAC  333
             +E++ K+TS GVQ  IANP W+VIHK++LA   + I  + +FLT+ EA++AC
Sbjct  610   EEIHKKLTSNGVQLAIANPGWRVIHKMKLAGLVDIIGEEWIFLTVSEAVEAC  661



>gb|EEE58498.1| hypothetical protein OsJ_09763 [Oryza sativa Japonica Group]
Length=638

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/643 (56%), Positives = 476/643 (74%), Gaps = 21/643 (3%)
 Frame = -1

Query  2240  TSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAV--LSAS  2067
             + S++P     A  +L  PE P L   L G F+K   + G       KR   +V  +S  
Sbjct  6     SESSVPIGTAFADLLLQGPEHPSLWNDLTGMFRKAFRWQGA-----DKRFTLSVYVMSVL  60

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             + +FP+L W K Y+L   +SD++AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPL+
Sbjct  61    QGLFPILDWWKTYNLKFFRSDLMAGLTLASLSIPQSIGYATLAKLDPQYGLYTSVVPPLV  120

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAV GSSREIAIGPVA++SLL+SSM+ K+ DP+ +PA Y  +V TVTF  G+FQ AFG+ 
Sbjct  121   YAVTGSSREIAIGPVAIVSLLLSSMIQKIVDPSVDPAFYRKMVFTVTFLTGVFQFAFGLF  180

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L G+S+FTN+TDVVSV   ++ S+H + 
Sbjct  181   RLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLSHFTNRTDVVSVTKAVWVSVHET-  239

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             W+P N+ IG SF  FIL  RF+G+K++KLFW+ A+AP+LSV LSTL VY TRA+ HGVKI
Sbjct  240   WHPENVFIGCSFFMFILAMRFIGRKYKKLFWVSAIAPVLSVALSTLFVYATRADKHGVKI  299

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             ++ V  G+N SS+ Q+     +  +  KI  + AV+ALTEA+AVG SF+++ GY LDGNK
Sbjct  300   IQKVNSGINASSVEQIDLKGGYAAECAKIALVCAVIALTEAVAVGRSFSAINGYRLDGNK  359

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGC++ VSN++MA TV+++L+LLTKLLY
Sbjct  360   EMVAMGFMNIAGSLSSCYVATGSFSRTAVNFAAGCKTTVSNIIMAATVMVALELLTKLLY  419

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TPV+ILASIILSALPGLIN+ E   +WKVDK+DFL C G+F GVLF SVEIGL VA+ +
Sbjct  420   YTPVSILASIILSALPGLINVQEVCFLWKVDKMDFLTCMGSFLGVLFGSVEIGLSVALLV  479

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI++ SI P +E LGRL GT+ +F  + QYP+  +TP V  +R ++S LCF N++ I
Sbjct  480   SFAKIIIQSIWPQVEILGRLQGTE-IFCNVKQYPVVHETPTVLTVRIETSFLCFVNSSSI  538

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K +I+  V +E+++              +V DMSN++N+DTS +++L+EL+ ++   G+Q
Sbjct  539   KEKIMGWVTDEREA-----------FCSVVLDMSNVVNMDTSGLVALEELHKELACLGIQ  587

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
               IA P WQVIHK++LA   + I +G  FLT+GEA++ACL +K
Sbjct  588   MAIAKPGWQVIHKMKLARLVDGIGEGWFFLTVGEAVEACLANK  630



>ref|XP_006649557.1| PREDICTED: sulfate transporter 2.1-like [Oryza brachyantha]
Length=656

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/645 (56%), Positives = 475/645 (74%), Gaps = 17/645 (3%)
 Frame = -1

Query  2240  TSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASES  2061
             + S++P     A  +L  PEPPGL   L G F+K     G          V +VL   + 
Sbjct  24    SESSVPKGTAFADLLLQGPEPPGLWNDLTGIFRKAFCCRGADKHFTLSVYVMSVL---QG  80

Query  2060  VFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYA  1881
             +FP+L W K Y+L   +SD++AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPL+YA
Sbjct  81    LFPILDWWKSYNLKFFRSDLMAGLTLASLSIPQSIGYATLARLDPQYGLYTSVVPPLVYA  140

Query  1880  VMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRL  1701
             V G+S+EIAIGPVA++SLL+SSM+ K+ DPA +P  Y  +V TVTF  G+FQ AFG+ RL
Sbjct  141   VTGTSKEIAIGPVAIVSLLLSSMIQKIVDPAVDPTYYRKMVFTVTFLTGVFQCAFGLFRL  200

Query  1700  GFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWN  1521
             G+LVDFLSHAAIVGFM GAAIVIGLQQLK L G+S+FTN+TDV+SV   ++ S+H + W+
Sbjct  201   GYLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLSHFTNRTDVISVTKAVWISVHET-WH  259

Query  1520  PYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVK  1341
             P N+ IG SF  FIL  RF+G+K++KLFW+ A+AP+LSV LSTL VY T A+ HGVKI++
Sbjct  260   PDNVFIGCSFFMFILAMRFIGRKYKKLFWISAIAPVLSVALSTLFVYATSADKHGVKIIQ  319

Query  1340  HVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEM  1161
              V  G+N SS+ Q+     ++ +  KI  I AV+ALTEA+AVG SF+++ GY LDGNKEM
Sbjct  320   KVNSGINASSVKQIDLKGDYVAECAKIALICAVIALTEAVAVGRSFSAINGYRLDGNKEM  379

Query  1160  LAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFT  981
             +A+G  NIAGSL+SCYVATGSFSR+AVNF AGC++AVSN++MA TV+++L+LLTKLLY+T
Sbjct  380   VAMGFMNIAGSLSSCYVATGSFSRTAVNFAAGCKTAVSNIIMAATVMVALELLTKLLYYT  439

Query  980   PVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSF  801
             PV+ILASIILSALPGLIN+ E   +WKVDK+DFL C G+F GVLF SVEIGL VA+G+SF
Sbjct  440   PVSILASIILSALPGLINVQEVCFLWKVDKMDFLTCMGSFLGVLFGSVEIGLSVALGVSF  499

Query  800   AKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKA  621
             AKI++ SI+  +E LGRL GTD +F  I+QYP+  QTP V  IR ++S LCF NA+ IK 
Sbjct  500   AKIVIQSIRSQVEILGRLQGTD-IFCSINQYPVVQQTPTVLTIRIETSFLCFINASSIKE  558

Query  620   RILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFV  441
             +I+  V +++++              ++ DMSN++N+DTS + +L+ELY ++   G+Q  
Sbjct  559   KIIGWVTDKREAFRS-----------VILDMSNVVNMDTSGLSALEELYKELACLGIQMA  607

Query  440   IANPRWQVIHKLRLADFHNKIKGK-VFLTIGEAIDACLVDKNMQA  309
             +A P WQV HK++LA   +++  +  FLT+GEA++ACL  K   A
Sbjct  608   MARPGWQVTHKMKLARLIDEVGERWFFLTVGEAVEACLTMKAANA  652



>ref|XP_006826990.1| hypothetical protein AMTR_s00010p00209860 [Amborella trichopoda]
 gb|ERM94227.1| hypothetical protein AMTR_s00010p00209860 [Amborella trichopoda]
Length=617

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/605 (60%), Positives = 455/605 (75%), Gaps = 17/605 (3%)
 Frame = -1

Query  2225  PPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLL  2046
             P +  R   VL+  EPPGL  +L+GS   T    G ++ RL  R     +     +FP+L
Sbjct  28    PDSVHR---VLDYVEPPGLVAELKGSI--TGAIFGPSWGRLGPR---WFVRGLRQLFPVL  79

Query  2045  SWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSS  1866
             SWG++Y L K K D++AGLTLASLCIPQSIGYA LA LDPQYGLYTS VPPLIYA MGSS
Sbjct  80    SWGREYDLGKFKCDLMAGLTLASLCIPQSIGYANLAGLDPQYGLYTSFVPPLIYAAMGSS  139

Query  1865  REIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVD  1686
             REIAIGPVA++SLL+S+M+ K  DP  +P GY  +V T TFFAGIFQAAFG+ RLGFL+D
Sbjct  140   REIAIGPVAIVSLLLSAMIRKTIDPLKDPIGYRKMVFTSTFFAGIFQAAFGLFRLGFLID  199

Query  1685  FLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNli  1506
             FLSHAAIVGFM GAAIVIGLQQLK L GI++FTNKTDV+SV+  ++  + H+ W+PYN +
Sbjct  200   FLSHAAIVGFMGGAAIVIGLQQLKALLGIAHFTNKTDVISVMKAVWAYVDHAAWHPYNFL  259

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG  FL  +L  R++G+K +KLFW+PA+APL+SVI+STL+V+LTRA+ HGV  VKH+KGG
Sbjct  260   IGSFFLILMLAARYIGRKKKKLFWIPAIAPLVSVIISTLVVFLTRADKHGVNTVKHIKGG  319

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             +NPSS  QL F   H  + VKIG I A+VALTEAIAVG SFAS KGY+LDGNKEM+A+G 
Sbjct  320   INPSSAKQLVFTGDHTGEAVKIGLISALVALTEAIAVGRSFASFKGYNLDGNKEMIAMGF  379

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              N  GS TSCYVATGSFSR+AVNF AGC++AVSNVVM++TVL++LQLLT LLYFTP+AIL
Sbjct  380   MNTIGSFTSCYVATGSFSRTAVNFSAGCQTAVSNVVMSITVLLALQLLTHLLYFTPMAIL  439

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ASIILS+LPGLI+L EAYSIW+VDKLDFL C G F GVLFASVEIGL+VAV +S  KI+L
Sbjct  440   ASIILSSLPGLIDLKEAYSIWEVDKLDFLVCMGTFFGVLFASVEIGLIVAVSISLLKIVL  499

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
             +  +P I KLGR+PGTD ++  I QY      PGV + R  S+L+CF NA  I+ RIL +
Sbjct  500   HIGRPSISKLGRVPGTD-IYCSIEQYSHVESVPGVLIARVDSALICFFNAGCIRDRILRM  558

Query  605   V-MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANP  429
             + +E++K  D   ++       ++ DMS +MN DT+ I +L+EL+DK+    ++ +    
Sbjct  559   IHVEKEKMNDHMFQA-------VIMDMSKVMNSDTTGIRALEELHDKLNRMDIKEIKLQS  611

Query  428   RWQVI  414
              W +I
Sbjct  612   LWAII  616



>ref|XP_006354020.1| PREDICTED: low affinity sulfate transporter 3-like isoform X2 
[Solanum tuberosum]
Length=598

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/644 (56%), Positives = 452/644 (70%), Gaps = 71/644 (11%)
 Frame = -1

Query  2246  QKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVL-SA  2070
             Q  +ST     +R  W+L  P PP    +L  S KK          +  K+    V  S 
Sbjct  15    QVDASTDTARNQRTQWLLTSPNPPSFFHQLINSVKKNV-------DKTTKQSRNGVFFSF  67

Query  2069  SESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPL  1890
              + +FP+LSWG+ Y   K K DV+AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPL
Sbjct  68    LKGLFPILSWGRNYKGTKFKHDVMAGLTLASLCIPQSIGYANLAKLDPQYGLYTSVVPPL  127

Query  1889  IYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgI  1710
             IYAVMGSSREIAIGPVAV+SLLIS++V K+ DPA +   Y +LV T TFF G FQA FG+
Sbjct  128   IYAVMGSSREIAIGPVAVVSLLISALVSKIIDPAVDHIAYRNLVFTATFFTGAFQAVFGL  187

Query  1709  LRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS  1530
              RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GI++FT KTDVVSVL  ++ SLH+ 
Sbjct  188   FRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGINHFTTKTDVVSVLEAVYKSLHNE  247

Query  1529  PWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVK  1350
             PW P N ++G SFL FIL+TRF+G++++KLFWLPA+APLLSV+LSTL+VYLT+A+ HGVK
Sbjct  248   PWFPLNFVLGCSFLIFILMTRFIGKRNKKLFWLPAIAPLLSVVLSTLIVYLTKADQHGVK  307

Query  1349  IVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGN  1170
             IVKH KGG+NPSSLHQL FN+PHI ++ KIG I A+VALTEAIAVG SFASMKGYHLDGN
Sbjct  308   IVKHFKGGINPSSLHQLQFNSPHIREIAKIGLICAIVALTEAIAVGRSFASMKGYHLDGN  367

Query  1169  KEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLL  990
             KEM+A+G  N+ GSLTS                  C +A                     
Sbjct  368   KEMVAMGCMNLVGSLTS------------------CYTAT--------------------  389

Query  989   YFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVG  810
                              GLI+++EA+ IWKVDK DF+ C  AF GVLF SVEIGL++AVG
Sbjct  390   -----------------GLIDISEAFHIWKVDKTDFIICIAAFFGVLFGSVEIGLIIAVG  432

Query  809   LSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANF  630
             +SF KI+L +I+P +E  GRLPGTD  F  I Q+P+A +T G+ +IR  ++ LCFANANF
Sbjct  433   ISFGKIILGTIRPSVELQGRLPGTDT-FCDITQFPVATETQGILIIRVNNASLCFANANF  491

Query  629   IKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGV  450
             I+ RILS V         ++E S+ +I ++V DMS++M++DTS I++L+EL+ ++ S G+
Sbjct  492   IRGRILSTV------TSRSEEQSKGKIRILVLDMSSVMSIDTSGIVALEELHRELVSQGI  545

Query  449   QFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             Q  IANPRW+VI+KL++A F +++ KG +FL++G+A+DACL  K
Sbjct  546   QLAIANPRWKVINKLKVAKFVDELGKGWIFLSVGDAVDACLNTK  589



>ref|NP_001049257.1| Os03g0195300 [Oryza sativa Japonica Group]
 gb|ABF94444.1| Sulfate transporter 2.1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11171.1| Os03g0195300 [Oryza sativa Japonica Group]
Length=656

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/643 (56%), Positives = 476/643 (74%), Gaps = 21/643 (3%)
 Frame = -1

Query  2240  TSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAV--LSAS  2067
             + S++P     A  +L  PE P L   L G F+K   + G       KR   +V  +S  
Sbjct  24    SESSVPIGTAFADLLLQGPEHPSLWNDLTGMFRKAFRWQGA-----DKRFTLSVYVMSVL  78

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             + +FP+L W K Y+L   +SD++AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPL+
Sbjct  79    QGLFPILDWWKTYNLKFFRSDLMAGLTLASLSIPQSIGYATLAKLDPQYGLYTSVVPPLV  138

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAV GSSREIAIGPVA++SLL+SSM+ K+ DP+ +PA Y  +V TVTF  G+FQ AFG+ 
Sbjct  139   YAVTGSSREIAIGPVAIVSLLLSSMIQKIVDPSVDPAFYRKMVFTVTFLTGVFQFAFGLF  198

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L G+S+FTN+TDVVSV   ++ S+H + 
Sbjct  199   RLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLSHFTNRTDVVSVTKAVWVSVHET-  257

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             W+P N+ IG SF  FIL  RF+G+K++KLFW+ A+AP+LSV LSTL VY TRA+ HGVKI
Sbjct  258   WHPENVFIGCSFFMFILAMRFIGRKYKKLFWVSAIAPVLSVALSTLFVYATRADKHGVKI  317

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             ++ V  G+N SS+ Q+     +  +  KI  + AV+ALTEA+AVG SF+++ GY LDGNK
Sbjct  318   IQKVNSGINASSVEQIDLKGGYAAECAKIALVCAVIALTEAVAVGRSFSAINGYRLDGNK  377

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGC++ VSN++MA TV+++L+LLTKLLY
Sbjct  378   EMVAMGFMNIAGSLSSCYVATGSFSRTAVNFAAGCKTTVSNIIMAATVMVALELLTKLLY  437

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TPV+ILASIILSALPGLIN+ E   +WKVDK+DFL C G+F GVLF SVEIGL VA+ +
Sbjct  438   YTPVSILASIILSALPGLINVQEVCFLWKVDKMDFLTCMGSFLGVLFGSVEIGLSVALLV  497

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI++ SI P +E LGRL GT+ +F  + QYP+  +TP V  +R ++S LCF N++ I
Sbjct  498   SFAKIIIQSIWPQVEILGRLQGTE-IFCNVKQYPVVHETPTVLTVRIETSFLCFVNSSSI  556

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K +I+  V +E+++              +V DMSN++N+DTS +++L+EL+ ++   G+Q
Sbjct  557   KEKIMGWVTDEREA-----------FCSVVLDMSNVVNMDTSGLVALEELHKELACLGIQ  605

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
               IA P WQVIHK++LA   + I +G  FLT+GEA++ACL +K
Sbjct  606   MAIAKPGWQVIHKMKLARLVDGIGEGWFFLTVGEAVEACLANK  648



>gb|EEC74681.1| hypothetical protein OsI_10372 [Oryza sativa Indica Group]
Length=638

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/640 (56%), Positives = 473/640 (74%), Gaps = 21/640 (3%)
 Frame = -1

Query  2231  TLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAV--LSASESV  2058
             ++P     A  +L  PE P L   L G F+K   + G       KR   +V  +S  + +
Sbjct  9     SVPIGTAFADLLLQGPEHPSLWNDLTGMFRKAFRWRGA-----DKRFTLSVYVMSVLQGL  63

Query  2057  FPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAV  1878
             FP+L W K Y+L   +SD++AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPL+YAV
Sbjct  64    FPILDWWKTYNLKFFRSDLMAGLTLASLSIPQSIGYATLAKLDPQYGLYTSVVPPLVYAV  123

Query  1877  MGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLG  1698
              GSSREIAIGPVA++SLL+SSM+ K+ DP+ +PA Y  +V TVTF  G+FQ AFG+ RLG
Sbjct  124   TGSSREIAIGPVAIVSLLLSSMIQKIVDPSVDPAFYRKMVFTVTFLTGVFQFAFGLFRLG  183

Query  1697  FLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNP  1518
             FLVDFLSHAAIVGFM GAAIVIGLQQLK L G+S+FTN+TDVVSV   ++ S+H + W+P
Sbjct  184   FLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLSHFTNRTDVVSVTKAVWVSVHET-WHP  242

Query  1517  YNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKH  1338
              N+ IG SF  FIL  RF+G+K++KLFW+ A+AP+LSV LSTL VY TRA+ HGVKI++ 
Sbjct  243   ENVFIGCSFFMFILAMRFIGRKYKKLFWVSAIAPVLSVALSTLFVYATRADKHGVKIIQK  302

Query  1337  VKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEML  1158
             V  G+N SS+ Q+     +  +  KI  + AV+ALTEA+AVG SF+++ GY LDGNKEM+
Sbjct  303   VNSGINASSVEQIDLKGGYAAECAKIALVCAVIALTEAVAVGRSFSAINGYRLDGNKEMV  362

Query  1157  AIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTP  978
             A+G  NIAGSL+SCYVATGSFSR+AVNF AGC++ VSN++MA TV+++L+LLTKLLY+TP
Sbjct  363   AMGFMNIAGSLSSCYVATGSFSRTAVNFAAGCKTTVSNIIMAATVMVALELLTKLLYYTP  422

Query  977   VAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFA  798
             V+ILASIILSALPGLIN+ E   +WKVDK+DFL C G+F GVLF SVEIGL VA+ +SFA
Sbjct  423   VSILASIILSALPGLINVQEVCFLWKVDKMDFLTCMGSFLGVLFGSVEIGLSVALLVSFA  482

Query  797   KIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR  618
             KI++ SI P +E LGRL GT+ +F  + QYP+  +TP V  +R ++S LCF N++ IK +
Sbjct  483   KIIIQSIWPQVEILGRLQGTE-IFCNVKQYPVVHETPTVLTVRIETSFLCFVNSSSIKEK  541

Query  617   ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVI  438
             I+  V +E+++              +V DMSN++N+DTS + +L+EL+ ++   G+Q  I
Sbjct  542   IMGWVTDEREAFRS-----------VVLDMSNVVNMDTSGLAALEELHKELACLGIQMAI  590

Query  437   ANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDK  321
             A P WQVIHK++LA   + I +G  FLT+GEA++ACL +K
Sbjct  591   AKPGWQVIHKMKLARLVDGIGEGWFFLTVGEAVEACLANK  630



>ref|XP_007136220.1| hypothetical protein PHAVU_009G028400g [Phaseolus vulgaris]
 gb|ESW08214.1| hypothetical protein PHAVU_009G028400g [Phaseolus vulgaris]
Length=566

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/516 (68%), Positives = 418/516 (81%), Gaps = 10/516 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ER+ WVL  P PP L  KL    KK+  F    F   +K  +   +S  ES+FP+L W K
Sbjct  24    ERSLWVLEPPNPPPLWNKLFSPLKKSMFF----FSSKKKTYLGRAVSFLESLFPILCWFK  79

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K K+D+LAGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPLIYAVMGSSREIA
Sbjct  80    NYKASKFKNDLLAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVVPPLIYAVMGSSREIA  139

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SS+VPK+ DPA +P  Y ++V TVT FAGIFQAAFGI RLGFLVDFLSH
Sbjct  140   IGPVAVVSLLLSSLVPKVVDPAVDPDAYRNVVFTVTLFAGIFQAAFGIFRLGFLVDFLSH  199

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH-----SPWNPYNl  1509
             AA+VGFMAGAAI+IGLQQLK L G+++FTNKTDV+SVL  ++ SLH        W P N 
Sbjct  200   AALVGFMAGAAIIIGLQQLKGLLGVTHFTNKTDVISVLVSVYKSLHQQITSGEKWYPLNF  259

Query  1508  iigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKG  1329
             +IG SFL F+LI RF+G++++KLFWLPA+APLLSV+LST +VYL++A+  GV I+KHVKG
Sbjct  260   VIGCSFLIFLLIARFVGRRNKKLFWLPAIAPLLSVLLSTSIVYLSKADKSGVNIIKHVKG  319

Query  1328  GLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIG  1149
             GLNPSS+H+L F+ PH+ Q  KIG I AV+ALTEAIAVG SFAS+KGYHLDGNKEMLA+G
Sbjct  320   GLNPSSVHKLQFHGPHVGQTAKIGLISAVIALTEAIAVGRSFASIKGYHLDGNKEMLAMG  379

Query  1148  VANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAI  969
               NIAGSL+SCYVATGSFSR+AVNF AGC+++VSN+VMAVTV + L+L T+LLY+TP+AI
Sbjct  380   CMNIAGSLSSCYVATGSFSRTAVNFSAGCQTSVSNIVMAVTVFLCLELFTRLLYYTPMAI  439

Query  968   LASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIM  789
             LASIILSALPGLI++NEAY IWKVDK DFLAC GAF GVLF SVE GLLVAV +SFAKI+
Sbjct  440   LASIILSALPGLIDINEAYYIWKVDKFDFLACIGAFFGVLFVSVETGLLVAVSISFAKIL  499

Query  788   LNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGV  681
             + SI+PGIE LG++P T+A F  + QYPMA  TPG+
Sbjct  500   IQSIRPGIEVLGQVPRTEA-FCDVSQYPMATSTPGI  534



>emb|CAN66052.1| hypothetical protein VITISV_009508 [Vitis vinifera]
Length=887

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/661 (54%), Positives = 450/661 (68%), Gaps = 91/661 (14%)
 Frame = -1

Query  2297  VEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATF---  2127
             V  T  L +P E  Q L     +     +RA WVLN PEPPGL  ++  S K +A F   
Sbjct  38    VCQTETLSMPMEQQQQLNIEDGS---KTQRAEWVLNSPEPPGLCHEIVSSIK-SAVFPNG  93

Query  2126  --LGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIG  1953
                 ++  +  +     V+S    +FP+L+WG+ Y   K ++D++AGLTLASL IPQSIG
Sbjct  94    GKHSSSSTKQTRSTAAGVVSFLXGLFPILTWGRNYKATKFRNDLMAGLTLASLSIPQSIG  153

Query  1952  YAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAG  1773
             YA LANL PQYGLYTSVVPPL+YA+MGSSREIAIGPVAV+SLL+SSM+  + DP +N   
Sbjct  154   YATLANLAPQYGLYTSVVPPLVYALMGSSREIAIGPVAVVSLLLSSMIQNVVDPVANAVA  213

Query  1772  YTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISN  1593
             Y  LVLTVTFFAG FQ  FG+ RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L GIS+
Sbjct  214   YRKLVLTVTFFAGTFQFIFGLFRLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGISH  273

Query  1592  FTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPL  1413
             FT KTDVVSVL  +F SLHH                        G++++KLFWLPA+APL
Sbjct  274   FTTKTDVVSVLEAVFRSLHHQ-----------------------GRRNKKLFWLPAIAPL  310

Query  1412  LSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVAL  1233
             +SV+LST +V+LT+A+ HGVKIVKH+K GLNP S H+L F+  H+ Q  KIG + A+VAL
Sbjct  311   ISVVLSTAIVFLTKADEHGVKIVKHIKRGLNPISAHELQFSGQHVGQAAKIGLVSAIVAL  370

Query  1232  TEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESA  1053
             TEAIAVG SFAS++GYHLDGNKEM+A+G  NIAGSLTSCYVA                  
Sbjct  371   TEAIAVGRSFASIRGYHLDGNKEMVAMGFMNIAGSLTSCYVA------------------  412

Query  1052  VSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLAC  873
                     TV +SL+LLT+LLYFTP+AILASIILSALPGLI++ EAY IWKV        
Sbjct  413   --------TVFLSLELLTRLLYFTPIAILASIILSALPGLIDIPEAYHIWKVT-------  457

Query  872   AGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQ  693
                                  +SFAKI+LNSI+P +E LG+LPGTD +F  I+QYPMA++
Sbjct  458   ---------------------ISFAKIILNSIRPSVEGLGKLPGTD-IFCDINQYPMAIK  495

Query  692   TPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMN  513
             TPG+ ++R  S LLCFANANF++ RI+  V E+    +E KE+S++R   ++ DMS +MN
Sbjct  496   TPGILIVRINSGLLCFANANFVRERIMKRVTEKD---EEGKENSKERTQAVILDMSTVMN  552

Query  512   VDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDA  336
             +DTS I +L+E+Y+K+ S  +   +ANPRWQVIHKL+LA   +KI K  +FL++GEA+DA
Sbjct  553   IDTSGICALQEVYNKLVSHNIHLAVANPRWQVIHKLKLAKVVDKIGKDWIFLSVGEAVDA  612

Query  335   C  333
             C
Sbjct  613   C  613



>ref|XP_010422881.1| PREDICTED: sulfate transporter 2.1-like, partial [Camelina sativa]
Length=517

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/516 (66%), Positives = 425/516 (82%), Gaps = 3/516 (1%)
 Frame = -1

Query  1877  MGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLG  1698
             MG+SREIAIGPVAV+SLLISSM+ KL DP  +P GY  LV+T TFFAGIFQA+FG+ RLG
Sbjct  1     MGTSREIAIGPVAVVSLLISSMLQKLIDPEVDPLGYKKLVITTTFFAGIFQASFGLFRLG  60

Query  1697  FLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNP  1518
             FLVDFLSHAAIVGFM GAAIVIGLQQLK L GI+NFT  TD+VSVL  ++ S     W+P
Sbjct  61    FLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGITNFTTNTDIVSVLRAVWRSCQQQ-WSP  119

Query  1517  YNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKH  1338
             +  I+G SFLSFILITRF+G+K++KLFWLPA+APL++V++ST++V+LT+A+ HGVK VKH
Sbjct  120   HTFILGCSFLSFILITRFIGKKNKKLFWLPAIAPLIAVVVSTVMVFLTKADEHGVKTVKH  179

Query  1337  VKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEML  1158
             +KGGLNP S+H L FNTPH+ Q+ KIG I+A++ALTEAIAVG SFA +KGY LDGNKEM+
Sbjct  180   IKGGLNPISIHDLDFNTPHLGQIAKIGLIIAIIALTEAIAVGRSFAGIKGYRLDGNKEMM  239

Query  1157  AIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTP  978
             AIG +N+ GS TSCY ATGSFSR+AVNF AGCE+A+SN+VM+VTV ++L+ LT+LLY+TP
Sbjct  240   AIGFSNVIGSFTSCYAATGSFSRTAVNFAAGCETAMSNIVMSVTVFVALECLTRLLYYTP  299

Query  977   VAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFA  798
             +AILASIILSALPGLI++NEA  IWKVDK DFLA  GAF GVLFASVEIGLLVAV +SFA
Sbjct  300   IAILASIILSALPGLIDINEAIHIWKVDKFDFLALIGAFVGVLFASVEIGLLVAVVISFA  359

Query  797   KIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR  618
             KI+L S++PG+E L R+PGTD +F   +QYPM V+TPGV + R KS+LLCFANA+ I+ R
Sbjct  360   KIILISVRPGVETLRRMPGTD-IFADTNQYPMTVKTPGVLIFRVKSALLCFANASSIEER  418

Query  617   ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVI  438
             I+  V  E++  +  K +++++I  +V DMSN++NVDTS I +L EL + +T  GV+ VI
Sbjct  419   IMGCV-NEEEEEENIKSNAKRKILFVVLDMSNLINVDTSGITALVELQNNLTQAGVELVI  477

Query  437   ANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACL  330
              NP+W+VIHKL  A F +KI GKV++TI EA+DAC 
Sbjct  478   VNPKWEVIHKLNQARFVSKIGGKVYMTIEEALDACF  513



>gb|AAN59770.1| Putative sulfate transporter [Oryza sativa Japonica Group]
Length=646

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/673 (52%), Positives = 461/673 (68%), Gaps = 73/673 (11%)
 Frame = -1

Query  2240  TSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAV--LSAS  2067
             + S++P     A  +L  PE P L   L G F+K   + G       KR   +V  +S  
Sbjct  6     SESSVPIGTAFADLLLQGPEHPSLWNDLTGMFRKAFRWQGA-----DKRFTLSVYVMSVL  60

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             + +FP+L W K Y+L   +SD++AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPL+
Sbjct  61    QGLFPILDWWKTYNLKFFRSDLMAGLTLASLSIPQSIGYATLAKLDPQYGLYTSVVPPLV  120

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAV GSSREIAIGPVA++SLL+SSM+ K+ DP+ +PA Y  +V TVTF  G+FQ AFG+ 
Sbjct  121   YAVTGSSREIAIGPVAIVSLLLSSMIQKIVDPSVDPAFYRKMVFTVTFLTGVFQFAFGLF  180

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFLVDFLSHAAIVGFM GAAIVIGLQQLK L G+S+FTN+TDVVSV   ++ S+H + 
Sbjct  181   RLGFLVDFLSHAAIVGFMGGAAIVIGLQQLKGLLGLSHFTNRTDVVSVTKAVWVSVHET-  239

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
                                   G+K++KLFW+ A+AP+LSV LSTL VY TRA+ HGVKI
Sbjct  240   ----------------------GRKYKKLFWVSAIAPVLSVALSTLFVYATRADKHGVKI  277

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             ++ V  G+N SS+ Q+     +  +  KI  + AV+ALTEA+AVG SF+++ GY LDGNK
Sbjct  278   IQKVNSGINASSVEQIDLKGGYAAECAKIALVCAVIALTEAVAVGRSFSAINGYRLDGNK  337

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NIAGSL+SCYVATGSFSR+AVNF AGC++ VSN++MA TV+++L+LLTKLLY
Sbjct  338   EMVAMGFMNIAGSLSSCYVATGSFSRTAVNFAAGCKTTVSNIIMAATVMVALELLTKLLY  397

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TPV+ILASIILSALPGLIN+ E   +WKVDK+DFL C G+F GVLF SVEIGL VA+ +
Sbjct  398   YTPVSILASIILSALPGLINVQEVCFLWKVDKMDFLTCMGSFLGVLFGSVEIGLSVALLV  457

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI++ SI P +E LGRL GT+ +F  + QYP+  +TP V  +R ++S LCF N++ I
Sbjct  458   SFAKIIIQSIWPQVEILGRLQGTE-IFCNVKQYPVVHETPTVLTVRIETSFLCFVNSSSI  516

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K +I+  V +E+++              +V DMSN++N+DTS +++L+EL+ ++   G+Q
Sbjct  517   KEKIMGWVTDEREA-----------FCSVVLDMSNVVNMDTSGLVALEELHKELACLGIQ  565

Query  446   ------------------------------FVIANPRWQVIHKLRLADFHNKI-KGKVFL  360
                                             IA P WQVIHK++LA   + I +G  FL
Sbjct  566   SLHCIFSSEKLADAVVKCSRPCPEKQPHLQMAIAKPGWQVIHKMKLARLVDGIGEGWFFL  625

Query  359   TIGEAIDACLVDK  321
             T+GEA++ACL +K
Sbjct  626   TVGEAVEACLANK  638



>ref|XP_004490362.1| PREDICTED: sulfate transporter 1.3-like isoform X1 [Cicer arietinum]
 ref|XP_004490363.1| PREDICTED: sulfate transporter 1.3-like isoform X2 [Cicer arietinum]
 ref|XP_004490364.1| PREDICTED: sulfate transporter 1.3-like isoform X3 [Cicer arietinum]
 ref|XP_004490365.1| PREDICTED: sulfate transporter 1.3-like isoform X4 [Cicer arietinum]
 ref|XP_004490366.1| PREDICTED: sulfate transporter 1.3-like isoform X5 [Cicer arietinum]
 ref|XP_004490367.1| PREDICTED: sulfate transporter 1.3-like isoform X6 [Cicer arietinum]
Length=658

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/644 (51%), Positives = 460/644 (71%), Gaps = 9/644 (1%)
 Frame = -1

Query  2255  QTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA--  2082
             +T +  S +L  +  +  +V  V  PP  +   E  +    TF      R  K   ++  
Sbjct  13    ETKEMDSRSLTSSQSQEPYVHKVGVPPKQNLFKEFQYTVKETFFSDDPLRPFKDQTKSRK  72

Query  2081  VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSV  1902
              +   E++FP+LSWG+ Y+L K + D++AGLT+ASLCIPQ IGY+ LANL PQYGLY+S 
Sbjct  73    FVLGIEAIFPILSWGRTYNLKKFRGDLIAGLTIASLCIPQDIGYSKLANLSPQYGLYSSF  132

Query  1901  VPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqa  1722
             VPPLIYA+MGSSR+IAIGPVAV+SLL+ +++    DP +NP  Y  L  T TFFAGI QA
Sbjct  133   VPPLIYALMGSSRDIAIGPVAVVSLLLGTLLQNEIDPNTNPTEYRRLAFTATFFAGITQA  192

Query  1721  afgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTS  1542
               G+ RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT KTD++SV++ +F+S
Sbjct  193   TLGVFRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIEKFTRKTDIISVMSSVFSS  252

Query  1541  LHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAEN  1362
              HH  WN   ++IG +FL+F+L  +++G+K +KLFW+PA+APL+SV+LSTL VY+TRA+ 
Sbjct  253   AHHG-WNWQTILIGSTFLAFLLFAKYIGKKSQKLFWVPAIAPLISVVLSTLFVYITRADK  311

Query  1361  HGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYH  1182
             HGV IVKH++ G+NPSS+ +++F   ++ + V+IG +  ++ALTEAIA+G +FASMK Y 
Sbjct  312   HGVAIVKHIEKGINPSSVKEIYFTGNYLGKGVRIGIVAGMIALTEAIAIGRTFASMKDYQ  371

Query  1181  LDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLL  1002
             LDGNKEM+A+G  N+ GS+TSCYVATGSFSRSAVNF AGCE+AVSN+VM+V VL++LQ +
Sbjct  372   LDGNKEMVALGAMNVVGSMTSCYVATGSFSRSAVNFMAGCETAVSNIVMSVVVLLTLQFI  431

Query  1001  TKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLL  822
             T L  +TP AILASII+ A+  L++   A  IWK+DK DF+AC GAF GV+FASVEIGLL
Sbjct  432   TPLFKYTPNAILASIIICAVINLVDYKAAILIWKIDKFDFVACMGAFFGVVFASVEIGLL  491

Query  821   VAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFA  642
             +AV +SFAKI+L   +P    LG++P T  ++  I QYP A + PGV +IR  S++  F+
Sbjct  492   IAVSISFAKILLQVTRPRTAILGKIPRT-TVYRNIQQYPEATRVPGVLIIRVDSAIY-FS  549

Query  641   NANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKIT  462
             N+N++K RIL  +M+E++  +   ++   RI  ++ +MS + ++DTS I +L+EL+  + 
Sbjct  550   NSNYVKERILRWLMDEEERVNRDYQT---RIQFLIVEMSPVTDIDTSGIHALEELFRSLQ  606

Query  461   SCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
                VQ V+ANP   VI KL  ++F N + + K+FLT+ EA+  C
Sbjct  607   KREVQLVLANPGPLVIDKLHTSNFANFLGEDKIFLTVAEAVSYC  650



>ref|XP_004502443.1| PREDICTED: sulfate transporter 2.1-like isoform X2 [Cicer arietinum]
Length=555

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/467 (70%), Positives = 387/467 (83%), Gaps = 2/467 (0%)
 Frame = -1

Query  2210  RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVL-SASESVFPLLSWGK  2034
             R+ WVLN P+PP   R +  S +K+ +           +    +L S  + VFP+  WG+
Sbjct  28    RSQWVLNAPDPPSPCRVVVDSMRKSFSNFREKISSFSDQSCGTLLLSGLQVVFPIFVWGR  87

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y++ K ++D LAGLT+ASLCIPQSIGYA LANL PQYGLYTSVVPPLIYAVMG+SREIA
Sbjct  88    NYTVAKFRNDFLAGLTIASLCIPQSIGYATLANLAPQYGLYTSVVPPLIYAVMGTSREIA  147

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSMV KL DP ++P GYT L+   T FAGIFQ AFG+ RLGFLVDFLSH
Sbjct  148   IGPVAVVSLLLSSMVQKLIDPFTDPIGYTKLIFLATLFAGIFQTAFGLFRLGFLVDFLSH  207

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             A+IVGF+AGAAIVIGLQQLK LFGI++FT KTD++SV+  ++ +LH+ PWNP N I+G S
Sbjct  208   ASIVGFVAGAAIVIGLQQLKGLFGITHFTTKTDIISVIKAVWEALHN-PWNPRNFILGGS  266

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL+FIL TRFLG++ +  FW  +++PL+SVILSTL+VYLTRA+ +GVKIVKHVKGGLNPS
Sbjct  267   FLAFILTTRFLGKRKKNFFWFASISPLVSVILSTLVVYLTRADKYGVKIVKHVKGGLNPS  326

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S+HQL FN PH+  V KIG IVAVVALTE+IAVG SFAS+KGY LDGNKEM++IG  NI 
Sbjct  327   SIHQLDFNNPHVADVAKIGLIVAVVALTESIAVGRSFASIKGYQLDGNKEMMSIGFTNII  386

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GSLTSCYVATGSFSR+AVN+ AGCES VSN+VMAVTVLISLQ LTKLLY+TP+AI+AS+I
Sbjct  387   GSLTSCYVATGSFSRTAVNYAAGCESLVSNIVMAVTVLISLQFLTKLLYYTPIAIIASVI  446

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LSALPGLI++NEAY IWKVDKLDFLACAGAF GVLFASVEIGLLVA+
Sbjct  447   LSALPGLIDINEAYKIWKVDKLDFLACAGAFFGVLFASVEIGLLVAI  493



>gb|KDO80893.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
Length=517

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/470 (70%), Positives = 392/470 (83%), Gaps = 4/470 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQ---RLRKRPVQAVLSASESVFPLLS  2043
             ERA W+LN P+PP +  +L GS ++ A F         R+++   ++  S    +FP+L+
Sbjct  28    ERARWLLNSPDPPSIWHELAGSIRE-AFFPRNKLSSSSRVKQTWRRSAFSFLRGLFPILN  86

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y   K KSD++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MGSSR
Sbjct  87    WGRNYKASKFKSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYALMGSSR  146

