BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26732_g1_i1 len=813 path=[742:0-704 1447:705-740 1447:741-776
1447:777-812]

Length=813
                                                                      Score     E

ref|XP_004232891.1|  PREDICTED: pistil-specific extensin-like pro...    155   9e-42   
gb|ADW66159.1|  pistil-specific extensin-like protein                   149   1e-40   
ref|XP_006347025.1|  PREDICTED: pistil-specific extensin-like pro...    152   2e-40   
ref|XP_009764640.1|  PREDICTED: pistil-specific extensin-like pro...    150   5e-40   
ref|XP_011096313.1|  PREDICTED: pistil-specific extensin-like pro...    146   9e-39   
ref|XP_009605693.1|  PREDICTED: pistil-specific extensin-like pro...    142   1e-36   
gb|AAS92246.1|  proline-rich protein 1                                  135   3e-34   Capsicum annuum
ref|XP_009758823.1|  PREDICTED: pistil-specific extensin-like pro...    132   3e-33   
ref|XP_006347027.1|  PREDICTED: pistil-specific extensin-like pro...    132   3e-33   
emb|CAA49895.1|  proline-rich protein                                   131   7e-33   Nicotiana alata [flowering tobacco]
ref|XP_004232888.1|  PREDICTED: pistil-specific extensin-like pro...    131   9e-33   
ref|XP_009602333.1|  PREDICTED: pistil-specific extensin-like pro...    131   1e-32   
ref|XP_010260222.1|  PREDICTED: pistil-specific extensin-like pro...    130   2e-32   
gb|ACN60130.1|  putative proline-rich protein                           129   5e-32   Petunia x hybrida [garden petunia]
ref|XP_007213090.1|  hypothetical protein PRUPE_ppa021281mg             126   7e-32   
ref|XP_011087017.1|  PREDICTED: pistil-specific extensin-like pro...    129   1e-31   
emb|CAC16734.1|  arabinogalactan protein                                127   2e-31   Daucus carota [carrots]
emb|CBI29537.3|  unnamed protein product                                125   2e-31   
ref|XP_008225109.1|  PREDICTED: pistil-specific extensin-like pro...    127   8e-31   
ref|XP_007025595.1|  Pollen Ole e 1 allergen and extensin family ...    127   1e-30   
ref|XP_002274293.3|  PREDICTED: pistil-specific extensin-like pro...    126   1e-30   Vitis vinifera
ref|XP_010537658.1|  PREDICTED: pistil-specific extensin-like pro...    122   2e-30   
gb|KHG06312.1|  Pistil-specific extensin-like protein                   125   5e-30   
gb|ABG91751.1|  HyPRP1                                                  125   5e-30   Gossypium hirsutum [American cotton]
ref|XP_004294012.1|  PREDICTED: uncharacterized protein LOC101292194    123   1e-29   
gb|EPS59678.1|  hypothetical protein M569_15127                         119   1e-29   
ref|XP_009346727.1|  PREDICTED: pistil-specific extensin-like pro...    121   1e-29   
ref|XP_008371380.1|  PREDICTED: pistil-specific extensin-like pro...    119   2e-29   
ref|XP_009353058.1|  PREDICTED: pistil-specific extensin-like pro...    121   3e-29   
ref|XP_009352905.1|  PREDICTED: pistil-specific extensin-like pro...    122   3e-29   
ref|XP_008383725.1|  PREDICTED: pistil-specific extensin-like pro...    122   5e-29   
ref|XP_008439849.1|  PREDICTED: pistil-specific extensin-like pro...    120   1e-28   
ref|XP_010272429.1|  PREDICTED: pistil-specific extensin-like pro...    119   1e-28   
gb|KDP20981.1|  hypothetical protein JCGZ_21452                         120   1e-28   
ref|XP_004155562.1|  PREDICTED: pistil-specific extensin-like pro...    117   1e-28   
ref|XP_010052299.1|  PREDICTED: pistil-specific extensin-like pro...    116   2e-28   
ref|XP_008442660.1|  PREDICTED: pistil-specific extensin-like pro...    119   2e-28   
ref|XP_002509463.1|  structural constituent of cell wall, putative      119   4e-28   Ricinus communis
ref|XP_006377373.1|  hypothetical protein POPTR_0011s05340g             118   6e-28   
gb|ABK93245.1|  unknown                                                 118   6e-28   Populus trichocarpa [western balsam poplar]
gb|ABK93518.1|  unknown                                                 118   7e-28   Populus trichocarpa [western balsam poplar]
ref|XP_004134701.1|  PREDICTED: uncharacterized protein LOC101204026    118   9e-28   
ref|XP_011043395.1|  PREDICTED: pistil-specific extensin-like pro...    117   1e-27   
ref|XP_011027818.1|  PREDICTED: pistil-specific extensin-like pro...    117   1e-27   
ref|XP_004165575.1|  PREDICTED: uncharacterized protein LOC101226613    116   3e-27   
ref|XP_004146606.1|  PREDICTED: uncharacterized protein LOC101210454    116   3e-27   
ref|XP_010057403.1|  PREDICTED: pistil-specific extensin-like pro...    115   4e-27   
gb|KHG03784.1|  Pistil-specific extensin-like protein                   116   5e-27   
gb|ACV72637.1|  proline-rich protein 3                                  116   5e-27   Gossypium hirsutum [American cotton]
ref|XP_002305791.2|  hypothetical protein POPTR_0004s04450g             115   6e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010509832.1|  PREDICTED: pistil-specific extensin-like pro...    115   8e-27   
ref|XP_009141344.1|  PREDICTED: pistil-specific extensin-like pro...    114   1e-26   
ref|XP_010413808.1|  PREDICTED: pistil-specific extensin-like pro...    114   1e-26   
ref|XP_006296145.1|  hypothetical protein CARUB_v10025298mg             114   2e-26   
ref|XP_010469426.1|  PREDICTED: pistil-specific extensin-like pro...    113   5e-26   
emb|CDO99529.1|  unnamed protein product                                113   7e-26   
emb|CDY53780.1|  BnaC04g44160D                                          110   2e-25   
ref|XP_009143748.1|  PREDICTED: pistil-specific extensin-like pro...    109   4e-25   
gb|KHN07246.1|  Pistil-specific extensin-like protein                   110   4e-25   
ref|NP_180935.1|  arabinogalactan protein 30                            109   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159332.1|  hypothetical protein PHAVU_002G229200g             110   1e-24   
ref|XP_010509721.1|  PREDICTED: pistil-specific extensin-like pro...    107   1e-24   
ref|XP_006377372.1|  hypothetical protein POPTR_0011s05340g             108   1e-24   
ref|XP_010059257.1|  PREDICTED: pistil-specific extensin-like pro...    108   2e-24   
gb|KHN09997.1|  Pistil-specific extensin-like protein                   109   2e-24   
ref|XP_006584402.1|  PREDICTED: pistil-specific extensin-like pro...    107   2e-24   
ref|XP_006594317.1|  PREDICTED: pistil-specific extensin-like pro...    109   2e-24   
emb|CAA42942.1|  proline-rich protein                                   109   2e-24   Phaseolus vulgaris [French bean]
ref|XP_003542742.1|  PREDICTED: pistil-specific extensin-like pro...    109   2e-24   
ref|XP_010549547.1|  PREDICTED: pistil-specific extensin-like pro...    107   4e-24   
ref|XP_002862304.1|  hypothetical protein ARALYDRAFT_497526             106   4e-24   
ref|XP_010504941.1|  PREDICTED: pistil-specific extensin-like pro...    105   5e-24   
gb|KFK44695.1|  hypothetical protein AALP_AA1G291300                    107   1e-23   
ref|XP_006410620.1|  hypothetical protein EUTSA_v10017961mg             104   1e-23   
ref|NP_001077616.1|  arabinogalactan protein 31                         107   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174150.1|  arabinogalactan protein 31                            107   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296427.1|  hypothetical protein CARUB_v10025607mg             104   2e-23   
dbj|BAF01102.1|  putative proline-rich protein                          106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010667752.1|  PREDICTED: pistil-specific extensin-like pro...    106   3e-23   
ref|NP_181017.1|  pollen Ole e 1 allergen and extensin family pro...    103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516625.1|  PREDICTED: pistil-specific extensin-like pro...    103   3e-23   
ref|XP_002893518.1|  hypothetical protein ARALYDRAFT_473038             106   4e-23   
gb|KFK36369.1|  hypothetical protein AALP_AA4G114500                    103   4e-23   
gb|ACU23724.1|  unknown                                                 105   6e-23   Glycine max [soybeans]
gb|AAX82549.1|  120 kDa pistil extensin-like protein                    105   1e-22   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDX84287.1|  BnaC04g10490D                                          102   2e-22   
ref|XP_009113681.1|  PREDICTED: gibberellin-regulated protein 14-...    103   2e-22   
ref|XP_006859021.1|  hypothetical protein AMTR_s00068p00169090          100   4e-22   
emb|CDY46612.1|  BnaA09g27390D                                          103   5e-22   
ref|XP_006415676.1|  hypothetical protein EUTSA_v10008255mg             102   7e-22   
ref|XP_010460614.1|  PREDICTED: gibberellin-regulated protein 14-...    102   9e-22   
gb|KCW76233.1|  hypothetical protein EUGRSUZ_D00613                   99.0    1e-21   
ref|XP_010478196.1|  PREDICTED: gibberellin-regulated protein 14-...    102   1e-21   
ref|XP_009102921.1|  PREDICTED: gibberellin-regulated protein 14-...    100   3e-21   
ref|XP_004505067.1|  PREDICTED: pistil-specific extensin-like pro...    100   3e-21   
emb|CDY15682.1|  BnaA07g08530D                                          100   3e-21   
gb|AAX82550.1|  120 kDa pistil extensin-like protein                  99.8    7e-21   Nicotiana longiflora
ref|XP_002881302.1|  hypothetical protein ARALYDRAFT_482331           98.6    8e-21   
emb|CDX94600.1|  BnaC07g10580D                                        99.0    9e-21   
gb|ACJ84438.1|  unknown                                               99.0    9e-21   Medicago truncatula
gb|KEH31054.1|  pollen Ole e I family allergen                        99.0    1e-20   
ref|XP_006305266.1|  hypothetical protein CARUB_v10009642mg           99.4    1e-20   
ref|XP_010540450.1|  PREDICTED: pistil-specific extensin-like pro...  97.4    2e-20   
gb|AFK48736.1|  unknown                                               97.4    3e-20   
gb|AAX82555.1|  120 kDa pistil extensin-like protein                  97.8    3e-20   Nicotiana bonariensis
ref|XP_010108175.1|  hypothetical protein L484_014500                 97.4    4e-20   
gb|AAC15893.1|  120 kDa style glycoprotein                            98.6    5e-20   Nicotiana alata [flowering tobacco]
ref|XP_008794128.1|  PREDICTED: pistil-specific extensin-like pro...  95.1    6e-20   
ref|XP_006468215.1|  PREDICTED: extensin-like                         95.9    9e-20   
gb|KCW74554.1|  hypothetical protein EUGRSUZ_E03269                   94.4    1e-19   
ref|XP_009335890.1|  PREDICTED: pistil-specific extensin-like pro...  93.6    2e-19   
gb|KEH32955.1|  pollen Ole e I family allergen                        94.7    5e-19   
ref|XP_010925565.1|  PREDICTED: proline-rich protein 1-like           92.4    5e-19   
ref|XP_009796660.1|  PREDICTED: pistil-specific extensin-like pro...  95.1    5e-19   
gb|AAX82548.1|  120 kDa pistil extensin-like protein                  94.0    7e-19   Nicotiana tabacum [American tobacco]
ref|XP_009617411.1|  PREDICTED: pistil-specific extensin-like pro...  94.0    1e-18   
ref|XP_006347170.1|  PREDICTED: pistil-specific extensin-like pro...  94.4    1e-18   
ref|XP_010317327.1|  PREDICTED: LOW QUALITY PROTEIN: pistil-speci...  94.4    3e-18   
gb|AAX82554.1|  120 kDa pistil extensin-like protein                  92.0    3e-18   Nicotiana forgetiana
gb|AAX82552.1|  120 kDa pistil extensin-like protein                  88.6    3e-18   Nicotiana langsdorffii [fumo-bravo]
gb|AAX82553.1|  120 kDa pistil extensin-like protein                  91.7    4e-18   Nicotiana langsdorffii [fumo-bravo]
ref|XP_010916048.1|  PREDICTED: pistil-specific extensin-like pro...  89.0    6e-18   
sp|Q03211.1|PEXLP_TOBAC  RecName: Full=Pistil-specific extensin-l...  91.7    9e-18   Nicotiana tabacum [American tobacco]
emb|CAA78396.1|  pistil extensin like protein, partial CDS            89.7    1e-17   Nicotiana tabacum [American tobacco]
gb|KEH30305.1|  pollen Ole e I family allergen                        90.1    2e-17   
ref|XP_006347026.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   
ref|XP_009796661.1|  PREDICTED: pistil-specific extensin-like pro...  90.5    2e-17   
emb|CAA78393.1|  pistil extensin like protein                         89.7    3e-17   Nicotiana tabacum [American tobacco]
ref|XP_009617406.1|  PREDICTED: pistil-specific extensin-like pro...  90.1    3e-17   
gb|AAA87047.1|  pistil extensin-like protein                          89.7    5e-17   Nicotiana alata [flowering tobacco]
ref|XP_004232890.1|  PREDICTED: pistil-specific extensin-like pro...  88.6    6e-17   
ref|XP_003597360.1|  Pistil-specific extensin-like protein            85.5    5e-16   
ref|XP_003614300.1|  Pistil-specific extensin-like protein            85.5    5e-16   
ref|XP_010418646.1|  PREDICTED: pistil-specific extensin-like pro...  80.1    2e-15   
gb|KEH29657.1|  pollen Ole e I family allergen                        82.8    3e-15   
ref|XP_006468216.1|  PREDICTED: forkhead box protein B2-like          81.6    4e-15   
gb|KEH41863.1|  pollen Ole e I family allergen                        82.4    8e-15   
gb|KEH31055.1|  pollen Ole e I family allergen                        82.8    1e-14   
ref|XP_010499343.1|  PREDICTED: gibberellin-regulated protein 14-...  80.9    2e-14   
ref|XP_010911389.1|  PREDICTED: pistil-specific extensin-like pro...  77.8    4e-14   
gb|AAD30268.1|AF117607_1  putative hybrid proline-rich protein PRP1   75.5    7e-14   Trifolium subterraneum
gb|KEH29658.1|  pollen Ole e I family allergen                        77.8    1e-13   
ref|XP_006847391.1|  hypothetical protein AMTR_s00153p00017940        73.6    1e-12   
ref|XP_002881352.1|  hypothetical protein ARALYDRAFT_482434           72.8    2e-12   
gb|KDP44722.1|  hypothetical protein JCGZ_01222                       70.9    8e-12   
ref|XP_003630140.1|  Pistil-specific extensin-like protein            72.8    1e-11   
ref|XP_006435786.1|  hypothetical protein CICLE_v10033597mg           70.5    2e-11   
ref|XP_008454812.1|  PREDICTED: uncharacterized protein LOC103495126  70.1    2e-11   
ref|XP_004148198.1|  PREDICTED: uncharacterized protein LOC101207189  69.3    3e-11   
ref|XP_007008896.1|  Pollen Ole e 1 allergen and extensin family ...  69.7    4e-11   
ref|XP_006353443.1|  PREDICTED: proline-rich protein 1-like           69.3    4e-11   
ref|XP_011076823.1|  PREDICTED: proline-rich protein 1                69.3    5e-11   
ref|XP_009414280.1|  PREDICTED: uncharacterized protein LOC103995419  68.9    5e-11   
ref|XP_008233793.1|  PREDICTED: proline-rich protein 1                68.9    7e-11   
ref|XP_002315144.1|  hypothetical protein POPTR_0010s19280g           68.9    7e-11   Populus trichocarpa [western balsam poplar]
gb|KCW65700.1|  hypothetical protein EUGRSUZ_G03079                   68.6    8e-11   
ref|XP_011035895.1|  PREDICTED: proline-rich protein 3-like           68.6    8e-11   
ref|XP_010693071.1|  PREDICTED: proline-rich protein 3                68.2    1e-10   
ref|XP_010042582.1|  PREDICTED: proline-rich protein 1-like           68.2    1e-10   
ref|XP_003604741.1|  Pistil-specific extensin-like protein            70.5    1e-10   
ref|XP_009415187.1|  PREDICTED: pistil-specific extensin-like pro...  67.4    2e-10   
gb|EMS64653.1|  hypothetical protein TRIUR3_21399                     67.4    2e-10   
emb|CDP13982.1|  unnamed protein product                              67.4    2e-10   
ref|XP_009345277.1|  PREDICTED: proline-rich protein 1-like           67.4    2e-10   
ref|XP_009776548.1|  PREDICTED: proline-rich protein 1                67.0    2e-10   
ref|XP_009632031.1|  PREDICTED: proline-rich protein 1                67.4    3e-10   
ref|XP_008369286.1|  PREDICTED: proline-rich protein 1                67.0    3e-10   
ref|XP_004240912.1|  PREDICTED: pistil-specific extensin-like pro...  66.6    3e-10   
ref|XP_009369269.1|  PREDICTED: proline-rich protein 1                66.6    4e-10   
ref|XP_010067554.1|  PREDICTED: proline-rich protein 1                66.2    5e-10   
ref|XP_004972155.1|  PREDICTED: uncharacterized protein LOC101757214  65.9    6e-10   
gb|KHN31297.1|  hypothetical protein glysoja_022951                   65.9    6e-10   
ref|XP_003552266.1|  PREDICTED: uncharacterized protein LOC100782212  65.9    6e-10   
ref|XP_010692250.1|  PREDICTED: mucin-2-like isoform X1               68.9    8e-10   
ref|XP_008374269.1|  PREDICTED: proline-rich protein 1-like           65.5    9e-10   
ref|XP_002528329.1|  conserved hypothetical protein                   65.5    1e-09   Ricinus communis
ref|XP_010692253.1|  PREDICTED: mucin-2-like isoform X4               68.6    1e-09   
ref|XP_010692252.1|  PREDICTED: mucin-2-like isoform X3               68.6    1e-09   
ref|XP_006646281.1|  PREDICTED: uncharacterized protein LOC102722358  65.5    1e-09   
ref|XP_010692251.1|  PREDICTED: mucin-2-like isoform X2               68.6    1e-09   
ref|XP_007163570.1|  hypothetical protein PHAVU_001G245200g           65.1    1e-09   
ref|XP_008656828.1|  PREDICTED: uncharacterized protein LOC103636245  65.1    1e-09   
ref|XP_008675090.1|  PREDICTED: pistil-specific extensin-like pro...  66.2    1e-09   
ref|NP_001152656.1|  pistil-specific extensin-like protein precursor  66.2    1e-09   Zea mays [maize]
ref|XP_002440125.1|  hypothetical protein SORBIDRAFT_09g026510        64.7    2e-09   Sorghum bicolor [broomcorn]
gb|KHN04779.1|  hypothetical protein glysoja_031879                   64.3    2e-09   
ref|XP_002458427.1|  hypothetical protein SORBIDRAFT_03g033370        65.1    2e-09   Sorghum bicolor [broomcorn]
ref|XP_004308952.1|  PREDICTED: proline-rich protein 3-like           64.3    2e-09   
ref|XP_003538478.1|  PREDICTED: uncharacterized protein LOC100805413  64.3    3e-09   
ref|XP_011001570.1|  PREDICTED: uncharacterized protein LOC105108781  63.9    3e-09   
ref|XP_002273190.2|  PREDICTED: pistil-specific extensin-like pro...  63.9    3e-09   Vitis vinifera
ref|XP_010233505.1|  PREDICTED: pistil-specific extensin-like pro...  63.5    4e-09   
gb|EYU20044.1|  hypothetical protein MIMGU_mgv1a014979mg              63.2    7e-09   
gb|EMT11440.1|  hypothetical protein F775_28378                       63.2    7e-09   
ref|XP_010921542.1|  PREDICTED: uncharacterized protein LOC105045075  63.2    7e-09   
ref|XP_003619134.1|  Pistil-specific extensin-like protein            64.3    7e-09   
ref|XP_002312174.1|  hypothetical protein POPTR_0008s07200g           63.2    7e-09   Populus trichocarpa [western balsam poplar]
emb|CAN84127.1|  hypothetical protein VITISV_041870                   62.8    8e-09   Vitis vinifera
gb|EAZ10663.1|  hypothetical protein OsJ_00493                        62.8    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969808.1|  PREDICTED: pistil-specific extensin-like pro...  63.5    1e-08   
dbj|BAD68108.1|  hypothetical protein                                 63.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004500509.1|  PREDICTED: uncharacterized protein LOC101506005  62.4    1e-08   
ref|XP_003591488.1|  Pistil-specific extensin-like protein            62.4    2e-08   
ref|XP_003600960.1|  hypothetical protein MTR_3g071470                62.0    2e-08   
gb|EMT24165.1|  hypothetical protein F775_00706                       62.0    2e-08   
gb|EAY72659.1|  hypothetical protein OsI_00525                        62.0    2e-08   Oryza sativa Indica Group [Indian rice]
gb|EAY72647.1|  hypothetical protein OsI_00513                        62.0    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010558065.1|  PREDICTED: pistil-specific extensin-like pro...  61.6    2e-08   
dbj|BAC00573.1|  hypothetical protein                                 61.6    3e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AFW78756.1|  arabinogalactan protein                               61.2    3e-08   
ref|XP_008675692.1|  PREDICTED: uncharacterized protein LOC103651770  61.6    4e-08   
ref|XP_004495936.1|  PREDICTED: proline-rich protein 3-like           61.2    4e-08   
ref|XP_004961410.1|  PREDICTED: uncharacterized protein LOC101783474  60.8    4e-08   
ref|XP_009631457.1|  PREDICTED: proline-rich protein 1-like           60.8    4e-08   
ref|XP_004307679.1|  PREDICTED: uncharacterized protein LOC101312388  60.8    4e-08   
ref|XP_004240229.1|  PREDICTED: pistil-specific extensin-like pro...  60.8    5e-08   
emb|CDJ26671.1|  unnamed protein product                              60.5    7e-08   
ref|XP_008780689.1|  PREDICTED: uncharacterized protein LOC103700538  58.9    8e-08   
gb|EAY72649.1|  hypothetical protein OsI_00515                        60.5    8e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_008794296.1|  PREDICTED: uncharacterized protein LOC103710381  60.1    9e-08   
ref|XP_006355745.1|  PREDICTED: uncharacterized protein LOC102584762  59.7    1e-07   
ref|XP_003536042.1|  PREDICTED: proline-rich protein 3-like           59.7    1e-07   
ref|NP_001044116.1|  Os01g0725900                                     59.3    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_568156.1|  pollen_Ole_e_I domain-containing protein            59.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084877.1|  PREDICTED: pistil-specific extensin-like pro...  59.3    2e-07   
ref|XP_010543710.1|  PREDICTED: proline-rich protein 3-like isofo...  60.1    2e-07   
dbj|BAC00572.1|  hypothetical protein                                 59.3    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147175.1|  arabinogalactan protein precursor                58.9    2e-07   Zea mays [maize]
ref|XP_006644648.1|  PREDICTED: pistil-specific extensin-like pro...  59.7    2e-07   
gb|EAY72654.1|  hypothetical protein OsI_00520                        58.9    3e-07   Oryza sativa Indica Group [Indian rice]
gb|EAY72651.1|  hypothetical protein OsI_00517                        58.9    3e-07   Oryza sativa Indica Group [Indian rice]
gb|EMT03252.1|  hypothetical protein F775_04159                       58.5    3e-07   
ref|XP_009387000.1|  PREDICTED: uncharacterized protein LOC103974010  58.9    3e-07   
emb|CDM84204.1|  unnamed protein product                              58.9    3e-07   
gb|EAY72650.1|  hypothetical protein OsI_00516                        58.9    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_009386691.1|  PREDICTED: pistil-specific extensin-like pro...  58.5    4e-07   
ref|XP_002458425.1|  hypothetical protein SORBIDRAFT_03g033350        58.2    4e-07   Sorghum bicolor [broomcorn]
gb|AFK49503.1|  unknown                                               58.2    4e-07   
gb|KHN30673.1|  Pistil-specific extensin-like protein                 58.2    5e-07   
gb|EAZ13398.1|  hypothetical protein OsJ_03318                        57.8    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010675451.1|  PREDICTED: DNA-directed RNA polymerase II su...  60.5    5e-07   
ref|XP_010675452.1|  PREDICTED: DNA-directed RNA polymerase II su...  60.5    5e-07   
ref|XP_010675453.1|  PREDICTED: adhesive plaque matrix protein-li...  60.1    6e-07   
gb|EMT12113.1|  hypothetical protein F775_09231                       57.8    6e-07   
ref|XP_007050998.1|  Pollen Ole e 1 allergen and extensin family ...  58.5    6e-07   
dbj|BAK03568.1|  predicted protein                                    57.8    8e-07   
gb|EAY72653.1|  hypothetical protein OsI_00519                        57.4    9e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010491082.1|  PREDICTED: pistil-specific extensin-like pro...  57.0    1e-06   
ref|XP_006655512.1|  PREDICTED: pistil-specific extensin-like pro...  57.4    1e-06   
ref|XP_010423467.1|  PREDICTED: pistil-specific extensin-like pro...  57.0    1e-06   
ref|NP_001044118.1|  Os01g0726100                                     57.4    1e-06   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC00576.1|  hypothetical protein                                 56.6    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655513.1|  PREDICTED: pistil-specific extensin-like pro...  56.6    2e-06   
ref|XP_006407622.1|  hypothetical protein EUTSA_v10021649mg           56.6    2e-06   
ref|NP_192136.1|  protein root hair specific 13                       56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_683542.1|  pollen Ole e 1 allergen and extensin family pro...  56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003568038.1|  PREDICTED: uncharacterized protein LOC100839300  57.0    2e-06   
emb|CDM84203.1|  unnamed protein product                              56.2    2e-06   
gb|EMS64652.1|  hypothetical protein TRIUR3_21398                     56.6    2e-06   
ref|XP_007145195.1|  hypothetical protein PHAVU_007G218200g           56.2    2e-06   
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg           55.8    3e-06   
ref|XP_002440124.1|  hypothetical protein SORBIDRAFT_09g026500        56.2    3e-06   Sorghum bicolor [broomcorn]
gb|EAY98794.1|  hypothetical protein OsI_20737                        56.2    3e-06   Oryza sativa Indica Group [Indian rice]
dbj|BAC00569.1|  hypothetical protein                                 55.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010675455.1|  PREDICTED: DNA-directed RNA polymerase II su...  58.2    3e-06   
ref|XP_010544996.1|  PREDICTED: proline-rich protein 1                55.5    4e-06   
ref|XP_010684333.1|  PREDICTED: proline-rich protein 1-like           55.8    5e-06   
gb|KDO41044.1|  hypothetical protein CISIN_1g048602mg                 55.1    5e-06   
ref|XP_009125602.1|  PREDICTED: pistil-specific extensin-like pro...  55.1    5e-06   
ref|XP_009414370.1|  PREDICTED: uncharacterized protein LOC103995501  56.2    5e-06   
ref|XP_006491610.1|  PREDICTED: uncharacterized protein LOC102629249  55.1    6e-06   
gb|EAY72646.1|  hypothetical protein OsI_00512                        55.1    6e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_002884765.1|  pollen ole e 1 allergen and extensin family ...  54.7    7e-06   
gb|EEE64463.1|  hypothetical protein OsJ_19312                        54.7    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006399011.1|  hypothetical protein EUTSA_v10014798mg           54.7    7e-06   
gb|AAS72358.1|  hypothetical protein                                  54.7    7e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98796.1|  hypothetical protein OsI_20739                        54.7    7e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_004961411.1|  PREDICTED: pistil-specific extensin-like pro...  55.1    7e-06   
ref|XP_002993254.1|  hypothetical protein SELMODRAFT_449075           56.6    8e-06   
ref|NP_001056132.1|  Os05g0531200                                     54.7    8e-06   
gb|ACG48861.1|  pistil-specific extensin-like protein precursor       55.1    9e-06   
ref|XP_009758521.1|  PREDICTED: pistil-specific extensin-like pro...  54.3    9e-06   
ref|XP_007051001.1|  Pollen Ole e 1 allergen and extensin family ...  56.2    9e-06   
gb|EMT28686.1|  hypothetical protein F775_09975                       54.7    9e-06   
gb|KDP28198.1|  hypothetical protein JCGZ_13969                       54.3    1e-05   
ref|XP_003568037.1|  PREDICTED: uncharacterized protein LOC100838992  54.3    1e-05   
gb|AFW78757.1|  pistil-specific extensin-like protein                 54.7    1e-05   
ref|XP_006289757.1|  hypothetical protein CARUB_v10003347mg           53.9    1e-05   
dbj|BAC00575.1|  hypothetical protein                                 54.3    1e-05   
ref|XP_006421230.1|  hypothetical protein CICLE_v10006960mg           53.9    1e-05   
ref|XP_006645524.1|  PREDICTED: uncharacterized protein LOC102700104  53.1    1e-05   
ref|XP_009122155.1|  PREDICTED: pistil-specific extensin-like pro...  53.9    1e-05   
ref|NP_001132399.1|  uncharacterized protein LOC100193845 precursor   53.9    2e-05   
ref|XP_006289713.1|  hypothetical protein CARUB_v10003279mg           53.5    2e-05   
gb|EAZ10660.1|  hypothetical protein OsJ_00490                        53.1    2e-05   
emb|CDY71695.1|  BnaC04g56470D                                        52.0    2e-05   
gb|EEC69996.1|  hypothetical protein OsI_00522                        53.1    2e-05   
ref|XP_008235211.1|  PREDICTED: proline-rich protein 3                53.5    3e-05   
emb|CDX99789.1|  BnaC05g22110D                                        53.1    3e-05   
ref|XP_006841503.1|  hypothetical protein AMTR_s00003p00132850        55.1    3e-05   
ref|XP_007050999.1|  Pollen Ole e 1 allergen and extensin family ...  54.7    3e-05   
ref|XP_010232982.1|  PREDICTED: uncharacterized protein LOC104583028  52.8    3e-05   
gb|EAY72658.1|  hypothetical protein OsI_00524                        52.8    3e-05   
emb|CDY01916.1|  BnaC02g28110D                                        52.8    3e-05   
ref|XP_009144584.1|  PREDICTED: proline-rich protein 3                52.4    4e-05   
ref|XP_004972154.1|  PREDICTED: uncharacterized protein LOC101756797  52.8    4e-05   
ref|XP_010429456.1|  PREDICTED: proline-rich protein 1-like           52.4    4e-05   
emb|CDX90944.1|  BnaA03g26240D                                        52.4    5e-05   
ref|XP_007051003.1|  Pollen Ole e 1 allergen and extensin family ...  53.9    5e-05   
ref|XP_011079960.1|  PREDICTED: proline-rich protein 3                52.4    5e-05   
gb|KFK37521.1|  hypothetical protein AALP_AA4G267800                  52.4    5e-05   
emb|CDX73999.1|  BnaA03g30480D                                        52.4    5e-05   
ref|XP_010091454.1|  hypothetical protein L484_001723                 52.4    5e-05   
emb|CDY69202.1|  BnaCnng62360D                                        52.0    6e-05   
emb|CDY18027.1|  BnaC03g30990D                                        52.0    6e-05   
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...  52.0    6e-05   
ref|XP_010095728.1|  hypothetical protein L484_003340                 52.8    8e-05   
emb|CDX98846.1|  BnaC09g49890D                                        52.0    8e-05   
ref|XP_010486570.1|  PREDICTED: proline-rich protein 3-like           51.6    8e-05   
ref|XP_006299409.1|  hypothetical protein CARUB_v10015569mg           51.6    8e-05   
ref|XP_010478850.1|  PREDICTED: proline-rich protein 3-like           51.6    8e-05   
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...  51.6    8e-05   
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...  51.6    9e-05   
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg           51.6    9e-05   
ref|XP_010422614.1|  PREDICTED: proline-rich protein 3-like           51.2    9e-05   
ref|XP_002990973.1|  hypothetical protein SELMODRAFT_429316           51.2    9e-05   
ref|XP_009135036.1|  PREDICTED: proline-rich protein 3-like           51.6    9e-05   
ref|XP_010518458.1|  PREDICTED: proline-rich protein 3-like           51.6    1e-04   
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...  51.2    1e-04   
ref|XP_010464652.1|  PREDICTED: proline-rich protein 3-like           51.2    1e-04   
ref|XP_010558200.1|  PREDICTED: proline-rich protein 1                51.2    1e-04   
ref|XP_006396434.1|  hypothetical protein EUTSA_v10029026mg           51.2    1e-04   
gb|EMS45328.1|  hypothetical protein TRIUR3_28388                     51.2    1e-04   
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   51.2    1e-04   
ref|XP_009413140.1|  PREDICTED: pistil-specific extensin-like pro...  51.2    1e-04   
emb|CDY43319.1|  BnaC03g58910D                                        51.2    1e-04   
ref|XP_010456054.1|  PREDICTED: proline-rich protein 3                50.8    1e-04   
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg           50.8    2e-04   
ref|XP_010088313.1|  hypothetical protein L484_011129                 51.2    2e-04   
ref|XP_006359929.1|  PREDICTED: uncharacterized protein LOC102597471  51.2    2e-04   
gb|KFK30801.1|  hypothetical protein AALP_AA6G027700                  51.6    2e-04   
ref|XP_010506792.1|  PREDICTED: proline-rich protein 3-like           50.4    2e-04   
ref|XP_002872848.1|  pollen ole e 1 allergen and extensin family ...  50.4    2e-04   
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...  50.4    2e-04   
ref|XP_008803445.1|  PREDICTED: pistil-specific extensin-like pro...  50.4    2e-04   
ref|NP_001065213.1|  Os10g0546100                                     50.4    2e-04   
gb|AFK42637.1|  unknown                                               50.4    2e-04   
emb|CBI36890.3|  unnamed protein product                              52.0    2e-04   
ref|XP_010497935.1|  PREDICTED: uncharacterized protein LOC104775694  48.5    2e-04   
emb|CAN65163.1|  hypothetical protein VITISV_002453                   52.0    2e-04   
ref|XP_009773994.1|  PREDICTED: olee1-like protein                    50.4    2e-04   
emb|CDY14111.1|  BnaC02g02280D                                        50.4    2e-04   
ref|NP_001140237.1|  uncharacterized protein LOC100272278 precursor   52.0    2e-04   
ref|XP_007032851.1|  Pollen Ole e 1 allergen and extensin family ...  50.4    3e-04   
ref|XP_010652208.1|  PREDICTED: early nodulin-75-like                 52.0    3e-04   
ref|XP_006397949.1|  hypothetical protein EUTSA_v10001657mg           50.1    3e-04   
ref|XP_002993257.1|  hypothetical protein SELMODRAFT_431382           50.1    3e-04   
gb|KFK37520.1|  hypothetical protein AALP_AA4G267700                  49.7    3e-04   
ref|XP_009378755.1|  PREDICTED: proline-rich protein 3-like           50.1    3e-04   
ref|XP_010507877.1|  PREDICTED: proline-rich protein 3-like           49.7    4e-04   
gb|EAZ10655.1|  hypothetical protein OsJ_00485                        49.7    4e-04   
emb|CDY63853.1|  BnaC04g51820D                                        49.3    6e-04   
ref|XP_008369101.1|  PREDICTED: proline-rich protein 3-like           49.7    6e-04   
ref|XP_011009987.1|  PREDICTED: proline-rich protein 3-like           49.3    6e-04   
ref|XP_009142522.1|  PREDICTED: proline-rich protein 3                49.3    6e-04   
ref|XP_003567068.1|  PREDICTED: pistil-specific extensin-like pro...  49.3    7e-04   
ref|NP_182276.1|  pollen Ole e 1 allergen and extensin family pro...  48.9    7e-04   
ref|XP_002880310.1|  hypothetical protein ARALYDRAFT_483934           48.9    7e-04   
ref|XP_002302729.1|  pollen Ole e 1 allergen and extensin family ...  48.9    8e-04   
gb|EYU46753.1|  hypothetical protein MIMGU_mgv1a014539mg              48.9    0.001   
ref|XP_002994212.1|  hypothetical protein SELMODRAFT_432150           50.1    0.001   
dbj|BAD68104.1|  hypothetical protein                                 49.7    0.001   
ref|XP_002993255.1|  hypothetical protein SELMODRAFT_431381           50.1    0.001   