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+S+L+S+++  ++DPA++P  Y  LV TVTFFAG+FQ+ FG+ RLGFLVDF
Sbjct  147   EIAIGPVAVVSMLLSALMQNVQDPAADPVAYRKLVFTVTFFAGVFQSVFGLFRLGFLVDF  206

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDVVSVL  +F+SLHHS W P N ++
Sbjct  207   LSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVVSVLGSVFSSLHHSYWYPLNFVL  266

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYLT+A+ HGVKIVKH+KGGL
Sbjct  267   GCSFLIFLLIARFIGRRNKKLFWLPAIAPLLSVILSTLIVYLTKADKHGVKIVKHIKGGL  326

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS HQL    PH+ Q  KIG I AVVALTEAIAVG SFAS+KGYHLDGNKEM+A+G  
Sbjct  327   NPSSAHQLQLTGPHLGQTAKIGLISAVVALTEAIAVGRSFASIKGYHLDGNKEMVAMGFM  386

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NI GSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+TVL+SL+L T LLY+TP+AILA
Sbjct  387   NIVGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAITVLLSLELFTSLLYYTPIAILA  446

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             SIILSALPGLI++NEA +I+KVDKLDFLAC GAF GVLFASVEIGLL AV
Sbjct  447   SIILSALPGLIDINEAINIYKVDKLDFLACIGAFLGVLFASVEIGLLAAV  496



>ref|XP_002307394.1| high affinity sulfate transporter family protein [Populus trichocarpa]
 gb|EEE94390.1| high affinity sulfate transporter family protein [Populus trichocarpa]
Length=647

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/632 (52%), Positives = 460/632 (73%), Gaps = 12/632 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPP--GLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLS  2043
             + A +V  V  PP   L ++ + + K+T  F     +  + +P  +  +   +++FP+L 
Sbjct  14    QDAPYVHKVGLPPKQNLFKEFKATVKET-FFADDPLRSFKDQPRSKKFILGLQAIFPILE  72

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ YS  K + D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S VPPLIYA MGSSR
Sbjct  73    WGRSYSFAKFRGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLIYAFMGSSR  132

Query  1862  EIAIGPVAVISLLISSMV-PKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVD  1686
             +IAIGPVAV+SLL+ +++  ++ DP +N A Y  L  T TFFAGI Q   G LRLGFL+D
Sbjct  133   DIAIGPVAVVSLLLGTLLQSEIADPVANAAEYRRLAFTATFFAGITQVTLGFLRLGFLID  192

Query  1685  FLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNli  1506
             FLSHAAIVGFM GAAI I LQQLK   GI  FT KTD+VSV+  +F S HH  WN   ++
Sbjct  193   FLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKKTDIVSVMHSVFASAHHG-WNWQTIV  251

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             +G S LSF+L  +++G+K++KLFW+PA+APL+SVILST  VY+TRA+  GV+IVKH++ G
Sbjct  252   MGVSLLSFLLFAKYIGKKNKKLFWVPAIAPLISVILSTFFVYITRADKDGVQIVKHIEKG  311

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             +NPSS++Q++F+  H+ + V+IG + A++ALTEAIA+G +FA+MK Y LDGNKEM+A+G 
Sbjct  312   INPSSVNQIYFSGDHMLKGVRIGIVAAMIALTEAIAIGRTFAAMKDYQLDGNKEMVALGT  371

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              NI GS+TSCYVATGSFSRSAVNF +GC++AVSN+VM++ V ++LQ +T L  +TP A+L
Sbjct  372   MNIVGSMTSCYVATGSFSRSAVNFMSGCQTAVSNIVMSIVVFLTLQFITPLFKYTPSAVL  431

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ++II+SA+ GL++ + AY IWK+DK DF+AC GAF GV+F SVEIGLL+AV +SF K++L
Sbjct  432   SAIIISAVIGLVDYDAAYLIWKIDKFDFVACMGAFFGVVFVSVEIGLLIAVSISFFKLLL  491

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
                +P    LG+LP T A++  I QYP A + PGV ++R  S++  F+N+N+IK RIL  
Sbjct  492   QVTRPRTAILGKLPRT-AVYRNILQYPEATKVPGVLIVRVDSAIY-FSNSNYIKERILRW  549

Query  605   VMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPR  426
             +++E++  +   +S + +I  ++ +MS + ++DTS I +L+ELY  +    +Q ++ANP 
Sbjct  550   LIDEEELVN---KSGQPKIQFLIVEMSPVTDIDTSGIHALEELYRSLQKREIQLILANPG  606

Query  425   WQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
               VI KL  +DF   I + K+FLT+  A+ AC
Sbjct  607   PVVIDKLHASDFAQLIGEDKIFLTVANAVAAC  638



>gb|KDO80892.1| hypothetical protein CISIN_1g006030mg [Citrus sinensis]
Length=549

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/469 (70%), Positives = 391/469 (83%), Gaps = 4/469 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQ---RLRKRPVQAVLSASESVFPLLS  2043
             ERA W+LN P+PP +  +L GS ++ A F         R+++   ++  S    +FP+L+
Sbjct  28    ERARWLLNSPDPPSIWHELAGSIRE-AFFPRNKLSSSSRVKQTWRRSAFSFLRGLFPILN  86

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y   K KSD++AGLTLASL IPQSIGYA LA LDPQYGLYTSV+PPLIYA+MGSSR
Sbjct  87    WGRNYKASKFKSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVIPPLIYALMGSSR  146

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             EIAIGPVAV+S+L+S+++  ++DPA++P  Y  LV TVTFFAG+FQ+ FG+ RLGFLVDF
Sbjct  147   EIAIGPVAVVSMLLSALMQNVQDPAADPVAYRKLVFTVTFFAGVFQSVFGLFRLGFLVDF  206

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFMAGAAIVIGLQQLK L GIS+FTNKTDVVSVL  +F+SLHHS W P N ++
Sbjct  207   LSHAAIVGFMAGAAIVIGLQQLKGLLGISHFTNKTDVVSVLGSVFSSLHHSYWYPLNFVL  266

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL F+LI RF+G++++KLFWLPA+APLLSVILSTL+VYLT+A+ HGVKIVKH+KGGL
Sbjct  267   GCSFLIFLLIARFIGRRNKKLFWLPAIAPLLSVILSTLIVYLTKADKHGVKIVKHIKGGL  326

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS HQL    PH+ Q  KIG I AVVALTEAIAVG SFAS+KGYHLDGNKEM+A+G  
Sbjct  327   NPSSAHQLQLTGPHLGQTAKIGLISAVVALTEAIAVGRSFASIKGYHLDGNKEMVAMGFM  386

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             NI GSLTSCYVATGSFSR+AVNF AGC++ VSN+VMA+TVL+SL+L T LLY+TP+AILA
Sbjct  387   NIVGSLTSCYVATGSFSRTAVNFSAGCQTVVSNIVMAITVLLSLELFTSLLYYTPIAILA  446

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVA  816
             SIILSALPGLI++NEA +I+KVDKLDFLAC GAF GVLFASVEIGLL A
Sbjct  447   SIILSALPGLIDINEAINIYKVDKLDFLACIGAFLGVLFASVEIGLLAA  495



>ref|XP_003614968.1| Sulfate transporter [Medicago truncatula]
 gb|AES97926.1| high affinity sulfate transporter [Medicago truncatula]
Length=655

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/647 (51%), Positives = 458/647 (71%), Gaps = 9/647 (1%)
 Frame = -1

Query  2264  EFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQ  2085
             E  +T +  S +L  +  +  +   V  PP  +   E  +    TF      R  K   +
Sbjct  7     ENVETKEMDSRSLSSSQGQEPYAHKVGIPPKQNLFKEFQYTVKETFFSDDPLRSFKDQTK  66

Query  2084  A--VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLY  1911
             +  ++   E++FP+LSWG+ Y+L K + D++AGLT+ASLCIPQ IGY+ LANL PQYGLY
Sbjct  67    SRKLILGIEAIFPILSWGRTYTLQKFRGDLIAGLTIASLCIPQDIGYSKLANLAPQYGLY  126

Query  1910  TSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagi  1731
             +S VPPLIYAVMGSSR+IAIGPVAV+SLL+ +++    DP ++P  Y  L  T TFFAGI
Sbjct  127   SSFVPPLIYAVMGSSRDIAIGPVAVVSLLLGTLLQNEIDPNTHPTEYRRLAFTATFFAGI  186

Query  1730  fqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHI  1551
              QA  G+ RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT KTD++SV+  +
Sbjct  187   TQATLGVFRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIQKFTKKTDIISVMNSV  246

Query  1550  FTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTR  1371
             F+S HH  WN   ++IG +FL+F+L  +++G+K +K FW+PA+APL+SV+LSTL VY+TR
Sbjct  247   FSSAHHG-WNWQTILIGSTFLAFLLFAKYIGKKGQKFFWVPAIAPLISVVLSTLFVYITR  305

Query  1370  AENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMK  1191
             A+ HGV IVKH++ G+NPSS+ +++F   ++ + V+IG +  ++ALTEAIA+G +FASMK
Sbjct  306   ADKHGVAIVKHIEKGINPSSVKEIYFTGDYLAKGVRIGIVAGMIALTEAIAIGRTFASMK  365

Query  1190  GYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISL  1011
              Y LDGNKEM+A+G  N+ GS+TSCYVATGSFSRSAVNF AGCE+AVSN+VM+V V ++L
Sbjct  366   DYQLDGNKEMVALGAMNVVGSMTSCYVATGSFSRSAVNFMAGCETAVSNIVMSVVVFLTL  425

Query  1010  QLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEI  831
             Q +T L  +TP AILASII+ A+  L++   A  IWK+DK DF+AC GAF GV+FASVEI
Sbjct  426   QFITPLFKYTPNAILASIIICAVINLVDYKAAILIWKIDKFDFVACMGAFFGVVFASVEI  485

Query  830   GLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLL  651
             GLL+AV +SFAKI+L   +P    LG++P T  ++  I QYP A + PGV +IR  S++ 
Sbjct  486   GLLIAVSISFAKILLQVTRPRTAILGKIPRT-TVYRNIQQYPEATRVPGVLIIRVDSAIY  544

Query  650   CFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYD  471
              F+N+N++K RIL  +M+E++  +   ++   RI  ++ +MS + ++DTS I +L+ELY 
Sbjct  545   -FSNSNYVKERILRWLMDEEERVNRDYQT---RIQFLIVEMSPVTDIDTSGIHALEELYR  600

Query  470   KITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              +    VQ V+ANP   VI KL  ++F N + + K+FLT+ EA+  C
Sbjct  601   SLQKREVQLVLANPGPLVIDKLHTSNFANFLGEDKIFLTVAEAVAYC  647



>ref|XP_008356837.1| PREDICTED: sulfate transporter 2.1-like [Malus domestica]
Length=548

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/480 (69%), Positives = 397/480 (83%), Gaps = 6/480 (1%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLS  2073
             L+K SS +    ER  WVLN PEPPGL  +L  S ++T +     +  L+ +P +++ +S
Sbjct  70    LEKNSSLV----ERTQWVLNGPEPPGLWHELMDSLRETISCCRKKYSSLKNQPTLKSAVS  125

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               + +FP+L WG+ Y++ K K D++AGLT+ASLCIPQSIGYA LA LDPQYGLYTSVVPP
Sbjct  126   VQQEIFPILVWGRSYNMSKFKHDLMAGLTIASLCIPQSIGYATLAKLDPQYGLYTSVVPP  185

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYAVMG+SREIAIGPVAV+SLL+ SM+ KL+DP ++P  YT LVLT TFF GIFQAAFG
Sbjct  186   LIYAVMGTSREIAIGPVAVVSLLLPSMIQKLQDPEADPIAYTKLVLTATFFTGIFQAAFG  245

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             + RLGFLVDFLSHAAIVGF+AGAAI+IGLQQLK L GI++F   TDV+SV+  ++TS HH
Sbjct  246   LFRLGFLVDFLSHAAIVGFVAGAAIIIGLQQLKGLLGITHFPTNTDVISVIEAVWTSFHH  305

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
              PW+P+N  +G SFL FIL++RFLG+K +KLFWLPA+APLLSVILSTL+VYLTR + HG+
Sbjct  306   -PWSPHNFFLGCSFLCFILMSRFLGKKKKKLFWLPAVAPLLSVILSTLIVYLTRGDKHGI  364

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
              IVKHVK GLNPSS++ L FN+P++  V K+G IVA+VAL EAIAVG SF++MKGYH+DG
Sbjct  365   NIVKHVKDGLNPSSVNLLQFNSPYVGAVAKVGLIVALVALAEAIAVGRSFSTMKGYHIDG  424

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+A+G  N+ GS TSCYVATGSFSR+AVNF AGCE+ VSNVVMA TV+ISLQLLTKL
Sbjct  425   NKEMMAMGFMNVVGSCTSCYVATGSFSRTAVNFSAGCETPVSNVVMAFTVIISLQLLTKL  484

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP AILASIILSAL GLINL+E Y IWKVDKLDFLAC GAF GVLFAS+EIGLLVAV
Sbjct  485   LYYTPTAILASIILSALSGLINLSEVYKIWKVDKLDFLACIGAFFGVLFASMEIGLLVAV  544



>ref|XP_008364763.1| PREDICTED: sulfate transporter 2.1-like [Malus domestica]
Length=548

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/480 (69%), Positives = 397/480 (83%), Gaps = 6/480 (1%)
 Frame = -1

Query  2249  LQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLS  2073
             L+K SS +    ER  WVLN PEPPGL  +L  S ++T +     +  L+ +P +++ +S
Sbjct  70    LEKNSSLV----ERTQWVLNGPEPPGLWHELMDSLRETISCCRKKYSSLKNQPTLKSAVS  125

Query  2072  ASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPP  1893
               + +FP+L WG+ Y++ K K D++AGLT+ASLCIPQSIGYA LA LDPQYGLYTSVVPP
Sbjct  126   VQQEIFPILVWGRSYNMSKFKHDLMAGLTIASLCIPQSIGYATLAKLDPQYGLYTSVVPP  185

Query  1892  LIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafg  1713
             LIYAVMG+SREIAIGPVAV+SLL+ SM+ KL+DP ++P  YT LVLT TFF GIFQAAFG
Sbjct  186   LIYAVMGTSREIAIGPVAVVSLLLPSMIQKLQDPEADPIAYTKLVLTATFFTGIFQAAFG  245

Query  1712  ILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHH  1533
             + RLGFLVDFLSHAAIVGF+AGAAI+IGLQQLK L GI++F   TDV+SV+  ++TS HH
Sbjct  246   LFRLGFLVDFLSHAAIVGFVAGAAIIIGLQQLKGLLGITHFPTNTDVISVIEAVWTSFHH  305

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
              PW+P+N  +G SFL FIL++RFLG+K +KLFWLPA+APLLSVILSTL+VYLTR + HG+
Sbjct  306   -PWSPHNFFLGCSFLCFILMSRFLGKKKKKLFWLPAVAPLLSVILSTLIVYLTRGDKHGI  364

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
              IVKHVK GLNPSS++ L FN+P++  V K+G IVA+VAL EAIAVG SF++MKGYH+DG
Sbjct  365   NIVKHVKDGLNPSSVNLLQFNSPYVGAVAKVGLIVALVALAEAIAVGRSFSTMKGYHIDG  424

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+A+G  N+ GS TSCYVATGSFSR+AVNF AGCE+ VSNVVMA TV+ISLQLLTKL
Sbjct  425   NKEMMAMGFMNVVGSCTSCYVATGSFSRTAVNFSAGCETPVSNVVMAFTVIISLQLLTKL  484

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             LY+TP AILASIILSAL GLINL+E Y IWKVDKLDFLAC GAF GVLFAS+EIGLLVAV
Sbjct  485   LYYTPTAILASIILSALSGLINLSEVYKIWKVDKLDFLACIGAFFGVLFASMEIGLLVAV  544



>ref|XP_002465704.1| hypothetical protein SORBIDRAFT_01g044110 [Sorghum bicolor]
 gb|EER92702.1| hypothetical protein SORBIDRAFT_01g044110 [Sorghum bicolor]
Length=612

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/626 (57%), Positives = 453/626 (72%), Gaps = 30/626 (5%)
 Frame = -1

Query  2240  TSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSAS--  2067
             + S +P  A+ A  VL  PEPP L   L G  +KT       +Q   K    +V + S  
Sbjct  6     SKSYIPKRADFAELVLQGPEPPSLWYVLIGMLRKT-----VHYQSADKHFALSVCAMSIL  60

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
               +FP+L W K YSL   +SD++AGLTLASL IPQSIGYA LA LDPQYGLYTSVVPPL+
Sbjct  61    HGLFPILEWWKSYSLKSFRSDLMAGLTLASLSIPQSIGYANLAKLDPQYGLYTSVVPPLV  120

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAVMG+SREIAIGPVA++SLL+SSM  K+ DP  +PA Y   V TVT F GIFQ AFG+ 
Sbjct  121   YAVMGTSREIAIGPVAIVSLLLSSMAQKIADPVIDPAFYRKTVFTVTCFTGIFQFAFGLF  180

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFLVDFLSHAAI GFM GAAIVIGLQQLK L G+S+FT+ TDVVSV+  ++ S+H  P
Sbjct  181   RLGFLVDFLSHAAITGFMGGAAIVIGLQQLKGLLGLSHFTSSTDVVSVIRAVWVSVHE-P  239

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             W+P N  IG SF  FIL  RF+G+K++KLFW+ A+AP+LSV LSTL+VY+TRA+ HGVKI
Sbjct  240   WHPENFYIGCSFFLFILGMRFIGRKNKKLFWVSAIAPVLSVALSTLMVYMTRADKHGVKI  299

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             ++ V  G+N SS+ Q++FN  ++ +  KI  I AV+ALTEAIAVG SF+ + GY LDGNK
Sbjct  300   IQKVDAGINASSIKQINFNGSYVSECAKIALICAVIALTEAIAVGRSFSVINGYKLDGNK  359

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EMLA+G  N+AGS++SCYVATGSFSR+AVNF AGC++ +SNVVMAVTV+++L+LLTKLLY
Sbjct  360   EMLAMGFMNVAGSMSSCYVATGSFSRTAVNFTAGCKTTMSNVVMAVTVMVALELLTKLLY  419

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TPV+ILASIILSALPGLIN  E   +WKVDKLDFL C G+F GV+F SVEIGL VA+ +
Sbjct  420   YTPVSILASIILSALPGLINFQEVCILWKVDKLDFLTCMGSFLGVIFGSVEIGLSVAIVI  479

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+++S+ P +E LGRL GT+ +F  + QYPM  QTP V  IR  +S LCF N N I
Sbjct  480   SFAKIVVHSVWPQVEILGRLQGTN-IFCNMEQYPMVCQTPAVLAIRISTSFLCFINGNSI  538

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             + +I   V++++ +           I L+V DMSN++N+DT+ + +L+EL  ++ SCG+Q
Sbjct  539   REKITGWVIDKRDA-----------ICLVVLDMSNVVNIDTAGLAALEELRQELVSCGIQ  587

Query  446   FVIANPRWQVIHKLRLADFHNKIKGK  369
                       +H L LA      +G 
Sbjct  588   ----------VHALTLAHLSLHKRGN  603



>ref|XP_007018862.1| STAS domain / Sulfate transporter family isoform 2 [Theobroma 
cacao]
 gb|EOY16087.1| STAS domain / Sulfate transporter family isoform 2 [Theobroma 
cacao]
Length=537

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/495 (66%), Positives = 392/495 (79%), Gaps = 16/495 (3%)
 Frame = -1

Query  2273  LPYE-FSQTLQKTSSTLPPAA--ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRL  2103
             LP E FS   Q+    L  A   ER  W++N P+PP   ++L  + +      G+ F   
Sbjct  4     LPDETFSVEEQQQQLDLEDAGRTERKKWLINSPDPPSFWQELVSAIR------GSVFPHG  57

Query  2102  RKRPVQA------VLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAAL  1941
             RK    A       +S  + +FP+LSWG+ Y   K K D++AGLTLASL IPQSIGYA L
Sbjct  58    RKHSSSAGGRRATAMSFLQGLFPILSWGRTYKASKFKHDLMAGLTLASLSIPQSIGYANL  117

Query  1940  ANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSL  1761
             A +DPQYGLYTSVVPPLIYA+MGSSREIAIGPVAV+S+L+SSM+P L DPA++P GY  L
Sbjct  118   AKVDPQYGLYTSVVPPLIYALMGSSREIAIGPVAVVSMLLSSMIPNLVDPAADPNGYRRL  177

Query  1760  VLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNK  1581
             V TVTFFAG FQ  FG+ RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLK LFG+S+FT K
Sbjct  178   VFTVTFFAGTFQTIFGLFRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKGLFGMSHFTTK  237

Query  1580  TDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVI  1401
             TDV+SVL  +F S+ H  W P N ++G  FL F+L+ RF+G++++KLFW PA+APL+SVI
Sbjct  238   TDVISVLHSVFKSVQHE-WYPLNFVLGCLFLVFLLVARFIGRRNKKLFWFPAIAPLISVI  296

Query  1400  LSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAI  1221
             LSTL+VYLT+A+ HGVKIVKH+KGGLNPSSLHQL F  PH+ +  KIG I A+VALTEAI
Sbjct  297   LSTLIVYLTKADKHGVKIVKHIKGGLNPSSLHQLQFEGPHVAEAAKIGLITAIVALTEAI  356

Query  1220  AVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNV  1041
             AVG SFAS+KGYHLDGNKEM+A+G  N+AGSLTSCYVATGSFSR+AVNF AGC++ VSN+
Sbjct  357   AVGRSFASIKGYHLDGNKEMMAMGFMNLAGSLTSCYVATGSFSRTAVNFSAGCQTVVSNI  416

Query  1040  VMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAF  861
             VMA+TVL+SL+L T+LLY+TP+AILASIILSALPGLI+ NEA  IWKVDKLDFLAC GAF
Sbjct  417   VMAITVLLSLELFTRLLYYTPIAILASIILSALPGLIDFNEACYIWKVDKLDFLACIGAF  476

Query  860   AGVLFASVEIGLLVA  816
              GVLFASVEIGLL A
Sbjct  477   FGVLFASVEIGLLAA  491



>ref|XP_007141140.1| hypothetical protein PHAVU_008G170800g [Phaseolus vulgaris]
 gb|ESW13134.1| hypothetical protein PHAVU_008G170800g [Phaseolus vulgaris]
Length=658

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/579 (55%), Positives = 432/579 (75%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             E++FP+LSWG+ Y+L KL+ D++AGLT+ASLCIPQ IGYA LANLDP+YGLY+S +PPLI
Sbjct  78    EAIFPILSWGRTYNLTKLRGDLIAGLTIASLCIPQDIGYAKLANLDPEYGLYSSFIPPLI  137

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAVMGSSR+IAIGPVAV+SLL+ +++    DP +NP  Y  L  T TFFAGI QA  G+L
Sbjct  138   YAVMGSSRDIAIGPVAVVSLLLGTLLQSEIDPIANPVDYRRLAFTATFFAGITQATLGVL  197

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT KTDVVSV+  + +S HH  
Sbjct  198   RLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIQKFTKKTDVVSVMHSVLSSAHHG-  256

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG  F++F+L  +++G+K+ K FW+PA+APL+SV+LSTL VYLTRA+ HGV I
Sbjct  257   WNWQTIVIGAVFMAFLLSAKYIGKKNPKFFWVPAIAPLISVVLSTLFVYLTRADKHGVAI  316

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             VKH++ G+NPSS+ +++F   ++ +  +IG +  ++ALTEA A+G +FASMK Y LDGNK
Sbjct  317   VKHIERGINPSSVKEIYFTGDYLGKGFRIGIVAGMIALTEATAIGRTFASMKDYQLDGNK  376

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  N+ GS TSCYVATGSFSRSAVN+ AGCE+AVSN+VM+V V ++L+ LT L  
Sbjct  377   EMVALGAMNVVGSFTSCYVATGSFSRSAVNYMAGCETAVSNIVMSVVVFLTLEFLTPLFE  436

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILA+II+SA+  L++   A  IWK+DK DF+AC GAF GV+FASVEIGLL+AV +
Sbjct  437   YTPNAILATIIISAVINLVDYKAAILIWKIDKFDFVACMGAFFGVVFASVEIGLLIAVSI  496

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LG++P T  ++  I QYP A + PGV +IR  S++  F+N+N++
Sbjct  497   SFAKILLQVTRPRTAILGKIPRT-TVYRNIQQYPEATRVPGVLIIRVDSAIY-FSNSNYV  554

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K RIL  +M+E+   ++ K   + RI  ++ +MS + ++DTS I +L+EL+  +    VQ
Sbjct  555   KERILRWLMDEE---EQVKGDYQTRIQFLIVEMSPVTDIDTSGIHALEELFRSLQKRDVQ  611

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VI KL  ++F   + + K+FLT+ EA+  C
Sbjct  612   LVLANPGPIVIDKLHTSNFAALLGEDKIFLTVAEAVAYC  650



>ref|XP_006601860.1| PREDICTED: early nodulin-70 isoform X1 [Glycine max]
Length=668

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/639 (55%), Positives = 464/639 (73%), Gaps = 18/639 (3%)
 Frame = -1

Query  2201  WVLNVPEPPGLSRKLEGSFKKTATFLG----TAFQRLRKRPV-QAVLSASESVFPLLSWG  2037
             WVLN PEPP + R++  + K+T   L       F  LR +P  +   +  +++FP+L+  
Sbjct  32    WVLNAPEPPSMLRQVVDNVKET--LLPHPNPNTFSYLRNQPFSKRAFALLQNLFPILASL  89

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + Y+  KLK D++AGLTLA   IPQ +G A LA L P+YGLYT +VPPLIYA++ SSREI
Sbjct  90    QNYNAQKLKCDLMAGLTLAIFAIPQCMGNATLARLSPEYGLYTGIVPPLIYAMLASSREI  149

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
              IGP +V SLL+SSM+  L+ P  + + Y  LV TVTFFAGIFQ AFG+ R GFLV++LS
Sbjct  150   VIGPGSVDSLLLSSMIQTLKVPIHDSSTYIQLVFTVTFFAGIFQVAFGLFRFGFLVEYLS  209

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSL-HHSPWNPYNliig  1500
              A IVGF+A AA+ IGLQQLK LFGI NF NKTD+ SV+  ++TS  + S W+PYNLIIG
Sbjct  210   QATIVGFLAAAAVGIGLQQLKGLFGIDNFNNKTDLFSVVKSLWTSFKNQSAWHPYNLIIG  269

Query  1499  fsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLT-----RAENHGVKIVKHV  1335
             FSFL FIL TRFLG++++KL WL  +APLLSVI S+ + Y       + +++ V ++  +
Sbjct  270   FSFLCFILFTRFLGKRNKKLMWLSHVAPLLSVIGSSAIAYKINFNELQVKDYKVAVLGPI  329

Query  1334  KGG-LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEML  1158
             KGG LNPSSLHQL F++  +  +++IG  +A+++LT +IAVG SFAS+KG+ +D N+E++
Sbjct  330   KGGSLNPSSLHQLTFDSQVVGHLIRIGLTIAIISLTGSIAVGRSFASLKGHSIDPNREVV  389

Query  1157  AIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTP  978
             ++G+ NI GSLTSCY+A+GS SR+AVN+ AG E+ VS +VMA+TVL+SL+ LT LLYFTP
Sbjct  390   SLGIMNIVGSLTSCYIASGSLSRTAVNYNAGSETMVSIIVMALTVLMSLKFLTGLLYFTP  449

Query  977   VAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFA  798
              AILA+IILSA+PGLI+LN+A  IWKVDK+DFLAC GAF GVLFASVEIGL + + +SFA
Sbjct  450   KAILAAIILSAVPGLIDLNKAREIWKVDKMDFLACTGAFLGVLFASVEIGLAIGIAISFA  509

Query  797   KIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR  618
             KI++ SIQP I  +GRLPGT A F  + QYPMAV  PGV ++  KSS LCFANAN ++ R
Sbjct  510   KIIITSIQPAIAVIGRLPGTAA-FGDVEQYPMAVNIPGVLIVSLKSSWLCFANANLVEER  568

Query  617   ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVI  438
             I   V    K+ D   +  E     ++ D S++ N+DT  I SL EL   + S GV+  I
Sbjct  569   IERWV-NNAKAKD--GKGGENTFIHVIIDASSLTNIDTVGIASLVELNKNLISSGVKLAI  625

Query  437   ANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
             ANPRW VIHKLRLA+F +KI G+VFL++GEA+DAC+  K
Sbjct  626   ANPRWHVIHKLRLANFVSKIGGRVFLSVGEAVDACVGTK  664



>ref|XP_011015979.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015980.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015981.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015982.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015983.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
Length=659

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/658 (50%), Positives = 469/658 (71%), Gaps = 13/658 (2%)
 Frame = -1

Query  2291  MTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPP--GLSRKLEGSFKKTATFLGT  2118
             M++ +    E+   ++  SS+     + A +V  V  PP   L ++ + + K+T  F   
Sbjct  1     MSSAVHSTEEYDMDIRSLSSS-HRHPQDAPYVHKVGLPPKQNLFKEFKATVKET-FFADD  58

Query  2117  AFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAAL  1941
               +  + +P  +  +   +++FP+L WG+ YS  K + D++AGLT+ASLCIPQ IGYA L
Sbjct  59    PLRSFKDQPRSKKFILGLQAIFPILEWGRSYSFAKFRGDLIAGLTIASLCIPQDIGYAKL  118

Query  1940  ANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMV-PKLEDPASNPAGYTS  1764
             ANLDPQYGLY+S VPPLIYA MGSSR+IAIGPVAV+SLL+ +++  ++ DP +N A Y  
Sbjct  119   ANLDPQYGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGTLLQSEIADPVANAAEYRR  178

Query  1763  LVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTN  1584
             L  T TFFAGI Q   G LRLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT 
Sbjct  179   LAFTATFFAGITQVTLGFLRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTK  238

Query  1583  KTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSV  1404
             KTD+VSV+  +F S HH  WN   +++G S LSF+L  +++G+K++KLFW+PA+ PL+SV
Sbjct  239   KTDIVSVMHSVFASAHHG-WNWQTIVMGVSLLSFLLFAKYIGKKNKKLFWVPAIGPLISV  297

Query  1403  ILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEA  1224
             ILST  V++TR +  GV+IVKH++ G+NPSS++Q++F+  ++ + V+IG + A++ALTEA
Sbjct  298   ILSTFFVFITRVDKDGVEIVKHIEKGINPSSVNQIYFSGDNLLKGVRIGIVAAMIALTEA  357

Query  1223  IAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSN  1044
             IA+G +FA+MK Y LDGNKEM+A+G  NI GS+TSCYVATGSFSRSAVNF +GC++AVSN
Sbjct  358   IAIGRTFAAMKDYQLDGNKEMVALGTMNIVGSMTSCYVATGSFSRSAVNFMSGCQTAVSN  417

Query  1043  VVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGA  864
             +VM++ V ++LQ +T L  +TP A+L++II+SA+ GL++ + AY IWK+DK DF+AC GA
Sbjct  418   IVMSIVVFLTLQFITPLFKYTPNAVLSAIIISAVIGLVDFDAAYLIWKIDKFDFVACMGA  477

Query  863   FAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPG  684
             F GV+FASVEIGLL+AV +SF K++L   +P    LG LP T A++  I QYP A + PG
Sbjct  478   FFGVVFASVEIGLLIAVSISFFKLLLQVTRPRTAILGNLPRT-AVYRNILQYPEATKVPG  536

Query  683   VFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDT  504
             V ++R  S++  F+N+N+IK RIL  +++E++  +   +S + +I  ++ +MS + ++DT
Sbjct  537   VLIVRVDSAIY-FSNSNYIKERILRWLIDEEELVN---KSGQPKIQFLIVEMSPVTDIDT  592

Query  503   SAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             S I +L+ELY  +    +Q ++ANP   VI KL  +DF   I + K+FLT+  A+ AC
Sbjct  593   SGIHALEELYRSLQKREIQLILANPGPVVIDKLHASDFAQLIGEDKIFLTVANAVAAC  650



>gb|ABK35751.2| sulfate transporter [Populus tremula x Populus alba]
Length=646

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/632 (51%), Positives = 458/632 (72%), Gaps = 12/632 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPP--GLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLS  2043
             + A +V  V  PP   L ++ + + K+T  F     +  + +P  +  +   +++FP+L 
Sbjct  14    QDAPYVHKVGLPPKQNLFKEFKDTVKET-FFADDPLRSFKDQPRSKKFILGLQAIFPILE  72

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ YS  K + D++AG T+ASLCIPQ IGYA LANLDPQYGLYTS VPPLIYA MGSSR
Sbjct  73    WGRSYSFAKFRGDLIAGQTIASLCIPQDIGYAKLANLDPQYGLYTSFVPPLIYAFMGSSR  132

Query  1862  EIAIGPVAVISLLISSMV-PKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVD  1686
             +IAIGPVAV+ LL+ +++  ++ DP +N A Y  L  T TFFAGI Q   G LRLGFL+D
Sbjct  133   DIAIGPVAVVPLLLGTLLQSEIADPVANAAEYRRLAFTATFFAGITQVTLGFLRLGFLID  192

Query  1685  FLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNli  1506
             FLSHAAIVGFM GAAI I LQQLK   GI  FT KTD+VSV+  +F S  H  WN   ++
Sbjct  193   FLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKKTDIVSVMHSVFASARHG-WNWQTIV  251

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG S LSF+L  +++G+K+++LFW+PA+ PL+SVILST  V++TRA+  GV+IVKH++ G
Sbjct  252   IGVSLLSFLLFAKYIGKKNKRLFWVPAIGPLISVILSTFFVFITRADKDGVQIVKHMEKG  311

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             +NPSS++Q++F+  H+ + V+IG + A++ALTEAIA+G +FA+MK Y LDGNKEM+A+G 
Sbjct  312   INPSSVNQIYFSGDHLLKGVRIGIVAAMIALTEAIAIGRTFAAMKDYQLDGNKEMVALGT  371

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              NI GS+TSCYVATGSFSRSAVNF +GC++AVSN+VM++ V ++LQ +T L  +TP A+L
Sbjct  372   MNIVGSMTSCYVATGSFSRSAVNFMSGCQTAVSNIVMSIVVFLTLQFITPLFKYTPNAVL  431

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ++II+SA+ GL++ + AY IWK+DK DF+AC GAF GV+FASVEIGLL+AV +SF K++L
Sbjct  432   SAIIISAVIGLVDFDAAYLIWKIDKFDFVACMGAFFGVVFASVEIGLLIAVSISFFKLLL  491

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
                +P    LG+LP T A++  I QYP A + PGV ++R  S++  F+N+N+IK RIL  
Sbjct  492   QVTRPRTAILGKLPRT-AVYRNILQYPEATKVPGVLIVRVDSAIY-FSNSNYIKERILRW  549

Query  605   VMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPR  426
             +++E++  +   +SS+ +I  +V +MS + ++DTS I +L+ELY  +    +Q ++ANP 
Sbjct  550   LIDEEELVN---KSSQPKIQFLVVEMSPVTDIDTSGIHALEELYRSLQKREIQLILANPG  606

Query  425   WQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
               VI KL  +DF   I + K+FLT+  A+ AC
Sbjct  607   PVVIDKLHASDFAQLIGEDKIFLTVANAVAAC  638



>ref|XP_011006147.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011006149.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011006150.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
Length=659

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/658 (50%), Positives = 468/658 (71%), Gaps = 13/658 (2%)
 Frame = -1

Query  2291  MTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPP--GLSRKLEGSFKKTATFLGT  2118
             M++ +    E+   ++  SS+     + A +V  V  PP   L ++ + + K+T  F   
Sbjct  1     MSSAVHSTEEYDMDIRSLSSS-HRHPQDAPYVHKVGLPPKQNLFKEFKATVKET-FFADD  58

Query  2117  AFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAAL  1941
               +  + +P  +  +   +++FP+L WG+ YS  K + D++AGLT+ASLCIPQ IGYA L
Sbjct  59    PLRSFKDQPRSKKFILGLQAIFPILEWGRSYSFAKFRGDLIAGLTIASLCIPQDIGYAKL  118

Query  1940  ANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMV-PKLEDPASNPAGYTS  1764
             ANLDPQYGLY+S VPPLIYA MGSSR+IAIGPVAV+SLL+ +++  ++ DP +N A Y  
Sbjct  119   ANLDPQYGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGTLLQSEIADPVANAAEYRR  178

Query  1763  LVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTN  1584
             L  T TFFAGI Q   G LRLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT 
Sbjct  179   LAFTATFFAGITQVTLGFLRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTK  238

Query  1583  KTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSV  1404
             KTD+VSV+  +F S HH  WN   +++G S LSF+L  +++G+K++KLFW+PA+ PL+SV
Sbjct  239   KTDIVSVMHSVFASAHHG-WNWQTIVMGVSLLSFLLFAKYIGKKNKKLFWVPAIGPLISV  297

Query  1403  ILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEA  1224
             ILST  V++TR +  GV+IVKH++ G+NPSS++Q++F+  ++ + V+IG + A++ALTEA
Sbjct  298   ILSTFFVFITRVDKDGVEIVKHIEKGINPSSVNQIYFSGDNLLKGVRIGIVAAMIALTEA  357

Query  1223  IAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSN  1044
             IA+G +FA+MK Y LDGNKEM+A+G  NI GS+TSCYVATGSFSRSAVNF +GC++AVSN
Sbjct  358   IAIGRTFAAMKDYQLDGNKEMVALGTMNIVGSMTSCYVATGSFSRSAVNFMSGCQTAVSN  417

Query  1043  VVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGA  864
             +VM++ V ++LQ +T L  +TP A+L++II+SA+ GL++ + AY IWK+DK DF+AC GA
Sbjct  418   IVMSIVVFLTLQFITPLFKYTPNAVLSAIIISAVIGLVDFDAAYLIWKIDKFDFVACMGA  477

Query  863   FAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPG  684
             F GV+F SVEIGLL+AV +SF K++L   +P    LG LP T A++  I QYP A + PG
Sbjct  478   FFGVVFVSVEIGLLIAVSISFFKLLLQVTRPRTAILGNLPRT-AVYRNILQYPEATKVPG  536

Query  683   VFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDT  504
             V ++R  S++  F+N+N+IK RIL  +++E++  +   +S + +I  ++ +MS + ++DT
Sbjct  537   VLIVRVDSAIY-FSNSNYIKERILRWLIDEEELVN---KSGQPKIQFLIVEMSPVTDIDT  592

Query  503   SAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             S I +L+ELY  +    +Q ++ANP   VI KL  +DF   I + K+FLT+  A+ AC
Sbjct  593   SGIHALEELYRSLQKREIQLILANPGPVVIDKLHASDFAQLIGEDKIFLTVANAVAAC  650



>gb|KDO47029.1| hypothetical protein CISIN_1g010524mg [Citrus sinensis]
Length=508

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/467 (69%), Positives = 382/467 (82%), Gaps = 2/467 (0%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGK  2034
             ERA WVLN P+PPG  ++L  S ++T       F+         V +    +FP+L W +
Sbjct  26    ERAQWVLNAPKPPGFWQELVNSVRETFFPHRRKFKN-EHDGFNLVFTFLHGLFPILHWCR  84

Query  2033  QYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIA  1854
              Y   K ++D++AGLTLASLCIPQSIGYA LA LDPQYGLYTSVVPPLIYAVMG+SREIA
Sbjct  85    NYKASKFRNDLMAGLTLASLCIPQSIGYATLAKLDPQYGLYTSVVPPLIYAVMGTSREIA  144

Query  1853  IGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             IGPVAV+SLL+SSM+ K++DP +NP  Y + VLT TFFAGIFQA+FG+ RLGFL+D LSH
Sbjct  145   IGPVAVVSLLLSSMIQKVQDPLANPIAYRNFVLTATFFAGIFQASFGLFRLGFLIDILSH  204