>ref|XP_004232891.1| PREDICTED: pistil-specific extensin-like protein [Solanum lycopersicum]
Length=257

 Score =   155 bits (391),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 96/129 (74%), Gaps = 5/129 (4%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             VRG+VYCK+CKY+GVD L  A PI+GAVVKLACNNTKYHL+    TDKNGFF F  PK 
Sbjct  127  GVRGVVYCKACKYRGVDTLLGASPIQGAVVKLACNNTKYHLTSLGTTDKNGFF-FIQPKW  185

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLI---PTPLKLPAP-YNLYTVGPFA  246
            +++AGY KCKV+L KSP ++CS  TN+  G+ GA LI   P+P+ L  P   L+ VGPFA
Sbjct  186  LTTAGYHKCKVFLAKSPKAECSVPTNFHNGQSGAMLIPAPPSPMTLSEPEVKLFNVGPFA  245

Query  245  FEPSKKVLC  219
            FEPSKK+ C
Sbjct  246  FEPSKKLPC  254



>gb|ADW66159.1| pistil-specific extensin-like protein [Solanum nigrum]
Length=168

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 94/135 (70%), Gaps = 14/135 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             VRG+VYCKSCKY+GVD L  A PI+GAVVKLACNNTKYHL+    TDKNG+F F  PK 
Sbjct  35   GVRGVVYCKSCKYRGVDTLLGASPIQGAVVKLACNNTKYHLTSLGTTDKNGYF-FIQPKW  93

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN----------LY  264
            +++AGY KCKV+L KSP ++CS  TN+  G+ GA LIP P   P+P            L+
Sbjct  94   LTTAGYHKCKVFLAKSPKAECSVPTNFHNGQSGAMLIPAP---PSPMTLSKQAESEVKLF  150

Query  263  TVGPFAFEPSKKVLC  219
             VGPFAFEPSK + C
Sbjct  151  NVGPFAFEPSKNLPC  165



>ref|XP_006347025.1| PREDICTED: pistil-specific extensin-like protein-like [Solanum 
tuberosum]
Length=280

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 95/136 (70%), Gaps = 15/136 (11%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             VRG+VYCK+CKY+GVD L  A PI+GAVVKLACNNTKYHL+    TDKNGFF F  PK 
Sbjct  146  GVRGVVYCKACKYRGVDTLLGASPIQGAVVKLACNNTKYHLTSLGTTDKNGFF-FIQPKW  204

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN-----------L  267
            +++AGY KCKV+L KSP ++CS  TN+  G+ GA LIP P   P+P             L
Sbjct  205  LTTAGYHKCKVFLAKSPKAECSVPTNFHNGQSGAMLIPAP---PSPMTLVSKPAEPEVKL  261

Query  266  YTVGPFAFEPSKKVLC  219
            + VGPFAFEPSKK+ C
Sbjct  262  FNVGPFAFEPSKKLPC  277



>ref|XP_009764640.1| PREDICTED: pistil-specific extensin-like protein [Nicotiana sylvestris]
Length=252

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 12/136 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             VRG+VYCKSCKY+G+D L  A PI GAVVKLACNNTKYHL+    TDKNG+F F  PK 
Sbjct  116  GVRGVVYCKSCKYRGIDTLLGASPILGAVVKLACNNTKYHLTALGTTDKNGYF-FIQPKW  174

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN-----------L  267
            +++AGY KCKV+L KSP  +CS  TN+  G+ GA LIP  L  PAP             L
Sbjct  175  LTTAGYHKCKVFLAKSPKPECSVPTNFHNGQAGAMLIPASLPPPAPMTSKPVDSETGVKL  234

Query  266  YTVGPFAFEPSKKVLC  219
            + VGPFAFEPSK + C
Sbjct  235  FNVGPFAFEPSKNLPC  250



>ref|XP_011096313.1| PREDICTED: pistil-specific extensin-like protein [Sesamum indicum]
Length=224

 Score =   146 bits (368),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 95/132 (72%), Gaps = 9/132 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY+GVD L  A P+ GAVVKL CNNTKY L   TKTDKNG+F F+MP+ 
Sbjct  93   AVQGVVYCKSCKYRGVDTLVGAAPLAGAVVKLQCNNTKYSLVEQTKTDKNGYF-FFMPQK  151

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT-------PLKLPAPYNLYTVG  255
            +++AG  KCKV+++ SPL+ CS  TN   G  GA L+PT       P K P P+ L+TVG
Sbjct  152  LTTAGSHKCKVFIISSPLATCSVPTNLHGGAVGAILMPTTKPPVPAPTK-PLPFELFTVG  210

Query  254  PFAFEPSKKVLC  219
            PFAFEP KK+ C
Sbjct  211  PFAFEPHKKMPC  222



>ref|XP_009605693.1| PREDICTED: pistil-specific extensin-like protein [Nicotiana tomentosiformis]
Length=258

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 89/136 (65%), Gaps = 12/136 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             VRG+VYCKSCKY+GVD L  A PI+GAVVKLACNNTKYHL+    TDKNGFF F  PK 
Sbjct  122  GVRGVVYCKSCKYRGVDTLLGASPIQGAVVKLACNNTKYHLTALGTTDKNGFF-FIQPKW  180

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-----------IPTPLKLPAPYNL  267
            +++AGY KCKV+L KSP  +CS  TN+  G+ GA L              P+       L
Sbjct  181  LTTAGYHKCKVFLAKSPKPECSVPTNFHNGQAGAMLNPAPLPPPAPMTSKPVDSETGVKL  240

Query  266  YTVGPFAFEPSKKVLC  219
            + VGPFAFEPSK + C
Sbjct  241  FNVGPFAFEPSKNLPC  256



>gb|AAS92246.1| proline-rich protein 1 [Capsicum annuum]
Length=260

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 6/129 (5%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            VRGLVYCK CKY+G++ LY+AKP++GAVVKL C N+K  L    KTDKNG+F + MPK++
Sbjct  131  VRGLVYCKPCKYRGIETLYRAKPLEGAVVKLVCKNSKKTLVEQGKTDKNGYF-WIMPKLL  189

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-----YNLYTVGPFA  246
            +S  Y KCKV+LV S  S C+  TN+  GK GA L  TP   P P     ++++TVGPF 
Sbjct  190  TSGAYHKCKVFLVSSNNSYCNVPTNFNGGKSGALLKYTPPSKPTPSAITKFDVFTVGPFG  249

Query  245  FEPSKKVLC  219
            FEPSKKV C
Sbjct  250  FEPSKKVPC  258



>ref|XP_009758823.1| PREDICTED: pistil-specific extensin-like protein [Nicotiana sylvestris]
Length=257

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 90/136 (66%), Gaps = 13/136 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CK++GV  L +A P+ GAVVKL CNNTK  L    KTDKNGFF + MPK 
Sbjct  122  AVRGLVYCKPCKFRGVKTLNQASPLLGAVVKLVCNNTKKTLVEQGKTDKNGFF-WIMPKF  180

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPL-----------KLPAPYNL  267
            +SSA Y KCKV+LV S  + C   T+Y  GK GA L  TPL           KLP  +++
Sbjct  181  LSSAAYHKCKVFLVSSNNTYCDVPTDYNGGKSGALLKYTPLPKPPAATSLPVKLPT-FDV  239

Query  266  YTVGPFAFEPSKKVLC  219
            +TVGPF FEPSKKV C
Sbjct  240  FTVGPFGFEPSKKVPC  255



>ref|XP_006347027.1| PREDICTED: pistil-specific extensin-like protein-like [Solanum 
tuberosum]
Length=254

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 90/134 (67%), Gaps = 10/134 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CK++G++ L +AKP++GA VKL CNNTK  L    +TDKNGFF + +PK+
Sbjct  119  AVRGLVYCKPCKFRGINTLNQAKPLQGAKVKLVCNNTKKTLVEQAETDKNGFF-WILPKL  177

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDG--------APLIPTPLKLPAP-YNLYT  261
            +SS  Y KCKV+LV S  S C+  TNY  GK G        AP    P+K P P Y+ +T
Sbjct  178  LSSGAYHKCKVFLVSSNNSYCNVPTNYNDGKSGALLKYTPPAPATHLPIKPPTPKYDFFT  237

Query  260  VGPFAFEPSKKVLC  219
            VGPF FE SKKV C
Sbjct  238  VGPFGFEASKKVPC  251



>emb|CAA49895.1| proline-rich protein [Nicotiana alata]
Length=255

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 90/136 (66%), Gaps = 13/136 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CK++GV  L +A P+ GAVV+L CNNTK  L    KTDKNGFF + MPK 
Sbjct  120  AVRGLVYCKPCKFRGVKTLNQASPLLGAVVELVCNNTKKTLVEQGKTDKNGFF-WIMPKF  178

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPL-----------KLPAPYNL  267
            +SSA Y KCKV+LV S  + C   T+Y  GK GA L  TPL           KLP  +++
Sbjct  179  LSSAAYHKCKVFLVSSNNTYCDVPTDYNGGKSGALLKYTPLPKPPAASSLPVKLPT-FDV  237

Query  266  YTVGPFAFEPSKKVLC  219
            +TVGPF FEPSKKV C
Sbjct  238  FTVGPFGFEPSKKVPC  253



>ref|XP_004232888.1| PREDICTED: pistil-specific extensin-like protein [Solanum lycopersicum]
Length=246

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 92/140 (66%), Gaps = 16/140 (11%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CK++G++ L +AKP++GA VKL CNNTK  L    +TDKNGFF + +PK+
Sbjct  105  AVRGLVYCKPCKFRGINTLNQAKPLQGAKVKLVCNNTKKTLVEQAETDKNGFF-WILPKL  163

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT--------------PLKLPAP  276
            +SS  Y KCKV+LV S  + C+  TNY  GK GA L  T              P+K P P
Sbjct  164  LSSGAYHKCKVFLVSSNNTYCNVPTNYNSGKSGALLKYTPPPMPPSPAPATHLPIKPPTP  223

Query  275  -YNLYTVGPFAFEPSKKVLC  219
             Y+ +TVGPF FEPSKKV C
Sbjct  224  KYDFFTVGPFGFEPSKKVPC  243



>ref|XP_009602333.1| PREDICTED: pistil-specific extensin-like protein [Nicotiana tomentosiformis]
Length=261

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 88/135 (65%), Gaps = 11/135 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CK++GV  L +A P+ GAVVKL CNNTK  L    KTDKNGFF + MPK+
Sbjct  126  AVRGLVYCKPCKFRGVKTLNQASPLLGAVVKLVCNNTKKTLVEQGKTDKNGFF-WIMPKL  184

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP----------YNLY  264
            +SS  Y KCKV+LV S  + C   T+Y  GK GA L  TPL  P            Y+++
Sbjct  185  LSSGAYHKCKVFLVSSNNTYCDVPTDYNGGKSGALLKYTPLPKPPAASSLPVKPPTYDVF  244

Query  263  TVGPFAFEPSKKVLC  219
            TVGPF FEPSKKV C
Sbjct  245  TVGPFGFEPSKKVPC  259



>ref|XP_010260222.1| PREDICTED: pistil-specific extensin-like protein [Nelumbo nucifera]
Length=236

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  A PI GA VKL CNNTK  ++    TDKNG+FL   PK 
Sbjct  114  AVQGVVYCKSCKYPGVDTLLGATPIAGATVKLQCNNTKSPVTQQATTDKNGYFLLQAPKK  173

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLYTVGPFAFEP  237
            V++ G RKCKV+LV SPL+ C + TN   G  GA L     K P  + LYTVGP AF P
Sbjct  174  VTTYGVRKCKVFLVSSPLASCQQPTNLHQGSTGAVLRYEKPKTPISFALYTVGPLAFAP  232



>gb|ACN60130.1| putative proline-rich protein [Petunia x hybrida]
Length=256

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 87/135 (64%), Gaps = 11/135 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CKY+GV+ L  A P++GA+VKLACNNTK  L     TDKNGFFL  +PK+
Sbjct  121  AVRGLVYCKPCKYRGVETLNLATPLQGAIVKLACNNTKKTLVEQGTTDKNGFFLI-LPKM  179

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP----------YNLY  264
            +SS  Y KCKV+LV S  + C   TN+  GK GA L  TPL  P            ++++
Sbjct  180  LSSGAYHKCKVFLVSSKNTHCDVPTNFNGGKSGALLKYTPLPKPPATSHLPVKPPTFDVF  239

Query  263  TVGPFAFEPSKKVLC  219
            TVGPF FE S KV C
Sbjct  240  TVGPFGFEASSKVPC  254



>ref|XP_007213090.1| hypothetical protein PRUPE_ppa021281mg, partial [Prunus persica]
 gb|EMJ14289.1| hypothetical protein PRUPE_ppa021281mg, partial [Prunus persica]
Length=166

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  A P+ GA +KL CNNTKY L V T TDKNG+F    PK 
Sbjct  43   AVQGVVYCKSCKYSGVDTLLGASPVLGATIKLQCNNTKYPLVVKTNTDKNGYFFITAPKT  102

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KCKV+LV SP + CS+ ++   G  GA L P    +    P+ LY VGPFAFE
Sbjct  103  ITTFGAHKCKVFLVSSPSATCSKPSDLHAGLSGAVLRPQKPFMSKKLPFLLYNVGPFAFE  162

Query  239  P  237
            P
Sbjct  163  P  163



>ref|XP_011087017.1| PREDICTED: pistil-specific extensin-like protein [Sesamum indicum]
Length=288

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 86/129 (67%), Gaps = 5/129 (4%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY+GVD L  A P+ GAVVKL CN+ K  L   TKTDKNG+F F+MP  
Sbjct  159  AVQGVVYCKSCKYRGVDTLVGASPLSGAVVKLQCNDAKQSLVEQTKTDKNGYF-FFMPPK  217

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT---PLKL-PAPYNLYTVGPFA  246
            + +    KCKV+LV SPL +C   TN   G  GA LIP    P+K+   P+ L+ VGP A
Sbjct  218  LRTLTAHKCKVFLVSSPLPKCGVPTNLHGGATGATLIPAVKPPVKIKKQPFVLFNVGPLA  277

Query  245  FEPSKKVLC  219
            FEP KK+ C
Sbjct  278  FEPHKKLPC  286



>emb|CAC16734.1| arabinogalactan protein [Daucus carota]
Length=242

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 86/139 (62%), Gaps = 12/139 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCK C Y GV+ L  A P+ GAVVKL CNNTKY L V  KTDKNG+F    PK 
Sbjct  111  AVQGVVYCKPCNYTGVETLLGATPLLGAVVKLQCNNTKYPLVVQGKTDKNGYFSLNAPKT  170

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLI-----PTPLKLPAPYNLYTVGPF  249
            +++ G  KC+V++V SP  +C + TN + G  GA L      P   K PA + +++VGPF
Sbjct  171  ITTYGVHKCRVFVVSSPEKKCDKPTNLRYGVKGAILEKSTKPPVSTKTPATFEMFSVGPF  230

Query  248  AFEPSKKVLCPR**HPCMH  192
            AFEPS K        PC H
Sbjct  231  AFEPSTK-------KPCSH  242



>emb|CBI29537.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 84/130 (65%), Gaps = 3/130 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCK+CKY+G+D L  A P+ GA VKL CNNTKY L V  KTDKNG+F    PK 
Sbjct  30   AVQGVVYCKACKYRGIDTLLGASPLLGATVKLQCNNTKYPLVVLGKTDKNGYFFIQAPKK  89

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT---PLKLPAPYNLYTVGPFAF  243
            +++ G  KCKV L+ S    C+  T+   G  GA L P        P PY  ++VGPFAF
Sbjct  90   ITTFGAHKCKVSLISSSSPTCNLATDLHFGLKGAILRPEKPPAGLPPPPYVTFSVGPFAF  149

Query  242  EPSKKVLCPR  213
            EP+KKV CPR
Sbjct  150  EPAKKVECPR  159



>ref|XP_008225109.1| PREDICTED: pistil-specific extensin-like protein [Prunus mume]
Length=293

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  A P+ GA +KL CNNTKY L V T TDKNG+F    PK 
Sbjct  170  AVQGVVYCKSCKYSGVDTLLGASPVLGATIKLQCNNTKYPLVVKTNTDKNGYFFITAPKT  229

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KCKV+LV SP + CS+ ++   G  GA L P    +    P+ LY VGPFAFE
Sbjct  230  ITTFGAHKCKVFLVSSPSATCSKPSDLHAGLSGAVLRPQKPFMSEKLPFLLYNVGPFAFE  289

Query  239  P  237
            P
Sbjct  290  P  290



>ref|XP_007025595.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY28217.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=326

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 80/121 (66%), Gaps = 2/121 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  AKPI GA+VKL C NTKY   V  KTDKNG+F    PK 
Sbjct  203  AVQGVVYCKSCKYAGVDTLLGAKPIFGAIVKLTCKNTKYKQVVQAKTDKNGYFFLEAPKS  262

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            ++S G  KC V LV SPL+ CS+ +N   G  GA L P    +    P+ LY+VGPFAFE
Sbjct  263  ITSFGAHKCTVSLVSSPLASCSKPSNLNNGLQGATLKPEKPFIANKLPFILYSVGPFAFE  322

Query  239  P  237
            P
Sbjct  323  P  323



>ref|XP_002274293.3| PREDICTED: pistil-specific extensin-like protein [Vitis vinifera]
Length=276

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 84/130 (65%), Gaps = 3/130 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCK+CKY+G+D L  A P+ GA VKL CNNTKY L V  KTDKNG+F    PK 
Sbjct  147  AVQGVVYCKACKYRGIDTLLGASPLLGATVKLQCNNTKYPLVVLGKTDKNGYFFIQAPKK  206