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             AA+VGFMAGAAIVIGLQQLK L GI +FTNKTD +SV+  ++ SLHH+ W+P N I+G S
Sbjct  205   AAVVGFMAGAAIVIGLQQLKGLIGIPHFTNKTDAISVVKAVWNSLHHT-WSPQNFILGCS  263

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL FIL TR+LG+K RKLFWLPA+APL+SVILSTL V+LTRA+ HGVKIVKH+  GLNPS
Sbjct  264   FLCFILTTRYLGRKKRKLFWLPAIAPLVSVILSTLFVFLTRADKHGVKIVKHIDRGLNPS  323

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S+HQ+ F+  H+ +V KIGF+ A+VAL EAIAVG SFAS+KGY LDGNKEM+A+G  NI 
Sbjct  324   SVHQIQFHGQHVGEVAKIGFVAAIVALAEAIAVGRSFASIKGYRLDGNKEMVAMGFMNIV  383

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GS TSCYVATGSFSRSAVNF AGCES VSN+VMA+TVLISL+  T+LLY+TP+AILASII
Sbjct  384   GSFTSCYVATGSFSRSAVNFRAGCESTVSNIVMAITVLISLEFFTRLLYYTPMAILASII  443

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             +SALPGLI+ NE Y+IWKVDKLDFLAC GAF GVLFASVEIGLLVAV
Sbjct  444   MSALPGLIDFNEFYNIWKVDKLDFLACIGAFFGVLFASVEIGLLVAV  490



>gb|EPS63999.1| hypothetical protein M569_10782, partial [Genlisea aurea]
Length=631

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/579 (55%), Positives = 431/579 (74%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+L WG+ Y+L KLK DV+AGLT+A+LCIPQ IGYA LANL PQYGLY+S VPPLI
Sbjct  51    QAVFPILDWGRSYTLTKLKGDVIAGLTIATLCIPQDIGYAKLANLAPQYGLYSSFVPPLI  110

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA MGSSR+IAIGPVAV+SLL+ +++    DP +N   YT L  T TFFAGI QAA GIL
Sbjct  111   YAFMGSSRDIAIGPVAVVSLLLGTLLRSEVDPINNAVEYTRLAFTATFFAGITQAALGIL  170

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAA+VGFM GAAI I LQQLK   GI NFT KTD++SV+  + +S HH  
Sbjct  171   RLGFLIDFLSHAAVVGFMGGAAITIALQQLKGFLGIKNFTKKTDIISVMHSVLSSAHHG-  229

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG +FL F+L+ ++ G+K RKLFW+PA+APL+SVIL+TL VY+TRA+  GV+I
Sbjct  230   WNWQTIVIGATFLVFLLVAKYAGKKKRKLFWVPAIAPLVSVILATLFVYITRADKSGVQI  289

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             VKH++ G+NPSSL ++HF   ++ +  +IG +  +VALTEA+A+G +FASMK Y +DGN+
Sbjct  290   VKHIERGINPSSLKEIHFTGRYLWKGFRIGLVAGMVALTEAVAIGRTFASMKDYQIDGNR  349

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NIAGS TSCYV TGSFSRSAVN+ AGCE+A+SN+VM+  V ++L  +T L +
Sbjct  350   EMIALGTMNIAGSFTSCYVTTGSFSRSAVNYMAGCETAISNIVMSFVVFVTLLFITPLFH  409

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AIL+SII+SA+ GLI+ N A  IWK+DK DF AC GAF GV+FASVEIGLL+AV +
Sbjct  410   YTPNAILSSIIISAVMGLIDYNAAILIWKIDKFDFFACMGAFFGVIFASVEIGLLIAVSI  469

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAK++L   +P    LGR+P TD ++  + QYP A + PGV +IR  S++  F+N+N+I
Sbjct  470   SFAKLLLQVTRPRTAVLGRIPLTD-VYRNMQQYPEASKIPGVLIIRVDSAIY-FSNSNYI  527

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K RIL  + +E    +  K+S  + I  ++ +MS + ++DTS I +L+EL+  +    V+
Sbjct  528   KERILRWLTDED---ENLKDSGRQSIQFLIVEMSPVTDIDTSGIHALEELHRSLQKRDVK  584

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VIHKL  A F + I    +FL++ +A+  C
Sbjct  585   LVLANPGPVVIHKLHAAKFTSLIGDDMIFLSVADAVRTC  623



>ref|XP_008780888.1| PREDICTED: sulfate transporter 1.2-like [Phoenix dactylifera]
 ref|XP_008780889.1| PREDICTED: sulfate transporter 1.2-like [Phoenix dactylifera]
Length=658

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/620 (52%), Positives = 445/620 (72%), Gaps = 9/620 (1%)
 Frame = -1

Query  2186  PEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLVKLK  2010
             P      R+ + + K+T  F     +R + +P  + ++   + +FP+L WG+ Y+  KLK
Sbjct  38    PPQRNFFREFKDTLKET-LFADDPLRRYKDQPRSRKLILGLQFLFPILEWGRDYNFSKLK  96

Query  2009  SDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVIS  1830
              D++AGLT+ASLCIPQ I YA LAN+DPQYGLY S VPPLIYAVMGSSR+IAIGPVAV+S
Sbjct  97    GDLIAGLTIASLCIPQDIAYAKLANMDPQYGLYCSFVPPLIYAVMGSSRDIAIGPVAVVS  156

Query  1829  LLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMA  1650
             LL+ +++    DP +  A Y  L  T TFFAGI QAA G LRLGFL++FLSHAAIVGFM 
Sbjct  157   LLLGTLIQNEVDPVTEKAEYIRLAFTATFFAGITQAALGFLRLGFLIEFLSHAAIVGFMG  216

Query  1649  GAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilIT  1470
             GAAI I LQQLK   GI NFT  +D++SV+  + +S HH  WN   ++IG +FL+F+L  
Sbjct  217   GAAITIALQQLKGFLGIRNFTKNSDIISVMKSVRSSAHHG-WNWQTILIGSTFLAFLLFA  275

Query  1469  RFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFN  1290
             +++G+K + LFW+PA+APL+SVILSTL V +T AENHGV+IV+H+  G+NPSS++++HF 
Sbjct  276   KYIGKKKKSLFWVPAIAPLISVILSTLFVDITHAENHGVQIVRHIDKGINPSSVNKIHFT  335

Query  1289  TPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYV  1110
               +  +  +IG + A+VALTEA+A+G +FA+MK Y LDGNKEM+A+G  N+ GS+TSCYV
Sbjct  336   GSYAAKGFRIGLVAAMVALTEAVAIGRTFAAMKEYQLDGNKEMVALGTMNVIGSMTSCYV  395

Query  1109  ATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLI  930
             ATGSFSRSAVN+ AGC++AVSN++M+  VL++L+L+T L  +TP AILASII+SA+ GLI
Sbjct  396   ATGSFSRSAVNYMAGCQTAVSNMIMSAVVLLTLELITPLFKYTPNAILASIIISAVIGLI  455

Query  929   NLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGR  750
             +   AY IWKVDKLDF+AC GAF GV+F SVEIGLLVAV +S AKI+L   +P    LG 
Sbjct  456   DYEAAYLIWKVDKLDFVACMGAFFGVVFVSVEIGLLVAVSISLAKILLQVTRPRTALLGN  515

Query  749   LPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETK  570
             LP T  ++  I QYP A + PGV ++R  S++  F N+N++K RIL  + +E+   ++ K
Sbjct  516   LPST-MIYRNIEQYPEATKVPGVLIVRVDSAIY-FTNSNYVKERILRWLRDEE---EQLK  570

Query  569   ESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADF  390
                  +I  ++ +MS + ++DTS I + +EL+  +    +Q V+ANP   VI KLRLA+F
Sbjct  571   AKQLPKIEFLIVEMSPVTDIDTSGIHAFEELHKSLQKRSIQLVLANPGPVVIDKLRLAEF  630

Query  389   HNKI-KGKVFLTIGEAIDAC  333
                I   K+FLT+GEA+  C
Sbjct  631   TELIGHDKIFLTVGEAVMTC  650



>ref|XP_003543770.2| PREDICTED: sulfate transporter 1.3-like isoform X1 [Glycine max]
 ref|XP_006593569.1| PREDICTED: sulfate transporter 1.3-like isoform X2 [Glycine max]
 ref|XP_006593570.1| PREDICTED: sulfate transporter 1.3-like isoform X3 [Glycine max]
 ref|XP_006593571.1| PREDICTED: sulfate transporter 1.3-like isoform X4 [Glycine max]
 gb|KHN26071.1| Sulfate transporter 1.3 [Glycine soja]
Length=658

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/579 (55%), Positives = 432/579 (75%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             E++FP++SWG+ Y+L K + D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S +PPLI
Sbjct  78    EAIFPIVSWGRTYNLTKFRGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFIPPLI  137

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAVMGSSR+IAIGPVAV+SLL+ +++    DP +NP  Y  L  T TFFAGI QA  G+L
Sbjct  138   YAVMGSSRDIAIGPVAVVSLLLGTLLQSEIDPIANPVDYRRLAFTATFFAGITQATLGVL  197

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI+ F+ KTDV+SV+  + +S HH  
Sbjct  198   RLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIAKFSKKTDVISVMHSVLSSAHHG-  256

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG SFL F+L  +++G+K+ K FW+PA+APL+SV+LSTL V+LTRA+ HGV I
Sbjct  257   WNWQTIVIGASFLGFLLFAKYIGKKNPKFFWVPAIAPLVSVVLSTLFVFLTRADKHGVAI  316

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             VKH++ GLNPSS+ +++F   ++ +  +IG +  ++ALTEA A+G +FASMK Y LDGNK
Sbjct  317   VKHLEKGLNPSSVKEIYFTGDYLGKGFRIGIVAGMIALTEATAIGRTFASMKDYQLDGNK  376

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  N+ GS+TSCYVATGSFSRSAVNF AGCE+AVSN+VM+V V ++LQ LT L  
Sbjct  377   EMVALGAMNVVGSMTSCYVATGSFSRSAVNFMAGCETAVSNIVMSVVVFLTLQFLTPLFK  436

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILA+II+SA+  L++   A  IWK+DK DF+AC GAF GV+FASVEIGLL+AV +
Sbjct  437   YTPNAILATIIISAVINLVDYKAAILIWKIDKFDFVACMGAFFGVVFASVEIGLLIAVSI  496

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LG++P T  ++  I QYP A + PGV +IR  S++  F+N+N++
Sbjct  497   SFAKILLQVTRPRTAILGKIPRT-TVYRNIQQYPEATRVPGVLIIRVDSAIY-FSNSNYV  554

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K RIL  +++E+   +  K   + RI  ++ +MS + ++DTS I +L+EL+  +    VQ
Sbjct  555   KERILRWLVDEE---ELVKGDYQTRIQFLMVEMSPVTDIDTSGIHTLEELFRSLQKRNVQ  611

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VI KL  ++F   + + K+FLT+ EA+  C
Sbjct  612   LVLANPGPIVIDKLHTSNFAALLGEDKIFLTVAEAVAYC  650



>gb|KHN41502.1| Sulfate transporter 1.3 [Glycine soja]
Length=658

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/579 (55%), Positives = 429/579 (74%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             E++FP++ WG+ Y+L KL+ D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S +PPLI
Sbjct  78    EAIFPIIGWGRTYNLTKLRGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFIPPLI  137

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAVMGSSR+IAIGPVAV+SLL+ +++    DP +NP  Y  L  T TFFAGI QA  GIL
Sbjct  138   YAVMGSSRDIAIGPVAVVSLLLGTLLQSEIDPIANPVDYRRLAFTATFFAGITQATLGIL  197

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT KTDV+SV+  + +S HH  
Sbjct  198   RLGFLIDFLSHAAIVGFMGGAAITITLQQLKGFLGIEKFTKKTDVISVIHSVLSSAHHG-  256

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG SFL+F+L  +++G+K+ K FW+PA+APL+SVILSTL V+L RA+ HGV I
Sbjct  257   WNWQTIVIGASFLAFLLYAKYIGKKNPKFFWVPAIAPLISVILSTLFVFLIRADKHGVAI  316

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             VKH+  GLNPSS+ +++F   ++ +  +IG +  ++ALTEA A+G +FASMK Y LDGNK
Sbjct  317   VKHIDKGLNPSSVKEIYFTGDYLGKGFRIGIVAGMIALTEATAIGRTFASMKDYQLDGNK  376

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  N+ GS+TSCYVATGSFSRSAVNF +GCE+AVSN+VM+V V ++LQ LT L  
Sbjct  377   EMVALGAMNVVGSMTSCYVATGSFSRSAVNFMSGCETAVSNIVMSVVVFLTLQFLTPLFK  436

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP  ILA+II+SA+  L++   A  IWK+DK DF+AC GAF GV+FASVEIGLL+AV +
Sbjct  437   YTPNVILATIIISAVINLVDYKAAILIWKIDKFDFVACMGAFFGVVFASVEIGLLIAVSI  496

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LG++P T  ++  I QYP A + PGV +IR  S++  F+N+N++
Sbjct  497   SFAKILLQVTRPRTAILGKIPRT-TVYRNIQQYPEATRVPGVLIIRVDSAIY-FSNSNYV  554

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K RIL  +M+E+   +  K   + RI  ++ +MS + ++DTS I +L+EL+  +    VQ
Sbjct  555   KERILRWLMDEE---ELVKGDYQTRIQFLMVEMSPVTDIDTSGIHALEELFRSLQKRDVQ  611

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VI KL  ++F   + + K+FLT+ EA+  C
Sbjct  612   LVLANPGPIVIDKLHTSNFATLLGEDKIFLTVAEAVAYC  650



>ref|XP_011092411.1| PREDICTED: sulfate transporter 1.3-like [Sesamum indicum]
 ref|XP_011092412.1| PREDICTED: sulfate transporter 1.3-like [Sesamum indicum]
Length=651

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/628 (51%), Positives = 451/628 (72%), Gaps = 12/628 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPP--GLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLS  2043
             E A +V  V  PP   L ++    FK+T  F     +  + +P  + +L   ++VFP+L 
Sbjct  23    ENAPYVHKVGVPPKQSLFKEFTYMFKET-FFHDDPLRPFKDQPRSRKLLLGIQAVFPILD  81

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG++Y L   K D++AGLT+ASLCIPQ IGYA LANLDPQ+GLY+S VPPLIYA+MGSSR
Sbjct  82    WGRRYKLHMFKGDLIAGLTIASLCIPQDIGYAKLANLDPQFGLYSSFVPPLIYAIMGSSR  141

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             +IAIGPVAV+SLL+ S+V    DP   P  Y  L+ T TFFAG+ Q   G  RLGFL+DF
Sbjct  142   DIAIGPVAVVSLLLGSLVQNEIDPKHKPE-YQRLMFTATFFAGVTQFVLGFFRLGFLIDF  200

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAA+VGFMAGAAI I LQQLK L G+  FT KTD+VSV+  ++T++HH  WN   ++I
Sbjct  201   LSHAAVVGFMAGAAITISLQQLKGLLGVKKFTKKTDIVSVMRSVWTNVHHG-WNWETVVI  259

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G SFL+F+L+ +++G+K+RKLFW+PA+APL+SVI+ST  V++T A+  GV+IV H++ G+
Sbjct  260   GVSFLAFLLLAKYIGKKNRKLFWVPAIAPLISVIISTFFVFITHADKKGVQIVNHIERGI  319

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NP S+H++HF   ++    +IG I  ++ LTEA+A+G +FA+MK YHLDGNKEM+A+G  
Sbjct  320   NPPSVHKIHFTGSYVGIGFRIGAIAGMIGLTEAVAIGRTFAAMKDYHLDGNKEMVALGTM  379

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             N+ GS+TSCYVATGSFSRSAVN+ AGC +AVSN+VM++ VL++L+L+T L  +TP  ILA
Sbjct  380   NVIGSMTSCYVATGSFSRSAVNYMAGCNTAVSNIVMSIVVLLTLELITPLFKYTPNTILA  439

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SII+SA+ GL +      IWK+DK DF+AC GAF GV+FASVEIGLL+AV +SFAKI+L 
Sbjct  440   SIIISAVVGLFDYEAMILIWKIDKFDFVACMGAFFGVVFASVEIGLLIAVAISFAKILLQ  499

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
               +P    LG++P T  ++  I QYP A + PGV ++R  S++  F+N+N+I+ RIL L+
Sbjct  500   VTRPRTAVLGKIPRT-TVYRNIQQYPEATKVPGVLIVRVDSAIY-FSNSNYIRERILRLL  557

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              +E+   +E K +   RI  ++ +MS + ++DTS I +L++LY  +    VQ V+ANP  
Sbjct  558   ADEE---EEQKANERPRIQYLIVEMSPVTDIDTSGIHALEDLYKNLQKRDVQLVLANPGQ  614

Query  422   QVIHKLRLADFHNKI-KGKVFLTIGEAI  342
              V+ KL  +DF N +   K+FLT+ +A+
Sbjct  615   IVLDKLHTSDFANTVGDDKIFLTVADAV  642



>gb|ACL53345.1| unknown [Zea mays]
 tpg|DAA43991.1| TPA: hypothetical protein ZEAMMB73_140973 [Zea mays]
Length=523

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/517 (60%), Positives = 407/517 (79%), Gaps = 5/517 (1%)
 Frame = -1

Query  1877  MGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLG  1698
             MG+SREIAIGPVAV+SLL+SSM+ K+ DPA++PA Y SLV TVTF AG+FQ +FG+ RLG
Sbjct  1     MGTSREIAIGPVAVVSLLLSSMIQKVVDPAADPATYRSLVFTVTFLAGVFQVSFGLFRLG  60

Query  1697  FLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNP  1518
             FLVDFLSHAAIVGFM GAAIVIG+QQLK L G+++FTN TDVVSVL  + ++L H PW+P
Sbjct  61    FLVDFLSHAAIVGFMGGAAIVIGMQQLKGLLGLAHFTNSTDVVSVLKAVCSALRHDPWHP  120

Query  1517  YNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKH  1338
              N +IG SFL FIL TRF+G++++KLFWL A++PLLSVILST  VY TRA+ HGVKI++ 
Sbjct  121   GNFLIGCSFLIFILTTRFIGRRYKKLFWLSAISPLLSVILSTAAVYATRADRHGVKIIQK  180

Query  1337  VKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEML  1158
             V  GLNPSS+ Q+H N PH  +  KI  I AV+ALTEAIAVG SFAS++GY LDGNKEML
Sbjct  181   VHAGLNPSSVKQIHLNGPHTTECAKIAVICAVIALTEAIAVGRSFASVRGYRLDGNKEML  240

Query  1157  AIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTP  978
             A+G +N+AGSL+SCYVATGSFSR+AVNF AG  S VSN+VM++TV ++L+L  KLLY+TP
Sbjct  241   AMGFSNVAGSLSSCYVATGSFSRTAVNFSAGARSTVSNIVMSITVFVTLELFMKLLYYTP  300

Query  977   VAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFA  798
             +A+LASIILSALPGLI++ EA SIWK+DK+DFL C GAF GVLF SVEIGL VA+G+SFA
Sbjct  301   MAVLASIILSALPGLIDIKEACSIWKIDKMDFLTCLGAFVGVLFGSVEIGLAVALGISFA  360

Query  797   KIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKAR  618
             KI++ S++P +E LGRL GTD +F  + QYP+A  TP V  IR  +S LCF NA  +K R
Sbjct  361   KIIIQSLRPQVEILGRLQGTD-IFCSVRQYPVACLTPTVLPIRVDTSFLCFINATSVKER  419

Query  617   ILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVI  438
             I   V E     + +   + +RI  +V DMS+++N+DTS + +L+E++ ++ S G+Q  I
Sbjct  420   ITEWVWE---GVETSNGKARERIQAVVLDMSSVVNIDTSGLTALEEIHKELVSLGLQMAI  476

Query  437   ANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
             A+P W+ + K++++   +++ +  +F+T+GEA++ACL
Sbjct  477   ASPGWKAVQKMKVSQVVDRVGQDWIFMTVGEAVEACL  513



>gb|KDP32700.1| hypothetical protein JCGZ_11992 [Jatropha curcas]
Length=636

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/629 (52%), Positives = 455/629 (72%), Gaps = 9/629 (1%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWG  2037
             E+ +  + VP    L ++L+ + K+T  F     +  + +P  +  +   +++FP+L WG
Sbjct  6     EQYTHKVGVPPKQNLFKELKATVKET-LFADDPLRPFKDQPRSKKFILGIQTIFPILEWG  64

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             + YSL K + DV+AGLT+ASLCIPQ IGY+ LANLDPQYGLY+S VPPLIYA MGSSR+I
Sbjct  65    RSYSLRKFRGDVIAGLTIASLCIPQDIGYSKLANLDPQYGLYSSFVPPLIYAFMGSSRDI  124

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+ +++    DP  +   Y  L  T TFFAGI QA  G  RLGFL+DFLS
Sbjct  125   AIGPVAVVSLLLGTLLQNELDPKKDKEAYRRLAFTATFFAGITQATLGFFRLGFLIDFLS  184

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAA+VGFM GAAI I LQQLK L GI NFT KTD+VSV+  +F S+HH  WN   ++IG 
Sbjct  185   HAAVVGFMGGAAITIALQQLKGLLGIQNFTKKTDIVSVMHSVFGSVHHG-WNWQTIVIGV  243

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFL+F+L  +++G+K+R+ FW+PA+APL+SVILST  VY+T A+  GV+IVKH++ G+NP
Sbjct  244   SFLAFLLSAKYIGKKNRRFFWVPAIAPLISVILSTFFVYITHADRKGVQIVKHIEKGINP  303

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             SS+ +++F+  ++ + ++IG +  ++ALTEA+A+G +FASMK Y +DGNKEM+A+G  NI
Sbjct  304   SSVKEIYFSGQYLLKGLRIGVVAGMIALTEAVAIGRTFASMKDYQIDGNKEMVALGTMNI  363

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS+TSCYVATGSFSRSAVN+ AGC++AVSN++M+  V ++L  +T L  +TP AILA+I
Sbjct  364   VGSMTSCYVATGSFSRSAVNYMAGCQTAVSNIIMSFVVFLTLLFITPLFKYTPNAILAAI  423

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             I+SA+ GLI+   A  IWK+DK DF+AC GAF GV+F SVEIGLL+AV +SFAKI+L   
Sbjct  424   IISAVVGLIDFEAAILIWKIDKFDFIACMGAFFGVVFVSVEIGLLIAVSISFAKILLQVT  483

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +P    LG+LPGT  ++  I QYP A + PGV V+R  S++  F+N+N+IK RIL  + +
Sbjct  484   RPRTAILGKLPGT-TVYRNIQQYPGATKVPGVLVVRVDSAIY-FSNSNYIKERILRWLAD  541

Query  596   EQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQV  417
             E+   ++ KES +     ++ +MS + ++DTS I +L+ELY  +   GVQ ++ANP   V
Sbjct  542   EE---EQLKESYQSNFEFLIVEMSPVTDIDTSGIHALEELYKSLQKRGVQLILANPGPVV  598

Query  416   IHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             I KL  +DF N I + K+FLT+ +A+ +C
Sbjct  599   IGKLHASDFANTIGEDKIFLTVADAVASC  627



>ref|XP_011098138.1| PREDICTED: sulfate transporter 1.2-like [Sesamum indicum]
 ref|XP_011098147.1| PREDICTED: sulfate transporter 1.2-like [Sesamum indicum]
 ref|XP_011098155.1| PREDICTED: sulfate transporter 1.2-like [Sesamum indicum]
Length=641

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/626 (52%), Positives = 449/626 (72%), Gaps = 11/626 (2%)
 Frame = -1

Query  2201  WVLNVPEPPGLSRKLEGSFKKTATFLGTAFQR-LRKRPV-QAVLSASESVFPLLSWGKQY  2028
             + + VP      ++   S K+T  FL     R  + +PV +  +   ++VFP+L WG+ Y
Sbjct  16    YKVGVPPKQKFWKEFTTSLKET--FLSDDPLRPFKDQPVPRKFILGVQAVFPILEWGRNY  73

Query  2027  SLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIG  1848
             +L K K D++AGLT+ASLCIPQ IGYA LANL PQYGLY+S VPPL+YA+MGSSR+IAIG
Sbjct  74    NLSKFKGDLIAGLTIASLCIPQDIGYAKLANLAPQYGLYSSFVPPLVYALMGSSRDIAIG  133

Query  1847  PVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAA  1668
             PVAV+SLL+ +++    DP  NP  Y  L  T TFFAGI QAA GILRLGFL+DFLSHAA
Sbjct  134   PVAVVSLLLGTLLRDEIDPVKNPVEYRRLAFTATFFAGITQAALGILRLGFLIDFLSHAA  193

Query  1667  IVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsfl  1488
             IVGFM GAAI I LQQLK   GI  FT  TD++SVL  +F+S HH  WN   ++IG +FL
Sbjct  194   IVGFMGGAAITIALQQLKGFLGIKKFTKNTDIISVLQSVFSSAHHG-WNWLTILIGAAFL  252

Query  1487  sfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSL  1308
              F+L  +++G+++RK FW+PA+APL+SVILST LVY+T A+  GV IVKH++ G+N  S+
Sbjct  253   VFLLAAKYIGKRNRKFFWVPAIAPLISVILSTFLVYITHADKRGVDIVKHIEKGINHPSV  312

Query  1307  HQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGS  1128
               ++F   ++ + V+IG +  +VALTEA+A+G +FA+MK Y +DGNKEM+A+G  NIAGS
Sbjct  313   KDIYFTGDYLLKGVRIGIVAGMVALTEAVAIGRTFAAMKDYQIDGNKEMIALGAMNIAGS  372

Query  1127  LTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILS  948
             LTSCYVATGSFSRSAVNF AGC++AVSN+VM++ VL++L  +T L  +TP AIL+SII+S
Sbjct  373   LTSCYVATGSFSRSAVNFMAGCQTAVSNIVMSIVVLLTLLFITPLFEYTPNAILSSIIIS  432

Query  947   ALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPG  768
             A+ GLI+ + A  IWK+DK DF+AC GAF GV+F SVEIGLL+AV +SFAK++L   +P 
Sbjct  433   AVIGLIDFDAAILIWKIDKFDFVACIGAFFGVVFVSVEIGLLIAVSISFAKLLLQVTRPR  492

Query  767   IEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQK  588
                LG++P T+ ++  I QYP A + PGV +IR  S++  F+N+N+I+ R+L  + +E  
Sbjct  493   TALLGKIPRTN-VYRNIQQYPEATKVPGVLIIRVDSAIY-FSNSNYIRERLLRWLTDED-  549

Query  587   SADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHK  408
               ++ K     RI  +V +MS + ++DTS I +L+EL+  +    VQ ++ANP   V+HK
Sbjct  550   --EKLKSGGLPRIQFLVVEMSPVTDIDTSGIHALEELFKSLEKRHVQLILANPGPVVMHK  607

Query  407   LRLADFHNKI-KGKVFLTIGEAIDAC  333
             L  + F N I + K+FLT+ EAI+ C
Sbjct  608   LHASKFANLIGEDKIFLTVAEAIETC  633



>ref|XP_003602001.1| Sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
 gb|AES72252.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=660

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/643 (53%), Positives = 469/643 (73%), Gaps = 20/643 (3%)
 Frame = -1

Query  2219  AAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLS  2043
             +  R  WVLN PEPPG+  ++  +       L   F  L+ +P  + V    + VFP+L+
Sbjct  24    SENRILWVLNPPEPPGMLHRIIENIN-----LRNRFFSLKHQPSTKLVFPLLQCVFPILN  78

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
               K Y++ K K DVLAGL LA   IPQ++G A+LA + P+YG YTS+VPPLIYA++ +SR
Sbjct  79    SFKNYNVQKFKCDVLAGLVLAIFAIPQAMGNASLAKMSPEYGFYTSIVPPLIYALLATSR  138

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             E+ IGP  V SLL+SSM+  L+DP ++   YT LVLT TFF G+FQ AFG LR GFL+D+
Sbjct  139   EVVIGPSTVDSLLLSSMIQTLKDPINDSIAYTHLVLTATFFTGVFQVAFGFLRFGFLLDY  198

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSL-HHSPWNPYNli  1506
             LSHA ++GF+A  AI I LQQLK LFGI+NFTNK D++SV+  ++TS  ++S W+P+N I
Sbjct  199   LSHATVLGFLAAVAIGIVLQQLKDLFGIANFTNKADLISVINSLWTSYKNNSEWHPFNFI  258

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLT-----RAENHGVKIVK  1341
             IGFSFLSFI+ TRFLG++ +KL WL  +APLLS I+ST + Y       + E++ ++++ 
Sbjct  259   IGFSFLSFIIFTRFLGRRKKKLLWLSHIAPLLSFIISTFIAYKVNVHQPKLEDYKIEVLG  318

Query  1340  HVKGG-LNPSSLHQLHF--NTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGN  1170
              +KGG LNPSSL+QL    N  ++  ++KI   VA+++ T+++AVG  +AS++GY++D N
Sbjct  319   PIKGGSLNPSSLNQLQLDGNGKYLGPLIKIALTVAIISTTQSVAVGRLYASLRGYNIDPN  378

Query  1169  KEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLL  990
             +E+L++G+ NI GS TSCYVA+GS +R+AVN+ AG ++ VS++VMA+TVL+SL+ LT+LL
Sbjct  379   REVLSLGIINIFGSFTSCYVASGSIARTAVNYNAGSQTMVSSIVMALTVLVSLKFLTELL  438

Query  989   YFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVG  810
             YFTP A+LA+IILSA+PGLI+  +AY IWKVDK+DFLACAGAF GVLF+SVE+GL + V 
Sbjct  439   YFTPKAMLAAIILSAVPGLIDFKKAYEIWKVDKIDFLACAGAFFGVLFSSVEMGLAIGVM  498

Query  809   LSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANF  630
             +SFAKI++ SIQPGI  +GRLPGTDA F  + QYPMA+  PGV V+  KS+ LCFANA+ 
Sbjct  499   VSFAKIIVISIQPGIAVVGRLPGTDA-FGDVEQYPMAINMPGVLVVSIKSAWLCFANASP  557

Query  629   IKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGV  450
             I+ RI   V+ ++  A+  K   E  I +++ D S ++++DT+ I SL EL   +   GV
Sbjct  558   IRDRIEKWVIIDE--AENGK--GESIIKVVIIDTSCLVSIDTAGIASLVELNKNLILHGV  613

Query  449   QFVIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
                IANPRWQVIHKLRLA+F ++I G+VFL++GEAIDA L  K
Sbjct  614   TLSIANPRWQVIHKLRLANFVSEIGGRVFLSVGEAIDAILSAK  656



>ref|XP_010926258.1| PREDICTED: sulfate transporter 1.2-like [Elaeis guineensis]
 ref|XP_010926259.1| PREDICTED: sulfate transporter 1.2-like [Elaeis guineensis]
 ref|XP_010926260.1| PREDICTED: sulfate transporter 1.2-like [Elaeis guineensis]
 ref|XP_010926261.1| PREDICTED: sulfate transporter 1.2-like [Elaeis guineensis]
Length=658

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/577 (55%), Positives = 427/577 (74%), Gaps = 7/577 (1%)
 Frame = -1

Query  2060  VFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYA  1881
             +FP+L WG+ Y+  KLK D++AGLT+ASLCIPQ IGYA LAN+DPQYGLY+S VPPLIY+
Sbjct  80    LFPILEWGRNYNFSKLKGDLVAGLTIASLCIPQDIGYAKLANMDPQYGLYSSFVPPLIYS  139

Query  1880  VMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRL  1701
             VMGSSR+IAIGPVAV+SLL+ +++    DP +    Y  L  T TFFAGI QAA G LRL
Sbjct  140   VMGSSRDIAIGPVAVVSLLLGTLLQNEVDPGTQKEEYIRLAFTATFFAGITQAALGFLRL  199

Query  1700  GFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWN  1521
             GFL++FLSHAAIVGFM GAAI I LQQLK   GI NFT  +D++SV+  ++ S+HH  WN
Sbjct  200   GFLIEFLSHAAIVGFMGGAAITIALQQLKGFLGIRNFTKNSDIISVMKSVWGSVHHG-WN  258

Query  1520  PYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVK  1341
                ++IG +FL+F+L+T+++G+K + LFW+ A+APL+SVILST  VY+T AE HGV+IVK
Sbjct  259   WETILIGSAFLAFLLLTKYIGKKRKSLFWVAAIAPLISVILSTFFVYITHAEKHGVQIVK  318

Query  1340  HVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEM  1161
             H+  G+NPSS++++HF   +  +  KIG + A+VALTEA+A+G +FA+MK Y LDGNKEM
Sbjct  319   HIDKGINPSSVNKIHFTGSYAAKGFKIGLVAAMVALTEAVAIGRTFAAMKDYQLDGNKEM  378

Query  1160  LAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFT  981
             +A+G  NI GS+TSCYVATGSFSRSAVN+ AGC++ VSN++M+  VL++L+L+T L  +T
Sbjct  379   VALGTMNIIGSMTSCYVATGSFSRSAVNYMAGCQTTVSNMIMSAVVLLTLELITPLFKYT  438

Query  980   PVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSF  801
             P AILASII+SA+ GLI+   AY IWKVDKLDF+AC GAF GV+F SVEIGLL+AV +S 
Sbjct  439   PNAILASIIISAVIGLIDYEAAYLIWKVDKLDFVACMGAFFGVVFISVEIGLLIAVSISL  498

Query  800   AKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKA  621
             AKI+L   +P    LG LP T  ++  I QYP A   PGV ++R  S++  F N+N++K 
Sbjct  499   AKILLQVTRPRTALLGNLPRT-TVYRNIEQYPEATNVPGVLIVRVDSAIY-FTNSNYVKE  556

Query  620   RILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFV  441
             RIL  + +E+   ++ K +   RI  ++ +MS + ++DTS I + +ELY  +    VQ V
Sbjct  557   RILRWLRDEE---EQLKANQLPRIDFLIVEMSPVTDIDTSGIHAFEELYKSLQKRSVQLV  613

Query  440   IANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             +ANP   VI KLRLA F   + +  +FLT+GEA+  C
Sbjct  614   LANPGPVVIDKLRLAKFTELLGQDNIFLTVGEAVMTC  650



>ref|XP_010657602.1| PREDICTED: sulfate transporter 1.3-like [Vitis vinifera]
 emb|CBI20050.3| unnamed protein product [Vitis vinifera]
Length=639

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/621 (52%), Positives = 450/621 (72%), Gaps = 11/621 (2%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV--QAVLSASESVFPLLSWGKQYSL  2022
             + VP    L ++   + K+T  F     +  + +P   Q VL   +S+FP+L WG+ Y+L
Sbjct  17    VGVPPKQDLLKEFTDTVKET-FFADDPLRPFKDQPRSRQFVLGL-QSLFPILEWGRDYNL  74

Query  2021  VKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPV  1842
              KL+ D++AG T+ASLCIPQ IGYA LANL PQYGLY+S VPPLIYA MGSSR+IAIGPV
Sbjct  75    TKLRGDLIAGFTIASLCIPQDIGYAKLANLAPQYGLYSSFVPPLIYAFMGSSRDIAIGPV  134

Query  1841  AVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIV  1662
             AV+SLLI +M+  + DP  N   Y  L  T TFFAGI QA  G  RLGFL+DFLSHAAIV
Sbjct  135   AVVSLLIGTMLQDVIDPTENEVEYRRLAFTATFFAGITQATLGFFRLGFLIDFLSHAAIV  194

Query  1661  GFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsf  1482
             GFMAGAAI I LQQLK L GI  FT KTD++SV+  +++++HH  WN   ++IG SFL+F
Sbjct  195   GFMAGAAITIALQQLKGLLGIKKFTRKTDIISVMHSVWSTVHHG-WNWETIVIGLSFLAF  253

Query  1481  ilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQ  1302
             +L+ +++G+K++KLFW+PA+APL+SVILST  VY+T AE HGV+IV H++ G+NP SLH+
Sbjct  254   LLLAKYIGKKNKKLFWVPAIAPLISVILSTFFVYITHAEKHGVQIVPHIRKGVNPPSLHE  313

Query  1301  LHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLT  1122
             ++F   ++ +  KIG +V ++ALTEAIA+G +FA+MKGY LDGNKEM+A+G  NI GS+T
Sbjct  314   IYFTGGYVIKGFKIGVVVGLIALTEAIAIGRTFAAMKGYQLDGNKEMVALGTMNIVGSMT  373

Query  1121  SCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSAL  942
             SCYVATGSFSRSAVN  AGC +AVSN+VM+  VL++L+++T L  +TP AIL+SII+SA+
Sbjct  374   SCYVATGSFSRSAVNNMAGCRTAVSNIVMSCIVLLTLEVITPLFKYTPNAILSSIIISAV  433

Query  941   PGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIE  762
               LI++     IWK+DK DF+AC GA  GV+FASVEIGLL+A+ +SF KI+L   +P   
Sbjct  434   LSLIDIQAIVLIWKIDKFDFVACMGALFGVVFASVEIGLLIAISISFIKILLQVTRPRTT  493

Query  761   KLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSA  582
              LG+LP T+ ++  I+QYP A + PG+ ++R  S++  F+N+N++K RIL  + +E+   
Sbjct  494   ILGKLPRTN-IYRNIYQYPEAAKVPGILIVRVDSAIY-FSNSNYVKERILRWLTDEE---  548

Query  581   DETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLR  402
             ++ KE+   RI  ++ +MS +  +DTS I +L+ELY  +    VQ  +ANP   VI KL 
Sbjct  549   EQLKENQLPRIQSLIVEMSPVTEIDTSGIHALEELYKNLQKREVQLNLANPGQVVIDKLH  608

Query  401   LADFHNKI-KGKVFLTIGEAI  342
              ++F N I + K+FL++ +A+
Sbjct  609   ASNFANLIGQDKIFLSVADAV  629



>ref|XP_010261215.1| PREDICTED: sulfate transporter 1.3-like [Nelumbo nucifera]
 ref|XP_010261216.1| PREDICTED: sulfate transporter 1.3-like [Nelumbo nucifera]
 ref|XP_010261217.1| PREDICTED: sulfate transporter 1.3-like [Nelumbo nucifera]
 ref|XP_010261218.1| PREDICTED: sulfate transporter 1.3-like [Nelumbo nucifera]
 ref|XP_010261219.1| PREDICTED: sulfate transporter 1.3-like [Nelumbo nucifera]
Length=659

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/579 (54%), Positives = 432/579 (75%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+L WG+ YSL KLK D++AGLT+ASLCIPQ IGY+ LANL PQYGLY+S VPPL+
Sbjct  78    QAVFPILEWGRNYSLTKLKGDIIAGLTIASLCIPQDIGYSNLANLSPQYGLYSSFVPPLV  137

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA MGSSR+IAIGPVAV+SLL+ +++    DP  +   Y  L  T TFFAGI QAA G L
Sbjct  138   YAFMGSSRDIAIGPVAVVSLLLGTLLQDEIDPVKHAEEYRRLAFTATFFAGITQAALGFL  197

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI NFT K D+VSV+  +  S HH  
Sbjct  198   RLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIQNFTKKADIVSVMHSVVGSAHHG-  256

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG  FLSF+L ++++G+K++KLFW+PA+APL+SV+LST  VY+TRA+  GV+I
Sbjct  257   WNWQTVLIGAVFLSFLLFSKYIGKKNKKLFWVPAIAPLISVVLSTFFVYITRADKKGVQI  316

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V+H++ G+NPSS+H+++F+  ++ +  KIG +  ++ALTEAIA+G +FASMK Y +DGNK
Sbjct  317   VRHIEKGINPSSVHEIYFSGHYVLKGFKIGVVAGMIALTEAIAIGRTFASMKDYQIDGNK  376