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT---PLKLPAPYNLYTVGPFAF  243
            +++ G  KCKV L+ S    C+  T+   G  GA L P        P PY  ++VGPFAF
Sbjct  207  ITTFGAHKCKVSLISSSSPTCNLATDLHFGLKGAILRPEKPPAGLPPPPYVTFSVGPFAF  266

Query  242  EPSKKVLCPR  213
            EP+KKV CPR
Sbjct  267  EPAKKVECPR  276



>ref|XP_010537658.1| PREDICTED: pistil-specific extensin-like protein [Tarenaya hassleriana]
Length=163

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  A P++GA V LACNNT+  L++ +KTDKNG+FL  +PK 
Sbjct  39   AVQGVVYCKSCKYAGVDTLLDASPLQGATVGLACNNTEKGLTMESKTDKNGYFLMLVPKK  98

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT-PLKL-PAPYNLYTVGPFAFE  240
            ++S  + KC+  LVKS  + C   +    G  G  L P+ P+ +    Y LYTVGPFAF+
Sbjct  99   ITSYAFHKCRATLVKSAENSCKIPSQLNNGTTGGFLRPSQPITVGKVSYVLYTVGPFAFD  158

Query  239  PSKKVLCPR  213
            PS    CPR
Sbjct  159  PS----CPR  163



>gb|KHG06312.1| Pistil-specific extensin-like protein [Gossypium arboreum]
Length=322

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 81/123 (66%), Gaps = 6/123 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+V+CKSCKY G + L  AKPI GA VKL C NTKY    T KTDKNG+F    PK 
Sbjct  199  AVQGVVFCKSCKYAGSNTLLGAKPILGATVKLTCKNTKYKQEATAKTDKNGYFFLQAPKT  258

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP----TPLKLPAPYNLYTVGPFA  246
            V+S G  KC V LV SP+++CS+ +N   G  GA L P    T  KL  P+ LYTVGPFA
Sbjct  259  VTSFGAHKCTVSLVSSPMAKCSKPSNLHGGLKGATLRPEKPFTANKL--PFILYTVGPFA  316

Query  245  FEP  237
            FEP
Sbjct  317  FEP  319



>gb|ABG91751.1| HyPRP1 [Gossypium hirsutum]
Length=326

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 81/123 (66%), Gaps = 6/123 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+V+CKSCKY G + L  AKPI GA VKL C NTKY    T KTDKNG+F    PK 
Sbjct  203  AVQGVVFCKSCKYAGSNTLLGAKPILGATVKLTCKNTKYKQEATAKTDKNGYFFLQAPKT  262

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP----TPLKLPAPYNLYTVGPFA  246
            V+S G  KC V LV SP+++CS+ +N   G  GA L P    T  KL  P+ LYTVGPFA
Sbjct  263  VTSFGAHKCTVSLVSSPMAKCSKPSNLHGGLKGATLRPEKPFTANKL--PFILYTVGPFA  320

Query  245  FEP  237
            FEP
Sbjct  321  FEP  323



>ref|XP_004294012.1| PREDICTED: uncharacterized protein LOC101292194 [Fragaria vesca 
subsp. vesca]
Length=276

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 83/130 (64%), Gaps = 7/130 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  A  I GA VKL CNNTKY L V   TDKNG+F    PK 
Sbjct  151  AVQGVVYCKSCKYSGVDTLLNATAIAGATVKLQCNNTKYPLVVKGTTDKNGYFFISAPKT  210

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT-PL--KLPAPYNLYTVGPFAF  243
            +++ G  KCK +LV +P + CS+ +++  G  GA L PT P   +   P+ LYTVGPFAF
Sbjct  211  ITTFGAHKCKAFLVSAPTTACSKISDFHGGLTGAVLRPTKPFVSEKKLPFLLYTVGPFAF  270

Query  242  EPSKKVLCPR  213
            E      CPR
Sbjct  271  ESK----CPR  276



>gb|EPS59678.1| hypothetical protein M569_15127, partial [Genlisea aurea]
Length=125

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 84/125 (67%), Gaps = 7/125 (6%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+V+CKSC Y G+++ ++  P++GAVVKL C+NTK   S   +TDKNG+F F+ PK 
Sbjct  2    AVEGIVFCKSCHYIGLNSSHRPPPLEGAVVKLQCHNTKNPFSDRARTDKNGYFFFF-PKH  60

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP------LKLPAPYNLYTVGP  252
            +S+ G  KCKVYLV SPL++CS  +N   G  G  L+P+       +    PY L++VGP
Sbjct  61   LSTMGAHKCKVYLVSSPLTKCSVPSNLHGGVTGVSLLPSEAPPVEGVSRKLPYTLFSVGP  120

Query  251  FAFEP  237
            FAFEP
Sbjct  121  FAFEP  125



>ref|XP_009346727.1| PREDICTED: pistil-specific extensin-like protein [Pyrus x bretschneideri]
Length=198

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD L  AKP+ GA VKL CNN K+ L V   TDKNG+F    PK 
Sbjct  74   AVQGVVYCKSCNYSGVDTLNGAKPVLGATVKLQCNNRKFPLVVKETTDKNGYFFITAPKT  133

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KCKV LV SP + CS+ ++   G  GA L P    +    P+ LY VGPFAFE
Sbjct  134  ITTFGAHKCKVSLVSSPSAACSKPSDLHGGLSGALLKPAKPFMSQKLPFLLYNVGPFAFE  193

Query  239  PSKKVLCPR  213
            P+    CPR
Sbjct  194  PT----CPR  198



>ref|XP_008371380.1| PREDICTED: pistil-specific extensin-like protein [Malus domestica]
Length=138

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD L  AKP+ GA VKL CNN K+ L V   TDKNG+F    PK 
Sbjct  14   AVQGVVYCKSCNYSGVDTLNGAKPVLGATVKLQCNNRKFPLVVKETTDKNGYFFITAPKT  73

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KCKV LV SP   CS+ ++   G  GA + P    +    P+ LY VGPFAFE
Sbjct  74   ITTFGAHKCKVSLVSSPSVACSKPSDLHGGLSGALMKPAKPFMSQKLPFLLYNVGPFAFE  133

Query  239  PSKKVLCPR  213
            P+    CPR
Sbjct  134  PT----CPR  138



>ref|XP_009353058.1| PREDICTED: pistil-specific extensin-like protein [Pyrus x bretschneideri]
Length=224

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD L  AKP+ GA VKL CNN K+ L V   TDKNG+F    PK 
Sbjct  100  AVQGVVYCKSCNYSGVDTLNGAKPVLGATVKLQCNNRKFPLVVKETTDKNGYFFITAPKT  159

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KCKV LV SP + CS+ ++   G  GA L P    +    P+ LY VGPFAFE
Sbjct  160  ITTFGAHKCKVSLVSSPSAACSKPSDLHGGLSGALLKPAKPFMSQKLPFLLYNVGPFAFE  219

Query  239  PSKKVLCPR  213
            P+    CPR
Sbjct  220  PT----CPR  224



>ref|XP_009352905.1| PREDICTED: pistil-specific extensin-like protein [Pyrus x bretschneideri]
Length=287

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD L  AKP+ GA VKL CNNTKY L V   TDKNG+F    PK 
Sbjct  163  AVQGVVYCKSCNYSGVDTLNGAKPVLGATVKLQCNNTKYPLVVKKTTDKNGYFFITAPKT  222

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            V++ G  KCKV LV +P + CS+ ++   G  GA L P    +    P+ LY VGPFAFE
Sbjct  223  VTTFGAHKCKVSLVSAPSTACSKPSDLHGGLSGALLRPVKPFVSQKLPFLLYNVGPFAFE  282

Query  239  PSKKVLCPR  213
            P     CPR
Sbjct  283  PK----CPR  287



>ref|XP_008383725.1| PREDICTED: pistil-specific extensin-like protein [Malus domestica]
Length=307

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 83/131 (63%), Gaps = 10/131 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD L  AKP+ GA VKL CNNTKY L V   TDKNG+F    PK 
Sbjct  183  AVQGVVYCKSCNYSGVDTLNGAKPVLGATVKLQCNNTKYPLVVKKTTDKNGYFFITAPKT  242

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT-PL---KLPAPYNLYTVGPFA  246
            V++ G  KCKV LV +P + CS+ ++   G  GA L P  P    KL  P+ LY VGPFA
Sbjct  243  VTTFGAHKCKVSLVSAPSTACSKPSDLHGGLSGALLRPVKPFVSQKL--PFLLYNVGPFA  300

Query  245  FEPSKKVLCPR  213
            FEP     CPR
Sbjct  301  FEPK----CPR  307



>ref|XP_008439849.1| PREDICTED: pistil-specific extensin-like protein [Cucumis melo]
Length=271

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 78/123 (63%), Gaps = 3/123 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            +V+G+VYCKSCKY G D L  A P+ GA VKL C NTKY L  T  TDKNG+F    PK 
Sbjct  145  SVQGVVYCKSCKYAGADTLLGATPVAGASVKLICQNTKYPLVQTATTDKNGYFFITAPKA  204

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYTVGPFAF  243
            ++S  + KCKV L KSP   CS+ +    G  GAPL P    + A   P+ LY+VGPFAF
Sbjct  205  ITSYAFHKCKVVLGKSPSPTCSKPSALHGGAAGAPLRPQKSYIDANKLPFVLYSVGPFAF  264

Query  242  EPS  234
            EP+
Sbjct  265  EPT  267



>ref|XP_010272429.1| PREDICTED: pistil-specific extensin-like protein [Nelumbo nucifera]
Length=229

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 76/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  A PI GA VKL CNNTKY  S    T KNG+F    PK 
Sbjct  108  AVQGVVYCKSCKYPGVDTLLGATPISGATVKLQCNNTKYPTSHEATTAKNGYFFLQPPKT  167

Query  413  VSSAGYRKCKVYLVKS-PLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLYTVGPFAFEP  237
            +++ G  KCKV+LVKS P + C  KTN   G  GA L     K P  + LY+VGPFAF P
Sbjct  168  ITTYGVHKCKVFLVKSLPSASCQLKTNLNQGISGAVLRYEKPKSPLSFALYSVGPFAFAP  227



>gb|KDP20981.1| hypothetical protein JCGZ_21452 [Jatropha curcas]
Length=261

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            +V+G+VYCKSCKY GV+ L  A P+ GA VKL CNNTKY L     TDKNG+F    PK 
Sbjct  137  SVQGVVYCKSCKYSGVETLLGASPLSGATVKLQCNNTKYPLEAKATTDKNGYFFLEAPKS  196

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KCKV LV +P + CS+ T+   G  G  L P    +    P+ L+TVGPFAFE
Sbjct  197  ITNFGAHKCKVSLVSAPNTACSKPTDLHGGVSGGLLRPEKKYISNKLPFVLFTVGPFAFE  256

Query  239  PSKKVLCPR  213
            P     CPR
Sbjct  257  PK----CPR  261



>ref|XP_004155562.1| PREDICTED: pistil-specific extensin-like protein-like [Cucumis 
sativus]
Length=176

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 77/123 (63%), Gaps = 3/123 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            +V+G+VYCKSCKY G D L  A P+ GA VKL C NTKY L  T  TDKNG+F    PK 
Sbjct  50   SVQGVVYCKSCKYPGADTLLGATPVAGASVKLICQNTKYPLVQTATTDKNGYFFITAPKA  109

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYTVGPFAF  243
            ++S  + KCKV L  SP   C++ +    G  GAPL P    + A   P+ LY+VGPFAF
Sbjct  110  ITSYAFHKCKVVLGSSPSPTCTKPSALHGGAAGAPLRPQKSYIDANKLPFVLYSVGPFAF  169

Query  242  EPS  234
            EP+
Sbjct  170  EPT  172



>ref|XP_010052299.1| PREDICTED: pistil-specific extensin-like protein [Eucalyptus 
grandis]
Length=132

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 80/125 (64%), Gaps = 3/125 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV-TTKTDKNGFFLFYMPK  417
            AV+G+VYCKSCKY GV+ L  A P+ GAVVKL CNNTKY  +V T KTDKNG+F    PK
Sbjct  7    AVQGVVYCKSCKYSGVETLLGATPVLGAVVKLECNNTKYRPTVQTAKTDKNGYFFLKAPK  66

Query  416  IVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT-PLKLP-APYNLYTVGPFAF  243
             +++  + KC   L  SP+  C + +    G  GA L P  P+ +   PY ++TVGPFAF
Sbjct  67   TITTYAFHKCMASLASSPVPSCQKPSALHGGTVGAVLRPEKPVMIDKLPYTVFTVGPFAF  126

Query  242  EPSKK  228
            EP  K
Sbjct  127  EPQCK  131



>ref|XP_008442660.1| PREDICTED: pistil-specific extensin-like protein [Cucumis melo]
Length=245

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 80/123 (65%), Gaps = 4/123 (3%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKT-DKNGFFLFYMPKI  414
            V+G+VYCKSCKY GVD L  AKP+ GA VKL+C NTKY  +V T T DKNG+F    PK 
Sbjct  120  VQGVVYCKSCKYPGVDTLLGAKPLSGATVKLSCKNTKYAPTVETATSDKNGYFRLAAPKN  179

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPL---KLPAPYNLYTVGPFAF  243
            V+S  + +CKVYLV+SP S C + +    G+DGA L P      +   P  LY VGP AF
Sbjct  180  VTSYAFHRCKVYLVESPDSNCKKASKLNGGEDGAELKPARAFTDEEKKPVVLYNVGPLAF  239

Query  242  EPS  234
            EP+
Sbjct  240  EPT  242



>ref|XP_002509463.1| structural constituent of cell wall, putative [Ricinus communis]
 gb|EEF50850.1| structural constituent of cell wall, putative [Ricinus communis]
Length=261

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 80/130 (62%), Gaps = 8/130 (6%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  A P+ GA VKL CNNTKY       TDKNG+F    PK 
Sbjct  137  AVQGVVYCKSCKYSGVDTLLGASPVLGATVKLQCNNTKYPQEAKATTDKNGYFYLQAPKS  196

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYTVGPFAF  243
            +++ G  KCKV LV +P + CS+ T+   G  G  L P   K  A   P+ LYTVGPFAF
Sbjct  197  ITNYGAHKCKVSLVSAPNTACSKITDLHGGLSGGILRPQ-KKFVANKLPFVLYTVGPFAF  255

Query  242  EPSKKVLCPR  213
            EP     CPR
Sbjct  256  EPK----CPR  261



>ref|XP_006377373.1| hypothetical protein POPTR_0011s05340g [Populus trichocarpa]
 gb|ERP55170.1| hypothetical protein POPTR_0011s05340g [Populus trichocarpa]
Length=249

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD    AKP+ GA VKL CNNTKY L V   TDKNG+FL   P  
Sbjct  123  AVQGVVYCKSCNYSGVDTFLGAKPVPGATVKLQCNNTKYPLEVKATTDKNGYFLAKAPGT  182

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP------APYNLYTVGP  252
            +++ G+ KCKV+LV +P + CS+ T+   G  GA L P   K P        Y L++VGP
Sbjct  183  ITNYGFHKCKVWLVSAPNTACSKITDIHGGLAGAILRPE--KKPFVDEKKRGYALFSVGP  240

Query  251  FAFEPSKKVLCPR  213
            FAFE SK   CPR
Sbjct  241  FAFE-SK---CPR  249



>gb|ABK93245.1| unknown [Populus trichocarpa]
Length=251

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD    AKP+ GA VKL CNNTKY L V   TDKNG+FL   P  
Sbjct  125  AVQGVVYCKSCNYSGVDTFLGAKPVPGATVKLQCNNTKYPLEVKATTDKNGYFLAKAPGT  184

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP------APYNLYTVGP  252
            +++ G+ KCKV+LV +P + CS+ T+   G  GA L P   K P        Y L++VGP
Sbjct  185  ITNYGFHKCKVWLVSAPNTACSKITDIHGGLAGAILRPE--KKPFVDEKKRGYALFSVGP  242

Query  251  FAFEPSKKVLCPR  213
            FAFE SK   CPR
Sbjct  243  FAFE-SK---CPR  251



>gb|ABK93518.1| unknown [Populus trichocarpa]
Length=250

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD    AKP+ GA VKL CNNTKY L V   TDKNG+FL   P  
Sbjct  124  AVQGVVYCKSCNYSGVDTFLGAKPVPGATVKLQCNNTKYPLEVKATTDKNGYFLAKAPGT  183

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP------APYNLYTVGP  252
            +++ G+ KCKV+LV +P + CS+ T+   G  GA L P   K P        Y L++VGP
Sbjct  184  ITNYGFHKCKVWLVSAPNTACSKITDIHGGLAGAILRPE--KKPFVDEKKRGYALFSVGP  241

Query  251  FAFEPSKKVLCPR  213
            FAFE SK   CPR
Sbjct  242  FAFE-SK---CPR  250



>ref|XP_004134701.1| PREDICTED: uncharacterized protein LOC101204026 [Cucumis sativus]
 gb|KGN49232.1| Structural constituent of cell wall [Cucumis sativus]
Length=262

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 77/123 (63%), Gaps = 3/123 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            +V+G+VYCKSCKY G D L  A P+ GA VKL C NTKY L  T  TDKNG+F    PK 
Sbjct  136  SVQGVVYCKSCKYPGADTLLGATPVAGASVKLICQNTKYPLVQTATTDKNGYFFITAPKA  195

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYTVGPFAF  243
            ++S  + KCKV L  SP   C++ +    G  GAPL P    + A   P+ LY+VGPFAF
Sbjct  196  ITSYAFHKCKVVLGSSPSPTCTKPSALHGGAAGAPLRPQKSYIDANKLPFVLYSVGPFAF  255

Query  242  EPS  234
            EP+
Sbjct  256  EPT  258



>ref|XP_011043395.1| PREDICTED: pistil-specific extensin-like protein [Populus euphratica]
Length=247

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD    AKP+ GA VKL CNNTK  L V  +TDKNG+FL   P  
Sbjct  121  AVQGVVYCKSCNYSGVDTFLGAKPVPGATVKLQCNNTKSPLEVKAQTDKNGYFLVKAPGT  180

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP------APYNLYTVGP  252
            +++ G+ +CKV+LV +P + CS+ TN   G  GA L P   K P        Y L++VGP
Sbjct  181  ITNYGFHRCKVWLVSAPNTACSKITNIHGGLAGAILRPE--KKPFVDEKKRGYALFSVGP  238

Query  251  FAFEPSKKVLCPR  213
            FAFE SK   CPR
Sbjct  239  FAFE-SK---CPR  247



>ref|XP_011027818.1| PREDICTED: pistil-specific extensin-like protein [Populus euphratica]
Length=234

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 83/133 (62%), Gaps = 12/133 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD L  AKP+ GA VKL CNNTK    V T TDKNG+FL   P  
Sbjct  108  AVQGVVYCKSCNYSGVDTLLGAKPVLGATVKLQCNNTKKPQDVKTTTDKNGYFLIKAPGT  167

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP------APYNLYTVGP  252
            +++ G  +CKV+LV SP + CS+ TN   G  GA L P   K P        + L++VGP
Sbjct  168  ITNYGVHRCKVWLVSSPSTACSKITNLHGGLTGAILRPE--KKPFVDEKKREFALFSVGP  225

Query  251  FAFEPSKKVLCPR  213
            FAFE SK   CPR
Sbjct  226  FAFE-SK---CPR  234



>ref|XP_004165575.1| PREDICTED: uncharacterized protein LOC101226613 [Cucumis sativus]
 gb|KGN64686.1| Structural constituent of cell wall [Cucumis sativus]
Length=241

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKT-DKNGFFLFYMPKI  414
            V+G+VYCKSCKY  VD L  AKP+ GA VKL+C NTKY  +V T T D+NG+F    PK 
Sbjct  116  VQGVVYCKSCKYPDVDTLLGAKPLSGATVKLSCKNTKYAPAVETATSDENGYFRLAAPKN  175

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPL---KLPAPYNLYTVGPFAF  243
            V+S  + +CKVYLVKSP S+C + +    G DGA L P      +   P  LY VGP AF
Sbjct  176  VTSYAFHRCKVYLVKSPDSKCEKASKMNGGVDGAELKPARAFTDEEKKPVVLYNVGPLAF  235

Query  242  EPS  234
            EP+
Sbjct  236  EPT  238



>ref|XP_004146606.1| PREDICTED: uncharacterized protein LOC101210454 [Cucumis sativus]
Length=241

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 4/123 (3%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKT-DKNGFFLFYMPKI  414
            V+G+VYCKSCKY  VD L  AKP+ GA VKL+C NTKY  +V T T D+NG+F    PK 
Sbjct  116  VQGVVYCKSCKYPDVDTLLGAKPLSGATVKLSCKNTKYAPAVETATSDENGYFRLAAPKN  175

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPL---KLPAPYNLYTVGPFAF  243
            V+S  + +CKVYLVKSP S+C + +    G DGA L P      +   P  LY VGP AF
Sbjct  176  VTSYAFHRCKVYLVKSPDSKCEKASKMNGGVDGAELKPARAFTDEEKKPVVLYNVGPLAF  235

Query  242  EPS  234
            EP+
Sbjct  236  EPT  238



>ref|XP_010057403.1| PREDICTED: pistil-specific extensin-like protein [Eucalyptus 
grandis]
Length=223

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 79/128 (62%), Gaps = 5/128 (4%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            A++G+VYCKSC+Y     L  AKPI GAVVKL C NTKY    T  TDKNG+F    PK 
Sbjct  100  AIQGVVYCKSCEY----TLNGAKPIIGAVVKLWCKNTKYPAWATATTDKNGYFFLEAPKT  155

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YNLYTVGPFAFEP  237
            VS+    KCKV+LV SP+  CSE +N   G  GAPL    L L  P + LY+VGP AFEP
Sbjct  156  VSNFATHKCKVFLVSSPIPSCSEPSNLNGGSSGAPLKFEKLVLGKPLFTLYSVGPLAFEP  215

Query  236  SKKVLCPR  213
              +   P+
Sbjct  216  KCRAPGPK  223



>gb|KHG03784.1| Pistil-specific extensin-like protein [Gossypium arboreum]
Length=290

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 77/124 (62%), Gaps = 6/124 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  AKPI  A V+L C + K  L+V  KTDKNG+F    P  
Sbjct  165  AVQGVVYCKSCKYAGVDTLLGAKPILSATVRLTCKDAKNELTVQFKTDKNGYFFLQAPIT  224

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP----TPLKLPAPYNLYTVGPFA  246
            + +     C V LV SPL  CS+ +N   G  GAPL P    T  KL  PY LY+VGPFA
Sbjct  225  IYNFDLHNCSVSLVSSPLKACSKPSNLNGGLKGAPLKPEKPSTSKKL--PYVLYSVGPFA  282

Query  245  FEPS  234
            FEP+
Sbjct  283  FEPT  286



>gb|ACV72637.1| proline-rich protein 3 [Gossypium hirsutum]
 gb|ADV57367.1| arabinogalactan protein [Gossypium hirsutum]
Length=290

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 77/124 (62%), Gaps = 6/124 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY GVD L  AKPI  A V+L C + K  L+V  KTDKNG+F    P  
Sbjct  165  AVQGVVYCKSCKYAGVDTLLGAKPILSATVRLTCKDAKNELTVQFKTDKNGYFFLQAPIT  224

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP----TPLKLPAPYNLYTVGPFA  246
            + +     C V LV SPL  CS+ +N   G  GAPL P    T  KL  PY LY+VGPFA
Sbjct  225  IYNFDLHNCSVSLVSSPLKACSKPSNLNGGLKGAPLKPEKPSTSKKL--PYVLYSVGPFA  282

Query  245  FEPS  234
            FEP+
Sbjct  283  FEPT  286



>ref|XP_002305791.2| hypothetical protein POPTR_0004s04450g [Populus trichocarpa]
 gb|ABK92898.1| unknown [Populus trichocarpa]
 gb|EEE86302.2| hypothetical protein POPTR_0004s04450g [Populus trichocarpa]
Length=234

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 80/133 (60%), Gaps = 12/133 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD L  AKP+ GA VKL CNNT     V T TDKNG+FL   P  
Sbjct  108  AVQGVVYCKSCNYSGVDTLLGAKPVLGATVKLQCNNTMKPQDVKTTTDKNGYFLIKAPGT  167

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP------APYNLYTVGP  252
            +++ G  KCKV+LV +P + CS+ TN   G  GA L P   K P        + L++VGP
Sbjct  168  ITNYGVHKCKVWLVSAPSTACSKITNLHGGLTGAMLRPE--KKPFVDEKKREFALFSVGP  225

Query  251  FAFEPSKKVLCPR  213
            FAFE      CPR
Sbjct  226  FAFESK----CPR  234



>ref|XP_010509832.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=257

 Score =   115 bits (288),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 85/134 (63%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CKY GV+ L  AKP+K AVV+L C N K  +S  TKTDKNG+F+F  PK 
Sbjct  129  AVRGLVYCKPCKYAGVNTLIGAKPVKDAVVRLVCKNKKSSIS-ETKTDKNGYFMFLAPKT  187

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            V+S G + C+ +LVKSP ++CS+ +    G  GA L P       T +     Y +Y VG
Sbjct  188  VTSYGIKGCRAFLVKSPDAKCSKVSTLHGGDKGAYLKPVLKPGNSTTIINKLTYGIYNVG  247

Query  254  PFAFEPSKKVLCPR  213
            PFAF+P+    CP+
Sbjct  248  PFAFDPA----CPK  257



>ref|XP_009141344.1| PREDICTED: pistil-specific extensin-like protein [Brassica rapa]
 emb|CDY37690.1| BnaA04g19780D [Brassica napus]
Length=220

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 86/134 (64%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG+V+CK+CKY GV+NL  AKP+KGAVV+L C N K   S  T TDKNG+FL Y PK 
Sbjct  92   AVRGVVFCKACKYAGVNNLQGAKPVKGAVVRLLCKNKKNATSEAT-TDKNGYFLLYAPKT  150

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            VS+   R C+ YLVKSP ++CS+ +    G  G+ L P       T +     Y+L+ VG
Sbjct  151  VSNYAIRNCRAYLVKSPDAKCSKVSKLHGGYLGSFLKPVVKPENATIIFNKLKYSLFNVG  210

Query  254  PFAFEPSKKVLCPR  213
            PFAFEP    +CP+
Sbjct  211  PFAFEP----VCPK  220



>ref|XP_010413808.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=257

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 85/134 (63%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CKY GV+ L  AKP+K AVV+L C N K  +S  TKTDKNG+F+F  PK 
Sbjct  129  AVRGLVYCKPCKYAGVNTLIGAKPVKDAVVRLVCKNKKSSIS-ETKTDKNGYFMFLAPKT  187

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            V+S G + C+ +LVKSP ++CS+ +    G  GA L P       T +     Y +Y VG
Sbjct  188  VTSYGIKGCRAFLVKSPDAKCSKVSTLHGGDKGAYLKPVVKPGNSTTIINKFTYGIYNVG  247

Query  254  PFAFEPSKKVLCPR  213
            PFAF+P+    CP+
Sbjct  248  PFAFDPA----CPK  257



>ref|XP_006296145.1| hypothetical protein CARUB_v10025298mg [Capsella rubella]
 gb|EOA29043.1| hypothetical protein CARUB_v10025298mg [Capsella rubella]
Length=256