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC++AVSN+VM+  VL++L+L+T L  
Sbjct  377   EMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCQTAVSNIVMSCVVLLTLELITPLFK  436

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AIL+SII+SA+ GLI+   A  IWK+DK DF+AC GAF GV+F SVEIGLL+AV +
Sbjct  437   YTPNAILSSIIISAVIGLIDYEAALLIWKIDKFDFIACMGAFFGVVFVSVEIGLLIAVSI  496

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SF+KI+L   +P    LG++PGT  ++  + QY  A + PG  ++R  S++  F+N+N++
Sbjct  497   SFSKILLQVTRPRTAVLGKIPGT-TVYRNVAQYLDATKVPGTLIVRVDSAIY-FSNSNYV  554

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K RIL  + +E+   ++ K     RI  ++ DMS ++++DTS I +L+EL+  +    VQ
Sbjct  555   KERILRWLTDEE---EQLKIKDIARIQFLIVDMSPVIDIDTSGIHALEELHRSLQKRDVQ  611

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VI KL  ++F N + + K+FLT+ +AI  C
Sbjct  612   LVLANPGQVVIDKLHASNFANLVGEDKIFLTVADAILTC  650



>ref|XP_007018858.1| Sulfate transporter 1,3 isoform 2 [Theobroma cacao]
 ref|XP_007018859.1| Sulfate transporter 1,3 isoform 2 [Theobroma cacao]
 gb|EOY16083.1| Sulfate transporter 1,3 isoform 2 [Theobroma cacao]
 gb|EOY16084.1| Sulfate transporter 1,3 isoform 2 [Theobroma cacao]
Length=661

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/623 (51%), Positives = 453/623 (73%), Gaps = 9/623 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + VP    L R+   + K+T  F     +  + +P  +  +   +++FP+L W + YS  
Sbjct  38    VGVPPKQNLFREFTATVKET-FFHDDPLRPFKDQPRSRKFILGIQAIFPILEWARGYSWR  96

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K + D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S+VPPLIYA MGSSR+IAIGPVA
Sbjct  97    KFRGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSLVPPLIYAFMGSSRDIAIGPVA  156

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ +M+    DP  N A Y  L  T TFFAGI QA  G LRLGFL+DFLSHAAIVG
Sbjct  157   VVSLLLGTMLSSEIDPIKNKAEYRRLAFTATFFAGITQATLGFLRLGFLIDFLSHAAIVG  216

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FMAGAA+ I LQQLK L GI +FT K+D++SV+  ++ ++HH  WN   ++IG SFLSF+
Sbjct  217   FMAGAAVTIALQQLKGLLGIKDFTKKSDIISVMNSVWGNVHHG-WNWQTILIGVSFLSFL  275

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L  +++G+ +RKLFW+PA+APL+SVILST  VY+T AE  GV+IVK ++ G+NPSS+ Q+
Sbjct  276   LFAKYIGKTNRKLFWVPAIAPLISVILSTFFVYITHAEKKGVQIVKQIEKGINPSSVDQI  335

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             +F+  ++ + +KIG +  ++ALTEA+A+G +FAS K Y ++GNKEM+A+G  N+ GS+TS
Sbjct  336   YFSGDYLLKGLKIGVVAGMIALTEAVAIGRTFASKKDYQINGNKEMVALGAMNVVGSMTS  395

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSRSAVN+ AGCE+AVSN++M+  V ++L+ +T L  +TP AILASII+SA+ 
Sbjct  396   CYVATGSFSRSAVNYMAGCETAVSNIIMSCVVFLTLEFITPLFKYTPNAILASIIISAVI  455

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI++  A  IWK+DK DF+AC GAF GV+F+SVEIGLL+AV +SFAKI+L   +P    
Sbjct  456   GLIDVPAAILIWKIDKFDFVACLGAFLGVVFSSVEIGLLIAVTISFAKILLQVTRPRTAI  515

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG+LP T +++  I QYP A + PG+ ++R  S++  F+N+N++K RIL  +M+E+   +
Sbjct  516   LGKLPRT-SVYRNIQQYPEAAKVPGLLIVRVDSAIY-FSNSNYVKERILRWLMDEE---E  570

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
               K + +  I  ++ +MS + ++DTS I +L+EL+  +   GVQ ++ANP   VI KL  
Sbjct  571   LVKAACQPTIQFLIVEMSPVTDIDTSGIHALEELHRSLGKKGVQLILANPGPTVIDKLHA  630

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             +DF N I + ++FLT+ +A+ +C
Sbjct  631   SDFANLIAEDRIFLTVSDAVSSC  653



>ref|XP_010269183.1| PREDICTED: sulfate transporter 1.2-like [Nelumbo nucifera]
Length=658

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/620 (51%), Positives = 448/620 (72%), Gaps = 10/620 (2%)
 Frame = -1

Query  2186  PEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLVKLK  2010
             P P  + ++ + + K+T  F     +  + +P  +  +   +S+FP+L WG+ YSL K K
Sbjct  37    PSPNNVLKEFKDAVKET-FFPDNPLRPFKDQPRSKKFILGLQSIFPILEWGRNYSLSKFK  95

Query  2009  SDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVIS  1830
              D++AGLT+ASLCIPQ IGYA LANLDPQYGLYTS VPPLIYA+MGSSR+IAIGPVAV+S
Sbjct  96    GDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYTSFVPPLIYAIMGSSRDIAIGPVAVVS  155

Query  1829  LLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMA  1650
             LL+ SM+    DP  N   Y  L  T TFFAGI +AA G LRLGFL++FLSHAAIVGFM 
Sbjct  156   LLLGSMLQDEIDP-KNVVEYRRLAFTATFFAGITEAALGFLRLGFLIEFLSHAAIVGFMG  214

Query  1649  GAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilIT  1470
             GAAI I LQQLK   GI  FT KTD+VSV+  +F S HH  WN   ++IG +FL F+L T
Sbjct  215   GAAITIALQQLKGFLGIQKFTKKTDIVSVMRSVFGSAHHG-WNWQTILIGAAFLGFLLAT  273

Query  1469  RFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFN  1290
             +++G++++K FW+PA+APL+SV+LST  VY+ RA+  GV+IVKH+K G+NPSS+++++F+
Sbjct  274   KYIGKRNKKFFWVPAIAPLISVVLSTFFVYIFRADKKGVQIVKHIKKGINPSSVNEIYFS  333

Query  1289  TPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYV  1110
               ++ +  KIG +  ++ALTEA+A+  +FASMK Y +DGNKEM+A+G  NI GS+TSCYV
Sbjct  334   GKNLAKGAKIGIVAGMIALTEAVAIARTFASMKDYKIDGNKEMVALGAMNIVGSMTSCYV  393

Query  1109  ATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLI  930
             ATGSFSRSAVN+ AGC +AVSN+VM+  VL++L+L+T L  +TP AIL++II+SA+ GL+
Sbjct  394   ATGSFSRSAVNYMAGCHTAVSNIVMSCVVLLTLELITPLFKYTPNAILSAIIISAVIGLV  453

Query  929   NLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGR  750
             ++     IWK+DKLDFLAC GAF GV+F SVEIGLL+AV +SFAKI+L   +P I  LG+
Sbjct  454   DIEAVLLIWKIDKLDFLACMGAFFGVVFVSVEIGLLIAVCISFAKILLQVTRPRIALLGK  513

Query  749   LPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETK  570
             LP T  +F  I QY  A + PG+ ++R  S++  F+N+N+++ RI+  + +E+   +E K
Sbjct  514   LPRT-TIFRNIQQYAEATRVPGILIVRVDSAIY-FSNSNYVRERIMRWLTDEE---EELK  568

Query  569   ESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADF  390
                  RI  ++ ++S ++++DTS I +L++L+  +    +Q V+ANP   VI KL  + F
Sbjct  569   ARGLPRIQFLIVELSPVIDIDTSGIHALEDLHKSLQKNDIQLVLANPGQSVIDKLHASHF  628

Query  389   HNKI-KGKVFLTIGEAIDAC  333
              N I +  +FLT+G+A+  C
Sbjct  629   ANLIGQQNIFLTVGDAVLTC  648



>ref|XP_009409847.1| PREDICTED: sulfate transporter 1.2-like, partial [Musa acuminata 
subsp. malaccensis]
Length=633

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/579 (54%), Positives = 430/579 (74%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             + +FP+L WG+ Y L KLK DV++GLT+ASLCIPQ I YA LANL+PQY LYTS V PL+
Sbjct  53    QYLFPILDWGRSYDLAKLKGDVVSGLTIASLCIPQDIAYAKLANLEPQYALYTSFVAPLV  112

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAVMGSSR+IAIGPVAV+SLL+ + +    DP  NP  Y  L  T TFFAG+ QAA G  
Sbjct  113   YAVMGSSRDIAIGPVAVVSLLLGTQLQNEIDPVKNPEEYLRLAFTATFFAGVIQAALGFF  172

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL++FLSHAAIVGFMAGAA+ I LQQLK   GI NFT KTD+VSV+  ++  +HH  
Sbjct  173   RLGFLIEFLSHAAIVGFMAGAAVTISLQQLKGFLGIKNFTTKTDIVSVMKSVWRPVHHG-  231

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++I  +FL+F+L+ +++G+K + LFW+ A+APL+SVIL+T  VY+TRA+ HGV+I
Sbjct  232   WNWQTILIATAFLTFLLVAKYIGKKRKNLFWVSALAPLVSVILATFFVYITRADRHGVQI  291

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V+H+K G+NPSS  +++F+  +  + +KIG +  ++ALTEAIA+G +FA+MK Y LDGNK
Sbjct  292   VRHIKQGINPSSAGEIYFSGSYATKGLKIGIVAGLIALTEAIAIGRTFAAMKDYRLDGNK  351

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EMLA+G  N+AGSLTSCY+ATGSFSRSAVN+ AGC +AVSN+VM+VTV+++L ++T L  
Sbjct  352   EMLALGTMNVAGSLTSCYIATGSFSRSAVNYMAGCHTAVSNIVMSVTVMLTLLVITPLFK  411

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP A+LA+II+SA+ GLI+   AY IWKVDKLDFLAC GAF GV+F SVEIGLL+AV +
Sbjct  412   YTPNAVLAAIIISAVIGLIDYQTAYLIWKVDKLDFLACMGAFFGVVFISVEIGLLIAVMI  471

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LG LPGT+ ++  + QYP  ++ PGV ++R  S++  F N+N+ 
Sbjct  472   SFAKILLQVTRPRTALLGNLPGTE-IYRNVEQYPETIKVPGVLIVRVDSAIY-FTNSNYA  529

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             + RIL  + +E    ++ K  +   I  ++ ++S ++++DTS I + ++L+  +   GVQ
Sbjct  530   RERILRWLKDE---VEQIKAKNLPMIEFLIVELSPVIDIDTSGIHAFEDLHTALQKHGVQ  586

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              ++ANP   VI KLR + F   I + K+FLT+G+A+ AC
Sbjct  587   LLLANPGAAVIQKLRSSGFIEIIGRDKIFLTVGDAVKAC  625



>ref|XP_007018857.1| Sulfate transporter 1,3 isoform 1 [Theobroma cacao]
 gb|EOY16082.1| Sulfate transporter 1,3 isoform 1 [Theobroma cacao]
Length=695

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/623 (51%), Positives = 453/623 (73%), Gaps = 9/623 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + VP    L R+   + K+T  F     +  + +P  +  +   +++FP+L W + YS  
Sbjct  72    VGVPPKQNLFREFTATVKET-FFHDDPLRPFKDQPRSRKFILGIQAIFPILEWARGYSWR  130

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K + D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S+VPPLIYA MGSSR+IAIGPVA
Sbjct  131   KFRGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSLVPPLIYAFMGSSRDIAIGPVA  190

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ +M+    DP  N A Y  L  T TFFAGI QA  G LRLGFL+DFLSHAAIVG
Sbjct  191   VVSLLLGTMLSSEIDPIKNKAEYRRLAFTATFFAGITQATLGFLRLGFLIDFLSHAAIVG  250

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FMAGAA+ I LQQLK L GI +FT K+D++SV+  ++ ++HH  WN   ++IG SFLSF+
Sbjct  251   FMAGAAVTIALQQLKGLLGIKDFTKKSDIISVMNSVWGNVHHG-WNWQTILIGVSFLSFL  309

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L  +++G+ +RKLFW+PA+APL+SVILST  VY+T AE  GV+IVK ++ G+NPSS+ Q+
Sbjct  310   LFAKYIGKTNRKLFWVPAIAPLISVILSTFFVYITHAEKKGVQIVKQIEKGINPSSVDQI  369

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             +F+  ++ + +KIG +  ++ALTEA+A+G +FAS K Y ++GNKEM+A+G  N+ GS+TS
Sbjct  370   YFSGDYLLKGLKIGVVAGMIALTEAVAIGRTFASKKDYQINGNKEMVALGAMNVVGSMTS  429

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSRSAVN+ AGCE+AVSN++M+  V ++L+ +T L  +TP AILASII+SA+ 
Sbjct  430   CYVATGSFSRSAVNYMAGCETAVSNIIMSCVVFLTLEFITPLFKYTPNAILASIIISAVI  489

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI++  A  IWK+DK DF+AC GAF GV+F+SVEIGLL+AV +SFAKI+L   +P    
Sbjct  490   GLIDVPAAILIWKIDKFDFVACLGAFLGVVFSSVEIGLLIAVTISFAKILLQVTRPRTAI  549

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG+LP T +++  I QYP A + PG+ ++R  S++  F+N+N++K RIL  +M+E+   +
Sbjct  550   LGKLPRT-SVYRNIQQYPEAAKVPGLLIVRVDSAIY-FSNSNYVKERILRWLMDEE---E  604

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
               K + +  I  ++ +MS + ++DTS I +L+EL+  +   GVQ ++ANP   VI KL  
Sbjct  605   LVKAACQPTIQFLIVEMSPVTDIDTSGIHALEELHRSLGKKGVQLILANPGPTVIDKLHA  664

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             +DF N I + ++FLT+ +A+ +C
Sbjct  665   SDFANLIAEDRIFLTVSDAVSSC  687



>ref|XP_010030063.1| PREDICTED: sulfate transporter 1.3-like [Eucalyptus grandis]
 ref|XP_010030064.1| PREDICTED: sulfate transporter 1.3-like [Eucalyptus grandis]
 gb|KCW57019.1| hypothetical protein EUGRSUZ_I02687 [Eucalyptus grandis]
Length=656

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/623 (51%), Positives = 451/623 (72%), Gaps = 9/623 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + +P    L ++   + K+T  F     ++ + +P  +  L   +SVFP+L WG+ Y+L 
Sbjct  34    VGIPPKQSLLQEFTATVKETF-FADDPLRQFKDQPQSRKFLIGIQSVFPILEWGRHYNLT  92

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K + D++AGLT+ASLCIPQ IGY+ LANL PQYGLY+S VPPLIYA MGSSR+IAIGPVA
Sbjct  93    KFRGDLIAGLTIASLCIPQDIGYSKLANLPPQYGLYSSFVPPLIYAFMGSSRDIAIGPVA  152

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ +++    DPA NP  Y  L  T TFFAGI +   G  RLGFL+DFLSHAA+VG
Sbjct  153   VVSLLLGTLLQNEIDPAKNPDEYRRLAFTATFFAGITEVMLGFFRLGFLIDFLSHAAVVG  212

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FM GAAI I LQQLK L GI+ FT KTD+VSV+  ++ ++ H  WN   ++IG +FL+F+
Sbjct  213   FMGGAAITIALQQLKGLLGITIFTKKTDIVSVMRSVWGTVDHG-WNWQTIVIGVTFLAFL  271

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L+T+++G+K+RKLFW+ A+APL+SVI+ST  VY+TRA+ H V IV  +K G+NPSS++++
Sbjct  272   LLTKYIGKKNRKLFWIAAIAPLISVIVSTFFVYITRADKHHVAIVGKMKKGVNPSSVNEI  331

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
              F   ++ +  KIG I  ++ALTEA+A+G +FA+MK Y +DGNKEM+A+G  N+ GS+TS
Sbjct  332   FFTGTYLAKGFKIGVIAGMIALTEAVAIGRTFATMKDYQIDGNKEMIALGTMNVVGSMTS  391

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CY+ATGSFSRSAVN+ AGC++AVSN+VM+  VL++L+L+T L  +TP AILASII+SA+ 
Sbjct  392   CYIATGSFSRSAVNYMAGCQTAVSNIVMSCVVLLTLELITPLFKYTPNAILASIIISAVV  451

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI++  A  IWK+DKLDF+AC GAF GV+F SVEIGLL+AV +SFAKI+L   +P    
Sbjct  452   GLIDIEAAILIWKIDKLDFVACMGAFFGVVFVSVEIGLLIAVSISFAKILLQVTRPRTAI  511

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG+LP T  ++  I QYP A + PGV ++R  S++  F+N+N+I+ R+L  + +E+   +
Sbjct  512   LGKLPRT-TVYRNILQYPEATKVPGVLIVRVDSAIY-FSNSNYIRERVLRWLGDEE---E  566

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
               KE+++ RI  ++ +MS + ++DTS I +L EL+  +T   +Q V+ANP   V+ KL  
Sbjct  567   YLKENNQPRIQYLIVEMSPVTDIDTSGIHALDELHKSLTKRDIQLVLANPGPVVMDKLHA  626

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             + F + I + K+FLT+ +AI  C
Sbjct  627   SKFTDVIGEDKIFLTVSDAIMTC  649



>gb|KHN31354.1| Sulfate transporter 2.1 [Glycine soja]
Length=522

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/514 (62%), Positives = 403/514 (78%), Gaps = 21/514 (4%)
 Frame = -1

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             +IAIGPVAV+SLL+SSM+ KL DPA++P GYT L+L  T FAGIFQ +FG+LRLGFLVDF
Sbjct  17    QIAIGPVAVVSLLLSSMMEKLVDPATDPVGYTKLILLATLFAGIFQTSFGLLRLGFLVDF  76

Query  1682  LSHAAIV-------GFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPW  1524
             LSHAAIV        F     I + +  +K      NF   T +++V            W
Sbjct  77    LSHAAIVLEPDSNSPFSTFIIINLIINIIKHKTNKYNFIMHTHIINV-----------QW  125

Query  1523  NPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIV  1344
             NP N I+G SFL FIL TR LG++ +KLFWL +++PL+SV++STL+V++TRA+ +GVKIV
Sbjct  126   NPRNFILGCSFLVFILTTRCLGKRKKKLFWLASISPLVSVVVSTLIVFITRADKNGVKIV  185

Query  1343  KHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKE  1164
             KHVKGGLNPSS+HQL FN P+I +V KIG +VAVVALTE+IAVG SFAS+KGY LDGNKE
Sbjct  186   KHVKGGLNPSSIHQLDFNNPYIGEVAKIGLVVAVVALTESIAVGRSFASIKGYQLDGNKE  245

Query  1163  MLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYF  984
             M++IG+ NI GS TSCYVATGSFSR+AVN+ AGCE+ VSN+VMA+TVLISLQ LTKLLY+
Sbjct  246   MMSIGLTNIIGSFTSCYVATGSFSRTAVNYAAGCETLVSNIVMAITVLISLQFLTKLLYY  305

Query  983   TPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLS  804
             TP AILAS+ILSALPGLI+L+EAY IWKVDK+DFLACAGAF GVLFASVEIGLL AV +S
Sbjct  306   TPTAILASVILSALPGLIDLSEAYKIWKVDKIDFLACAGAFFGVLFASVEIGLLAAVVIS  365

Query  803   FAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIK  624
             F+KI+L SI+PG E LG+LPGTD LF  ++QYPMAV+ PGV +IR KS+LLCFANANF++
Sbjct  366   FSKIILISIRPGTETLGKLPGTD-LFCDVYQYPMAVKVPGVMIIRVKSALLCFANANFVR  424

Query  623   ARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQF  444
              RI+  V EE+   D  K +S   I L++ D SN++N+DT+ I +L+EL+  ++S G Q 
Sbjct  425   ERIIKWVTEEESEDD--KGNSRSTIQLLILDTSNLVNIDTAGITALEELHKSLSSHGKQL  482

Query  443   VIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAI  342
              IANPRWQVIHKL++++F  KI G+VFLT+ EA+
Sbjct  483   AIANPRWQVIHKLKVSNFVGKIGGRVFLTVEEAV  516



>ref|XP_002513877.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF48460.1| sulfate transporter, putative [Ricinus communis]
Length=667

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/623 (51%), Positives = 456/623 (73%), Gaps = 9/623 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + VP    + ++ + +FK+T  F     +  + +P  +  +   +++FP+L WG+ Y L 
Sbjct  36    VGVPPKQNILKEFKATFKET-FFSDDPLRPFKDQPRSKKFILGIQAIFPILEWGRSYDLK  94

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K + D++AGLT+ASLCIPQ IGYA LANL P+YGLY+S VPPLIYA MGSSR+IAIGPVA
Sbjct  95    KFRGDLIAGLTIASLCIPQDIGYAKLANLSPEYGLYSSFVPPLIYASMGSSRDIAIGPVA  154

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ +++    DP +N   Y  L  T TFFAGI QAA G LRLGFL+DFLSHAAIVG
Sbjct  155   VVSLLLGTLLQNELDPKTNAEEYLRLAFTATFFAGITQAALGFLRLGFLIDFLSHAAIVG  214

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FM GAAI I LQQLK L GI +FT KTD+VSV+  +F S+HH  WN   ++IG SFL+F+
Sbjct  215   FMGGAAITIALQQLKGLLGIKDFTKKTDLVSVMQSVFGSIHHG-WNWQTIVIGVSFLAFL  273

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L  +++G+K++K FW+PA+APL+SVILST  VY+TRA+  GV+IVKH+K G+NP+S++Q+
Sbjct  274   LSAKYIGKKNKKFFWVPAIAPLISVILSTFFVYITRADKEGVQIVKHIKKGINPASVNQI  333

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             +F+ P++ + ++IG +  ++ALTEA A+G +FA+MK Y +DGNKEM+A+G  NI GS+TS
Sbjct  334   YFSGPYLLKGIRIGVVAGMIALTEASAIGRTFAAMKDYQIDGNKEMVALGTMNIVGSMTS  393

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSRSAVN+ AGC++AVSN+VM+  V ++L  +T L  +TP AILA+II+SA+ 
Sbjct  394   CYVATGSFSRSAVNYMAGCQTAVSNIVMSCIVFLTLLFITPLFKYTPSAILAAIIISAVL  453

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI++     IWK+DK DF+AC GAF GV+F+SVEIGLL+AV +SFAKI+L   +P    
Sbjct  454   GLIDIEATILIWKIDKFDFIACMGAFFGVVFSSVEIGLLIAVSISFAKILLQVTRPRTAI  513

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG+LPGT  ++  I QYP A + PGV ++R  S++  F+N+N+I+ RIL  +++E+   +
Sbjct  514   LGKLPGT-TVYRNIQQYPGATKVPGVLIVRVDSAIY-FSNSNYIRERILRWLIDEE---E  568

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
             + KES + +   ++ DMS + ++DTS I +L+ELY  +    +Q ++ANP   VI KL  
Sbjct  569   QLKESYQPKFQFLIVDMSPVTDIDTSGIHALEELYKSLQKKEIQLILANPGPVVIDKLHA  628

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             + F + I + K+FLT+ +A+ +C
Sbjct  629   SSFAHMIGEDKLFLTVADAVSSC  651



>ref|XP_006826989.1| hypothetical protein AMTR_s00010p00208980 [Amborella trichopoda]
 gb|ERM94226.1| hypothetical protein AMTR_s00010p00208980 [Amborella trichopoda]
Length=658

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/627 (53%), Positives = 451/627 (72%), Gaps = 19/627 (3%)
 Frame = -1

Query  2198  VLNVPEPPGLSRKLEGSFKKTAT---FLGTAFQRLRKR-PVQAVLSASESVFPLLSWGKQ  2031
             V  V  PP   RKL   F  T     F    F+  + +   + ++  S+++FP+L WG+ 
Sbjct  32    VYKVGLPP--KRKLMSEFTSTVKETFFADNPFRHFKDQSKSKKLILGSQALFPILEWGRY  89

Query  2030  YSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAI  1851
             YSL K K D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S VPPL+YA MGSSR+IAI
Sbjct  90    YSLSKFKGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLVYAFMGSSRDIAI  149

Query  1850  GPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHA  1671
             GPVAV+SL++ +++    DP  N A Y  L  T TFFAG+ QAA G LRLGFL+DFLSHA
Sbjct  150   GPVAVVSLILGTLLQNEVDPVHNAAEYRRLAFTATFFAGVTQAALGFLRLGFLIDFLSHA  209

Query  1670  AIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsf  1491
             AIVGFM GAAI I LQQLK L G+  FT KTD++SV+  ++ ++HH  WN   +++G  F
Sbjct  210   AIVGFMGGAAITIALQQLKGLLGVIKFTKKTDIISVMHSVWGNVHHG-WNWQTVVLGSVF  268

Query  1490  lsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSS  1311
             L+F+L+ R++G+K + LFW+ A+APL+SVILSTL VYLTR +  GV+IVK ++ G+NP S
Sbjct  269   LAFLLLARYIGKKKKSLFWVSAIAPLISVILSTLFVYLTRVDKDGVQIVKKIRRGINPPS  328

Query  1310  LHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAG  1131
              H+++F+ P++ +  KIG I  ++ LTEAIA+G +FASMK YHLDGNKEMLA+GV N+ G
Sbjct  329   AHKIYFSGPNVAKGFKIGVIAGMIGLTEAIAIGRTFASMKDYHLDGNKEMLALGVMNLTG  388

Query  1130  SLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIIL  951
             SLTSCYVATGSFSRSAVN+ AGC++AVSN+VM++ VL++L+++T L Y+TP AILA+II+
Sbjct  389   SLTSCYVATGSFSRSAVNYMAGCQTAVSNIVMSIVVLLTLEVITPLFYYTPNAILAAIII  448

Query  950   SALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQP  771
             SA+ GLI+   A  IWK+DKLDF+AC GAF GV+F+SVEIGLL+A+ LSFAKI+L+  +P
Sbjct  449   SAVLGLIDYEAALLIWKIDKLDFVACMGAFIGVVFSSVEIGLLIAISLSFAKILLHVTRP  508

Query  770   GIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQ  591
                 LG +P T +++  I QYP A + PG+ ++R  S++  F+N+N+I+ RIL  +    
Sbjct  509   HTALLGNIPRT-SIYRNIEQYPEATKVPGMLILRVDSAIY-FSNSNYIRERILRWL----  562

Query  590   KSADETKESSEK---RIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
               +DET+E   K   RI  +V DMS ++N+DTS I +L+EL+  +    +Q  +ANP   
Sbjct  563   --SDETQELDRKGLPRIQFLVVDMSPVINIDTSGIHALEELHSSLQKRDIQLALANPGQH  620

Query  419   VIHKLRLADFHNKIK-GKVFLTIGEAI  342
             VI KL  +   + I    +FLT+ EA+
Sbjct  621   VIDKLHASKITDTIGPDNIFLTVAEAV  647



>ref|XP_010939616.1| PREDICTED: sulfate transporter 1.3-like [Elaeis guineensis]
 ref|XP_010939617.1| PREDICTED: sulfate transporter 1.3-like [Elaeis guineensis]
Length=658

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/633 (52%), Positives = 446/633 (70%), Gaps = 13/633 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKT---ATFLGTAFQRLRKRP-VQAVLSASESVFPLL  2046
             E A +V  V  PP   +KL   F  T   A F     ++ R +P  + ++     +FP+ 
Sbjct  27    ENAPYVYKVGYPP--RKKLVREFTDTLKEALFPDDPLRQYRDQPRSRKLMLGLAYLFPIF  84

Query  2045  SWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSS  1866
              WG+ Y+LVK K D++AGLT+ASLCIPQ IGY+ LANLDPQYGLY+S VPPLIYA MGSS
Sbjct  85    EWGRGYNLVKFKGDIIAGLTIASLCIPQDIGYSKLANLDPQYGLYSSFVPPLIYAAMGSS  144

Query  1865  REIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVD  1686
             R+IAIGPVAV+SLLI S++    DP  N   Y  L  T TFFAGI QAA G LRLGFL+D
Sbjct  145   RDIAIGPVAVVSLLIGSLLQDEVDPVKNKEEYLRLAFTATFFAGITQAALGFLRLGFLID  204

Query  1685  FLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNli  1506
             FLSHAAIVGFM GAAI I LQQLK L GI NFT KTD+VSV++ ++ S+HH  WN   ++
Sbjct  205   FLSHAAIVGFMGGAAITIALQQLKLLLGIQNFTKKTDIVSVMSSVWGSVHHG-WNWQTIL  263

Query  1505  igfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGG  1326
             IG  FL+F+L T+++G+K++KLFW+ A+APL+SVIL+T  VY+T AE HGV+IV+H+K G
Sbjct  264   IGTGFLAFLLTTKYIGKKNKKLFWISAIAPLISVILATFFVYITHAEKHGVQIVRHLKKG  323

Query  1325  LNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGV  1146
             +NPSS ++++F   +  +  +IG +  ++ALTEA A+G +FA++K Y LDGNKEM+A+G 
Sbjct  324   INPSSFNKIYFTGSYAGKGFRIGVVTGMIALTEATAIGRTFAALKDYQLDGNKEMVALGT  383

Query  1145  ANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAIL  966
              NIAGS+TSCY ATGSFSRSAVN+ AGC++ +SNVVM+  V ++L L+T L  +TP +IL
Sbjct  384   MNIAGSMTSCYCATGSFSRSAVNYMAGCQTPISNVVMSTVVFLTLLLITPLFKYTPNSIL  443

Query  965   ASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIML  786
             ASII++A+ GLI+   AY IWK DK DF+AC GAF GV+F SVEIGLL+AV LSFAKI+L
Sbjct  444   ASIIITAVIGLIDFEAAYLIWKTDKFDFVACMGAFFGVVFKSVEIGLLIAVSLSFAKILL  503

Query  785   NSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSL  606
                +P    LG LPGT  ++  I QYP A + PGV ++R  S++  F+N+N+++ RIL  
Sbjct  504   QVTRPRTALLGNLPGT-TIYRNIEQYPEATKVPGVLIVRVDSAIY-FSNSNYVRERILRW  561

Query  605   VMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPR  426
             + +E++     KE    RI  ++ +MS + ++DTS I + +EL   +    VQ  +ANP 
Sbjct  562   LTDEEEEI---KERELPRINFLIVEMSPVTDIDTSGIHAFEELLKSLEKRKVQLTLANPG  618

Query  425   WQVIHKLRLADFHNKI-KGKVFLTIGEAIDACL  330
               VI KL+ + F   I   ++FLT+ +A+ +C+
Sbjct  619   PVVIEKLQSSKFTELIGNDRIFLTVADAVISCI  651



>ref|XP_008444099.1| PREDICTED: sulfate transporter 1.3-like [Cucumis melo]
 ref|XP_008444100.1| PREDICTED: sulfate transporter 1.3-like [Cucumis melo]
 ref|XP_008444102.1| PREDICTED: sulfate transporter 1.3-like [Cucumis melo]
Length=661

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/649 (50%), Positives = 463/649 (71%), Gaps = 17/649 (3%)
 Frame = -1

Query  2255  QTLQKTSSTLPP--AAERASWVLNVPEPPG--LSRKLEGSFKKT---ATFLGTAFQRLRK  2097
             +T +K + +L P   A+   +V  V  PP   L ++++ + K+T      L +   + +K
Sbjct  14    ETKEKDNRSLIPDNQAQDERYVHKVGVPPKQKLYKEIKSAVKETFFPDDPLRSFKDQTKK  73

Query  2096  RPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYG  1917
             R     +   ++VFP+L WG+ Y+L K + DV++GLT+ASLCIPQ IGYA LANL P+YG
Sbjct  74    R---KFILGIQAVFPILDWGRTYNLTKFRGDVISGLTIASLCIPQDIGYAKLANLSPEYG  130

Query  1916  LYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffa  1737
             LY+S VPPLIYA+MGSSR+IAIGPVAV+SLL+ +++ +  D A NP  Y  L  T TFFA
Sbjct  131   LYSSFVPPLIYALMGSSRDIAIGPVAVVSLLLGTLLQEEIDSAMNPKDYLRLAFTATFFA  190

Query  1736  gifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLT  1557
             GI QA  GILRLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT KTD++SV+ 
Sbjct  191   GITQATLGILRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKKTDIISVMQ  250

Query  1556  HIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYL  1377
              +F S+ H  WN   ++I  +FL F+L  +++G+K+++LFW+PA+APL+SV+LSTLLV++
Sbjct  251   SVFGSMRHG-WNWQTIVIATTFLGFLLFAKYMGKKNKRLFWVPAIAPLISVVLSTLLVFI  309

Query  1376  TRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFAS  1197
             TRA+  GV IVKH++ G+NP S+  L  +  ++ +  KIG +  +VALTEA+A+G +FAS
Sbjct  310   TRADKEGVAIVKHIEKGINPPSVKDLFLSGEYLLKGFKIGVVAGMVALTEAVAIGRTFAS  369

Query  1196  MKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLI  1017
             MK Y +DGNKEM+A+GV N+ GS++SCYVATGSFSRSAVN+ AGC++AVSN+VM++ VL+
Sbjct  370   MKDYQIDGNKEMVAMGVMNVVGSMSSCYVATGSFSRSAVNYMAGCQTAVSNIVMSIVVLL  429

Query  1016  SLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASV  837
             +L  LT L  +TP AIL++II+SA+  LI+L     IWK+DK DF+AC GAF GV+F SV
Sbjct  430   TLAFLTPLFKYTPNAILSAIIISAVINLIDLYAVKLIWKIDKFDFVACMGAFFGVIFFSV  489

Query  836   EIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSS  657
             EIGLLVAV +SFAKI+L   +P    LG++P T  ++  I QYP A + PGV ++R  S+
Sbjct  490   EIGLLVAVCISFAKILLQVTRPRTAILGKIPRT-TVYRNILQYPEATKVPGVLIVRVDSA  548

Query  656   LLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKEL  477
             +  F+N+N+IK RIL  +++E+   ++TK+  + +I  ++ +MS + ++DTS I +L+EL
Sbjct  549   IY-FSNSNYIKERILRWLVDEE---EQTKKLYQNKIQFLIVEMSPVTDIDTSGIHALEEL  604

Query  476   YDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
                +    +Q ++ANP   V+HKL  ++F + I +  +FLT+ +A+ +C
Sbjct  605   NGSLKKREIQLILANPGPVVMHKLHASEFVDLIGQDNIFLTVADAVSSC  653



>ref|XP_008790803.1| PREDICTED: sulfate transporter 1.3-like [Phoenix dactylifera]
Length=658

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/631 (52%), Positives = 447/631 (71%), Gaps = 11/631 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPP--GLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLS  2043
             E   +V  V  PP   L+R+   + K+ A F     ++ R +P  +  +     +FP+L 
Sbjct  27    ENEPYVYKVGYPPRKKLAREFADTLKE-ALFPDDPLRQYRDQPRSRKFMPGLAYLFPILD  85

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y+LVK K D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S VPPLIYA MGSSR
Sbjct  86    WGRGYNLVKFKGDIIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLIYAAMGSSR  145

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             +IAIGPVAV+SLL+ S++    DP  N   Y  L  T TFFAGI QAA G LRLGFL+DF
Sbjct  146   DIAIGPVAVVSLLMGSLLQDEVDPVKNKEEYLRLAFTATFFAGITQAALGFLRLGFLIDF  205

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFM GAAI I +QQLK LFGI NFT KTD+VSV+  ++ S+HH  WN   ++I
Sbjct  206   LSHAAIVGFMGGAAITIAIQQLKLLFGIKNFTKKTDIVSVMRSVWGSVHHG-WNWQTILI  264

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
             G  FL+F+L  +++G+K++K FWLPA+APL+SVIL+T  VY+T AE HGV+IV+H+K G+
Sbjct  265   GTVFLAFLLTAKYIGKKNKKFFWLPAIAPLISVILATFFVYITHAEKHGVQIVRHIKKGI  324

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NPSS ++++F  P+  +  +IG +  ++ALTEA A+G +FA++K Y LDGNKEM+A+G  
Sbjct  325   NPSSFNKIYFTGPYAGKGFRIGVVTGMIALTEATAIGRTFAALKDYQLDGNKEMVALGTM  384

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             N+AGS+TSCY ATGSFSRSAVNF AGC++ +SNVVM+  VL++L L+T L  +TP +ILA
Sbjct  385   NVAGSMTSCYCATGSFSRSAVNFMAGCQTPISNVVMSTVVLLTLLLITPLFKYTPNSILA  444

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             SII++A+ GL++   AY IWK DK DF+AC GAF GV+F SVEIGLL+AV +SFAKI+L 
Sbjct  445   SIIITAVIGLLDFEAAYLIWKTDKFDFVACMGAFFGVVFKSVEIGLLIAVSISFAKILLQ  504

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
               +P    LG LPGT  ++  I QYP A + PGV ++R  S++  F+N+N+I+ RIL  +
Sbjct  505   VTRPRTALLGNLPGT-TIYRNIEQYPEASKVPGVLIVRVDSAIY-FSNSNYIRERILRWL  562

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
              +E++     +     RI  ++ +MS + ++DTS I + +E+   +    VQ ++ANP  
Sbjct  563   ADEEEE---MEARELPRINFLIVEMSPVTDIDTSGIHAFEEMLKSLEKRKVQLILANPGP  619

Query  422   QVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              VI KL+ + F   I   K+FLT+ +A+ +C
Sbjct  620   VVIEKLQTSKFTELIGHDKIFLTVADAVMSC  650



>ref|XP_006659385.1| PREDICTED: sulfate transporter 1.2-like [Oryza brachyantha]
Length=656

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/649 (50%), Positives = 452/649 (70%), Gaps = 13/649 (2%)
 Frame = -1

Query  2243  KTSSTLP---PAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQA-VL  2076
              T++ LP   P+ E   + +  P    L+++L  + ++T  F      R + +   +  +
Sbjct  14    NTNAQLPSYEPSQEPHVYKVGRPPQKNLAKELADTLRET-FFHDNPLHRYKDQSGSSKFM  72

Query  2075  SASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVP  1896
                + +FP+  WG+ YSL K K D++AGLT+ASLCIPQ IGY+ LANLD QYGLY+S VP
Sbjct  73    MVLQFLFPIFEWGRSYSLSKFKGDLIAGLTIASLCIPQDIGYSKLANLDAQYGLYSSFVP  132

Query  1895  PLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaaf  1716
             PLIYA MGSS++IAIGPVAV+SLLI S++    DP  N   Y  L  T TFFAGI QAA 
Sbjct  133   PLIYAAMGSSKDIAIGPVAVVSLLIGSLLQNEVDPVKNKEEYVRLAFTATFFAGITQAAL  192

Query  1715  gILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLH  1536
             G LRLGFL++FLSHAAIVGFM GAAI I LQQLK + GI +FT KTD+VSV+  +++S H
Sbjct  193   GFLRLGFLIEFLSHAAIVGFMGGAAITIALQQLKLVLGIRSFTKKTDIVSVMRSVWSSAH  252

Query  1535  HSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHG  1356
             H  WN   ++IG +FL+F+L  +++G+K+RK FW+PA+AP++SVIL+TL VY+T AE  G
Sbjct  253   HG-WNWQTIVIGMAFLAFLLFAKYIGKKNRKFFWVPAIAPIISVILATLFVYITHAEKQG  311

Query  1355  VKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLD  1176
             V+IV H+K G+NPSS+ +++F  P + +  KIG I  ++ LTEA+A+G +FA++K Y LD
Sbjct  312   VQIVNHIKKGVNPSSVDKIYFTGPFVAKGFKIGVICGMIGLTEAVAIGRTFAALKDYQLD  371