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 85/136 (63%), Gaps = 16/136 (12%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CKY GV+ L  AKP+K AVV+L C N K  +S  TKTDKNG+F+F  PK 
Sbjct  128  AVRGLVYCKPCKYAGVNTLIGAKPVKDAVVRLVCKNKKSSIS-ETKTDKNGYFMFLAPKT  186

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP---------YNLYT  261
            VSS   + C+ +LVKSP ++CS+ +    G  GA L   P+  P P         Y ++ 
Sbjct  187  VSSYAIKGCRAFLVKSPDAKCSKVSKLHGGDKGAYL--KPVMKPGPSSVIINKLKYAMFN  244

Query  260  VGPFAFEPSKKVLCPR  213
            VGPFAF+P+    CP+
Sbjct  245  VGPFAFDPA----CPK  256



>ref|XP_010469426.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=257

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 84/134 (63%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRGLVYCK CKY GV+ L  AKP+K AVV+L C N K  +S  TKTDKNG+F+F  PK 
Sbjct  129  AVRGLVYCKPCKYAGVNTLIGAKPVKDAVVRLVCKNKKSSIS-ETKTDKNGYFMFLAPKT  187

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            V+  G + C+ +LVKSP ++CS+ +    G  GA L P       T +     Y +Y VG
Sbjct  188  VTRYGIKGCRAFLVKSPDAKCSKVSTLHGGDKGAYLKPVVKPGNSTTIINKFTYGIYNVG  247

Query  254  PFAFEPSKKVLCPR  213
            PFAF+P+    CP+
Sbjct  248  PFAFDPA----CPK  257



>emb|CDO99529.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 83/132 (63%), Gaps = 7/132 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTT-KTDKNGFFLFYMPK  417
            AV+G+VYCK+C Y G  N   A P++GAVV++ C+NT++   V   +TDKNG+FL  +P+
Sbjct  134  AVQGVVYCKTCSYAGF-NPKAAVPLQGAVVRVRCHNTRFKPVVAEGRTDKNGYFLI-VPE  191

Query  416  IVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP----YNLYTVGPF  249
            +V+S     CK YLVKSP  +CS  TN   G  GA L+P P   P P    Y LY VGPF
Sbjct  192  MVTSVAASTCKAYLVKSPSMKCSAPTNLNYGSTGAGLMPNPAHKPNPLAPKYALYNVGPF  251

Query  248  AFEPSKKVLCPR  213
            AF P+K   C R
Sbjct  252  AFGPAKLTPCHR  263



>emb|CDY53780.1| BnaC04g44160D [Brassica napus]
Length=219

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 81/126 (64%), Gaps = 8/126 (6%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG+V+CK+CKY G++NL  AKP+KGAVV+L C N K   S  T TDKNG+FL Y PK 
Sbjct  91   AVRGVVFCKACKYAGINNLQGAKPVKGAVVRLLCKNKKNATSEAT-TDKNGYFLLYAPKT  149

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            VS+   + C+ YLVKSP ++CS+ +    G  G+ L P       T +     Y L+ VG
Sbjct  150  VSNYAIKNCRAYLVKSPDAKCSKVSKLHGGYMGSVLKPVVKPENATIIFNKLKYGLFNVG  209

Query  254  PFAFEP  237
            PFAFEP
Sbjct  210  PFAFEP  215



>ref|XP_009143748.1| PREDICTED: pistil-specific extensin-like protein [Brassica rapa]
Length=191

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY G+D L +A P++GA VKLACNNTK  +++ TKTDKNG+F    P  
Sbjct  65   AVQGMVYCKSCKYSGIDTLLEASPLQGATVKLACNNTKRGVTMETKTDKNGYFFMLAPNK  124

Query  413  VSSAGYRKCKVYLVK--SPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP--YNLYTVGPFA  246
            ++S  +  C+ +     S  + C+  +    G  GA L P+     A   Y L++VGPFA
Sbjct  125  LTSYAFHTCRAWPTNPGSAAATCTVPSQLNSGTTGARLKPSKSINIAERDYVLFSVGPFA  184

Query  245  FEPS  234
            FEP+
Sbjct  185  FEPA  188



>gb|KHN07246.1| Pistil-specific extensin-like protein [Glycine soja]
Length=257

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 77/122 (63%), Gaps = 4/122 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GVD L  A P+ GAVVKL CNNTKY L  T+KTDKNG+F    PK 
Sbjct  136  AVQGVVYVKSCKYAGVDTLLGATPLLGAVVKLECNNTKYKLVQTSKTDKNGYFYIGAPKS  195

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KC V LV +P     + +N   G  GA L P    L    P+ LYTVGP AFE
Sbjct  196  ITTYGAHKCNVVLVSAPYGL--KASNLHGGVTGALLRPEKPFLSKKLPFVLYTVGPLAFE  253

Query  239  PS  234
            P+
Sbjct  254  PN  255



>ref|NP_180935.1| arabinogalactan protein 30 [Arabidopsis thaliana]
 gb|AAC69131.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAO22683.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAV85705.1| At2g33790 [Arabidopsis thaliana]
 gb|AEC08885.1| arabinogalactan protein 30 [Arabidopsis thaliana]
Length=239

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 87/134 (65%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG+VYCK+CKY GV+N+  AKP+K AVV+L C N K  +S  TKTDKNG+F+   PK 
Sbjct  111  AVRGVVYCKACKYAGVNNVQGAKPVKDAVVRLVCKNKKNSIS-ETKTDKNGYFMLLAPKT  169

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            V++   + C+ +LVKSP ++CS+ ++   G  G+ L P       + +     Y++Y VG
Sbjct  170  VTNYDIKGCRAFLVKSPDTKCSKVSSLHDGGKGSVLKPVLKPGFSSTIMRWFKYSVYNVG  229

Query  254  PFAFEPSKKVLCPR  213
            PFAFEP+    CP+
Sbjct  230  PFAFEPT----CPK  239



>ref|XP_007159332.1| hypothetical protein PHAVU_002G229200g [Phaseolus vulgaris]
 gb|ESW31326.1| hypothetical protein PHAVU_002G229200g [Phaseolus vulgaris]
Length=286

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 77/121 (64%), Gaps = 4/121 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GVD L  A P+ GAVVKL CNNTKY L  T+K+DKNG+F F  PK 
Sbjct  162  AVQGVVYVKSCKYAGVDTLLGATPLLGAVVKLQCNNTKYKLVETSKSDKNGYFYFEAPKS  221

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KC V LV +P     + +N   G  GA L P    L    P+ LYTVGP AFE
Sbjct  222  ITTYGAHKCNVVLVGAPYGL--KPSNLHSGVTGAVLRPEKPFLSKKLPFVLYTVGPLAFE  279

Query  239  P  237
            P
Sbjct  280  P  280



>ref|XP_010509721.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=175

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 81/126 (64%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VYCKSCKY GVD L +A P++GA VKLACNNT+  +++ TKTDKNG+F    PK 
Sbjct  47   AVEGMVYCKSCKYSGVDTLLEASPVQGATVKLACNNTRRGVTMETKTDKNGYFFMLAPKK  106

Query  413  VSSAGYRKCKVY-LVKSPLSQ---CSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGP  252
            +++  +  C+ +   + P+++   C+  +    G  GA L P+       ++  L++VGP
Sbjct  107  LTTYAFHTCRAWPTNRGPMTETMTCTVPSQLNNGITGAMLKPSKTINIGEHDYVLFSVGP  166

Query  251  FAFEPS  234
            FAFEP+
Sbjct  167  FAFEPA  172



>ref|XP_006377372.1| hypothetical protein POPTR_0011s05340g [Populus trichocarpa]
 gb|ERP55169.1| hypothetical protein POPTR_0011s05340g [Populus trichocarpa]
Length=246

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 82/133 (62%), Gaps = 15/133 (11%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSC Y GVD    AKP+    VKL CNNTKY L V   TDKNG+FL   P  
Sbjct  123  AVQGVVYCKSCNYSGVDTFLGAKPVP---VKLQCNNTKYPLEVKATTDKNGYFLAKAPGT  179

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP------APYNLYTVGP  252
            +++ G+ KCKV+LV +P + CS+ T+   G  GA L P   K P        Y L++VGP
Sbjct  180  ITNYGFHKCKVWLVSAPNTACSKITDIHGGLAGAILRPE--KKPFVDEKKRGYALFSVGP  237

Query  251  FAFEPSKKVLCPR  213
            FAFE SK   CPR
Sbjct  238  FAFE-SK---CPR  246



>ref|XP_010059257.1| PREDICTED: pistil-specific extensin-like protein [Eucalyptus 
grandis]
Length=210

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 85/130 (65%), Gaps = 9/130 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCK    D LY +KPI GA VKL C NTKY  S T  TDKNG+F    PK 
Sbjct  87   AVQGVVYCKSCK----DTLYGSKPIFGAQVKLLCKNTKYSASATATTDKNGYFFIQAPKT  142

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLI---PTPLKLPAPYNLYTVGPFAF  243
            V+S  + KCKVYLV S +S CS+ +N   G  GA L    P+ +KL  P++LY+VGPFAF
Sbjct  143  VTSFPFHKCKVYLVSSSISSCSQPSNLNSGFTGAFLRWEKPSSIKL--PFSLYSVGPFAF  200

Query  242  EPSKKVLCPR  213
            EP  +   P+
Sbjct  201  EPKCRAPGPK  210



>gb|KHN09997.1| Pistil-specific extensin-like protein [Glycine soja]
Length=282

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 4/122 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GVD L  A P+ GAVVKL CNNTKY L  T+K+DKNG+F    PK 
Sbjct  161  AVQGVVYVKSCKYAGVDTLLGATPLLGAVVKLQCNNTKYKLVQTSKSDKNGYFYIEAPKS  220

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KC V LV +P     + +N   G  GA L P    L    P+ LYTVGP AFE
Sbjct  221  ITTYGAHKCNVVLVSAPYGL--KASNLHGGVTGALLRPEKPFLSKRLPFVLYTVGPLAFE  278

Query  239  PS  234
            P+
Sbjct  279  PN  280



>ref|XP_006584402.1| PREDICTED: pistil-specific extensin-like protein-like [Glycine 
max]
Length=173

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 76/122 (62%), Gaps = 4/122 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GV  +  A P+ GAVVKL CNNTKY L  T+KTDKNG+F    PK 
Sbjct  52   AVQGVVYVKSCKYAGVGAVLGATPLLGAVVKLECNNTKYKLVQTSKTDKNGYFYIGAPKS  111

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KC V LV +P     + +N   G  GA L P    L    P+ LYTVGP AFE
Sbjct  112  ITTYGAHKCNVVLVSAPYGL--KASNLHGGVTGALLRPEKPFLSKKLPFVLYTVGPLAFE  169

Query  239  PS  234
            P+
Sbjct  170  PN  171



>ref|XP_006594317.1| PREDICTED: pistil-specific extensin-like protein-like isoform 
X2 [Glycine max]
Length=284

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 4/122 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GVD L  A P+ GAVVKL CNNTKY L  T+K+DKNG+F    PK 
Sbjct  163  AVQGVVYVKSCKYAGVDTLLGATPLLGAVVKLQCNNTKYKLVQTSKSDKNGYFYIEAPKS  222

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KC V LV +P     + +N   G  GA L P    L    P+ LYTVGP AFE
Sbjct  223  ITTYGAHKCNVVLVSAPYGL--KASNLHGGVTGALLRPEKPFLSKRLPFVLYTVGPLAFE  280

Query  239  PS  234
            P+
Sbjct  281  PN  282



>emb|CAA42942.1| proline-rich protein [Phaseolus vulgaris]
Length=297

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 77/121 (64%), Gaps = 4/121 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GVD L  A P+ GAVVK+ CNNTKY L  T+K+DKNG+F F  PK 
Sbjct  173  AVQGVVYVKSCKYAGVDTLLGATPLLGAVVKVQCNNTKYKLVETSKSDKNGYFYFEAPKS  232

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KC V LV +P     + +N   G  GA L P    L    P+ LYTVGP AFE
Sbjct  233  ITTYGAHKCNVVLVGAPYGL--KPSNLHSGVTGAVLRPEKPFLSKKLPFVLYTVGPLAFE  290

Query  239  P  237
            P
Sbjct  291  P  291



>ref|XP_003542742.1| PREDICTED: pistil-specific extensin-like protein-like isoform 
X1 [Glycine max]
Length=294

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 4/122 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GVD L  A P+ GAVVKL CNNTKY L  T+K+DKNG+F    PK 
Sbjct  173  AVQGVVYVKSCKYAGVDTLLGATPLLGAVVKLQCNNTKYKLVQTSKSDKNGYFYIEAPKS  232

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KC V LV +P     + +N   G  GA L P    L    P+ LYTVGP AFE
Sbjct  233  ITTYGAHKCNVVLVSAPYGL--KASNLHGGVTGALLRPEKPFLSKRLPFVLYTVGPLAFE  290

Query  239  PS  234
            P+
Sbjct  291  PN  292



>ref|XP_010549547.1| PREDICTED: pistil-specific extensin-like protein [Tarenaya hassleriana]
Length=235

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 78/134 (58%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCK CKY GVD L  AKP+KGAVV+L C   K  +   T TD+ G+F    PK 
Sbjct  107  AVQGMVYCKDCKYAGVDTLLGAKPVKGAVVRLLCKGWKKTVKEAT-TDEKGYFFLLAPKT  165

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP-------LKLPAPYNLYTVG  255
            V++ G+R C V LVKSP  +CS+ +    G +G  L P         L     Y L+ VG
Sbjct  166  VTNYGFRGCVVKLVKSPNPKCSKPSKLNGGDNGGALTPVKDRAKRIILVNDVKYGLFDVG  225