Query  1175  GNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTK  996
             GNKEM+A+G  NIAGS+TSCY+ATGSFSRSAVNF AGC++ VSN+VM+  VL++L ++T 
Sbjct  372   GNKEMVALGTMNIAGSMTSCYIATGSFSRSAVNFMAGCQTPVSNIVMSTVVLLTLLVITP  431

Query  995   LLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVA  816
             L  +TP AIL SII+SA+  L++   A  IWKVDK+DF+AC GAF GV+FASVEIGLL+A
Sbjct  432   LFKYTPNAILGSIIISAVISLVDYEAAILIWKVDKMDFIACMGAFFGVVFASVEIGLLIA  491

Query  815   VGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANA  636
             V +SFAKI+L   +P    LG LPGT  ++    QYP A   PG+ ++R  S++  F+N+
Sbjct  492   VSISFAKILLQVTRPRTVLLGNLPGT-TIYRNTDQYPEARHVPGLIIVRVDSAIY-FSNS  549

Query  635   NFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSC  456
             N+++ RIL  + EE++ A   K   E +I  ++ +MS ++++DTS I SL++LY  +   
Sbjct  550   NYVRERILRWLTEEEERA---KAEGESKINFLIIEMSPVIDIDTSGIHSLEDLYKNLQKR  606

Query  455   GVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDKNMQ  312
              +Q ++ANP   VI KL  ++    I    +FLT+ +A+  C   K MQ
Sbjct  607   DIQLILANPGSIVIEKLLSSNLTEHIGSNNIFLTVSDAVCFC-TSKTMQ  654



>gb|EYU39155.1| hypothetical protein MIMGU_mgv1a002721mg [Erythranthe guttata]
Length=644

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/620 (50%), Positives = 453/620 (73%), Gaps = 10/620 (2%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWGKQYSLV  2019
             + VP   GL ++++ + K+T  F     +  + + V + +L A + VFP+L W ++Y L 
Sbjct  24    VGVPPKQGLLKEIKFALKET-FFHDEPLKHFKDQSVSRKLLLAIQGVFPILDWARRYKLH  82

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
               + D++AGLT+ASLCIPQ I YA LANLDPQ+GLY+S VPPLIYA MGSSR+IAIGPVA
Sbjct  83    LFRGDLIAGLTIASLCIPQDIAYAKLANLDPQFGLYSSFVPPLIYAAMGSSRDIAIGPVA  142

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ SM+ +  DP  +   Y  L  T TFFAGI Q   G  RLGFL+DFLSHAAIVG
Sbjct  143   VVSLLLGSMLQQEIDP-KHKIEYQKLAFTATFFAGITQFTLGFFRLGFLIDFLSHAAIVG  201

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FMAGAAI IGLQQLK L G+  FT KTDVVSV++ ++T++HH  WN    +IG +FL+F+
Sbjct  202   FMAGAAITIGLQQLKGLLGVKTFTKKTDVVSVMSSVWTNVHHG-WNWETCVIGITFLAFL  260

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L+ +++G+++++LFW+PA+APL+SVI++T  V++TRA+  GV+IV++++ G+NP SL ++
Sbjct  261   LLAKYIGKRNKRLFWVPAIAPLISVIVATFCVFITRADKKGVQIVRYIERGINPPSLDKI  320

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             HF   ++    +IG I  ++ALTEA+A+G +FA+MK YHLDGNKEM+A+G  NI GS+TS
Sbjct  321   HFTGSYVLTGFRIGAIAGLIALTEAVAIGRTFAAMKDYHLDGNKEMVALGTMNIVGSMTS  380

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSRSAVN+ AGC +AVSN+VM++ VL++L+++T L  +TP AILASII+SA+ 
Sbjct  381   CYVATGSFSRSAVNYMAGCNTAVSNIVMSIVVLLTLEVITPLFKYTPNAILASIIISAVV  440

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GL +      IWK+DK DF+AC GAF GV+F S+EIGLL+AV +SFAKI+L   +P    
Sbjct  441   GLFDYQAMILIWKIDKFDFVACMGAFFGVVFISIEIGLLIAVAISFAKILLQVTRPRTAV  500

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG++P T +++    QYP A + PGV ++R  S++  F+N+N+I+ RIL L+ +E+++  
Sbjct  501   LGKIPRT-SVYRNTQQYPEATKVPGVLIVRVDSAIY-FSNSNYIRERILRLLSDEEENH-  557

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
               KE+ + RI  ++ +MS + ++DTS I SL++L   +    +Q V+ANP   V+ KL  
Sbjct  558   --KENDQSRIQYLIVEMSPVTDIDTSGIHSLEDLQKSLGKRHIQLVLANPGQTVLDKLHA  615

Query  398   ADFHNKI-KGKVFLTIGEAI  342
             ++F +K+ +  +FLT+G+A+
Sbjct  616   SEFASKVGEDNIFLTVGDAV  635



>ref|XP_006472647.1| PREDICTED: sulfate transporter 1.3-like isoform X1 [Citrus sinensis]
 ref|XP_006472648.1| PREDICTED: sulfate transporter 1.3-like isoform X2 [Citrus sinensis]
 ref|XP_006472649.1| PREDICTED: sulfate transporter 1.3-like isoform X3 [Citrus sinensis]
Length=659

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/630 (50%), Positives = 447/630 (71%), Gaps = 10/630 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWG  2037
             ER    + VP    L ++   + K+T  F     +  + R   Q  +   +++FP+  WG
Sbjct  28    ERYIHKVGVPPKQNLFKEFRETLKET-FFADDPLRPFKDRSRSQKFILGIQTIFPIFEWG  86

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             ++Y+L KL+ D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S VPPLIYA MGSSR+I
Sbjct  87    RKYNLKKLRGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLIYAFMGSSRDI  146

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+ +M+    DP +  A Y  L  T TFFAGI Q   G  RLGFL+DFLS
Sbjct  147   AIGPVAVVSLLLGTMLQNELDPINEKAQYQRLAFTATFFAGITQVTLGFFRLGFLIDFLS  206

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAA+ I LQQLK   GI  FT K+D++SV+  +  S HH  WN   + IG 
Sbjct  207   HAAIVGFMGGAAVTIALQQLKGFLGIKKFTKKSDIISVMHSVVASAHHG-WNWQTIAIGA  265

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSF+L  +F+G+K++K FW+PA+APL+SVILST  VY+TRA+  GV+IVK++K G+NP
Sbjct  266   SFLSFLLFAKFIGKKNKKFFWVPAIAPLISVILSTFFVYITRADKQGVQIVKNIKKGINP  325

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             SS+++++F+  ++ +  +IG +  ++ LTEAIA+G +FA+MK Y LDGNKEM+A+G  N+
Sbjct  326   SSVNEIYFSGDYLLKGFRIGVVAGMIGLTEAIAIGRTFAAMKDYQLDGNKEMVALGAMNV  385

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS+TSCYVATGSFSRSAVNF AGCE+AVSN++M+  V ++L+ +T L  +TP AILASI
Sbjct  386   VGSMTSCYVATGSFSRSAVNFMAGCETAVSNIIMSCVVFLTLEFITPLFKYTPNAILASI  445

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             I++A+ GLI++  A  +WK+DK DF+AC GAF GV+F+SVEIGLL+AV +SFAKI+L   
Sbjct  446   IINAVIGLIDIGAATLLWKIDKFDFVACMGAFFGVVFSSVEIGLLIAVSISFAKILLQVT  505

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +P    LG++P T  ++  I QYP A + PGV ++R  S++  F+N+N++K RIL  + +
Sbjct  506   RPRTAILGKVPRT-TVYRNIQQYPEATKVPGVLIVRVDSAIY-FSNSNYVKERILRWLED  563

Query  596   EQKSADETKESS-EKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
             E+   +E K ++ + RI  ++ +MS + ++DTS I +L+ L+  +    VQ ++ANP   
Sbjct  564   EE---EEVKAATYQPRIQFLIVEMSPVTDIDTSGIHALEGLHRSLEKREVQLILANPGPV  620

Query  419   VIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             V+ KL  + F + I +  +FLT+ +A+ +C
Sbjct  621   VMDKLHASSFTSLIGEDNIFLTVADAVSSC  650



>ref|XP_007163634.1| hypothetical protein PHAVU_001G250800g [Phaseolus vulgaris]
 gb|ESW35628.1| hypothetical protein PHAVU_001G250800g [Phaseolus vulgaris]
Length=671

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/675 (51%), Positives = 468/675 (69%), Gaps = 25/675 (4%)
 Frame = -1

Query  2306  TTGVEMTAELELPYEFSQTLQKTS--STLPPAAERASWVLNVPEPPGLSRKLEGSFKKTA  2133
             ++  EM A  +   E S TL+K +    L      + WV+N P+PP + R++  + K   
Sbjct  5     SSNSEMVASKKSTLEKS-TLEKITLEEVLDIEKNMSQWVVNPPDPPSMLRQVVDNIKDIL  63

Query  2132  TFLG--TAFQRLRKRPV-QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQ  1962
                     F  LR +P  +   +  +++FP+L+  + Y+  K K D +AGL LA   IPQ
Sbjct  64    VPHPHPNTFSSLRNQPFSKRAFAFFKNLFPILASFQNYNAQKFKCDFMAGLILAIFAIPQ  123

Query  1961  SIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASN  1782
              +G A LA L P+YGLYT +VPPLIYA++ SSRE+ IGP +V SLL+SSM+  L+ P  +
Sbjct  124   CMGNATLAQLSPEYGLYTGIVPPLIYALLASSREMVIGPGSVDSLLLSSMIQTLKLPIHD  183

Query  1781  PAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFG  1602
               GYT LV TVTFFAGIFQ AFG+ R GFLV+++S + IVGF+A AA+ IGLQQLK LFG
Sbjct  184   SIGYTHLVFTVTFFAGIFQLAFGLFRFGFLVEYISQSTIVGFLAAAAVGIGLQQLKGLFG  243

Query  1601  ISNFTNKTDVVSVLTHIFTSL-HHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPA  1425
             I   TNKT + SVL  ++TS  + S W+PYN +IGFSFL FIL TRFLG++++KL WL  
Sbjct  244   ID--TNKTALFSVLKSLWTSFKNQSLWHPYNFVIGFSFLCFILFTRFLGKRNKKLLWLSH  301

Query  1424  MAPLLSVILSTLLVYLTRAENHGVK-----IVKHVKGG--LNPSSLHQLHFNTPHIPQVV  1266
             +APLLS+I S+++ Y      H VK     ++  +KGG  LNPSS +QL F++  +  ++
Sbjct  302   VAPLLSIIASSIIAYKINVHEHQVKDYRVEVLGPIKGGGSLNPSSFNQLIFDSKVVVHLM  361

Query  1265  KIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRS  1086
             +IG  +A+++ T +IAVG SFAS+KG+ +  N+E++++G+ NI GSLTSCY+A+GS SRS
Sbjct  362   RIGLNIAIISFTGSIAVGRSFASLKGHSIYPNREVVSLGIMNIVGSLTSCYIASGSLSRS  421

Query  1085  AVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSI  906
             AVN+ AG E+ VSN+VMA+TVL+SL+ LT LLYFTP A+LA+IILSA+PGLI+L +A  I
Sbjct  422   AVNYDAGSETVVSNIVMALTVLLSLKFLTGLLYFTPKAMLAAIILSAVPGLIDLKKAREI  481

Query  905   WKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALF  726
             WKVDK+DFLACAGAF GVLFAS EIGL V + +SFAKI+L S+QP I  +GRLPGTD+ F
Sbjct  482   WKVDKMDFLACAGAFFGVLFASPEIGLAVGITISFAKIILTSVQPAIAVIGRLPGTDS-F  540

Query  725   MGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIA  546
               + QYPMA+  PGVF++  KS+ LCFANAN ++  I   V  E+          E    
Sbjct  541   GDVQQYPMALNIPGVFIVSLKSAWLCFANANLVEEMIERWVNNEK--------GGESTFH  592

Query  545   LIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKIKGKV  366
              ++ D S++ N+DT+ I SL EL   +TS GV+  IANPRW VIHKLRLA+F +KI G+V
Sbjct  593   HVIIDASSLTNIDTTGIASLVELNKNMTSRGVKLAIANPRWHVIHKLRLANFVSKIGGRV  652

Query  365   FLTIGEAIDACLVDK  321
             FL++GEA+DAC+  K
Sbjct  653   FLSVGEAVDACVTTK  667



>ref|XP_010667626.1| PREDICTED: sulfate transporter 1.2-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010667629.1| PREDICTED: sulfate transporter 1.2-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=659

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/665 (49%), Positives = 449/665 (68%), Gaps = 16/665 (2%)
 Frame = -1

Query  2321  MAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFK  2142
             MA  PT G   T E+++    S +  K  +       +    + VP    L ++   + K
Sbjct  1     MAGLPTNGDADTKEIDMA---SVSSSKRHNQYFDVHHK----VGVPSKQNLFKEFTHTVK  53

Query  2141  KTATFLGTAFQRLRKRPVQAVLSAS-ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIP  1965
             +T  F     +  + +P         ++VFP+L WG+ Y+L K K D+++GLT+ASLCIP
Sbjct  54    ET-FFADDPLRDFKDQPSSRKFKLGLQAVFPILEWGRGYNLNKFKGDLISGLTIASLCIP  112

Query  1964  QSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPAS  1785
             Q IGY+ LANLDPQYGLY+S +PPLIYA MGSSR+IAIGPVAV+SLL+ +++    DP  
Sbjct  113   QDIGYSKLANLDPQYGLYSSFIPPLIYACMGSSRDIAIGPVAVVSLLLGTLIQNEIDPIK  172

Query  1784  NPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLF  1605
             NP  Y  L  T TFFAGI Q   G  RLGFL+DFLSHAAIVGFM GAAI I LQQLK   
Sbjct  173   NPVEYRRLAFTATFFAGITQMTLGFFRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFL  232

Query  1604  GISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPA  1425
             GI  FT K+D++SVL  +F S+HH  WN   ++IG  FL+F+L  + +G++++KLFW+PA
Sbjct  233   GIKKFTKKSDIISVLHSVFGSMHHG-WNWQTILIGAVFLAFLLFAKLIGKRNKKLFWVPA  291

Query  1424  MAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVA  1245
             +APLLSVILST  V++T AE  GV IV H++ GLNPSSLHQL+F+  ++ +  KIG +  
Sbjct  292   IAPLLSVILSTFFVFVTHAEKEGVAIVNHIEKGLNPSSLHQLYFSGDNLLRGFKIGAVAG  351

Query  1244  VVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAG  1065
             ++ALTEA A+G +FA+MK Y LDGNKEM+A+G  N+ GS+TSCYVATGSFSRSAVN+ AG
Sbjct  352   MIALTEATAIGRTFAAMKDYQLDGNKEMVALGAMNVVGSMTSCYVATGSFSRSAVNYMAG  411

Query  1064  CESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLD  885
             C++AVSN++M+  V ++L  +T L  +TP AILASII+SA+  LI+   A  IWK+DK D
Sbjct  412   CQTAVSNIIMSFIVFLTLLFITPLFKYTPNAILASIIISAVINLIDYEAAILIWKIDKFD  471

Query  884   FLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYP  705
             F+AC GAF GV+F SVEIGLL+AV +SFAKI+L   +P    LG LPG+  ++  + QYP
Sbjct  472   FVACMGAFFGVIFGSVEIGLLIAVVISFAKILLQVTRPRTALLGNLPGS-TIYRNMQQYP  530

Query  704   MAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMS  525
              A   PG+ ++R  S++  F+N+N+IK RIL  +++E+   ++ K+    RI  ++ +MS
Sbjct  531   EATNIPGILIVRVDSAIY-FSNSNYIKERILRWLVDEE---EKRKKLYRPRIQFLIVEMS  586

Query  524   NIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGE  348
              + ++DTS I +L+ELY  +    VQ  +ANP   VI KL  + F   I +  ++LT+  
Sbjct  587   PVTDIDTSGIHALEELYKSLQKRSVQLALANPGPVVIEKLHASHFTTLIGEHNIYLTVAH  646

Query  347   AIDAC  333
             A+ +C
Sbjct  647   AVSSC  651



>ref|XP_010030061.1| PREDICTED: sulfate transporter 1.3-like [Eucalyptus grandis]
Length=656

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/646 (49%), Positives = 453/646 (70%), Gaps = 11/646 (2%)
 Frame = -1

Query  2258  SQTLQKTSSTLPPAAERASWVLNVPEPP--GLSRKLEGSFKKTATFLGTAFQRLRKRP-V  2088
             +Q    T+ T       A ++  V  PP   L ++   + K+T  F     +  + +P  
Sbjct  11    AQETDVTNETSLQHHSEAPYIHKVGIPPKQNLMQEFTATLKET-LFADDPLRWFKDQPQS  69

Query  2087  QAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYT  1908
             +  +   +SVFP+L WG+ Y+L K + D++AGLT+ASLCIPQ IGY+ LANL PQYGLY+
Sbjct  70    RKFIIGIQSVFPILEWGRHYNLAKFRGDLIAGLTIASLCIPQDIGYSKLANLPPQYGLYS  129

Query  1907  SVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagif  1728
             S VPPLIYA MGSSR+IAIGPVAV+SLL+ +++    DPA NP  Y  L  T TFFAGI 
Sbjct  130   SFVPPLIYAFMGSSRDIAIGPVAVVSLLLGTLLHNEIDPAKNPNDYRRLAFTATFFAGIT  189

Query  1727  qaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIF  1548
             +   G  RLGFL+DFLSHAA+VGFM GAAI I LQQLK L GI+ FT +TD+VSV+  ++
Sbjct  190   EVMLGFFRLGFLIDFLSHAAVVGFMGGAAITIALQQLKDLLGITKFTKETDIVSVMRSVW  249

Query  1547  TSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRA  1368
              ++ H  WN   ++IG +FL+F+L+ +++G+K+RKLFW+PA+APL+SVILST  VY+T A
Sbjct  250   GTVAHG-WNWQTIVIGVTFLAFLLLAKYIGKKNRKLFWVPAIAPLISVILSTFFVYITHA  308

Query  1367  ENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKG  1188
             + H V IV  +K G+NPSS+ ++ F   ++ +  KIG +  ++ALTEAIA+G +FA+ K 
Sbjct  309   DKHHVAIVGKIKKGVNPSSVKEIFFTGTYLAKGFKIGVVAGMIALTEAIAIGRTFATTKD  368

Query  1187  YHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQ  1008
             Y +DGNKEM+A+G  N+ GS+TSCY+ATGSFSRSAVN+ AGC++AVSN+VM+  VL++L+
Sbjct  369   YQIDGNKEMIALGTMNVVGSMTSCYIATGSFSRSAVNYTAGCQTAVSNIVMSCVVLLTLE  428

Query  1007  LLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIG  828
             L+T L  +TP AILASII+SA+ GLI++  A  IWK+DKLDF+AC GAF GV+F SVEIG
Sbjct  429   LITPLFKYTPKAILASIIISAVVGLIDIEAAILIWKIDKLDFIACMGAFFGVVFVSVEIG  488

Query  827   LLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLC  648
             LL+AV +SFAKI+L   +P    LG+LP T  ++  I QYP A + PGV ++R  S++  
Sbjct  489   LLIAVSISFAKILLQVTRPRTAILGKLPRT-TVYRNILQYPEATKVPGVLIVRVDSAIY-  546

Query  647   FANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDK  468
             F+N+N+I+ RIL  + +E+   +  KE+++ RI  ++ +MS I ++DTS I +L EL+  
Sbjct  547   FSNSNYIRERILRWLGDEE---EYLKENNQPRIQYLIVEMSPITDIDTSGIRALDELHKS  603

Query  467   ITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             +    +Q V+ANP   V+ KL  + F + I +  +FLT+ +A+  C
Sbjct  604   LKKRDIQLVLANPGPVVMDKLHSSKFTDMIGEDNIFLTVSDAVVTC  649



>gb|ABK35753.1| sulfate transporter, partial [Populus tremula x Populus alba]
Length=466

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/461 (65%), Positives = 377/461 (82%), Gaps = 6/461 (1%)
 Frame = -1

Query  1703  LGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPW  1524
             LGFLVDFLSHAAIVGF++GAAIVIGLQQ+K L GI++FTNKTDV+SV+  I+ S+HH  W
Sbjct  8     LGFLVDFLSHAAIVGFVSGAAIVIGLQQMKGLLGIAHFTNKTDVISVMQAIWRSVHHY-W  66

Query  1523  NPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIV  1344
             NP+N I+G SFLSFI++TRF+G+++RKLFWLPA APL+SV+LSTLLVYLTRA+ HGV I+
Sbjct  67    NPHNFILGCSFLSFIILTRFVGKRNRKLFWLPATAPLISVVLSTLLVYLTRADKHGVMII  126

Query  1343  KHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKE  1164
             KH+K GLNP S+H+L FN PHI +V K G IVAV+A+TEA AVG SFAS+KGY ++GN+E
Sbjct  127   KHIKKGLNPGSIHELQFNNPHIGEVAKTGLIVAVIAITEATAVGRSFASIKGYRINGNQE  186

Query  1163  MLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYF  984
             M+A G  NI GS TSCYVATGSFSRSAVNF AGCE+A+SN+VMA+TV+ISL+L T+LLYF
Sbjct  187   MVAFGFMNILGSFTSCYVATGSFSRSAVNFSAGCETAMSNIVMAITVIISLELFTRLLYF  246

Query  983   TPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLS  804
             TP+A+L++IILSALPGL++ +EAY IWKVDKLDFL C GAF GVLFASVEIGLL AV +S
Sbjct  247   TPIAVLSAIILSALPGLVDPHEAYYIWKVDKLDFLVCIGAFFGVLFASVEIGLLAAVIIS  306

Query  803   FAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIK  624
             F KI++ SI+PG E+LGRLPGTD +F  ++QYPMAV+     +IR KS LLCFANANF+K
Sbjct  307   FVKIIIISIRPGTEELGRLPGTD-IFCDVNQYPMAVKNSKALIIRVKSGLLCFANANFVK  365

Query  623   ARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQF  444
              +I+    EE+    E     ++ + +++ DMSN+MN+D S I SL EL + + S G++ 
Sbjct  366   EKIMKWATEEE----ENDSKGKRTVQVVILDMSNLMNIDMSGIASLLELQNNLASGGMEL  421

Query  443   VIANPRWQVIHKLRLADFHNKIKGKVFLTIGEAIDACLVDK  321
              I NP+WQVIHKLRLA+F  K+ G+VFLT GEA+DACL  K
Sbjct  422   AITNPKWQVIHKLRLANFATKMGGRVFLTAGEAVDACLGAK  462



>gb|ACN39795.1| unknown [Picea sitchensis]
Length=666

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/628 (54%), Positives = 459/628 (73%), Gaps = 16/628 (3%)
 Frame = -1

Query  2198  VLNVPEPPGLSRKLEGSFK---KTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWGKQ  2031
             V  V  PP L  KL   FK   K   F    F++ + +P  Q +    E +FP+L WG+ 
Sbjct  41    VYRVGAPPRL--KLINEFKIAIKETLFPDDPFRQFKDQPRPQKIRLGVEGMFPILEWGRT  98

Query  2030  YSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAI  1851
             Y+L K K D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S +PP +YAVMGSSR+IAI
Sbjct  99    YTLSKFKGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFLPPFVYAVMGSSRDIAI  158

Query  1850  GPVAVISLLISSMVP-KLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSH  1674
             GPVAV+S+L+ ++V  +++D  S  A Y  L++T TFFAG+FQA  GI R GFL+DFLSH
Sbjct  159   GPVAVVSILLGTLVRNEIDDIKS--ADYHRLIITSTFFAGVFQAVLGICRFGFLIDFLSH  216

Query  1673  AAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfs  1494
             A+IVGFMAGAAI IGLQQLK L GI  FT KTD++SV+  ++ ++HH  WN   ++IG  
Sbjct  217   ASIVGFMAGAAITIGLQQLKLLLGIQTFTKKTDIISVMKSVWGAVHHG-WNWQTILIGVF  275

Query  1493  flsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPS  1314
             FL F+L  +++G+K+R+LFW+PA+APL+SVIL+TL+VYL+R++ HGV+IV H+K G+NPS
Sbjct  276   FLIFLLTAKYIGKKNRRLFWVPAVAPLISVILATLIVYLSRSDKHGVQIVNHIKKGINPS  335

Query  1313  SLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIA  1134
             S+ QL F+   + + VKIGF+ A++ALTE IA+G +FA++K YHLDGNKEMLA+GV N+A
Sbjct  336   SISQLAFSGTLLVKGVKIGFVAALIALTEGIAIGRTFAALKDYHLDGNKEMLAMGVMNVA  395

Query  1133  GSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASII  954
             GSLTSCYV TGSFSRSAVN+ AGC SAVSNVVM++ VL++L ++T L  +TP AILASII
Sbjct  396   GSLTSCYVTTGSFSRSAVNYNAGCRSAVSNVVMSIVVLLTLLVITPLFKYTPNAILASII  455

Query  953   LSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQ  774
             +SA+  LI++  A+ IWK DKLDFLAC GAF GV+F SVE GLL+AV LSF KI+L   +
Sbjct  456   ISAVINLIDIKAAHLIWKTDKLDFLACVGAFIGVVFKSVEYGLLIAVALSFGKILLQVTR  515

Query  773   PGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEE  594
             P    LGR+PGT+ +F  I QYP A +  G+ V+R  S++  F+NAN+I+ RIL  V +E
Sbjct  516   PRTALLGRIPGTN-IFRNIEQYPDASKIHGILVVRIDSAMY-FSNANYIRERILRWVDDE  573

Query  593   QKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVI  414
                 D+ +E ++ ++  +V +MS I+++DTS I +L+EL+       +Q  +ANP   VI
Sbjct  574   ---GDKIQEKAQMKLQFLVVEMSPIIDIDTSGIHALEELHTVFQKRDLQLALANPGRAVI  630

Query  413   HKLRLADFHNKIKGK-VFLTIGEAIDAC  333
              KL  + F + I  + +FLT+GEA+  C
Sbjct  631   DKLFSSKFVDTIGQEWIFLTVGEAVQTC  658



>ref|XP_003526594.1| PREDICTED: sulfate transporter 1.3-like isoform X1 [Glycine max]
 ref|XP_006581551.1| PREDICTED: sulfate transporter 1.3-like isoform X2 [Glycine max]
 ref|XP_006581552.1| PREDICTED: sulfate transporter 1.3-like isoform X3 [Glycine max]
 ref|XP_006581553.1| PREDICTED: sulfate transporter 1.3-like isoform X4 [Glycine max]
 gb|KHN09142.1| Sulfate transporter 1.3 [Glycine soja]
Length=661

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/656 (49%), Positives = 457/656 (70%), Gaps = 20/656 (3%)
 Frame = -1

Query  2288  TAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQ  2109
             T E++L     +++  +S    P A + +    +P    L ++ + + K+T  F     +
Sbjct  14    TKEIDL-----RSMSSSSLGQAPQAHKVA----IPPRQNLFKEFQSTIKET-FFSDDPLR  63

Query  2108  RLRKRP-VQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANL  1932
               + +P  + +    E++FP+LSWG+ Y+L K + D+++GLT+ASLCIPQ IGYA LA+L
Sbjct  64    PFKDQPRSRKIRLGIEAIFPILSWGRSYNLKKFRGDIISGLTIASLCIPQDIGYAKLAHL  123

Query  1931  DPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLT  1752
              PQYGLY+S VPPLIYAVMGSSR+IAIGPVAV+SLL+ +++    DP +NP  Y  L  T
Sbjct  124   APQYGLYSSFVPPLIYAVMGSSRDIAIGPVAVVSLLLGTLLSNEIDPKTNPTEYQRLAFT  183

Query  1751  VTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGI--SNFTNKT  1578
              TFFAGI QA  G+LRLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  ++FT  T
Sbjct  184   ATFFAGITQATLGVLRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKTAHFTTDT  243

Query  1577  DVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVIL  1398
             D+V V+  +F+  HH  WN   ++IG SFL F+L+ +++G+K++K FW+PA+APL+SVIL
Sbjct  244   DIVHVMRSVFSEAHHG-WNWQTILIGASFLGFLLVAKYIGKKNKKFFWVPAIAPLISVIL  302

Query  1397  STLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIA  1218
             ST  V++TRA+  GV IV+ ++ G+NPSS+  ++F   ++ +  KIG +  ++ALTEA A
Sbjct  303   STFFVFITRADKQGVDIVRKIEKGINPSSVKDIYFTGEYLGKGFKIGIVAGMIALTEATA  362

Query  1217  VGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVV  1038
             +G +FASMK Y LDGNKEM+A+G  N+ GSLTSCYVATGSFSRSAVN+ AGC++AVSN+V
Sbjct  363   IGRTFASMKDYQLDGNKEMVALGTMNVVGSLTSCYVATGSFSRSAVNYMAGCQTAVSNIV  422

Query  1037  MAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFA  858
             M+V VL++L+ +T L  +TP AIL++II+SA+  L++   A  IWK+DK DF+AC GAF 
Sbjct  423   MSVVVLLTLEFITPLFKYTPNAILSAIIISAVISLVDYEAAILIWKIDKFDFVACMGAFF  482

Query  857   GVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVF  678
             GV+F SVEIGLL+AV +SFAKI+L   +P    LG++P T  ++  I QYP A + PGV 
Sbjct  483   GVVFVSVEIGLLIAVSISFAKILLQVTRPRTAILGKIPRT-TVYRNIQQYPEASKIPGVL  541

Query  677   VIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSA  498
             ++R  S++  F+N+N++K R L  +M+E+   ++ K     +I  ++ +MS + ++DTS 
Sbjct  542   IVRVDSAIY-FSNSNYVKERTLRWLMDEE---EQEKGDYRTKIQFLIVEMSPVTDIDTSG  597

Query  497   IISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             I + +EL+  +   GV+ V+ANP   V  KL  + F N I + K+FLT+ EAI  C
Sbjct  598   IQAFEELHRSLEKKGVELVLANPGSAVTDKLYASSFANTIGEDKIFLTVAEAIAYC  653



>ref|XP_010667625.1| PREDICTED: sulfate transporter 1.2-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=684

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/665 (49%), Positives = 449/665 (68%), Gaps = 16/665 (2%)
 Frame = -1

Query  2321  MAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFK  2142
             MA  PT G   T E+++    S +  K  +       +    + VP    L ++   + K
Sbjct  26    MAGLPTNGDADTKEIDMA---SVSSSKRHNQYFDVHHK----VGVPSKQNLFKEFTHTVK  78

Query  2141  KTATFLGTAFQRLRKRPVQAVLSAS-ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIP  1965
             +T  F     +  + +P         ++VFP+L WG+ Y+L K K D+++GLT+ASLCIP
Sbjct  79    ET-FFADDPLRDFKDQPSSRKFKLGLQAVFPILEWGRGYNLNKFKGDLISGLTIASLCIP  137

Query  1964  QSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPAS  1785
             Q IGY+ LANLDPQYGLY+S +PPLIYA MGSSR+IAIGPVAV+SLL+ +++    DP  
Sbjct  138   QDIGYSKLANLDPQYGLYSSFIPPLIYACMGSSRDIAIGPVAVVSLLLGTLIQNEIDPIK  197

Query  1784  NPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLF  1605
             NP  Y  L  T TFFAGI Q   G  RLGFL+DFLSHAAIVGFM GAAI I LQQLK   
Sbjct  198   NPVEYRRLAFTATFFAGITQMTLGFFRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFL  257

Query  1604  GISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPA  1425
             GI  FT K+D++SVL  +F S+HH  WN   ++IG  FL+F+L  + +G++++KLFW+PA
Sbjct  258   GIKKFTKKSDIISVLHSVFGSMHHG-WNWQTILIGAVFLAFLLFAKLIGKRNKKLFWVPA  316

Query  1424  MAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVA  1245
             +APLLSVILST  V++T AE  GV IV H++ GLNPSSLHQL+F+  ++ +  KIG +  
Sbjct  317   IAPLLSVILSTFFVFVTHAEKEGVAIVNHIEKGLNPSSLHQLYFSGDNLLRGFKIGAVAG  376

Query  1244  VVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAG  1065
             ++ALTEA A+G +FA+MK Y LDGNKEM+A+G  N+ GS+TSCYVATGSFSRSAVN+ AG
Sbjct  377   MIALTEATAIGRTFAAMKDYQLDGNKEMVALGAMNVVGSMTSCYVATGSFSRSAVNYMAG  436

Query  1064  CESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLD  885
             C++AVSN++M+  V ++L  +T L  +TP AILASII+SA+  LI+   A  IWK+DK D
Sbjct  437   CQTAVSNIIMSFIVFLTLLFITPLFKYTPNAILASIIISAVINLIDYEAAILIWKIDKFD  496

Query  884   FLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYP  705
             F+AC GAF GV+F SVEIGLL+AV +SFAKI+L   +P    LG LPG+  ++  + QYP
Sbjct  497   FVACMGAFFGVIFGSVEIGLLIAVVISFAKILLQVTRPRTALLGNLPGS-TIYRNMQQYP  555

Query  704   MAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMS  525
              A   PG+ ++R  S++  F+N+N+IK RIL  +++E+   ++ K+    RI  ++ +MS
Sbjct  556   EATNIPGILIVRVDSAIY-FSNSNYIKERILRWLVDEE---EKRKKLYRPRIQFLIVEMS  611

Query  524   NIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGE  348
              + ++DTS I +L+ELY  +    VQ  +ANP   VI KL  + F   I +  ++LT+  
Sbjct  612   PVTDIDTSGIHALEELYKSLQKRSVQLALANPGPVVIEKLHASHFTTLIGEHNIYLTVAH  671

Query  347   AIDAC  333
             A+ +C
Sbjct  672   AVSSC  676



>gb|KDO80894.1| hypothetical protein CISIN_1g006132mg [Citrus sinensis]
 gb|KDO80895.1| hypothetical protein CISIN_1g006132mg [Citrus sinensis]
 gb|KDO80896.1| hypothetical protein CISIN_1g006132mg [Citrus sinensis]
 gb|KDO80897.1| hypothetical protein CISIN_1g006132mg [Citrus sinensis]
Length=659

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/630 (50%), Positives = 446/630 (71%), Gaps = 10/630 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWG  2037
             ER    + VP    L ++   + K+T  F     +  + R   Q  +   +++FP+  WG
Sbjct  28    ERYIHKVGVPPKQNLFKEFRETLKET-FFADDPLRPFKDRSRSQKFILGIQTIFPIFEWG  86

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             ++Y+L KL+ D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S VPPLIYA MGSSR+I
Sbjct  87    RKYNLKKLRGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLIYAFMGSSRDI  146

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+ +M+    DP +  A Y  L  T TFFAGI Q   G  RLGFL+DFLS
Sbjct  147   AIGPVAVVSLLLGTMLQNELDPINEKAQYQRLAFTATFFAGITQVTLGFFRLGFLIDFLS  206

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAA+ I LQQLK   GI  FT K+D++SV+  +  S HH  WN   + IG 
Sbjct  207   HAAIVGFMGGAAVTIALQQLKGFLGIKKFTKKSDIISVMHSVVASAHHG-WNWQTIAIGA  265

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSF+L  +F+G+K++K FW+PA+APL+SVILST  VY+TRA+  GV+IVK++K G+NP
Sbjct  266   SFLSFLLFAKFIGKKNKKFFWVPAIAPLISVILSTFFVYITRADKQGVQIVKNIKKGINP  325

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             SS+++++F+  ++ +  +IG +  ++ LTEAIA+G +FA+MK Y LDGNKEM+A+G  N+
Sbjct  326   SSVNEIYFSGDYLLKGFRIGVVAGMIGLTEAIAIGRTFAAMKDYQLDGNKEMVALGAMNV  385

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS+TSCYVATGSFSRSAVNF AGCE+AVSN+VM+  V ++L+ +T L  +TP AILASI
Sbjct  386   VGSMTSCYVATGSFSRSAVNFMAGCETAVSNIVMSCVVFLTLEFITPLFKYTPNAILASI  445

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             I++A+  LI++  A  +WK+DK DF+AC GAF GV+F+SVEIGLL+AV +SFAKI+L   
Sbjct  446   IINAVISLIDIGAATLLWKIDKFDFVACMGAFFGVVFSSVEIGLLIAVSISFAKILLQVT  505

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +P    LG++P T  ++  I QYP A + PGV ++R  S++  F+N+N++K RIL  + +
Sbjct  506   RPRTAILGKVPRT-TVYRNIQQYPEATKVPGVLIVRVDSAIY-FSNSNYVKERILRWLED  563

Query  596   EQKSADETKESS-EKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
             E+   +E K ++ + RI  ++ +MS + ++DTS I +L+ L+  +    VQ ++ANP   
Sbjct  564   EE---EEVKAATYQPRIQFLIVEMSPVTDIDTSGIHALEGLHRSLEKREVQLILANPGPV  620

Query  419   VIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             V+ KL  + F + I +  +FLT+ +A+ +C
Sbjct  621   VMDKLHASSFTSLIGEDNIFLTVADAVSSC  650



>ref|XP_011027674.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011027675.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011027676.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011027677.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011027678.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011027679.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015568.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015569.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015570.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015571.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015572.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
Length=664

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/668 (50%), Positives = 465/668 (70%), Gaps = 19/668 (3%)
 Frame = -1

Query  2315  IAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKT  2136
             ++P++ V  T E +L          +SS   P  + A +V  V  PP   + L   FK T
Sbjct  1     MSPSSVVHSTEE-DLEKTVMDIRSLSSSHRHP--QDAPYVHKVGLPP--KQNLFSEFKAT  55

Query  2135  AT---FLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCI  1968
                  F     +  + +P  +  +   +++FP+  WG+ Y+  K + D++AGLT+ASLCI
Sbjct  56    VKETFFADDPLRPFKDQPRSKMFILGLQAIFPIFEWGRSYNFSKFRGDLIAGLTIASLCI  115

Query  1967  PQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVP-KLEDP  1791
             PQ IGYA LANLDPQYGLY+S VPPLIYA MGSSR+IAIGPVAV+SLL+ +++  +++DP
Sbjct  116   PQDIGYAKLANLDPQYGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGTLLQNEIDDP  175

Query  1790  ASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKP  1611
               N A Y  L  T TFFAGI Q   G  RLGFL+DFLSHAAIVGFM GAAI I LQQLK 
Sbjct  176   VGNAAEYRRLAFTATFFAGITQVTLGFFRLGFLIDFLSHAAIVGFMGGAAITIALQQLKG  235

Query  1610  LFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWL  1431
               GI  FT KTDVVSV+  +F S HH  WN   ++IG SFLSF+L+ +++G+K++K FWL
Sbjct  236   FLGIKKFTKKTDVVSVMHSVFASAHHG-WNWQTIVIGVSFLSFLLVAKYIGKKNKKFFWL  294

Query  1430  PAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFI  1251
             PA+ PL+SVILST  VY+TRA+  GV+IVKH++ G+NPSS+ Q++FN  ++ + V+IG +
Sbjct  295   PAIGPLISVILSTFFVYITRADKQGVQIVKHIQQGINPSSVDQIYFNGDYLLKGVRIGIV  354

Query  1250  VAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFY  1071
               +VALTEAIA+G +FA+MK Y LDGNKEM+A+G  N+ GS+TSCYVATGSFSRSAVN+ 
Sbjct  355   AGMVALTEAIAIGRTFAAMKDYQLDGNKEMVALGTMNVVGSMTSCYVATGSFSRSAVNYM  414

Query  1070  AGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDK  891
             AGC++AVSN+VMA+ V ++L+ LT L  +TP AILA+II+SA+ GLI+ + AY IWK+DK
Sbjct  415   AGCQTAVSNIVMAIVVFLTLKFLTPLFKYTPNAILAAIIISAVIGLIDFDAAYLIWKIDK  474

Query  890   LDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQ  711
              DF+AC GAF GV+FASVEIGLL+AV +SFAKI+L   +P    LG LP T  ++  I Q
Sbjct  475   FDFVACMGAFFGVVFASVEIGLLIAVSISFAKILLQVTRPRTAILGNLPRT-TVYRNILQ  533

Query  710   YPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADE-TKESSEKRIALIVF  534
             YP A + PGV ++R  S++  F+N+N+IK RIL  +M+E    DE   +S   +I  ++ 
Sbjct  534   YPEAAKVPGVLIVRVDSAIY-FSNSNYIKERILRWLMDE----DELVNKSGLTKIQFLIV  588

Query  533   DMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLT  357
             +MS ++++DTS I +++EL+  +    +Q ++ANP   VI KL  +     I + K+FLT
Sbjct  589   EMSPVIDIDTSGIHAMEELFRCLQKREIQLILANPGPAVIDKLHASGSAQLIGEEKIFLT  648

Query  356   IGEAIDAC  333
             + +A+ +C
Sbjct  649   VADAVASC  656



>ref|XP_006341835.1| PREDICTED: sulfate transporter 1.3 [Solanum tuberosum]
Length=657

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/651 (49%), Positives = 459/651 (71%), Gaps = 13/651 (2%)
 Frame = -1

Query  2279  LELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPP--GLSRKLEGSFKKTATFLGTAFQR  2106
             ++ P   +  + + +S+   +     +V  V  PP   L +++  + K+T  F     + 
Sbjct  6     IDNPENMATDISRVASSRRHSENGLPYVHKVGVPPKTNLLKEITETVKET-FFHDDPLRN  64

Query  2105  LRKR-PVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLD  1929
              + +   + +L A ++VFP+L WG+ Y+L K K D+++GLT+A+LCIPQ IGYA LANLD
Sbjct  65    FKDQSKSKKLLLAIQAVFPILEWGRSYNLSKFKGDLISGLTIATLCIPQDIGYAKLANLD  124

Query  1928  PQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTV  1749
              Q+GLY+S VPPLIYA MGSSR+IAIGPVAV+SLL+ SM+ +  DP      Y  L  T 
Sbjct  125   AQFGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGSMLQQELDPVKQKHEYQRLAFTA  184

Query  1748  TffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVV  1569
             TFFAGI Q   G  RLGFL+DFLSHAAIVGFM GAAI I LQQLK L GI  FT KTD+V
Sbjct  185   TFFAGITQFVLGFFRLGFLIDFLSHAAIVGFMGGAAITISLQQLKGLLGIKKFTKKTDIV  244

Query  1568  SVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTL  1389
             SV+  +F + HH  WN   ++IG SFL+F+L+ +F+G+KH+K FW+PA+APL+SVILST 
Sbjct  245   SVMKSVFAAAHHG-WNWQTIVIGLSFLAFLLVAKFIGKKHKKFFWVPAIAPLISVILSTF  303

Query  1388  LVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGG  1209
              V++  AE H V+IV+H+  G+NP SL++++F+  ++ +  +IG I  ++ALTEA+A+G 
Sbjct  304   FVFIFHAEKHDVQIVRHIDQGINPPSLNEIYFSGEYLTKGFRIGVIAGLIALTEAVAIGR  363

Query  1208  SFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAV  1029
             +FA+MK Y LDGNKEM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC +AVSN+VM+ 
Sbjct  364   TFAAMKDYSLDGNKEMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCHTAVSNIVMSC  423

Query  1028  TVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVL  849
              VL++L+L+T L  +TP AILASII+SA+ GLI+++    ++K+DK DF+AC GAF GV+
Sbjct  424   VVLLTLELITPLFKYTPNAILASIIISAVIGLIDIDAMTLLYKIDKFDFVACMGAFLGVV  483

Query  848   FASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIR  669
             F SVEIGLL+AV +SFAKI+L   +P I  LG++P T  ++  I QYP + + PG+ ++R
Sbjct  484   FQSVEIGLLIAVAISFAKILLQVTRPRIVVLGKVPRT-RVYRNIQQYPESTKVPGILIVR  542

Query  668   TKSSLLCFANANFIKARILSLVMEEQKSADET-KESSEKRIALIVFDMSNIMNVDTSAII  492
               S++  F+N+N++K RIL  + +E    DE  KE+++++I  ++ +MS + ++DTS I 
Sbjct  543   VDSAIY-FSNSNYMKDRILRWLTDE----DEILKETNQQKIQYLIVEMSPVTDIDTSGIH  597

Query  491   SLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAI  342
             SL++LY  +    V+ V+ANP   VI KL  +   + I + K+FLT+ +A+
Sbjct  598   SLEDLYKSLQKRNVELVLANPGTMVIDKLHASGLADMIGEDKIFLTVADAV  648



>ref|XP_002534156.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF28228.1| sulfate transporter, putative [Ricinus communis]
Length=644

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/625 (50%), Positives = 448/625 (72%), Gaps = 13/625 (2%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + +P    L +++  + K+T  F     +  + +P  +  +   +++FP+L WG+ YSL 
Sbjct  22    VGLPSKQNLLKEISATVKET-LFSDDPLRPFKDQPRSRKFILGLQTLFPILEWGRDYSLA  80

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             KLK D+++GLT+ASLCIPQ IGYA LANL PQYGLY+S VPPL+YA MGSS++IAIGPVA
Sbjct  81    KLKGDLISGLTIASLCIPQDIGYAQLANLKPQYGLYSSFVPPLVYAFMGSSKDIAIGPVA  140

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ +++    DP  +P  Y  L  T TFFAGI Q   G LRLGFL+DFLSHAAIVG
Sbjct  141   VVSLLLGTLLQDEIDPTKDPVNYLRLAFTATFFAGITQVTLGFLRLGFLIDFLSHAAIVG  200

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FMAGAAI I LQQLK L GIS+FT KTD+VSV+  I++++HH  WN   ++IG SFL F+
Sbjct  201   FMAGAAITIALQQLKGLLGISHFTQKTDIVSVMRSIWSTVHHG-WNWQTVVIGVSFLVFL  259

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L+ + +G+K++KLFW+ A+APL+SVILST LVY+T A+ HGVKIV  +K G+NP SL ++
Sbjct  260   LLAKHIGKKNKKLFWISAIAPLVSVILSTFLVYITHADKHGVKIVSSIKRGVNPPSLDEI  319

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
              F   ++ +  +IG +  ++ALTEA+A+G +FA+MK Y +DGNKEM+A+G  N+ GS+TS
Sbjct  320   FFTGKYLGKGFRIGAVAGMIALTEAVAIGRTFAAMKDYQIDGNKEMVALGTMNVVGSMTS  379

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYV TGSFSRSAVNF +GC +AVSN+VM++ VL++L+ +T L  +TP AIL+SI++SA+ 
Sbjct  380   CYVTTGSFSRSAVNFMSGCNTAVSNIVMSLVVLLTLEFITPLFKYTPNAILSSIVISAVL  439

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI++     IW +DK DF+AC GAF GV+F+SVEIGLL+AV +SFAKI+L   +P    
Sbjct  440   GLIDIEAVILIWNIDKFDFVACMGAFFGVVFSSVEIGLLIAVSISFAKILLQVTRPRTAI  499

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG+LP T  ++  I QYP A +  G+ ++R  S++  F+N+N+IK RIL  + +E+   +
Sbjct  500   LGKLPRT-TVYRNIRQYPEASKVQGILIVRVDSAIY-FSNSNYIKERILRWLTDEE---E  554

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKL--  405
             + KE S  RI  ++ +MS + ++DTS I + KEL++ +    VQ V+ANP   V+ KL  
Sbjct  555   KLKEISLPRIQFLIVEMSPVTDIDTSGIHAFKELHNSLQKRDVQLVLANPGPVVVDKLHA  614

Query  404   -RLADFHNKIKGKVFLTIGEAIDAC  333
              RLA+     +  +FLT+ +A++AC
Sbjct  615   SRLAELIG--EDNIFLTVSDAVNAC  637



>gb|EYU36528.1| hypothetical protein MIMGU_mgv1a002617mg [Erythranthe guttata]
Length=653

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/579 (53%), Positives = 426/579 (74%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+  WG+ Y L K K D+++GLT+ASLCIPQ IGYA LANL PQYGLY+S VPPL+
Sbjct  73    QAVFPIFEWGRNYDLAKFKGDLISGLTIASLCIPQDIGYAKLANLAPQYGLYSSFVPPLV  132

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA MGSSR+IAIGPVAV+SLL+ +++    DP  +   Y  L  T TFFAGI QA  GIL
Sbjct  133   YAFMGSSRDIAIGPVAVVSLLLGTLLQNEIDPVKDAFEYRRLAFTATFFAGITQATLGIL  192

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAA+VGFMAGAAI I LQQLK   GI  FT  TD+VSV+  +F S HH  
Sbjct  193   RLGFLIDFLSHAAVVGFMAGAAITIALQQLKGFLGIKKFTKNTDIVSVMRSVFGSAHHG-  251

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG +FL F+L  +++G+K +KLFW+PA+APL+SV+LST  VY+T AEN GV+I
Sbjct  252   WNWETIVIGATFLVFLLFAKYIGKKSKKLFWVPAIAPLISVVLSTFFVYITHAENKGVQI  311

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V+H++ G+NP S+ +++ +  ++ + V+IG +  ++ALTEA+A+G +FA+MK Y +DGNK
Sbjct  312   VRHIEKGINPPSVKEIYLSGEYLLKGVRIGMVAGIIALTEAVAIGRTFAAMKDYQIDGNK  371

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NIAGS+TSCYVATGSFSRSAVN+ AGC++A SN+VM++ V ++LQ +T L  
Sbjct  372   EMVALGAMNIAGSMTSCYVATGSFSRSAVNYMAGCKTAASNIVMSIVVFLTLQFITPLFE  431

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AIL+SII+SA+ GLI+   A  IWK+DK DF+AC GAF GV+FASVEIGLL+AV +
Sbjct  432   YTPNAILSSIIISAVIGLIDYEAAILIWKIDKFDFIACMGAFFGVVFASVEIGLLIAVSI  491

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAK++L   +P    LG++P T+ ++  I QYP A + PGV +IR  S++  F+N+N+I
Sbjct  492   SFAKLLLQVTRPKTVILGKIPRTN-VYRNIQQYPEASKVPGVLIIRVDSAIY-FSNSNYI  549

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K RIL  + +E+   ++ K +    I  ++ +MS + ++DTS I +L+EL+  +    VQ
Sbjct  550   KERILRWLTDEE---EQLKAAGLFDIQFLIVEMSPVTDIDTSGIHALEELHRSLQKRDVQ  606

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VI KL  + F + + + K+FLT+ +AI  C
Sbjct  607   LVLANPGPVVIDKLHASKFASCLGEDKIFLTVADAIQTC  645



>ref|XP_010664070.1| PREDICTED: sulfate transporter isoform X1 [Vitis vinifera]
 ref|XP_010664071.1| PREDICTED: sulfate transporter isoform X1 [Vitis vinifera]
 emb|CBI19122.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/579 (54%), Positives = 431/579 (74%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             +++FP+L WG+ Y+L K + D++AGLT+ASLCIPQ IGYA LA+L+PQYGLY+S VPPLI
Sbjct  78    QAIFPILEWGRSYNLTKFRGDLIAGLTIASLCIPQDIGYAKLASLEPQYGLYSSFVPPLI  137

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA MGSSR+IAIGPVAV+SLL+ S++    DP  NPA Y  L  T TFFAGI QA  G  
Sbjct  138   YAFMGSSRDIAIGPVAVVSLLLGSLLRAEIDPTENPAEYLRLAFTATFFAGITQATLGFF  197

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI NFT +TD++SV+  ++ S+HH  
Sbjct  198   RLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKNFTKETDIISVMHSVWASVHHG-  256

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG +FL F+L  +++G+K++K FW+PA+APL+SVILST  VY+TRA+  GV+I
Sbjct  257   WNWQTIVIGATFLGFLLFAKYIGKKNKKFFWVPAIAPLISVILSTFFVYITRADKKGVQI  316

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             VKH+  G+NPSS  Q++F+  ++ +  KIG +  ++ALTEA+A+G +FASMK Y LDGNK
Sbjct  317   VKHIDKGINPSSASQIYFSGVYLLKGFKIGVVAGLIALTEAVAIGRTFASMKDYQLDGNK  376

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC++AVSN+VM+  V ++L+ +T L  
Sbjct  377   EMVALGAMNIVGSMTSCYVATGSFSRSAVNYMAGCKTAVSNIVMSCVVFLTLEFITPLFK  436

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILASII+SA+ GLI+ + A  IWK+DK DF+AC GAF GV+F SVEIGLL+AV +
Sbjct  437   YTPNAILASIIISAVIGLIDYDAAILIWKIDKFDFVACMGAFFGVVFKSVEIGLLIAVAI  496

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LG+LP T  ++  I QYP A + PG+ ++R  S++  F+N+N++
Sbjct  497   SFAKILLQVTRPRTAILGKLPRT-TVYRNIQQYPEATKIPGLLIVRIDSAIY-FSNSNYV  554

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K RIL  + +E+   +  K+++  R+  ++ +MS + ++DTS I +L+EL+  +    V+
Sbjct  555   KERILRWLTDEE---EHLKKANLPRVQFLIVEMSPVTDIDTSGIHALEELHRSLLKRDVK  611

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VI KL  + F + I + K+FLT+G+A+  C
Sbjct  612   LVLANPGQVVIDKLHASKFADDIGEDKIFLTVGDAVVTC  650



>ref|XP_008375007.1| PREDICTED: low affinity sulfate transporter 3 isoform X3 [Malus 
domestica]
Length=541

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/507 (65%), Positives = 404/507 (80%), Gaps = 9/507 (2%)
 Frame = -1

Query  2336  KYLAGMAIAPTTGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKL  2157
             K+L  MA  PT   E+ + +EL     Q   + +      AERA W+L+ P+PPGL ++L
Sbjct  40    KFLTTMASLPT---EVFSTVEL-----QQQHRHAEDTSGRAERAQWLLSSPDPPGLWQQL  91

Query  2156  EGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLAS  1977
                 K      G  + + +K P     S    +FP+LSWG+ Y   K K+DV+AGLTLAS
Sbjct  92    IHGIKSNLLPQGNRYSK-QKTPANRAFSLFRGLFPILSWGRNYKASKFKNDVMAGLTLAS  150

Query  1976  LCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLE  1797
             L +PQSIGYA LA LDPQYGLYTS+VPPLIY++MGSSRE+AIGPVAV+S+L+SS++ K+E
Sbjct  151   LSVPQSIGYANLAKLDPQYGLYTSIVPPLIYSLMGSSRELAIGPVAVVSMLLSSLIQKIE  210

Query  1796  DPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQL  1617
             DP +NP  Y +L+ TVTFFAGIFQAAFG+ RLGFLVDFLSHAAIVGFMAGAAIVIGLQQL
Sbjct  211   DPVANPIAYRNLLFTVTFFAGIFQAAFGLFRLGFLVDFLSHAAIVGFMAGAAIVIGLQQL  270

Query  1616  KPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLF  1437
             K L GIS+FT  TD++SVL  +F S+ H PW+P N+++G +FL F+LI RF+G++++KLF
Sbjct  271   KGLLGISHFTTNTDIISVLESVFDSIVHEPWHPLNIVLGCAFLIFLLIARFIGKRNKKLF  330

Query  1436  WLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIG  1257
             WLPA+APL+SVILSTL+VYLT+A+ HGV IVKH+KGGLNPSS HQL    PH+ Q  K G
Sbjct  331   WLPAIAPLISVILSTLIVYLTKADKHGVNIVKHIKGGLNPSSAHQLQLRGPHVRQAAKAG  390

Query  1256  FIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVN  1077
              I A++AL EAIAVG SFA++KGYHLDGNKEMLA+G  NIAGSLTSCYVATGSFSR+AVN
Sbjct  391   LISAIIALAEAIAVGRSFAAIKGYHLDGNKEMLAMGCMNIAGSLTSCYVATGSFSRTAVN  450

Query  1076  FYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKV  897
             F AGC++AVSN+VMA+TV++SL+LLT+LLYFTP+AILASIILSALPGLI++N AY IWKV
Sbjct  451   FSAGCQTAVSNIVMALTVILSLELLTRLLYFTPIAILASIILSALPGLIDINGAYHIWKV  510

Query  896   DKLDFLACAGAFAGVLFASVEIGLLVA  816
             DKLDFLAC GAF GVLFAS EIGLL A
Sbjct  511   DKLDFLACVGAFLGVLFASAEIGLLAA  537



>ref|XP_009758742.1| PREDICTED: sulfate transporter 1.3-like [Nicotiana sylvestris]
Length=652

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/621 (51%), Positives = 447/621 (72%), Gaps = 11/621 (2%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKR-PVQAVLSASESVFPLLSWGKQYSLV  2019
             + VP  P L +++  + K+T  F     +  + +   + +L   ++VFP+L WG+ Y+  
Sbjct  31    VGVPPKPNLLKEITETVKET-FFHDDPLRHFKDQSKTKKLLLGIQAVFPILDWGRSYNFS  89

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K K D+++GLT+ASLCIPQ IGYA LANLDPQYGLY+S VPPL+YA MGSSR+IAIGPVA
Sbjct  90    KFKGDLISGLTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLVYAFMGSSRDIAIGPVA  149

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ SM+    DP      Y  L  T TFFAGI Q   G  RLGFL+DFLSHAAIVG
Sbjct  150   VVSLLLGSMLQAELDPVKQKLEYQRLAFTATFFAGITQFILGFFRLGFLIDFLSHAAIVG  209

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FMAGAAI I LQQLK L GI  FT +TD+VSV+  +F + HH  WN   ++IG SFL+F+
Sbjct  210   FMAGAAITISLQQLKGLLGIKKFTKETDIVSVMKSVFAAAHHG-WNWQTIVIGVSFLAFL  268

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L+ +F+G+K++K FW+PA+AP++S+ILSTL V++  AE HGV+IV+H++ G+NP SL ++
Sbjct  269   LVAKFIGKKNKKYFWVPAIAPMISIILSTLFVFIFHAEKHGVQIVRHIEQGINPPSLKKI  328

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             +F+  ++ +  KIG I  ++ALTEA A+G +FA++K Y LDGNKEM+A+G  NI GS+TS
Sbjct  329   YFSGENLTKGFKIGAISGLIALTEAAAIGRTFAALKDYQLDGNKEMVALGTMNIVGSMTS  388

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSRSAVN+ AGC +AVSN++M+  VL++L+L+T L  +TP AILASII+SA+ 
Sbjct  389   CYVATGSFSRSAVNYMAGCHTAVSNIIMSCVVLLTLELITPLFKYTPNAILASIIISAVI  448

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI+++    ++K+DK DF+AC GAF GV+F SVEIGLL+AV +SFAKI+L   +P I  
Sbjct  449   GLIDIDAMKLLYKIDKFDFVACMGAFLGVVFESVEIGLLIAVAISFAKILLQVTRPRIAV  508

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG++P T  ++  I QYP A + PG+ ++R  S++  F+N+N+++ RIL  + +E    D
Sbjct  509   LGKVPRT-TVYRNIQQYPEATRVPGILIVRVDSAIY-FSNSNYMRDRILRWLTDE----D  562

Query  578   ET-KESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLR  402
             E  KE++++RI  ++ +MS + ++DTS I SL++L+  +    VQ V+ANP   V  KL 
Sbjct  563   EMLKETNQQRIQYLIVEMSPVTDIDTSGIHSLEDLFKSLHKRDVQLVLANPGPLVNDKLH  622

Query  401   LADFHNKI-KGKVFLTIGEAI  342
              + F + I +  +FLT+ +A+
Sbjct  623   ASGFPDMIGEDNIFLTVADAV  643



>ref|XP_009607386.1| PREDICTED: sulfate transporter 1.3-like [Nicotiana tomentosiformis]
Length=656

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/654 (49%), Positives = 457/654 (70%), Gaps = 16/654 (2%)
 Frame = -1

Query  2294  EMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTA  2115
             + + E++       + ++ S  LP   +     + VP  P L +++  S K+T  F    
Sbjct  7     DYSGEMDTDISRVASSRRHSDNLPYVHK-----VGVPPKPNLLKEITESVKET-FFHDDP  60

Query  2114  FQRLRKRPVQAVLSAS-ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALA  1938
              +  + +     L    ++VFP+L WG+ Y+L K K D+++GLT+ASLCIPQ IGYA LA
Sbjct  61    LRHFKDQSKTKKLRLGIQAVFPILDWGRSYNLSKFKGDLISGLTIASLCIPQDIGYAKLA  120

Query  1937  NLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLV  1758
             NLDPQYGLY+S VPPL+YA MGSSR+IAIGPVAV+SLL+ SM+    DP      Y  L 
Sbjct  121   NLDPQYGLYSSFVPPLVYAFMGSSRDIAIGPVAVVSLLLGSMLQAEFDPVKQKLEYQRLA  180

Query  1757  LTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKT  1578
              T TFFAGI Q   G  RLGFL+DFLSHAAIVGFMAGAAI I LQQLK L GI  FT +T
Sbjct  181   FTATFFAGITQFILGFFRLGFLIDFLSHAAIVGFMAGAAITISLQQLKGLLGIKKFTKET  240

Query  1577  DVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVIL  1398
              +VSV+  +F + HH  WN   ++IG SFL+F+L+ +F+G+K++K FW+PA+AP++S+IL
Sbjct  241   GIVSVMRSVFAAAHHG-WNWQTIVIGVSFLAFLLVAKFIGKKNKKYFWVPAIAPMISIIL  299

Query  1397  STLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIA  1218
             STL V++  AE HGV+IV+H+  G+NP SL Q++F+  ++ +  KIG I  ++ALTEA A
Sbjct  300   STLFVFIFHAEKHGVQIVRHIDRGINPPSLKQIYFSGENLTKGFKIGAISGLIALTEAAA  359

Query  1217  VGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVV  1038
             +G +FA++K Y LDGNKEM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC +AVSN++
Sbjct  360   IGRTFAALKDYQLDGNKEMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCHTAVSNII  419

Query  1037  MAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFA  858
             M+  VL++L+L+T L  +TP AILASII+SA+ GLI+++    ++K+DK DF+AC GAF 
Sbjct  420   MSCVVLLTLELITPLFKYTPNAILASIIISAVIGLIDIDAMKLLYKIDKFDFVACMGAFL  479

Query  857   GVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVF  678
             GV+F SVEIGLL+AV +SFAKI+L   +P I  LG++P T  ++  I QYP A + PG+ 
Sbjct  480   GVIFESVEIGLLIAVAISFAKILLQVTRPRIAVLGKVPRT-TVYRNIQQYPEATRVPGIL  538

Query  677   VIRTKSSLLCFANANFIKARILSLVMEEQKSADET-KESSEKRIALIVFDMSNIMNVDTS  501
             ++R  S++  F+N+N+++ RIL  + +E    DE  KE+++++I  ++ +MS + ++DTS
Sbjct  539   IVRVDSAIY-FSNSNYMRDRILRWLTDE----DEMLKETNQQKIQYLIVEMSPVTDIDTS  593

Query  500   AIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAI  342
              I SL++L+  +    VQ V+ANP   V  KL  + F + I + K+FLT+ +A+
Sbjct  594   GIHSLEDLFKSLQKRDVQLVLANPGPLVNDKLHASGFPDMIGEDKIFLTVADAV  647



>ref|XP_003574460.1| PREDICTED: sulfate transporter 1.2 [Brachypodium distachyon]
Length=657

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/654 (50%), Positives = 453/654 (69%), Gaps = 20/654 (3%)
 Frame = -1

Query  2246  QKTSSTLPPAAE--RASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQR--LRKRPVQAV  2079
             + + +T  PA +  +A  V  V  PP   + L   F  T T   T F    LR+   Q++
Sbjct  13    EPSVTTQAPAYDPSQAPLVYKVGYPP--QKNLASEF--TETLRETFFHDNPLRQYKDQSL  68

Query  2078  ----LSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLY  1911
                 +   E +FP+  WG+ Y+  K K D++AGLT+ASLCIPQ IGY+ LANLDPQYGLY
Sbjct  69    CRKFMIGLEFLFPVFEWGRDYNFSKFKGDLIAGLTIASLCIPQDIGYSKLANLDPQYGLY  128

Query  1910  TSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagi  1731
             +S +PPLIYA MGSSR+IAIGPVAV+SLLI S++    D   N   Y  L  T TFFAGI
Sbjct  129   SSFIPPLIYAAMGSSRDIAIGPVAVVSLLIGSLLQNEVDHVKNKEEYMRLAFTATFFAGI  188

Query  1730  fqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHI  1551
              QAA G LRLGFL++FLSHAAIVGFM GAAI I LQQLK + GIS FT KTD++SV+  +
Sbjct  189   TQAALGFLRLGFLIEFLSHAAIVGFMGGAAITIALQQLKYVLGISQFTRKTDIISVMESV  248

Query  1550  FTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTR  1371
             + S+HH  WN   ++IG SFL+F+L  +++G+K++KLFW+PA+AP++SVIL+T  VY+TR
Sbjct  249   WGSVHHG-WNWQTIVIGISFLAFLLFAKYIGKKNKKLFWVPAIAPIISVILATFFVYITR  307

Query  1370  AENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMK  1191
             A+  GV+IV+ ++ G+NPSS+H+++F  P + +  KIG +  +V LTEA+A+G +FA+MK
Sbjct  308   ADKQGVQIVRKIEKGINPSSVHKIYFTGPFLAKGFKIGLVCGIVGLTEAVAIGRTFAAMK  367

Query  1190  GYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISL  1011
              Y LDGNKEM+A+G  NI GS+TSCYVATGSFSRSAVNF AGC++ VSNVVM++ VL++L
Sbjct  368   DYQLDGNKEMVALGTMNIVGSMTSCYVATGSFSRSAVNFMAGCKTPVSNVVMSIVVLLTL  427

Query  1010  QLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEI  831
              ++T L  +TP AIL SII+SA+ GL++   A  IWKVDKLDF+AC GAF GV+FASVEI
Sbjct  428   LVITPLFKYTPNAILGSIIISAVIGLVDYEAAILIWKVDKLDFIACMGAFFGVVFASVEI  487

Query  830   GLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLL  651
             GLL+AV +SFAKI+L   +P    LG LPGT  ++    QYP A   PGV ++R  S++ 
Sbjct  488   GLLIAVSISFAKILLQVTRPRTALLGNLPGT-TIYRNTSQYPEARLIPGVVIVRVDSAIY  546

Query  650   CFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYD  471
              F+N+N+++ RIL  + + +   D+TK     +I  ++ +MS ++++DTS I +L++LY 
Sbjct  547   -FSNSNYVRERILRWLTDGE---DKTKAEGLPKINFLIVEMSPVIDIDTSGIHALEDLYK  602

Query  470   KITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDKNMQ  312
              +    +Q +++NP   VI KL  +     I    +FL + +A+  C   K+MQ
Sbjct  603   NLQKRDIQLILSNPGSIVIEKLHASKLTEHIGSSNIFLAVSDAVRFC-TTKSMQ  655



>ref|XP_011074140.1| PREDICTED: sulfate transporter 1.3 [Sesamum indicum]
 ref|XP_011074141.1| PREDICTED: sulfate transporter 1.3 [Sesamum indicum]
Length=654

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/591 (52%), Positives = 428/591 (72%), Gaps = 8/591 (1%)
 Frame = -1

Query  2102  RKRPVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQ  1923
             + R  Q VL   ++ FP+  WG++Y+  K K D++AGLT+ASLCIPQ IGY+ LANL PQ
Sbjct  63    QSRSRQFVLGM-QAAFPIFEWGRRYNFDKFKGDLIAGLTIASLCIPQDIGYSKLANLSPQ  121

Query  1922  YGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTf  1743
             YGLY+S VPPL+YA MGSSR+IAIGPVAV+SLL+ +++    DP  N   Y  L  T TF
Sbjct  122   YGLYSSFVPPLVYAFMGSSRDIAIGPVAVVSLLLGTLLQNEIDPEKNVVEYRRLAFTATF  181

Query  1742  fagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSV  1563
             FAGI QA  G+LR GFL+DFLSHAA+VGFMAGAAI I LQQLK   GI  FT  TD +SV
Sbjct  182   FAGITQATLGMLRFGFLIDFLSHAAVVGFMAGAAITIALQQLKGFLGIKKFTRSTDAISV  241

Query  1562  LTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLV  1383
             +  +F+S +H  WN   ++IG +FL+F+L  +++G+K+ KLFW+PA+APL+SV+LST+ V
Sbjct  242   MHSVFSSANHG-WNWQTIVIGATFLAFLLFAKYIGKKNNKLFWVPAIAPLISVVLSTVFV  300

Query  1382  YLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSF  1203
             Y+T AE  GV IVKH++ G+NP S  +++F   ++ + V+IG +  ++ALTEA+A+G +F
Sbjct  301   YITHAEKKGVAIVKHIEKGINPPSAKEIYFTGHYLLKGVRIGIVAGIIALTEAVAIGRTF  360

Query  1202  ASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTV  1023
             A+MK Y +DGNKEM+A+G  NIAGS+TSCYVATGSFSRSAVN+ AGC++AVSN+VM+V V
Sbjct  361   AAMKDYQIDGNKEMVALGAMNIAGSMTSCYVATGSFSRSAVNYMAGCQTAVSNIVMSVVV  420

Query  1022  LISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFA  843
              ++LQ +T L  +TP AIL+SII+SA+ GLI+ + A  IWK+DK DF+AC GAF GV+FA
Sbjct  421   FLTLQFITPLFEYTPNAILSSIIISAVIGLIDYDAAILIWKIDKFDFIACMGAFLGVVFA  480

Query  842   SVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTK  663
             SVEIGLL+AV +SFAK++L   +P    LG++P T+ ++  I QYP A + PGV +IR  
Sbjct  481   SVEIGLLIAVSISFAKLLLQVTRPRTALLGKIPRTN-VYRNIQQYPEASKVPGVLIIRVD  539

Query  662   SSLLCFANANFIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLK  483
             S++  F+N+N++K RIL  + +E+   +  K      I  ++ +MS + ++DTS I +L+
Sbjct  540   SAIY-FSNSNYVKERILRWLTDEE---ERVKAGGLLSIQFLIVEMSPVTDIDTSGIHALE  595

Query  482   ELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             EL+  +    VQ V+ANP   VI KL  + F   I + K+FLT+ +AI  C
Sbjct  596   ELFRSLEKRDVQLVLANPGPVVIDKLHASKFTTLIGEDKIFLTVADAIQTC  646



>ref|XP_004150525.1| PREDICTED: sulfate transporter 1.3-like [Cucumis sativus]
 ref|XP_004166671.1| PREDICTED: sulfate transporter 1.3-like [Cucumis sativus]
 gb|KGN54619.1| hypothetical protein Csa_4G379280 [Cucumis sativus]
Length=661

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/631 (50%), Positives = 451/631 (71%), Gaps = 13/631 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKT---ATFLGTAFQRLRKRPVQAVLSASESVFPLLS  2043
             ER    + VP    L ++++ + K+T      L +   + +KR     +   ++VFP+L 
Sbjct  32    ERYIHKVGVPPKQKLYKEIKSAVKETFFPDDPLRSFKDQTKKR---KFILGIQAVFPILD  88

Query  2042  WGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSR  1863
             WG+ Y+L K + DV++GLT+ASLCIPQ IGYA LANL P+YGLY+S VPPLIYA+MGSSR
Sbjct  89    WGRNYNLTKFRGDVISGLTIASLCIPQDIGYAKLANLSPEYGLYSSFVPPLIYAIMGSSR  148

Query  1862  EIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDF  1683
             +IAIGPVAV+SLL+ +++ +  D A+NP  Y  L  T TFFAGI QA  GILRLGFL+DF
Sbjct  149   DIAIGPVAVVSLLLGTLLQEEIDSATNPKDYLRLAFTATFFAGITQATLGILRLGFLIDF  208

Query  1682  LSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNlii  1503
             LSHAAIVGFM GAAI I LQQLK   GI  FT KTD++SV+  +F S+ H  WN   ++I
Sbjct  209   LSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKKTDIISVMQSVFGSMRHG-WNWQTIVI  267

Query  1502  gfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGL  1323
               +FL F+L  +++G+K+++LFW+PA+APL+SV+LST LV++T A+  GV IVKH++ G+
Sbjct  268   ATTFLGFLLFAKYMGKKNKRLFWVPAIAPLISVVLSTFLVFITHADKEGVAIVKHIEKGI  327

Query  1322  NPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVA  1143
             NP S+  L  +  ++ +  KIG +  +VALTEA+A+G +FASMK Y +DGNKEM+A+GV 
Sbjct  328   NPPSVKDLFLSGQYLLKGFKIGVVAGMVALTEAVAIGRTFASMKDYQIDGNKEMVAMGVM  387

Query  1142  NIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILA  963
             N+ GS++SCYVATGSFSRSAVN+ AGC++AVSN+VM++ VL++L  LT L  +TP AIL+
Sbjct  388   NVVGSMSSCYVATGSFSRSAVNYMAGCQTAVSNIVMSIVVLLTLAFLTPLFKYTPNAILS  447

Query  962   SIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLN  783
             +II+SA+  LI+L     IWK+DK DF+AC GAF GV+F SVEIGLLVAV +SFAKI+L 
Sbjct  448   AIIISAVINLIDLYAVKLIWKIDKFDFVACMGAFFGVIFFSVEIGLLVAVCISFAKILLQ  507

Query  782   SIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLV  603
               +P    LG++P T  ++  I QYP A + PG+ ++R  S++  F+N+N+IK RIL  +
Sbjct  508   VTRPRTAILGKIPRT-TVYRNILQYPEATKVPGLLIVRVDSAIY-FSNSNYIKERILRWL  565

Query  602   MEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRW  423
             ++E+   ++TK+  + +I  ++ +MS + ++DTS I +L+EL   +    +Q ++ANP  
Sbjct  566   VDEE---EQTKKLYQNKIQFLIVEMSPVTDIDTSGIHALEELNGSLKKREIQLILANPGP  622

Query  422   QVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ KL  ++F + I +  +FLT+ +A+ +C
Sbjct  623   VVMDKLHASEFVDLIGQDNIFLTVADAVSSC  653



>gb|EYU43601.1| hypothetical protein MIMGU_mgv1a004486mg [Erythranthe guttata]
Length=525

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/474 (67%), Positives = 377/474 (80%), Gaps = 11/474 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRL-------RKRPVQAVLSASESVF  2055
             ER  W+L+ P PP   +++  S K+T   L     R         K P+  +    +++F
Sbjct  41    ERGKWLLSSPNPPSPWQEIYTSVKETVLILPQPNNRQPRTNTNNNKWPILFL----QALF  96

Query  2054  PLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVM  1875
             P+L WG+ Y   K K+D++AGLTLASLCIPQSIGYA LANLDPQYGLYTSVVPPLIYA+M
Sbjct  97    PILKWGRNYKATKFKNDLMAGLTLASLCIPQSIGYANLANLDPQYGLYTSVVPPLIYALM  156

Query  1874  GSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGF  1695
             GSSREIAIGPVAV+SLL+S+M+ KL DP  +PAGY   V TVTFF G FQA FG+ RLGF
Sbjct  157   GSSREIAIGPVAVVSLLLSAMISKLVDPTVDPAGYRRFVFTVTFFTGTFQALFGLFRLGF  216

Query  1694  LVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPY  1515
             L+DFLSHAAIVGFM GAAIVIGLQQLK L GI++FT KTDVVSV+  +  +L H  W P 
Sbjct  217   LIDFLSHAAIVGFMGGAAIVIGLQQLKGLLGITHFTTKTDVVSVVGAVAKALIHHQWLPL  276

Query  1514  NliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHV  1335
             N +IG +FL FIL TRF+G++++KLFWLPAMAPL SV+LSTL+VYLT+A+ HGVKIVKH 
Sbjct  277   NFVIGCTFLIFILATRFVGRRNKKLFWLPAMAPLFSVVLSTLIVYLTKADKHGVKIVKHF  336

Query  1334  KGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLA  1155
             KGG+NP S++QL F   H+ Q  KIG I +++ALTEAIAVG SFAS+KGYHLDGNKEM+A
Sbjct  337   KGGINPISVNQLDFGGQHVGQAAKIGLICSLIALTEAIAVGRSFASIKGYHLDGNKEMVA  396

Query  1154  IGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPV  975
             +G  N+ GS TSCY ATGSFSR+AVNF AGCE+ VSN+VMA+TVLISL L T+LLY+TP+
Sbjct  397   MGFMNVIGSCTSCYTATGSFSRTAVNFSAGCETVVSNIVMAITVLISLLLFTRLLYYTPL  456

Query  974   AILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
             AILASIILSALPGLI++NEAY+IWKVDKLDFL C GAF GVLF SVEIGLLVAV
Sbjct  457   AILASIILSALPGLIDVNEAYNIWKVDKLDFLVCIGAFFGVLFGSVEIGLLVAV  510



>gb|AAK62820.1| high affinity sulfate transporter [Solanum lycopersicum]
Length=651

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/577 (53%), Positives = 429/577 (74%), Gaps = 9/577 (2%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+L WG+ Y+  K K D++AGLT+A+LCIPQ IGYA LANLD Q+GLY+S VPPL+
Sbjct  73    QAVFPILEWGRSYNFSKFKGDLIAGLTIATLCIPQDIGYAKLANLDAQFGLYSSFVPPLV  132

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA MGSSR+IAIGPVAV+SLL+ SM+ +  DP      Y  L  T TFFAG+ Q   G  
Sbjct  133   YAFMGSSRDIAIGPVAVVSLLLGSMLQQELDPVKQKHEYQRLAFTATFFAGVTQFVLGFF  192

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK L GI  FT KTD+VSV+  +F + HH  
Sbjct  193   RLGFLIDFLSHAAIVGFMGGAAITISLQQLKGLLGIKKFTKKTDIVSVMKSVFAAAHHG-  251

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG SFL+F+L+ +F+G+K++K FW+PA+APL+SVILST  V++  AE H V+I
Sbjct  252   WNWQTIVIGLSFLAFLLVAKFIGKKNKKYFWVPAIAPLISVILSTFFVFIFHAEKHDVQI  311

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V+H+  G+NP S+++++F+  ++ +  +IG I  ++ALTEA+A+G +FA+MK Y LDGNK
Sbjct  312   VRHIDQGINPPSVNEIYFSGEYLTKGFRIGVIAGLIALTEAVAIGRTFAAMKDYSLDGNK  371

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC++AVSN+VM+  VL++L+L+T L  
Sbjct  372   EMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCQTAVSNIVMSCVVLLTLELITPLFK  431

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILASII+SA+ GLI+++    ++K+DK DF+AC GAF GV+F SVEIGLL+AV +
Sbjct  432   YTPNAILASIIISAVIGLIDIDAMTLLYKIDKFDFVACMGAFLGVVFQSVEIGLLIAVAI  491

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P I  LG++P T  ++  + QYP + + PGV ++R  S++  F+N+N++
Sbjct  492   SFAKILLQVTRPRIVVLGKVPRT-RVYRNMQQYPESTKVPGVLIVRVDSAIY-FSNSNYM  549

Query  626   KARILSLVMEEQKSADET-KESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGV  450
             + RIL  + +E    DE  KE+++++I  ++ +MS + ++DTS I SL++LY  +    V
Sbjct  550   RDRILRWLTDE----DEMLKETNQQKIQYLIVEMSPVTDIDTSGIHSLEDLYKSLQKRNV  605

Query  449   QFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAI  342
             + V+ANP   VI KL  + F + I + K+FLT+ +A+
Sbjct  606   ELVLANPGTMVIDKLHASGFADMIGEDKIFLTVADAV  642



>ref|XP_009404054.1| PREDICTED: sulfate transporter 1.2-like [Musa acuminata subsp. 
malaccensis]
Length=637

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/578 (55%), Positives = 426/578 (74%), Gaps = 8/578 (1%)
 Frame = -1

Query  2060  VFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYA  1881
             +FP L WG+ Y+L KLK D++AGLT+ASLCIPQ IGYA LAN+DPQYGLY+S VPPL+YA
Sbjct  58    LFPALEWGRDYNLSKLKGDIIAGLTIASLCIPQDIGYAKLANMDPQYGLYSSFVPPLVYA  117

Query  1880  VMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRL  1701
             VMGSSR+IAIGPVAV+SLL+ +++    DP +    +  L  T TFFAG+ QAA G LRL
Sbjct  118   VMGSSRDIAIGPVAVVSLLLGALLQNEFDPVTQKEEFRRLAFTATFFAGVTQAALGFLRL  177

Query  1700  GFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWN  1521
             GFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT  TD+VSV+  ++ S+ H  WN
Sbjct  178   GFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKNTDIVSVMRSVWGSVEHG-WN  236

Query  1520  PYNliigfsflsfilITRFLGQKHRK-LFWLPAMAPLLSVILSTLLVYLTRAENHGVKIV  1344
                ++IG +FL+F+L  R++G+K ++ LFW+PA+APL+SVIL+TLLVY+TRA+ HGV+IV
Sbjct  237   WQTMLIGSAFLAFLLAARYIGKKKKQQLFWVPAIAPLISVILATLLVYVTRADKHGVQIV  296

Query  1343  KHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKE  1164
             K ++ G+NPSS+ Q+ F      +  +IG +  +VALTEA+A+G +FA+MK Y LDGNKE
Sbjct  297   KKIEKGINPSSVDQIRFAGSFAAKGFRIGVVAGMVALTEAVAIGRTFAAMKDYQLDGNKE  356

Query  1163  MLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYF  984
             M+A+G  N+ GS+TSCYV TGSFSRSAVN+ AGC + VSNVVM++ V+++L +LT L  +
Sbjct  357   MVALGTMNMLGSMTSCYVTTGSFSRSAVNYMAGCRTTVSNVVMSLVVMLTLLVLTPLFEY  416

Query  983   TPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLS  804
             TP AIL+SII+SA+ GLI+   AY IWKVD+ DF+AC GAF GV+F SVEIGLLVAV +S
Sbjct  417   TPNAILSSIIISAVLGLIDYEAAYLIWKVDRFDFMACMGAFFGVVFTSVEIGLLVAVSIS  476

Query  803   FAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIK  624
              AKI+L   +P    LG LPGT  ++  + QYP A++ PGV ++R  S++  F+N+N++K
Sbjct  477   LAKILLPVTRPRTALLGNLPGT-LIYRNVEQYPEAIRVPGVLIVRVDSAIY-FSNSNYVK  534

Query  623   ARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQF  444
              RIL  + EE+   ++   +   R+  ++ DMS + +VDTS I +LKEL+  +    VQ 
Sbjct  535   ERILRWLREEE---EQQNANDLPRVDFLIIDMSPVTDVDTSGIHALKELHRGLQKRDVQL  591

Query  443   VIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              IANP   V+ KLRLA+F   I + K+FLT+GEA+  C
Sbjct  592   GIANPGAVVVEKLRLAEFIELIGQEKLFLTVGEAVIGC  629



>ref|XP_010261543.1| PREDICTED: sulfate transporter 1.2-like [Nelumbo nucifera]
Length=649

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/623 (49%), Positives = 441/623 (71%), Gaps = 8/623 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + VP P  L +  + + K+T  F     +  + +P  + ++   +++FP+  WG+ YSL 
Sbjct  23    VGVPSPQNLLKDFKETVKET-LFPDDPLRPFKDQPRSRKLILGLQAIFPIFEWGRDYSLA  81

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K K D++AGLT+ASLCIPQ IGYA LANL PQYGLYTS VPPLIYAV+GSSR+IAIGP A
Sbjct  82    KFKGDLIAGLTIASLCIPQDIGYAKLANLAPQYGLYTSFVPPLIYAVLGSSRDIAIGPAA  141

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SL++ +M+    DP  N A Y  L  T TFFAGI QAA G+ RLGFL+DFLSHAAIVG
Sbjct  142   VVSLILGTMLQDEIDPVKNAADYRRLAFTATFFAGITQAALGLFRLGFLIDFLSHAAIVG  201

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             F++G AI I LQQLK   GI +FT KTD+VSV+  ++ S+HH  WN   ++IG +FL F+
Sbjct  202   FLSGTAITIALQQLKGFLGIKDFTRKTDIVSVMRSVWGSVHHG-WNWQTIVIGTTFLGFL  260

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L+ + +G+K+++ FW+PA+APL+SVILST  VY+ RA+  GV+IVKH+K G+N  S+H++
Sbjct  261   LLAKHIGKKNKRFFWIPAIAPLISVILSTFFVYIFRADKKGVQIVKHIKKGINQPSVHEI  320

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             +F   ++ + VKIG +  ++ALTEA+A+  +FASMK Y +DGNKEM+A+G  N+ GS+TS
Sbjct  321   YFTGKYVMKGVKIGAVAGMIALTEALAIARTFASMKDYQIDGNKEMVALGAMNVVGSMTS  380

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CY+ATGSFSRSAVN+ AGC++ +SNVVM++ VL++L+L+T L  +TP  IL++II+SA+ 
Sbjct  381   CYLATGSFSRSAVNYMAGCQTTISNVVMSIVVLLTLELITPLFKYTPSTILSAIIISAVI  440

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             G+I++     IW++DKLDF+ C GAF GV+F SVEIGLL+AV LS AKI+L   +P +  
Sbjct  441   GMIDIESMLLIWRIDKLDFVTCMGAFLGVVFDSVEIGLLIAVSLSLAKILLQVTRPRVVL  500

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG+LP    ++  I QYP A++ PG+ ++R  S++  F+N N++K RI   + +E+   +
Sbjct  501   LGKLPCKTTIYRNIDQYPDAMRVPGLLIVRVDSAIY-FSNCNYVKERIGRWLSDEE---E  556

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
             + K     RI  ++ D+S ++++DTS I SL++LY  +    VQ V+ANP   VI K   
Sbjct  557   KFKARFLPRIQFLIIDLSPVIDIDTSGIHSLEDLYKSLRKKDVQLVLANPGQAVIDKFHA  616

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             +     I + ++FLT+ +A+  C
Sbjct  617   SKLTELIGQDQIFLTVDDAVLKC  639



>ref|NP_001275426.1| high affinity sulfate transporter type 1 [Solanum tuberosum]
 gb|AAG41419.1|AF309643_1 high affinity sulfate transporter type 1 [Solanum tuberosum]
Length=657

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/651 (49%), Positives = 457/651 (70%), Gaps = 13/651 (2%)
 Frame = -1

Query  2279  LELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPP--GLSRKLEGSFKKTATFLGTAFQR  2106
             ++ P   +  + + +S+   +     +V  V  PP   L +++  + K+T  F     + 
Sbjct  6     IDNPENMATDISRVASSRRHSENGLPYVHKVGVPPKTNLLKEITETVKET-FFHDDPLRN  64

Query  2105  LRKR-PVQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLD  1929
              + +   + +L A ++VFP+L WG+ Y+L K K D+++GLT+A+LCIPQ IGYA LANLD
Sbjct  65    FKDQSKSKKLLLAIQAVFPILEWGRSYNLSKFKGDLISGLTIATLCIPQDIGYAKLANLD  124

Query  1928  PQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTV  1749
              Q+GLY+S VPPLIYA MGSSR+IAIGPVAV+SLL+ SM+    DP      Y  L  T 
Sbjct  125   AQFGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGSMLQPELDPVKQKHEYQRLAFTA  184

Query  1748  TffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVV  1569
             TFFAGI Q   G  RLGFL+DFLSHAAIVGFM GAAI   LQQLK L GI  FT KTD+V
Sbjct  185   TFFAGITQFVLGFFRLGFLIDFLSHAAIVGFMGGAAITTSLQQLKGLLGIKKFTKKTDIV  244

Query  1568  SVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTL  1389
             SV+  +F + HH  WN   ++IG SFL+F+L+ +F+G+KH+K FW+PA+APL+SVILST 
Sbjct  245   SVMKSVFAAAHHG-WNWQTIVIGLSFLAFLLVAKFIGKKHKKFFWVPAIAPLISVILSTF  303

Query  1388  LVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGG  1209
              V++  AE H V+IV+H+  G+NP SL++++F+  ++ +  +IG I  ++ALTEA+A+G 
Sbjct  304   FVFIFHAEKHDVQIVRHIDQGINPPSLNEIYFSGEYLTKGFRIGVIAGLIALTEAVAIGR  363

Query  1208  SFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAV  1029
             +FA+MK Y LDGNKE++A+G  NI GS+TSCYVATGSFSRSAVN+ AGC +AVSN+VM+ 
Sbjct  364   TFAAMKDYSLDGNKEIVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCHTAVSNIVMSC  423

Query  1028  TVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVL  849
              VL++L+L+T L  +TP AILASII+SA+ GLI+++    ++K+DK DF+AC GAF GV+
Sbjct  424   VVLLTLELITPLFKYTPNAILASIIISAVIGLIDIDAMTLLYKIDKFDFVACMGAFLGVV  483

Query  848   FASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIR  669
             F SVEIGLL+AV +SFAKI+L   +P I  LG++P T  ++  I QYP + + PG+ ++R
Sbjct  484   FQSVEIGLLIAVAISFAKILLQVTRPRIVVLGKVPRT-RVYRNIQQYPESTKVPGILIVR  542

Query  668   TKSSLLCFANANFIKARILSLVMEEQKSADET-KESSEKRIALIVFDMSNIMNVDTSAII  492
               S++  F+N+N++K RIL  + +E    DE  KE+++++I  ++ +MS + ++DTS I 
Sbjct  543   VDSAIY-FSNSNYMKDRILRWLTDE----DEILKETNQQKIQYLIVEMSPVTDIDTSGIH  597

Query  491   SLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAI  342
             SL++LY  +    V+ V+ANP   VI KL  +   + I + K+FLT+ +A+
Sbjct  598   SLEDLYKSLQKRNVELVLANPGTMVIDKLHASGLADMIGEDKIFLTVADAV  648



>ref|XP_010327388.1| PREDICTED: sulfate transporter 1 isoform X1 [Solanum lycopersicum]
Length=657

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/577 (53%), Positives = 429/577 (74%), Gaps = 9/577 (2%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+L WG+ Y+  K K D++AGLT+A+LCIPQ IGYA LANLD Q+GLY+S VPPL+
Sbjct  79    QAVFPILEWGRSYNFSKFKGDLIAGLTIATLCIPQDIGYAKLANLDAQFGLYSSFVPPLV  138

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA MGSSR+IAIGPVAV+SLL+ SM+ +  DP      Y  L  T TFFAG+ Q   G  
Sbjct  139   YAFMGSSRDIAIGPVAVVSLLLGSMLQQELDPVKQKHEYQRLAFTATFFAGVTQFVLGFF  198

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK L GI  FT KTD+VSV+  +F + HH  
Sbjct  199   RLGFLIDFLSHAAIVGFMGGAAITISLQQLKGLLGIKKFTKKTDIVSVMKSVFAAAHHG-  257

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG SFL+F+L+ +F+G+K++K FW+PA+APL+SVILST  V++  AE H V+I
Sbjct  258   WNWQTIVIGLSFLAFLLVAKFIGKKNKKYFWVPAIAPLISVILSTFFVFIFHAEKHDVQI  317

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V+H+  G+NP S+++++F+  ++ +  +IG I  ++ALTEA+A+G +FA+MK Y LDGNK
Sbjct  318   VRHIDQGINPPSVNEIYFSGEYLTKGFRIGVIAGLIALTEAVAIGRTFAAMKDYSLDGNK  377

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC++AVSN+VM+  VL++L+L+T L  
Sbjct  378   EMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCQTAVSNIVMSCVVLLTLELITPLFK  437

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILASII+SA+ GLI+++    ++K+DK DF+AC GAF GV+F SVEIGLL+AV +
Sbjct  438   YTPNAILASIIISAVIGLIDIDAMTLLYKIDKFDFVACMGAFLGVVFQSVEIGLLIAVAI  497

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P I  LG++P T  ++  + QYP + + PGV ++R  S++  F+N+N++
Sbjct  498   SFAKILLQVTRPRIVVLGKVPRT-RVYRNMQQYPESTKVPGVLIVRVDSAIY-FSNSNYM  555

Query  626   KARILSLVMEEQKSADET-KESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGV  450
             + RIL  + +E    DE  KE+++++I  ++ +MS + ++DTS I SL++LY  +    V
Sbjct  556   RDRILRWLTDE----DEMLKETNQQKIQYLIVEMSPVTDIDTSGIHSLEDLYKSLQKRNV  611

Query  449   QFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAI  342
             + V+ANP   VI KL  + F + I + K+FLT+ +A+
Sbjct  612   ELVLANPGTMVIDKLHASGFADMIGEDKIFLTVADAV  648



>ref|XP_004299604.1| PREDICTED: sulfate transporter 1.3-like [Fragaria vesca subsp. 
vesca]
Length=651

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/579 (54%), Positives = 431/579 (74%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+L WG+ Y+LV  + D++AGLT+ASLCIPQ IGY+ LANL PQYGLY+S VPPLI
Sbjct  71    QAVFPILEWGRNYNLVNFRGDLIAGLTIASLCIPQDIGYSKLANLAPQYGLYSSFVPPLI  130

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAVMGSSR+IAIGPVAV+SLL+ +++    DP +NP  Y  L  T TFFAGI QA  GIL
Sbjct  131   YAVMGSSRDIAIGPVAVVSLLLGTLLQNEIDPTTNPEDYLRLAFTATFFAGITQATLGIL  190

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             R+GFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT KTD++SV+  +F+S  +  
Sbjct  191   RMGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKKTDIISVMDSVFSSAQNG-  249

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG SFL+F+++ +++G+K++K FW+PA+APL+SV+LST  VY+TRA+  GV+I
Sbjct  250   WNWQTIVIGASFLTFLIVCKYIGKKNKKFFWVPAIAPLISVVLSTFFVYITRADKQGVEI  309

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V+H++ G+NPSS+ Q+ F   ++ +  KIG +  ++ALTEAIA+G +FA+MK Y +DGNK
Sbjct  310   VRHIEKGINPSSVKQIFFTGDYVAKGFKIGIVAGMIALTEAIAIGRTFAAMKDYQIDGNK  369

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS TSCYVATGSFSRSAVN+ AGC+SAVSN++M+V V ++LQ +T L  
Sbjct  370   EMVAMGTMNIIGSFTSCYVATGSFSRSAVNYMAGCQSAVSNIIMSVVVFLTLQFITPLFK  429

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILA+II+SA+  LI+   A  IWK+DK DF+AC GAF GV+FASVEIGLL+AV +
Sbjct  430   YTPNAILAAIIISAVINLIDFQAAILIWKIDKFDFVACMGAFFGVIFASVEIGLLIAVTI  489

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LG++P T  ++  I QYP A + PGV ++R  S++  F+N+N+I
Sbjct  490   SFAKILLQVTRPRTALLGKIPST-TVYRNIQQYPEATKVPGVMIVRVDSAIY-FSNSNYI  547

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             K RIL  + +E+   ++ K +    I  ++ +MS + ++DTS I +L+EL+  + + G+Q
Sbjct  548   KERILRWLADEE---EQLKAAYLPNIQFLIVEMSPVTDIDTSGIHALEELHKSLQNRGIQ  604

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VI KL  +   N I + ++FLT+ EA+ +C
Sbjct  605   LVLANPGPVVIDKLHASHVANLIGEDRIFLTVAEAVSSC  643



>ref|XP_007136221.1| hypothetical protein PHAVU_009G028500g [Phaseolus vulgaris]
 gb|ESW08215.1| hypothetical protein PHAVU_009G028500g [Phaseolus vulgaris]
Length=661

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/581 (53%), Positives = 425/581 (73%), Gaps = 9/581 (2%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             E++FP+L WG+ Y+L K + D+++GLT+ASLCIPQ IGY+ LA+L PQYGLY+S VPPLI
Sbjct  79    EAIFPILKWGRSYNLKKFRGDLISGLTIASLCIPQDIGYSRLAHLPPQYGLYSSFVPPLI  138

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YAVMGSSR+IAIGPVAV+SLL+ +++    DP  N A Y  L  T TFFAGI QA  GIL
Sbjct  139   YAVMGSSRDIAIGPVAVVSLLLGTLLSNEIDPTKNAAEYQRLAFTATFFAGITQATLGIL  198

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISN--FTNKTDVVSVLTHIFTSLHH  1533
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI    FT KTD++SV+  +F + HH
Sbjct  199   RLGFLIDFLSHAAIVGFMGGAAITISLQQLKGFLGIKTKMFTTKTDIISVMHSVFNTAHH  258

Query  1532  SPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGV  1353
               WN   ++IG SFL F+L+ +++G+K+R+LFWLPA+APL+SVILST  V++TRA+  GV
Sbjct  259   G-WNWQTIVIGASFLGFLLVAKYIGKKNRRLFWLPAIAPLISVILSTFFVFITRADKQGV  317

Query  1352  KIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDG  1173
             +IV+ ++ G+NPSS+  L+    ++ +  KIG +  ++ALTEA A+G +FASMK Y LDG
Sbjct  318   EIVRKIEKGINPSSVKDLYLTGENLGKGFKIGIVAGMIALTEASAIGRTFASMKDYQLDG  377

Query  1172  NKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKL  993
             NKEM+A+G  N+ GS+TSCYVATGSFSRSAVNF AGC++AVSN+VM+V V ++L+ +T L
Sbjct  378   NKEMVALGAMNVVGSMTSCYVATGSFSRSAVNFMAGCQTAVSNIVMSVVVFLTLEFITPL  437

Query  992   LYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAV  813
               +TP AIL++II+SA+  LI+   A  IWK+DK DF+AC GAF GV+F SVEIGLL+AV
Sbjct  438   FKYTPNAILSAIIISAVINLIDYEAAILIWKIDKFDFVACMGAFFGVVFVSVEIGLLIAV  497

Query  812   GLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANAN  633
              +SFAKI+L   +P    LG++P T  ++  I QYP A + PGV ++R  S++  F+N+N
Sbjct  498   SISFAKILLQVTRPRTAILGKIPRT-TVYRNIQQYPEASKVPGVLIVRVDSAIY-FSNSN  555

Query  632   FIKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCG  453
             ++K R +  +M+E+   ++ K     +I  ++ ++S + ++DTS I S +EL+  +   G
Sbjct  556   YVKERTIRWLMDEE---EKVKGDYRTKIQFLILELSPVTDIDTSGIQSFEELHRSLEKRG  612

Query  452   VQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             V+ V+ANP   V  KL  ++F N + + K+FLT+ EA+  C
Sbjct  613   VELVLANPGPAVTDKLYASNFANTLGEDKIFLTVAEAVAYC  653



>emb|CDO97472.1| unnamed protein product [Coffea canephora]
Length=658

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/619 (50%), Positives = 441/619 (71%), Gaps = 5/619 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRPVQAVLSASESVFPLLSWGKQYSLVK  2016
             + VP    L  + + +FK+T            +   + +L   ++VFP+L WG+ YSL K
Sbjct  35    VGVPPKQNLFTEFKTTFKETFMHDDPLRSFKDQSNSKKLLLGLQAVFPILDWGRSYSLSK  94

Query  2015  LKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAV  1836
              + D++AGLT+ASLCIPQ IGY+ LANL PQYGLY+S VPPLIYA MGSSR+IAIGPVAV
Sbjct  95    FRGDLIAGLTIASLCIPQDIGYSKLANLAPQYGLYSSFVPPLIYAAMGSSRDIAIGPVAV  154

Query  1835  ISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGF  1656
             +SLL+ +++    DP      Y  L  T TFFAG+ Q A G  RLGFL+DFLSHAA+VGF
Sbjct  155   VSLLLGTLIQDEFDPVKQKLDYQRLAFTATFFAGLTQFALGFFRLGFLIDFLSHAAVVGF  214

Query  1655  MAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfil  1476
             M G AI I LQQLK L GI  FT KTD+VSV+  ++TS+HH  WN   ++IG +FL+F+L
Sbjct  215   MGGTAITIALQQLKGLLGIKKFTKKTDIVSVMRSVWTSVHHG-WNWETVVIGVAFLAFLL  273

Query  1475  ITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLH  1296
             + +++G+K++KLFW+ A+APL+SVI+ST  VY+T AE  GV+IV  ++ G+NPSS+H++ 
Sbjct  274   LAKYIGKKNKKLFWVSAIAPLISVIISTFFVYITHAEKKGVQIVNKIEKGINPSSVHEIF  333

Query  1295  FNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSC  1116
             F   ++ +  +IG +  ++ALTEA+A+  +FA+MK YH+DGN+EM+A+G  N+ GS+TSC
Sbjct  334   FTGENLGKGFRIGVVAGMIALTEAVAIARTFAAMKDYHIDGNREMVALGTMNVIGSMTSC  393

Query  1115  YVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPG  936
             YVATGSFSRSAVN+ AGC +AVSN+VM++ VL++L+++T L  +TP AILASII+SA+ G
Sbjct  394   YVATGSFSRSAVNYMAGCNTAVSNIVMSLVVLLTLEVITPLFKYTPNAILASIIISAVVG  453

Query  935   LINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKL  756
             LI++N    IWK+DK DF+AC GAF GV+F SVEIGLL+AV +SFAKI+L   +P    L
Sbjct  454   LIDINAMLLIWKIDKFDFIACMGAFFGVVFVSVEIGLLIAVAISFAKILLQVTRPRTAVL  513

Query  755   GRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADE  576
             G++P T+ ++  I QYP A + PG+ ++R  S++  F+N+N+I+ RIL  + +E++   E
Sbjct  514   GKVPRTN-VYRNIQQYPEAAKVPGILIVRVDSAIY-FSNSNYIRERILRWLSDEEEQLKE  571

Query  575   TKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLA  396
               E   K   LIV +MS + ++DTS I +L+EL++ +    +Q V+ANP   V  KL  +
Sbjct  572   NGELKSKIHCLIV-EMSPVTDIDTSGIHALEELHNSLRKKDIQLVLANPGPVVADKLHAS  630

Query  395   DFHNKI-KGKVFLTIGEAI  342
             DF + I +  +FLT+ +A+
Sbjct  631   DFTSLIGEDNIFLTVADAV  649



>gb|AAM14588.1|AF493790_1 putative sulphate transporter [Oryza sativa Indica Group]
 gb|AAM14590.1|AF493792_1 putative sulphate transporter [Oryza sativa Indica Group]
 gb|EAY88895.1| hypothetical protein OsI_10374 [Oryza sativa Indica Group]
Length=662

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/622 (51%), Positives = 447/622 (72%), Gaps = 13/622 (2%)
 Frame = -1

Query  2192  NVPEPPGLSRKLEGSFK---KTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWGKQYS  2025
              V  PP   +KL   F    K   F     ++ + +P+ + VL + ++ FP+L WG+ Y+
Sbjct  38    KVEFPP--KKKLIDEFTDAVKETFFADDPLRQYKDQPMSKKVLISLQNFFPVLDWGRHYT  95

Query  2024  LVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGP  1845
               K + D+++GLT+ASLCIPQ IGYA LA L P YGLY+S VPPLIYA+MGSSR+IAIGP
Sbjct  96    FRKFRGDLVSGLTIASLCIPQDIGYAKLAGLLPNYGLYSSFVPPLIYAMMGSSRDIAIGP  155

Query  1844  VAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAI  1665
             VAV+SLL+ +++    DP  N   YT L  T TFFAG+ QA  G LRLGF+++FLSHAAI
Sbjct  156   VAVVSLLLGTLLQNEFDPKKNQEEYTRLAFTATFFAGVTQAVLGFLRLGFIIEFLSHAAI  215

Query  1664  VGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsfls  1485
             VGFMAGAAI I LQQLK   GI+NFT KTD++SV+  ++ ++HH  WN   ++IG SFL+
Sbjct  216   VGFMAGAAITIALQQLKGFLGIANFTKKTDIISVMKSVWGNVHHG-WNWQTILIGASFLT  274

Query  1484  filITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLH  1305
             F+L+ +++ +K++KLFW+ A+APL SVI+STL VY+TRA+ HGV IVK++K G+NP S  
Sbjct  275   FLLVAKYIAKKNKKLFWVAAIAPLTSVIISTLFVYITRADKHGVVIVKYIKKGINPPSAS  334

Query  1304  QLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSL  1125
              ++F+ P++ +  +IG I  ++ LTEAIA+G +FA +K Y +DGNKEM+A+G  NI GS+
Sbjct  335   LIYFSGPNLMKGFRIGVIAGMIGLTEAIAIGRTFAGLKDYKIDGNKEMVALGTMNIVGSM  394

Query  1124  TSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSA  945
             TSCYVATGSFSRSAVN+ AGC++AVSN+VM++ VL++L+L+T L  +TP AIL+SII+SA
Sbjct  395   TSCYVATGSFSRSAVNYMAGCQTAVSNIVMSIVVLLTLELITPLFKYTPNAILSSIIISA  454

Query  944   LPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGI  765
             + GL++ + AY IWKVDKLDFLAC GAF GV+F+SVE GLL+AV +S AKI+L   +P  
Sbjct  455   VLGLVDYHTAYLIWKVDKLDFLACLGAFFGVIFSSVEYGLLIAVAISLAKILLQVTRPRT  514

Query  764   EKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKS  585
               LG LP T  L+  I QYP A   PGV ++R  S++  F N+N++K RIL  + +E++ 
Sbjct  515   VLLGNLPRT-TLYRNIDQYPEATLVPGVVIVRVDSAIY-FTNSNYVKDRILRWLRDEEER  572

Query  584   ADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKL  405
               E K    ++   ++ ++S ++++DTS I +L++L+  +    +Q ++ANP   VI KL
Sbjct  573   QQEQK---LQKTEFLIVELSPVIDIDTSGIHALEDLFRALEKRKIQLILANPGPAVILKL  629

Query  404   RLADFHNKI-KGKVFLTIGEAI  342
             R A F + I + K+FLT+G+A+
Sbjct  630   RSAKFTDLIGEDKIFLTVGDAV  651



>ref|NP_001049259.1| Os03g0195800 [Oryza sativa Japonica Group]
 gb|AAN59767.1| Putative sulfate transporter [Oryza sativa Japonica Group]
 gb|ABF94449.1| Sulfate transporter 1.2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11173.1| Os03g0195800 [Oryza sativa Japonica Group]
 gb|EAZ25922.1| hypothetical protein OsJ_09765 [Oryza sativa Japonica Group]
 dbj|BAG95832.1| unnamed protein product [Oryza sativa Japonica Group]
Length=662

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/622 (51%), Positives = 448/622 (72%), Gaps = 13/622 (2%)
 Frame = -1

Query  2192  NVPEPPGLSRKLEGSFK---KTATFLGTAFQRLRKRPV-QAVLSASESVFPLLSWGKQYS  2025
              V  PP   +KL   F    K   F     ++ + +P+ + VL + ++ FP+L WG+ Y+
Sbjct  38    KVEFPP--KKKLIDEFTDAVKETFFADDPLRQYKDQPMSKKVLISLQNFFPVLDWGRHYT  95

Query  2024  LVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGP  1845
               K + D+++GLT+ASLCIPQ IGYA LA L P YGLY+S VPPLIYA+MGSSR+IAIGP
Sbjct  96    FRKFRGDLVSGLTIASLCIPQDIGYAKLAGLLPNYGLYSSFVPPLIYAMMGSSRDIAIGP  155

Query  1844  VAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAI  1665
             VAV+SLL+ +++    DP  N   YT L  T TFFAG+ QAA G LRLGF+++FLSHAAI
Sbjct  156   VAVVSLLLGTLLQNEFDPKKNQEEYTRLAFTATFFAGVTQAALGFLRLGFIIEFLSHAAI  215

Query  1664  VGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsfls  1485
             VGFMAGAAI I LQQLK   GI+NFT KTD++SV+  ++ ++HH  WN   ++IG SFL+
Sbjct  216   VGFMAGAAITIALQQLKGFLGIANFTKKTDIISVMKSVWGNVHHG-WNWQTILIGASFLA  274

Query  1484  filITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLH  1305
             F+L+ +++ +K++KLFW+ A+APL SVI+STL VY+TRA+ HGV IVK++K G+NP S  
Sbjct  275   FLLVAKYIAKKNKKLFWVAAIAPLTSVIISTLFVYITRADKHGVVIVKYIKKGINPPSAS  334

Query  1304  QLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSL  1125
              ++F+ P++ +  +IG I  ++ LTEAIA+G +FA +K Y +DGNKEM+A+G  NI GS+
Sbjct  335   LIYFSGPNLMKGFRIGVIAGMIGLTEAIAIGRTFAGLKDYKIDGNKEMVALGTMNIVGSM  394

Query  1124  TSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSA  945
             TSCYVATGSFSRSAVN+ AGC++AVSN+VM++ VL++L+L+T L  +TP AIL+SII+SA
Sbjct  395   TSCYVATGSFSRSAVNYMAGCQTAVSNIVMSIVVLLTLELITPLFKYTPNAILSSIIISA  454

Query  944   LPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGI  765
             + GL++ + AY IWKVDKLDFLAC GAF GV+F+SVE GLL+AV +S AKI+L   +P  
Sbjct  455   VLGLVDYHTAYLIWKVDKLDFLACLGAFFGVIFSSVEYGLLIAVAISLAKILLQVTRPRT  514

Query  764   EKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKS  585
               LG LP T  L+  I QYP A   PGV ++R  S++  F N+N++K RIL  + +E++ 
Sbjct  515   VLLGNLPRT-TLYRNIDQYPEATLVPGVVIVRVDSAIY-FTNSNYVKDRILRWLRDEEER  572

Query  584   ADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKL  405
               E K    ++   ++ ++S ++++DTS I +L++L+  +    +Q ++ANP   VI KL
Sbjct  573   QQEQK---LQKTEFLIVELSPVIDIDTSGIHALEDLFRALEKRKIQLILANPGPAVILKL  629

Query  404   RLADFHNKI-KGKVFLTIGEAI  342
             R A F + I + K+FLT+G+A+
Sbjct  630   RSAKFTDLIGEDKIFLTVGDAV  651



>ref|XP_006434033.1| hypothetical protein CICLE_v10000528mg [Citrus clementina]
 ref|XP_006434034.1| hypothetical protein CICLE_v10000528mg [Citrus clementina]
 ref|XP_006434035.1| hypothetical protein CICLE_v10000528mg [Citrus clementina]
 gb|ESR47273.1| hypothetical protein CICLE_v10000528mg [Citrus clementina]
 gb|ESR47274.1| hypothetical protein CICLE_v10000528mg [Citrus clementina]
 gb|ESR47275.1| hypothetical protein CICLE_v10000528mg [Citrus clementina]
Length=659

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/629 (49%), Positives = 445/629 (71%), Gaps = 10/629 (2%)
 Frame = -1

Query  2213  ERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWG  2037
             ER    + VP    L ++   + K+T  F     +  + +   Q  +   +++FP+  WG
Sbjct  28    ERYIHKVGVPPKQNLFKEFRETLKET-FFADDPLRPFKDQSRSQKFILGIQTIFPIFEWG  86

Query  2036  KQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREI  1857
             ++Y+L KL+ D++AGLT+ASLCIPQ IGYA LANLDPQYGLY+S VPPLIYA MGSSR+I
Sbjct  87    RKYNLKKLRGDLIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLIYAFMGSSRDI  146

Query  1856  AIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLS  1677
             AIGPVAV+SLL+ +M+    DP +  A Y  L  T TFFAGI Q   G  RLGFL+DFLS
Sbjct  147   AIGPVAVVSLLLGTMLQNELDPINEKAQYQRLAFTATFFAGITQVTLGFFRLGFLIDFLS  206

Query  1676  HAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigf  1497
             HAAIVGFM GAA+ I LQQLK   GI  FT K+D++SV+  +  S HH  WN   + IG 
Sbjct  207   HAAIVGFMGGAAVTIALQQLKGFLGIKKFTKKSDIISVMHSVVASAHHG-WNWQTIAIGA  265

Query  1496  sflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNP  1317
             SFLSF+L  +F+G+K++K FW+PA+APL+SVILST  VY+TRA+  GV+IVK++K G+NP
Sbjct  266   SFLSFLLFAKFIGKKNKKFFWVPAIAPLISVILSTFFVYITRADKQGVQIVKNIKKGINP  325

Query  1316  SSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANI  1137
             SS+++++F+  ++ +  +IG +  ++ LTEAIA+G +FA+MK Y LDGNKEM+A+G  N+
Sbjct  326   SSVNEIYFSGDYLLKGFRIGVVAGMIGLTEAIAIGRTFAAMKDYQLDGNKEMVALGAMNV  385

Query  1136  AGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASI  957
              GS+TSCYVATGSFSRSAVN+ AGCE+AVSN+VM+  V ++L+ +T L  +TP AILASI
Sbjct  386   VGSMTSCYVATGSFSRSAVNYMAGCETAVSNIVMSCVVFLTLEFITPLFKYTPNAILASI  445

Query  956   ILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSI  777
             I++A+  LI++  A  +WK+DK DF+AC GAF GV+F+SVEIGLL+AV +SFAKI+L   
Sbjct  446   IINAVISLIDIGAATLLWKIDKFDFVACMGAFFGVVFSSVEIGLLIAVSISFAKILLQVT  505

Query  776   QPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVME  597
             +P    LG++P T  ++  I QYP A + PGV ++R  S++  F+N+N++K RIL  + +
Sbjct  506   RPRTAILGKVPRT-TVYRNIQQYPEATKVPGVLIVRVDSAIY-FSNSNYVKERILRWLED  563

Query  596   EQKSADETKESS-EKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQ  420
             E+   +E K ++ + RI  ++ +MS + ++DTS I +L+ L+  +    VQ ++ANP   
Sbjct  564   EE---EEVKAATYQPRIQFLIVEMSPVTDIDTSGIHALEGLHRSLEKREVQLILANPGPV  620

Query  419   VIHKLRLADFHNKI-KGKVFLTIGEAIDA  336
             V+ KL  + F + I +  +FLT+ +A+ +
Sbjct  621   VMDKLHASSFTSLIGEDNIFLTVADAVSS  649



>ref|XP_010105878.1| Sulfate transporter 1.3 [Morus notabilis]
 gb|EXC06697.1| Sulfate transporter 1.3 [Morus notabilis]
Length=694

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/683 (48%), Positives = 458/683 (67%), Gaps = 49/683 (7%)
 Frame = -1

Query  2258  SQTLQKTSS-TLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKR-PVQ  2085
              Q L+K+     PP +ER    ++VP    L ++   + K+T  F     +  + +   +
Sbjct  11    DQALEKSGEMDTPPGSERYMHKVSVPPKQNLLKEFTATVKET-FFADDPLRPFKDQSKSR  69

Query  2084  AVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTS  1905
              ++   +++FP+L W + YSL K + D++AGLT+ASLCIPQ IGYA LANL PQYGLY+S
Sbjct  70    KLILGIQAIFPILEWSRSYSLKKFRGDLIAGLTIASLCIPQDIGYAKLANLAPQYGLYSS  129

Query  1904  VVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifq  1725
              VPPLIYA MGSSR+IAIGPVAV+SLL+ +++    D  +NP  Y  L  T TFFAGI Q
Sbjct  130   FVPPLIYACMGSSRDIAIGPVAVVSLLLGTLLQNEVDHTTNPTEYLRLAFTATFFAGITQ  189

Query  1724  aafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFT  1545
             A  GILRLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT KTD++SV+  +F 
Sbjct  190   ATLGILRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKKTDIISVMHSVFG  249

Query  1544  SLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAE  1365
             S HH  WN   ++IG +FLSF+L+ +++G+K++KLFW+PA+APL+SVILST  VY+T AE
Sbjct  250   SAHHG-WNWQTIVIGATFLSFLLVAKYIGKKNKKLFWVPAIAPLISVILSTFFVYITHAE  308

Query  1364  NHGVKI--------------------------------------VKHVKGGLNPSSLHQL  1299
               GV+I                                      V+H++ G+NPSS+ Q+
Sbjct  309   KKGVEIGKKNKKLFWVPAIAPLISVILSTFFVYITHAEKKGVEIVRHLEKGINPSSVDQI  368

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             +F+  ++ +  KIG +  ++ALTEA A+G +FASMK Y LDGNKEM+A+G  N+ GS+TS
Sbjct  369   YFSGEYLGKGFKIGVVAGMIALTEATAIGRTFASMKDYTLDGNKEMIALGAMNVVGSMTS  428

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSRSAVN+ AGC +AVSN+VM+  V ++L+ +T L  +TP AIL++II++A+ 
Sbjct  429   CYVATGSFSRSAVNYMAGCSTAVSNIVMSCVVFLTLEFITPLFKYTPNAILSAIIINAVL  488

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
              LI++  A  IWKVDK DF+AC GAF GV+F+SVE+GLL+AV +SFAKI+L   +P    
Sbjct  489   NLIDIQAAILIWKVDKFDFVACMGAFFGVVFSSVEMGLLIAVSISFAKILLQVTRPRTAL  548

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG++P T A++  I QYP A + PGV ++R  S++  F+N+N++K RIL  + +E+    
Sbjct  549   LGKIPRT-AVYRNIQQYPDASKVPGVLIVRVDSAIY-FSNSNYVKERILRWLTDEE----  602

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
             E K+++E  I  ++ +MS + ++DTS I +L+ELY  +    VQ ++ANP   VI KL  
Sbjct  603   ERKKAAEPTIHFLIVEMSPVTDIDTSGIHALEELYRSLQKRNVQLILANPGPVVIDKLHE  662

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             + F   I + K+FLT+ +A+ AC
Sbjct  663   SKFETLIGEDKIFLTVADAVAAC  685



>dbj|BAK00729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=656

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/586 (53%), Positives = 428/586 (73%), Gaps = 8/586 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             E +FP+  WG+ YSL K K D++AGLT+ASLCIPQ IGY+ LANLDPQYGLY+S +PPLI
Sbjct  76    EFLFPIFGWGRNYSLNKFKGDLIAGLTIASLCIPQDIGYSKLANLDPQYGLYSSFIPPLI  135

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA MGSSR+IAIGPVAV+SLLI S++    D   N   Y  L  T TFFAGI QAA G L
Sbjct  136   YAAMGSSRDIAIGPVAVVSLLIGSLLQAEVDHVKNKEEYMRLAFTATFFAGITQAALGFL  195

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL++FLSHAAIVGFM GAAI I LQQLK + GI+NFT KTD+VSV+  ++ S+HH  
Sbjct  196   RLGFLIEFLSHAAIVGFMGGAAITIALQQLKYVLGIANFTRKTDIVSVMESVWRSVHHG-  254

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG SFL+F+L+ +F+G+K+R+LFW+PA+AP++SVIL+T  VY+TRA+  GV+I
Sbjct  255   WNWQTIVIGVSFLAFLLLAKFIGKKNRRLFWVPAIAPIISVILATFFVYITRADKQGVQI  314

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V+H++ G+NPSS+H+++F  P + +  KIG +  +V LT A+A+G +FA+MK Y LDGNK
Sbjct  315   VRHIEQGINPSSVHKIYFTGPFVAKGFKIGVVCGIVGLTAAVAIGRTFAAMKDYQLDGNK  374

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS+TSCYV TGSFSRSAVNF AGC++ VSNV+M+V VL++L ++T L  
Sbjct  375   EMVALGTMNIVGSMTSCYVTTGSFSRSAVNFMAGCKTPVSNVIMSVVVLLTLLVITPLFK  434

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AIL SII+SA+ GL++   A  IWKVDKLDF+AC GAF GV+F SVEIGLL+AV +
Sbjct  435   YTPNAILGSIIISAVIGLVDYEAAILIWKVDKLDFIACMGAFFGVVFVSVEIGLLIAVAI  494

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LG LPGT  ++    QYP A  TPGV ++R  S++  F+N+N++
Sbjct  495   SFAKILLQVTRPRTALLGNLPGT-TIYRNTSQYPEAKLTPGVVIVRVDSAIY-FSNSNYV  552

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             + RIL  + +E+   D  K     +I+ ++ +MS + ++DTS I +L++LY  +    +Q
Sbjct  553   RERILRWLTDEE---DRAKAVGLPKISFLIVEMSPVTDIDTSGIHALEDLYKNLQKRDMQ  609

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDACLVDKNMQ  312
              +++NP   VI KL+ +     I    +FL + +A+  C   K+MQ
Sbjct  610   LILSNPGSVVIEKLQASKLTEHIGSNNIFLAVSDAVRFC-TTKSMQ  654



>ref|XP_004237882.1| PREDICTED: sulfate transporter 1.3 [Solanum lycopersicum]
Length=654

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/651 (49%), Positives = 455/651 (70%), Gaps = 18/651 (3%)
 Frame = -1

Query  2276  ELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRK  2097
             E+ Y   ++L  +    PP   +    + +P    L  + + + K+T  F     +  + 
Sbjct  10    EMDY---RSLSSSEHQQPPYMHK----VGLPPKQNLFDEFKTTVKET-LFSDDPLRPFKD  61

Query  2096  RP-VQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQY  1920
             +P  +  +   ++VFP+L WGK Y++ K + DV+AGLT+ASLCIPQ IGYA LANL PQY
Sbjct  62    QPRSRKFILGLQAVFPILEWGKSYNVSKFRGDVIAGLTIASLCIPQDIGYAKLANLAPQY  121

Query  1919  GLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTff  1740
             GLY+S VPPL+Y+ MGSSR+IAIGPVAV+SLL+ S++    DP +NP  Y  L  T TFF
Sbjct  122   GLYSSFVPPLVYSFMGSSRDIAIGPVAVVSLLLGSLLSSEIDPTTNPIEYRRLAFTATFF  181

Query  1739  agifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVL  1560
             AGI QA  GILRLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT +TD++SV+
Sbjct  182   AGITQATLGILRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKETDIISVM  241

Query  1559  THIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVY  1380
               +  S  H  WN   ++IG  FL+ +L  ++ G+KH+KLFW+PA+APL+SVILST LVY
Sbjct  242   KSVCRSAQHG-WNWPTILIGAIFLTLLLFVKYAGKKHKKLFWIPAIAPLISVILSTFLVY  300

Query  1379  LTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFA  1200
             +T AE  GV+IV+H++ G+NP S+ +++F   ++ + ++IG +  ++ALTEA+A+G SFA
Sbjct  301   ITHAEKQGVEIVRHIEKGINPPSVKEIYFTGDYLLKGLRIGIVAGMIALTEAVAIGRSFA  360

Query  1199  SMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVL  1020
             + K Y LDGNKEM+A+G  N+ GS+TSCYV TGSFSRSAVN+ AGC++AVSN+VM++ V+
Sbjct  361   AKKDYQLDGNKEMVALGTMNVVGSMTSCYVTTGSFSRSAVNYMAGCQTAVSNIVMSIVVV  420

Query  1019  ISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFAS  840
             ++L  +T L  +TP AIL++II+SA+ GL++      IWK+DK DF+AC GAF GV+FAS
Sbjct  421   LTLLFITPLFEYTPNAILSAIIISAVIGLVDYEATILIWKIDKFDFVACMGAFFGVVFAS  480

Query  839   VEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKS  660
             VEIGL++AV +SFAKI+L   +P    LG++P T+ ++  I QYP A Q PGV ++R  S
Sbjct  481   VEIGLIIAVSISFAKILLQVTRPRTALLGKIPRTN-VYRNIQQYPEATQVPGVLIVRVDS  539

Query  659   SLLCFANANFIKARILSLVMEEQKSADETKES-SEKRIALIVFDMSNIMNVDTSAIISLK  483
             ++  F+N+N+++ RIL  + +E    DE  ES ++ +I  ++ DMS + ++DTS I + +
Sbjct  540   AIY-FSNSNYMRERILRWLTDE----DEQLESVNQPKIQFLIVDMSPVTDIDTSGIHAFE  594

Query  482   ELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             EL+  +    VQ V++NP   VI KL  +DF N+I + K+FLT+G+A+  C
Sbjct  595   ELHRSLHKREVQLVLSNPGRVVIDKLHASDFVNQIGEDKIFLTVGDAVLTC  645



>ref|XP_007226563.1| hypothetical protein PRUPE_ppa024463mg [Prunus persica]
 gb|EMJ27762.1| hypothetical protein PRUPE_ppa024463mg [Prunus persica]
Length=668

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/623 (51%), Positives = 440/623 (71%), Gaps = 15/623 (2%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTA----FQRLRKRPVQAVLSASESVFPLLSWGKQY  2028
             + VP    L ++   + K+T  F        F+   KR  + +L   E++FP+L W + Y
Sbjct  46    VGVPAKQNLFKEFRATVKET--FFSDEPLRPFKDQTKR--RKILLGLEALFPILRWARDY  101

Query  2027  SLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIG  1848
             +L K + D++AGLT+ASLCIPQ +GYA LA L  Q GLY+S VPPL+YA MGSSR+IAIG
Sbjct  102   NLTKFRGDLIAGLTIASLCIPQDLGYAKLAYLPGQNGLYSSFVPPLVYAFMGSSRDIAIG  161

Query  1847  PVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAA  1668
             PVAV+SLL+ +MV    DP  N   Y  L LT TFFAG+ Q   G  RLGFL+DFLSHA+
Sbjct  162   PVAVVSLLLGTMVQNEVDPTKNAHDYLRLTLTATFFAGVTQLTLGFCRLGFLIDFLSHAS  221

Query  1667  IVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsfl  1488
             IVGFM GAAI I LQQLK L GI NFT KTD+VSV+  + T+ HH  WN   ++IG SFL
Sbjct  222   IVGFMGGAAITIALQQLKGLLGIKNFTKKTDIVSVMRSVITAAHHG-WNWQTILIGVSFL  280

Query  1487  sfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSL  1308
             +F+L+T+++G+K  KLFW+PA+APL+SVI+ST  VY+TRA+  GV IV  ++ G+NP+S 
Sbjct  281   AFLLLTKYIGKKKTKLFWVPAIAPLISVIVSTFFVYITRADKEGVAIVSKIRKGINPASA  340

Query  1307  HQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGS  1128
               ++F   ++ +  +IG +  ++ALTEAIA+G +FA MK Y LDGNKEM+A+G  NI GS
Sbjct  341   DLIYFTGDNVIKGFRIGVVAGMIALTEAIAIGRTFAGMKDYQLDGNKEMVALGTMNIIGS  400

Query  1127  LTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILS  948
             LTSCYVATGSFSRSAVN+ AGC +AVSN++M++ VL++L+L+T L  +TP AILASII+S
Sbjct  401   LTSCYVATGSFSRSAVNYMAGCHTAVSNIIMSLVVLLTLELITPLFKYTPNAILASIIIS  460

Query  947   ALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPG  768
             A+ GLI+      IWK+DKLDF+AC GAF GV+F SVEIGLL+AV +SFAKI+L   +P 
Sbjct  461   AVIGLIDFEAMKLIWKIDKLDFVACMGAFFGVVFISVEIGLLIAVSISFAKILLQVTRPR  520

Query  767   IEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQK  588
                LG+LP T+ ++  I QYP A Q PG+ +IR  S++  F+N+N+IK RIL  V +E+ 
Sbjct  521   TALLGKLPRTN-VYRNILQYPNATQIPGILIIRVDSAIY-FSNSNYIKERILRWVTDEE-  577

Query  587   SADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHK  408
               +E K++S  +I  ++ +MS + ++DTS I +L+ELY  +    ++  +ANP   V+ K
Sbjct  578   --EELKQNSLPKIEHLIVEMSPVTDIDTSGIHALEELYRSLQKREIELALANPGTVVMDK  635

Query  407   LRLADFHNKI-KGKVFLTIGEAI  342
             +  ++F   I KGK+FL++ +AI
Sbjct  636   IHASEFVELIGKGKIFLSVADAI  658



>ref|NP_001234565.1| sulfate transporter 1 [Solanum lycopersicum]
 gb|AAK27687.1| sulfate transporter 1 [Solanum lycopersicum]
Length=657

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/577 (52%), Positives = 428/577 (74%), Gaps = 9/577 (2%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+L WG+ Y+  K K D++AGLT+A+LCIPQ IGYA LANLD Q+GLY+S VPPL+
Sbjct  79    QAVFPILEWGRSYNFSKFKGDLIAGLTIATLCIPQDIGYAKLANLDAQFGLYSSFVPPLV  138

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA MGSSR+IAIGPVAV+SLL+ SM+ +  DP      Y  L  T TFFAG+ Q   G  
Sbjct  139   YAFMGSSRDIAIGPVAVVSLLLGSMLQQELDPVKQKHEYQRLAFTATFFAGVTQFVLGFF  198

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK L GI  FT KTD+VSV+  +F + HH  
Sbjct  199   RLGFLIDFLSHAAIVGFMGGAAITISLQQLKGLLGIKKFTKKTDIVSVMKSVFAAAHHG-  257

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG SFL+F+L+ +F+G+K++K FW+PA+APL+SVILST  V++  AE H V+I
Sbjct  258   WNWQTIVIGLSFLAFLLVAKFIGKKNKKYFWVPAIAPLISVILSTFFVFIFHAEKHDVQI  317

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V+H+  G+NP S+++++F+  ++ +  +IG I  ++ALTEA+A+G +FA+MK Y LDGNK
Sbjct  318   VRHIDQGINPPSVNEIYFSGEYLTKGFRIGVIAGLIALTEAVAIGRTFAAMKDYSLDGNK  377

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC++AVSN+VM+  VL++L+L+T L  
Sbjct  378   EMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCQTAVSNIVMSCVVLLTLELITPLFK  437

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILASII+SA+ GLI+++    ++K+DK DF+AC GAF GV+F SVEIGLL+AV +
Sbjct  438   YTPNAILASIIISAVIGLIDIDAMTLLYKIDKFDFVACMGAFLGVVFQSVEIGLLIAVAI  497

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P I  LG++P T  ++  + QYP + + PGV ++R  S++  F+N+N++
Sbjct  498   SFAKILLQVTRPRIVVLGKVPRT-RVYRNMQQYPESTKVPGVLIVRVDSAIY-FSNSNYM  555

Query  626   KARILSLVMEEQKSADET-KESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGV  450
             + RIL  + +E    DE  KE+++++I  ++ +M  + ++DTS I SL++LY  +    V
Sbjct  556   RDRILRWLTDE----DEMLKETNQQKIQYLIVEMPPVTDIDTSGIHSLEDLYKSLQKRNV  611

Query  449   QFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAI  342
             + V+ANP   VI KL  + F + I + K+FLT+ +A+
Sbjct  612   ELVLANPGTMVIDKLHASGFADMIGEDKIFLTVADAV  648



>ref|XP_008337948.1| PREDICTED: sulfate transporter 1.2-like [Malus domestica]
Length=660

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/623 (51%), Positives = 446/623 (72%), Gaps = 9/623 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + VP    L ++   + K+T  F     +  + +P  +  +   +++FP+  WG+ Y+L+
Sbjct  37    VGVPPKQNLFKEFXNTVKET-FFSDDPLRPFKHQPKSRKXILGVQAIFPIFEWGRGYNLL  95

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K + D++AGLT+ASLCIPQ IGYA LANL PQYGLY+S VPPLIYA+MGSSR+IAIGPVA
Sbjct  96    KFRGDLIAGLTIASLCIPQDIGYAKLANLAPQYGLYSSFVPPLIYAIMGSSRDIAIGPVA  155

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ +++    DP  NP  Y  L  T TFFAGI QA  GILR+GFL+DFLSHAAIVG
Sbjct  156   VVSLLLGTLLQNEIDPVKNPDDYRRLAFTATFFAGITQATLGILRMGFLIDFLSHAAIVG  215

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FM GAAI I LQQLK   GI  FT KTD+VSV+  +F S HH  WN   ++IG SFLSF+
Sbjct  216   FMGGAAITIALQQLKGFLGIQKFTKKTDIVSVMQSVFHSAHHG-WNWQTIVIGVSFLSFL  274

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L+ +++G+K + LFW+PA+APL+SVILST  VY+T AE  GV IV+H++ G+NP S++++
Sbjct  275   LLAKYIGKKKKNLFWVPAIAPLISVILSTFFVYITHAEKDGVAIVRHIEKGINPPSVNEI  334

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
              F   ++ +  KIG +  +VALTEAIA+G +FASMK Y LDGNKEM+A+G  NI GS+TS
Sbjct  335   FFTGDYLAKGFKIGVVAGMVALTEAIAIGRTFASMKDYQLDGNKEMVALGTMNIVGSMTS  394

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSRSAVN+YAGCE+AVSN+VM+V V ++LQ +T L  +TP AILA+II+SA+ 
Sbjct  395   CYVATGSFSRSAVNYYAGCETAVSNIVMSVVVFLTLQFITPLFKYTPNAILAAIIISAVI  454

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
              L++   A  IWK+DK DF+AC GAF GV+FASVEIGLL+AV +SFAKI+L   +P    
Sbjct  455   NLVDFQAAILIWKIDKFDFVACMGAFFGVIFASVEIGLLIAVSISFAKILLQVTRPRTAI  514

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG++P T+ ++  I QYP A + PGV ++R  S++  F+N+N+IK RIL  +++E+   +
Sbjct  515   LGKIPRTN-VYRNIQQYPEATKVPGVMIVRIDSAVY-FSNSNYIKERILRWLVDEE---E  569

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
             + KE+    I  ++ +MS + ++DTS I +L+EL+  +    +Q V+ANP   VI K+  
Sbjct  570   QLKEAYLPSIQFLIVEMSPVTDIDTSGIHALEELHRGLQKRDIQLVLANPGPVVIDKIHA  629

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             +     I + ++FLT+ +A+ +C
Sbjct  630   SHVXTLIGEDRIFLTVADAVSSC  652



>ref|XP_007043016.1| Sulfate transporter 1,3 isoform 1 [Theobroma cacao]
 ref|XP_007043018.1| Sulfate transporter 1,3 isoform 1 [Theobroma cacao]
 ref|XP_007043019.1| Sulfate transporter 1,3 isoform 1 [Theobroma cacao]
 gb|EOX98847.1| Sulfate transporter 1,3 isoform 1 [Theobroma cacao]
 gb|EOX98849.1| Sulfate transporter 1,3 isoform 1 [Theobroma cacao]
 gb|EOX98850.1| Sulfate transporter 1,3 isoform 1 [Theobroma cacao]
Length=657

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/640 (50%), Positives = 456/640 (71%), Gaps = 14/640 (2%)
 Frame = -1

Query  2246  QKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSA  2070
             ++ S  LP   +     + VP    L +++  + K+T  F     +  + +P  +  +  
Sbjct  23    RRNSENLPYVHK-----VGVPPKQNLLKEIAATVKET-FFADDPLRHFKDQPRSRKFVLG  76

Query  2069  SESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPL  1890
              ++VFP+  WG+ YSL K K D++AGLT+ASLCIPQ IGYA LANL+PQYGLY+S VPPL
Sbjct  77    FQAVFPIFEWGRNYSLSKFKGDLIAGLTIASLCIPQDIGYAKLANLEPQYGLYSSFVPPL  136

Query  1889  IYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgI  1710
             +YA MGSSR+IAIGPVAV+SLL+ S++    D + NP  Y  L  T TFFAGI Q   G 
Sbjct  137   VYAFMGSSRDIAIGPVAVVSLLLGSLLRDEIDSSENPVDYRRLAFTATFFAGITQFTLGF  196

Query  1709  LRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHS  1530
             LRLGFL+DFLSHAAIVGFMAGAAI I LQQLK L GI  FT  TD+VSV+  ++ S+HH 
Sbjct  197   LRLGFLIDFLSHAAIVGFMAGAAITISLQQLKGLLGIKKFTKNTDIVSVMRSVWNSVHHG  256

Query  1529  PWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVK  1350
              WN   ++IG +FL+F+L+ +++G+K +KLFW+PA+APL+SVILST  VY+ RA+ HGV+
Sbjct  257   -WNWQTILIGVAFLAFLLVAKYIGKKKKKLFWVPAIAPLISVILSTFFVYIARADKHGVQ  315

Query  1349  IVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGN  1170
             IVKH++ G+NP S++++ F+  ++ +  +IG +  ++ALTEA+A+G +FASMK Y LDGN
Sbjct  316   IVKHIRQGVNPPSVNEIFFSGEYLGKGFRIGVVAGMIALTEAVAIGRTFASMKDYQLDGN  375

Query  1169  KEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLL  990
             KEM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC +AVSN+VM+  VL++L+L+T L 
Sbjct  376   KEMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCHTAVSNIVMSCVVLLTLELITPLF  435

Query  989   YFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVG  810
              +TP AILASII+SA+ GLI++     IWK+DK DF+AC GAF GV+F+SVE+GLL+AV 
Sbjct  436   KYTPNAILASIIISAVIGLIDIEAVALIWKIDKFDFVACMGAFFGVVFSSVEMGLLIAVS  495

Query  809   LSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANF  630
             +SFAKI+L   +P    LG+LP T  ++  I QYP A + PG+ ++R  S++  F+N+N+
Sbjct  496   ISFAKILLQVTRPRTAILGKLPRT-TVYRNILQYPDATKVPGILIVRVDSAIY-FSNSNY  553

Query  629   IKARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGV  450
             +K RIL  + +E+   ++ KE+ + RI  ++ +MS + ++DTS I +L+EL+  +    V
Sbjct  554   VKERILRWLADEE---EQLKENFQPRIMYLIVEMSPVTDIDTSGIHALEELFRSLEKRDV  610

Query  449   QFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             + V+ANP   V+ KL  + F   I + ++FLT+ +A+  C
Sbjct  611   KLVLANPGPVVVDKLHASKFPELIGEDRIFLTVADAVLTC  650



>ref|XP_011087851.1| PREDICTED: sulfate transporter 1.3-like isoform X1 [Sesamum indicum]
Length=665

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/576 (53%), Positives = 428/576 (74%), Gaps = 8/576 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+L WG++Y L   K D++AGLT+ASLCIPQ IGY+ LAN+D Q+GLY+S +PPLI
Sbjct  74    QAVFPILEWGRRYKLSMFKGDLIAGLTIASLCIPQDIGYSKLANMDSQFGLYSSFIPPLI  133

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA+MGSSR+IAIGPVAV+SLL+ SM+ +  DP  N   Y  L  T TFFAG+ Q   G  
Sbjct  134   YAIMGSSRDIAIGPVAVVSLLLGSMLQEEIDP-RNKHEYERLAFTATFFAGVTQFVLGFF  192

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFMAGAAI I LQQLK L G+  FT K+D+VSV+  ++T++HH  
Sbjct  193   RLGFLIDFLSHAAIVGFMAGAAITISLQQLKGLLGMKTFTKKSDIVSVMRSVWTNVHHG-  251

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   +IIG +FL F+L+ +++G+  +KLFW+PA+APL+SVI+ST  V++T AE  GV+I
Sbjct  252   WNWQTIIIGVAFLIFLLLAKYIGKTKKKLFWVPAIAPLISVIISTFFVFITHAEKKGVQI  311

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V H++ G+NP S+ ++HF   ++ + ++IG +  ++ALTEA+A+G +FA+MK YHLDGNK
Sbjct  312   VNHIERGINPPSVSEIHFTGSYMTKGLRIGVVAGMIALTEAVAIGRTFAAMKDYHLDGNK  371

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC +AVSN+VM+  VL++L+++T L  
Sbjct  372   EMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCNTAVSNIVMSCVVLLTLEVITPLFK  431

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILASII+SA+ GL +      IWK+DK DF+AC GAF GV+FASVEIGLL+AV +
Sbjct  432   YTPNAILASIIISAVVGLFDYQAMILIWKIDKFDFVACMGAFFGVVFASVEIGLLIAVAI  491

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LGR+P T  ++  I QYP A++ PGV ++R  S++  F+N+N+I
Sbjct  492   SFAKILLQVTRPRTAVLGRIPRT-TVYRNIQQYPEAIKVPGVLIVRVDSAIY-FSNSNYI  549

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             + RIL L+ +E++   E  E+   RI  ++ +MS + ++DTS I +L++L+  +     Q
Sbjct  550   RERILRLLNDEEELLKENNEA---RIQYLIIEMSPVTDIDTSGIHALEDLHKSLKKRHTQ  606

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAI  342
              V+ANP   V+ KL  +DF N +   K+FLT+G+A+
Sbjct  607   LVLANPGQVVLDKLHSSDFANMVGDDKIFLTVGDAV  642



>ref|XP_011087852.1| PREDICTED: sulfate transporter 1.3-like isoform X2 [Sesamum indicum]
Length=651

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/576 (53%), Positives = 428/576 (74%), Gaps = 8/576 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             ++VFP+L WG++Y L   K D++AGLT+ASLCIPQ IGY+ LAN+D Q+GLY+S +PPLI
Sbjct  74    QAVFPILEWGRRYKLSMFKGDLIAGLTIASLCIPQDIGYSKLANMDSQFGLYSSFIPPLI  133

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA+MGSSR+IAIGPVAV+SLL+ SM+ +  DP  N   Y  L  T TFFAG+ Q   G  
Sbjct  134   YAIMGSSRDIAIGPVAVVSLLLGSMLQEEIDP-RNKHEYERLAFTATFFAGVTQFVLGFF  192

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFMAGAAI I LQQLK L G+  FT K+D+VSV+  ++T++HH  
Sbjct  193   RLGFLIDFLSHAAIVGFMAGAAITISLQQLKGLLGMKTFTKKSDIVSVMRSVWTNVHHG-  251

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   +IIG +FL F+L+ +++G+  +KLFW+PA+APL+SVI+ST  V++T AE  GV+I
Sbjct  252   WNWQTIIIGVAFLIFLLLAKYIGKTKKKLFWVPAIAPLISVIISTFFVFITHAEKKGVQI  311

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             V H++ G+NP S+ ++HF   ++ + ++IG +  ++ALTEA+A+G +FA+MK YHLDGNK
Sbjct  312   VNHIERGINPPSVSEIHFTGSYMTKGLRIGVVAGMIALTEAVAIGRTFAAMKDYHLDGNK  371

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  NI GS+TSCYVATGSFSRSAVN+ AGC +AVSN+VM+  VL++L+++T L  
Sbjct  372   EMVALGTMNIVGSMTSCYVATGSFSRSAVNYMAGCNTAVSNIVMSCVVLLTLEVITPLFK  431

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILASII+SA+ GL +      IWK+DK DF+AC GAF GV+FASVEIGLL+AV +
Sbjct  432   YTPNAILASIIISAVVGLFDYQAMILIWKIDKFDFVACMGAFFGVVFASVEIGLLIAVAI  491

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P    LGR+P T  ++  I QYP A++ PGV ++R  S++  F+N+N+I
Sbjct  492   SFAKILLQVTRPRTAVLGRIPRT-TVYRNIQQYPEAIKVPGVLIVRVDSAIY-FSNSNYI  549

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             + RIL L+ +E++   E  E+   RI  ++ +MS + ++DTS I +L++L+  +     Q
Sbjct  550   RERILRLLNDEEELLKENNEA---RIQYLIIEMSPVTDIDTSGIHALEDLHKSLKKRHTQ  606

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAI  342
              V+ANP   V+ KL  +DF N +   K+FLT+G+A+
Sbjct  607   LVLANPGQVVLDKLHSSDFANMVGDDKIFLTVGDAV  642



>ref|XP_006354018.1| PREDICTED: sulfate transporter 1.3-like [Solanum tuberosum]
Length=657

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/660 (48%), Positives = 459/660 (70%), Gaps = 18/660 (3%)
 Frame = -1

Query  2303  TGVEMTAELELPYEFSQTLQKTSSTLPPAAERASWVLNVPEPPGLSRKLEGSFKKTATFL  2124
             + VE     E+ Y   ++L  +    PP   +    + VP    L  + + + K+T  F 
Sbjct  4     SSVEAINAKEMDY---RSLSSSEHQQPPYMHK----VGVPPKQNLFDEFKTTVKET-LFS  55

Query  2123  GTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYA  1947
                 +  + +P  +  +   ++VFP+L WGK Y++ K + DV+AGLT+ASLCIPQ IGYA
Sbjct  56    DDPLRPFKDQPRSRKFILGLQAVFPILDWGKSYNVSKFRGDVIAGLTIASLCIPQDIGYA  115

Query  1946  ALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYT  1767
              LANL PQYGLY+S VPPL+Y+ MGSSR+IAIGPVAV+SLL+ S++    DP +NP  Y 
Sbjct  116   KLANLAPQYGLYSSFVPPLVYSFMGSSRDIAIGPVAVVSLLLGSLLSSEIDPTTNPIEYR  175

Query  1766  SLVLTVTffagifqaafgILRLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFT  1587
              L  T TFFAGI QA  GILRLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT
Sbjct  176   RLAFTATFFAGITQATLGILRLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFT  235

Query  1586  NKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLS  1407
              +TD++SV+  +  S  H  WN   ++IG  FL+F+L  ++ G+K++KLFW+PA+APL+S
Sbjct  236   KETDIISVMKSVCRSAQHG-WNWPTILIGAIFLTFLLFAKYAGKKNKKLFWIPAIAPLIS  294

Query  1406  VILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTE  1227
             VILST LVY+T AE  GV+IV+H++ G+NP S+ +++F   ++ + ++IG +  ++ALTE
Sbjct  295   VILSTFLVYITHAEKQGVEIVRHIEKGINPPSVKEIYFTGDYLLKGLRIGIVAGMIALTE  354

Query  1226  AIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVS  1047
             A+A+G SFA+ K Y LDGNKEM+A+G  N+ GS+TSCYV TGSFSRSAVN+ AGC++AVS
Sbjct  355   AVAIGRSFAAKKDYQLDGNKEMVALGTMNVVGSMTSCYVTTGSFSRSAVNYMAGCQTAVS  414

Query  1046  NVVMAVTVLISLQLLTKLLYFTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAG  867
             N+VM++ V+++L  +T L  +TP AIL++II+SA+ GL++      IWK+DK DF+AC G
Sbjct  415   NIVMSIVVVLTLLFITPLFEYTPNAILSAIIISAVIGLVDYEATILIWKIDKFDFVACMG  474

Query  866   AFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTP  687
             AF GV+FASVEIGL++AV +SFAKI+L   +P    LG++P T+ ++  I QYP A Q P
Sbjct  475   AFFGVVFASVEIGLIIAVSISFAKILLQVTRPRTALLGKIPRTN-VYRNIQQYPEATQVP  533

Query  686   GVFVIRTKSSLLCFANANFIKARILSLVMEEQKSADETKES-SEKRIALIVFDMSNIMNV  510
             GV ++R  S++  F+N+N+++ RIL  + +E    DE  ES ++ +I  ++ DMS + ++
Sbjct  534   GVLIVRVDSAIY-FSNSNYMRERILRWLTDE----DEQLESVNQPKIQFLIVDMSPVTDI  588

Query  509   DTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
             DTS I + +EL+  +    VQ V++NP   VI KL  +DF ++I + K+FLT+G+A+  C
Sbjct  589   DTSGIHAFEELHRSLHKREVQLVLSNPGRVVIDKLHASDFMSQIGEDKIFLTVGDAVLTC  648



>ref|XP_010060154.1| PREDICTED: sulfate transporter 1.3 [Eucalyptus grandis]
 ref|XP_010060155.1| PREDICTED: sulfate transporter 1.3 [Eucalyptus grandis]
 gb|KCW66723.1| hypothetical protein EUGRSUZ_F00483 [Eucalyptus grandis]
Length=661

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/623 (51%), Positives = 444/623 (71%), Gaps = 9/623 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + VP    L ++   + K+T  F     +  + +P  + ++   +++FP+L WG+ Y L 
Sbjct  38    VGVPPRQKLFKEFASTLKET-FFADDPLRPFKDQPQSRKLVLGIQAIFPILEWGRSYDLK  96

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K K DV+AGLT+ASLCIPQ IGYA LANLDPQYGLY+S VPPLIYA+MGSSR+IAIGPVA
Sbjct  97    KFKGDVIAGLTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLIYALMGSSRDIAIGPVA  156

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ +++    DP  NP  Y  L  T TFFAGI Q   G  RLGFL+DFLSHAAIVG
Sbjct  157   VVSLLLGTLLQSEIDPTKNPVEYRRLAFTATFFAGITQVTLGFFRLGFLIDFLSHAAIVG  216

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FM GAAI I LQQLK   GI  FT KTD++SV+  ++ S+HH  WN   ++IG SFL F+
Sbjct  217   FMGGAAITIALQQLKGFLGIKKFTKKTDIISVMQSVWGSVHHG-WNWQTIVIGASFLGFL  275

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L  +++G+K++K FW+PA+APL+SVIL+T  VY+T AE HGV+IVK+++ G+NP S+ ++
Sbjct  276   LFAKYIGKKNKKFFWVPAIAPLISVILATFFVYITHAEKHGVQIVKNIEKGINPPSVKEI  335

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             +F   ++ +  +IG +  +VALTEAIA+G +FA+MK Y LDGNKEM+A+G  NI GS+TS
Sbjct  336   YFTGDYLLKGFRIGIVAGMVALTEAIAIGRTFAAMKDYQLDGNKEMVALGTMNIVGSMTS  395

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVATGSFSRSAVN+ AGC +AVSN++M+  V ++L  +T L  +TP AILA+II+SA+ 
Sbjct  396   CYVATGSFSRSAVNYMAGCHTAVSNIIMSFVVFLTLLFITPLFKYTPNAILAAIIISAVI  455

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI+ + A  IWK+DKLDF+AC GAF GV+F SVEIGLL+AV +SFAKI+L   +P    
Sbjct  456   GLIDYDAAILIWKIDKLDFVACLGAFLGVVFVSVEIGLLIAVAISFAKILLQVTRPRTAI  515

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LG++P T A++  I QYP A++ PG+ ++R  S++  F+N+N+IK RIL  + +E+   +
Sbjct  516   LGKIPQT-AVYRNIQQYPDAMKVPGILIVRVDSAIY-FSNSNYIKERILRWLRDEE---E  570

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
             + K     +I  ++ +MS + ++DTS I +L+ELY  +    +Q V+ANP   VI KL  
Sbjct  571   QLKADYLPQIKFLLAEMSPVTDIDTSGIHALEELYKSLQKRDIQLVLANPGPVVIDKLHS  630

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             + F N I + ++FL + EA+ +C
Sbjct  631   SGFANLIGEDRIFLNVAEAVSSC  653



>ref|XP_008460483.1| PREDICTED: sulfate transporter 1.3-like isoform X1 [Cucumis melo]
 ref|XP_008460484.1| PREDICTED: sulfate transporter 1.3-like isoform X1 [Cucumis melo]
 ref|XP_008460485.1| PREDICTED: sulfate transporter 1.3-like isoform X1 [Cucumis melo]
Length=658

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/579 (52%), Positives = 424/579 (73%), Gaps = 7/579 (1%)
 Frame = -1

Query  2066  ESVFPLLSWGKQYSLVKLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLI  1887
             +++FP+  WG+ Y+L K + D++AGLT+ASLCIPQ IGYA LANL PQYGLY+S VPPL+
Sbjct  78    QAIFPIFEWGRNYNLTKFRGDIVAGLTIASLCIPQDIGYAKLANLTPQYGLYSSFVPPLV  137

Query  1886  YAVMGSSREIAIGPVAVISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgIL  1707
             YA+MGSSR+IAIGPVAV+SLL+ +++ K  D  ++P  Y  L  T TFFAGI QA  GIL
Sbjct  138   YALMGSSRDIAIGPVAVVSLLLGTLLQKEIDYHTHPEEYLRLAFTATFFAGITQATLGIL  197

Query  1706  RLGFLVDFLSHAAIVGFMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSP  1527
             RLGFL+DFLSHAAIVGFM GAAI I LQQLK   GI  FT KTD++SV+  +F + HH  
Sbjct  198   RLGFLIDFLSHAAIVGFMGGAAITIALQQLKGFLGIQKFTKKTDIISVMRSVFEAAHHG-  256

Query  1526  WNPYNliigfsflsfilITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKI  1347
             WN   ++IG SFLSF+L  +++G+K++ LFW+PA+APL+SVILST  VY+T A+  GV I
Sbjct  257   WNWQTIVIGVSFLSFLLFAKYIGKKNKNLFWVPAIAPLISVILSTFFVYITHADQKGVAI  316

Query  1346  VKHVKGGLNPSSLHQLHFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNK  1167
             VKH++ G+NP S+ Q++F   ++ +  + G +  ++ALTEAIA+G +F +MK Y LDGNK
Sbjct  317   VKHIEKGINPLSVKQIYFTGDNLLKGFRTGTVAGMIALTEAIAIGRTFPTMKDYQLDGNK  376

Query  1166  EMLAIGVANIAGSLTSCYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLY  987
             EM+A+G  N+ GS+TSCYVATGSFSRSAVN+ +GC++AVSN+VM+  V ++L+ +T L  
Sbjct  377   EMVALGTMNVIGSMTSCYVATGSFSRSAVNYMSGCQTAVSNIVMSCVVFLTLEFMTPLFK  436

Query  986   FTPVAILASIILSALPGLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGL  807
             +TP AILA II+SA+  LI++  A  +WK+DK DF+AC GAF GV+FASVEIGLL+AV +
Sbjct  437   YTPNAILAVIIISAVINLIDIQAAILLWKIDKFDFVACLGAFFGVIFASVEIGLLIAVSI  496

Query  806   SFAKIMLNSIQPGIEKLGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFI  627
             SFAKI+L   +P +  LG++P T  ++    QYP A +  G+ ++R  S++  F+N+N+I
Sbjct  497   SFAKILLQVTRPRVSVLGKIPRT-TVYRNTQQYPEATRVSGILIVRVDSAIY-FSNSNYI  554

Query  626   KARILSLVMEEQKSADETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQ  447
             + RIL  + +E+   ++TK++   +   ++ +MS + ++DTS I +L+ELY  +    +Q
Sbjct  555   RERILRCLADEE---EQTKKAYSPKTQFLIVEMSPVTDIDTSGIHALEELYKNLRKRDIQ  611

Query  446   FVIANPRWQVIHKLRLADFHNKI-KGKVFLTIGEAIDAC  333
              V+ANP   VI KL  +D  N I +  +FLT+ EA+ +C
Sbjct  612   LVLANPGPVVIDKLHASDVANLIGEDHIFLTVAEAVSSC  650



>ref|NP_001234569.1| sulfate transporter 2 [Solanum lycopersicum]
 gb|AAK27688.1| sulfate transporter 2 [Solanum lycopersicum]
Length=656

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/623 (50%), Positives = 451/623 (72%), Gaps = 9/623 (1%)
 Frame = -1

Query  2195  LNVPEPPGLSRKLEGSFKKTATFLGTAFQRLRKRP-VQAVLSASESVFPLLSWGKQYSLV  2019
             + VP   G+ ++ + + K+T  F     +  + +P  + ++   +++FP+L WG+ Y+L 
Sbjct  33    VGVPPKQGVFKEFKTTVKETF-FADDPLRSFKDQPRSRKLVLGLQAIFPILDWGRSYNLR  91

Query  2018  KLKSDVLAGLTLASLCIPQSIGYAALANLDPQYGLYTSVVPPLIYAVMGSSREIAIGPVA  1839
             K + D+++GLT+ASLCIPQ IGY+ LANLDPQYGLY+S VPPL+YA MGSSR+IAIGPVA
Sbjct  92    KFRGDLISGLTIASLCIPQDIGYSKLANLDPQYGLYSSFVPPLVYAFMGSSRDIAIGPVA  151

Query  1838  VISLLISSMVPKLEDPASNPAGYTSLVLTVTffagifqaafgILRLGFLVDFLSHAAIVG  1659
             V+SLL+ +++    DP+ +PA Y  L  T TFFAGI QA  GILRLGFL+DFLSHAA+VG
Sbjct  152   VVSLLLGTLLRNEIDPSKHPAEYLRLAFTATFFAGITQATLGILRLGFLIDFLSHAAVVG  211

Query  1658  FMAGAAIVIGLQQLKPLFGISNFTNKTDVVSVLTHIFTSLHHSPWNPYNliigfsflsfi  1479
             FM GAAI I LQQLK   GI  FT K D++SV+  +F S+ H  WN   ++IG +FL+F+
Sbjct  212   FMGGAAITIALQQLKGFLGIKKFTKKADIISVMKSVFHSVEHE-WNWQTILIGATFLTFL  270

Query  1478  lITRFLGQKHRKLFWLPAMAPLLSVILSTLLVYLTRAENHGVKIVKHVKGGLNPSSLHQL  1299
             L  +++G+K++KLFW+PA+APL+SVILST  VY+T A+  GV IV  ++ G+NP S+ ++
Sbjct  271   LFAKYVGKKNKKLFWVPAIAPLISVILSTFFVYITHADKRGVAIVGRIEKGINPPSVDKI  330

Query  1298  HFNTPHIPQVVKIGFIVAVVALTEAIAVGGSFASMKGYHLDGNKEMLAIGVANIAGSLTS  1119
             +F+  ++ + ++ G +  ++ALTEA+A+G +FASMK Y LDGNKEM+A+G  NI GS+TS
Sbjct  331   YFSGDYLMKGIRTGIVAGMIALTEAVAIGRTFASMKDYQLDGNKEMVALGAMNIVGSMTS  390

Query  1118  CYVATGSFSRSAVNFYAGCESAVSNVVMAVTVLISLQLLTKLLYFTPVAILASIILSALP  939
             CYVAT SFSRSAVN+ AGC++A SN+VM+V V ++L+ +T L  FTP AILA+II+SA+ 
Sbjct  391   CYVATSSFSRSAVNYMAGCQTAFSNIVMSVVVFLTLEFITPLFKFTPNAILAAIIISAVL  450

Query  938   GLINLNEAYSIWKVDKLDFLACAGAFAGVLFASVEIGLLVAVGLSFAKIMLNSIQPGIEK  759
             GLI+   A  IWK+DK DF+AC GAF GV+FASVEIGLL+AV +SFAKI+L   +P    
Sbjct  451   GLIDYEAAILIWKIDKFDFVACIGAFFGVVFASVEIGLLIAVTISFAKILLQVTRPRTAT  510

Query  758   LGRLPGTDALFMGIHQYPMAVQTPGVFVIRTKSSLLCFANANFIKARILSLVMEEQKSAD  579
             LGR+P T+ ++    QYP A + PGV ++R  S++  F+N+N+IK RIL  +M+E+   +
Sbjct  511   LGRIPRTN-VYRNTQQYPEATKVPGVLIVRVDSAIY-FSNSNYIKERILRWLMDEE---E  565

Query  578   ETKESSEKRIALIVFDMSNIMNVDTSAIISLKELYDKITSCGVQFVIANPRWQVIHKLRL  399
             + K +S+ +I  ++ +MS + ++DTS I +L+EL+  +    VQ V++NP   VI KL  
Sbjct  566   QRKATSDPKIQFLIVEMSPVTDIDTSGIHALEELHRSLIKRNVQLVLSNPGRVVIDKLHA  625

Query  398   ADFHNKI-KGKVFLTIGEAIDAC  333
             + F ++I + K+FLT+ +A+  C
Sbjct  626   SKFPDQIGEDKIFLTVADAVLTC  648



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7783292402864