Query  254  PFAFEPSKKVLCPR  213
            PF+FEP    +CPR
Sbjct  226  PFSFEP----VCPR  235



>ref|XP_002862304.1| hypothetical protein ARALYDRAFT_497526 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38562.1| hypothetical protein ARALYDRAFT_497526 [Arabidopsis lyrata subsp. 
lyrata]
Length=176

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VYCKSCKY GVDNL +A P++GA VKLACNNTK  +++ TKTDKNG+F    PK 
Sbjct  48   AVEGMVYCKSCKYSGVDNLLEASPLQGATVKLACNNTKRGVTMETKTDKNGYFFMLAPKK  107

Query  413  VSSAGYRKCKVYLVK----SPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGP  252
            +++  +  C+ +       +    C+  +    G  GA L P+       ++  L++VGP
Sbjct  108  LTTYAFHTCRAWPTNPGPTTATMTCTVPSKLNNGITGAMLKPSKTINIGEHDYVLFSVGP  167

Query  251  FAFEPS  234
            FAFEP+
Sbjct  168  FAFEPA  173



>ref|XP_010504941.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=180

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VYCKSCKY GVD L  A P++GA VKLACNNTK  +++ TKTDKNG+F    PK 
Sbjct  47   AVEGMVYCKSCKYSGVDTLLDASPVQGATVKLACNNTKRGVTMETKTDKNGYFFMLAPKK  106

Query  413  VSSAGYRKCKVYLVK-SPLSQ---CSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGP  252
            +++  +  C+ +     P ++   C+  +    G  GA L P+       ++  L++VGP
Sbjct  107  LTTYAFHTCRAWPTNPGPTTETMTCTVPSQLNNGTTGATLKPSKTINIGEHDYVLFSVGP  166

Query  251  FAFEPS  234
            FAFEP+
Sbjct  167  FAFEPA  172



>gb|KFK44695.1| hypothetical protein AALP_AA1G291300 [Arabis alpina]
Length=335

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 85/136 (63%), Gaps = 16/136 (12%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG VYCKSCKY   + L  A P++GAVV+L C + K ++   TKTDKNG+FL   PK 
Sbjct  207  AVRGTVYCKSCKYASYNTLLGATPVEGAVVRLVCKSKK-NIVAETKTDKNGYFLLLGPKT  265

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---------PYNLYT  261
            V++ G+R C+VYLVKS  ++CS+ +    G  GA L   P+++P           Y L+ 
Sbjct  266  VTNYGFRGCRVYLVKSKDTKCSKVSKLFGGDVGAIL--KPVRIPGKSVVVINKLTYGLFN  323

Query  260  VGPFAFEPSKKVLCPR  213
            VGPFAF+P+    CP+
Sbjct  324  VGPFAFDPT----CPK  335



>ref|XP_006410620.1| hypothetical protein EUTSA_v10017961mg [Eutrema salsugineum]
 gb|ESQ52073.1| hypothetical protein EUTSA_v10017961mg [Eutrema salsugineum]
Length=174

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 79/126 (63%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY G+D L  A P++GA VK+ACNNTK  +++ TKTDKNG+F    PK 
Sbjct  46   AVQGMVYCKSCKYSGIDTLLGASPLQGATVKMACNNTKKGVTMETKTDKNGYFFMLAPKK  105

Query  413  VSSAGYRKCKVYLVK----SPLSQCSEKTNYKLGKDGAPLIPT-PLKL-PAPYNLYTVGP  252
            +++  +  C+ +  K         C+  +    G  GA L P+  +K+    Y L++VGP
Sbjct  106  LTTYAFHTCRAWPTKPGPAGAKGTCTVLSQLNNGTTGAMLKPSKSVKINEHDYVLFSVGP  165

Query  251  FAFEPS  234
            FAFEP+
Sbjct  166  FAFEPT  171



>ref|NP_001077616.1| arabinogalactan protein 31 [Arabidopsis thaliana]
 gb|AEE30944.1| arabinogalactan protein 31 [Arabidopsis thaliana]
Length=315

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 81/134 (60%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG VYCKSCKY   + L  AKPI+GA VKL C + K +++  T TDKNG+FL   PK 
Sbjct  187  AVRGTVYCKSCKYAAFNTLLGAKPIEGATVKLVCKSKK-NITAETTTDKNGYFLLLAPKT  245

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            V++ G+R C+VYLVKS   +CS+ +    G  GA L P       T +     Y L+ VG
Sbjct  246  VTNFGFRGCRVYLVKSKDYKCSKVSKLFGGDVGAELKPEKKLGKSTVVVNKLVYGLFNVG  305

Query  254  PFAFEPSKKVLCPR  213
            PFAF PS    CP+
Sbjct  306  PFAFNPS----CPK  315



>ref|NP_174150.1| arabinogalactan protein 31 [Arabidopsis thaliana]
 gb|AAF98426.1|AC021044_5 Unknown protein [Arabidopsis thaliana]
 gb|ABL66745.1| At1g28290 [Arabidopsis thaliana]
 gb|AEE30943.1| arabinogalactan protein 31 [Arabidopsis thaliana]
Length=359

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 81/134 (60%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG VYCKSCKY   + L  AKPI+GA VKL C + K +++  T TDKNG+FL   PK 
Sbjct  231  AVRGTVYCKSCKYAAFNTLLGAKPIEGATVKLVCKSKK-NITAETTTDKNGYFLLLAPKT  289

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            V++ G+R C+VYLVKS   +CS+ +    G  GA L P       T +     Y L+ VG
Sbjct  290  VTNFGFRGCRVYLVKSKDYKCSKVSKLFGGDVGAELKPEKKLGKSTVVVNKLVYGLFNVG  349

Query  254  PFAFEPSKKVLCPR  213
            PFAF PS    CP+
Sbjct  350  PFAFNPS----CPK  359



>ref|XP_006296427.1| hypothetical protein CARUB_v10025607mg [Capsella rubella]
 gb|EOA29325.1| hypothetical protein CARUB_v10025607mg [Capsella rubella]
Length=177

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 76/126 (60%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VYCKSCKY GVD L +A PI+GA VKLACNNTK  +++ TKTD+NG+F    PK 
Sbjct  49   AVEGMVYCKSCKYSGVDTLLEASPIQGATVKLACNNTKRGVTMETKTDRNGYFFMLAPKK  108

Query  413  VSSAGYRKCKVYLVK----SPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGP  252
            +++  +  C+ +       +    C+  +    G  G  L P+       ++  L++VGP
Sbjct  109  LTTYAFHTCRAWPTNPGPATATMTCTVPSQLNNGTTGGMLKPSKTINIGEHDYVLFSVGP  168

Query  251  FAFEPS  234
            FAFEP+
Sbjct  169  FAFEPT  174



>dbj|BAF01102.1| putative proline-rich protein [Arabidopsis thaliana]
Length=315

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 81/134 (60%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG VYCKSCKY   + L  AKPI+GA VKL C + K +++  T TDKNG+FL   PK 
Sbjct  187  AVRGTVYCKSCKYAAFNTLLGAKPIEGATVKLVCKSKK-NITAETTTDKNGYFLLLAPKT  245

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            V++ G+R C+VYLVKS   +CS+ +    G  GA L P       T +     Y L+ VG
Sbjct  246  VTNFGFRGCRVYLVKSKDYKCSKVSKLFGGDVGAELKPEKKLGKSTVVVNKLVYGLFNVG  305

Query  254  PFAFEPSKKVLCPR  213
            PFAF PS    CP+
Sbjct  306  PFAFNPS----CPK  315



>ref|XP_010667752.1| PREDICTED: pistil-specific extensin-like protein [Beta vulgaris 
subsp. vulgaris]
Length=301

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 79/127 (62%), Gaps = 6/127 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCK+C Y GVD L  A P+ GA V+L C NTKY +  T+ TDKNG+F    PK 
Sbjct  171  AVQGVVYCKNCSYAGVDTLLGASPLSGATVELRCRNTKYTIKKTSTTDKNGYFFLQAPKY  230

Query  413  VSSAGYRKCKVYLVKSPL--SQCSEKTNYKLGKDGAPLI----PTPLKLPAPYNLYTVGP  252
            +++ G  KC+V+L++ P     CS  TN   G  GA L      TP   P P++L+TVGP
Sbjct  231  ITTYGVHKCRVFLIEMPKKGGPCSHATNLNGGVSGAFLFFNKKLTPPPKPLPFSLFTVGP  290

Query  251  FAFEPSK  231
             AFEP K
Sbjct  291  LAFEPPK  297



>ref|NP_181017.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAC16264.1| putative proline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAO42303.1| putative proline-rich glycoprotein [Arabidopsis thaliana]
 gb|AAO63960.1| putative proline-rich glycoprotein [Arabidopsis thaliana]
 gb|AEC09011.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=175

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 77/126 (61%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VYCKSCKY GVD L +A P++GA VKLACNNTK  +++ TKTDKNG+F    PK 
Sbjct  47   AVEGMVYCKSCKYSGVDTLLEASPLQGATVKLACNNTKRGVTMETKTDKNGYFFMLAPKK  106

Query  413  VSSAGYRKCKVYLVK----SPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGP  252
            +++  +  C+ +       +    C+  +    G  GA L P+       ++  L++VGP
Sbjct  107  LTTYAFHTCRAWPTNPGPTTATMTCTVPSKLNNGITGAMLKPSKTINIGEHDYVLFSVGP  166

Query  251  FAFEPS  234
            FAFEP+
Sbjct  167  FAFEPA  172



>ref|XP_010516625.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=175

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 77/126 (61%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VYCKSCKY GVD L  A P++GA VKLACNNTK  +++ TKTDKNG+F    PK 
Sbjct  47   AVEGMVYCKSCKYSGVDTLLDASPVQGATVKLACNNTKRGVTMETKTDKNGYFFMLAPKK  106

Query  413  VSSAGYRKCKVYLVK-SPLSQ---CSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGP  252
            +++  +  C+ +     P ++   C+  +    G  GA L P+       ++  L++VGP
Sbjct  107  LTTYAFHTCRAWPTNPGPTTETMTCTVPSQLNNGTTGAMLKPSKTINIGEHDYVLFSVGP  166

Query  251  FAFEPS  234
             AFEP+
Sbjct  167  LAFEPA  172



>ref|XP_002893518.1| hypothetical protein ARALYDRAFT_473038 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69777.1| hypothetical protein ARALYDRAFT_473038 [Arabidopsis lyrata subsp. 
lyrata]
Length=315

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 81/134 (60%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG VYCKSCKY   + L  AKPI+GA VKL C + K +++  T TDKNG+FL   PK 
Sbjct  187  AVRGTVYCKSCKYAAFNTLLGAKPIEGATVKLVCKSKK-NITAETLTDKNGYFLLLAPKT  245

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-------TPLKLPAPYNLYTVG  255
            V++ G+R C+VYLVKS   +CS+ +    G  GA L P       T +     Y L+ VG
Sbjct  246  VTNFGFRGCRVYLVKSKDYKCSKVSKLFGGDVGAELKPERRPGKGTVVVNKLTYGLFNVG  305

Query  254  PFAFEPSKKVLCPR  213
            PFAF P+    CP+
Sbjct  306  PFAFNPT----CPK  315



>gb|KFK36369.1| hypothetical protein AALP_AA4G114500 [Arabis alpina]
Length=174

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 76/126 (60%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VYCKSCKY G+D L +A P++GA V+LACNNTK  L++ T TDKNG+F    P  
Sbjct  46   AVEGMVYCKSCKYSGIDTLLEASPLQGATVRLACNNTKRGLTMETTTDKNGYFFMLAPNK  105

Query  413  VSSAGYRKCKVYLVK----SPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGP  252
            ++S  +  C+V        +    C+  +    G  GA L P+     A ++  L++VGP
Sbjct  106  LTSYAFHTCRVSPTNPGPAAATVTCTVPSKLNNGTTGAMLKPSRSINIAEHDYVLFSVGP  165

Query  251  FAFEPS  234
            FAFEP+
Sbjct  166  FAFEPA  171



>gb|ACU23724.1| unknown [Glycine max]
Length=293

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 75/122 (61%), Gaps = 4/122 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GVD L  A P+ GAVVKL CNNTKY L  T+K DKNG+F    PK 
Sbjct  172  AVQGVVYVKSCKYAGVDTLLGATPLLGAVVKLQCNNTKYKLVQTSKFDKNGYFYIEAPKS  231

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFE  240
            +++ G  KC V LV +P     + +N   G  GA   P    L    P+ LYTVGP AFE
Sbjct  232  ITTYGAHKCNVVLVSAPYGL--KASNLHGGVTGALFRPEKPFLFKRLPFVLYTVGPLAFE  289

Query  239  PS  234
            P+
Sbjct  290  PN  291



>gb|AAX82549.1| 120 kDa pistil extensin-like protein [Nicotiana plumbaginifolia]
Length=362

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 80/126 (63%), Gaps = 3/126 (2%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            + G V+CKSC  +G+  LYKA P++GAVVKL C+N     +V T  TDKNG F+  +P  
Sbjct  236  IVGRVHCKSCNSRGLPTLYKASPLQGAVVKLVCHNNARKANVQTAMTDKNGEFVI-IPMS  294

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YNLYTVGPFAFEP  237
            ++ A   KCKVYLVKSP   C+  TN+  GK GA L P+P  +  P ++ + VGPF FE 
Sbjct  295  LTRADVHKCKVYLVKSPKPICNVPTNFNGGKSGALLKPSPGPVQPPMFDYHGVGPFIFEA  354

Query  236  SKKVLC  219
            S K+ C
Sbjct  355  SSKLPC  360



>emb|CDX84287.1| BnaC04g10490D [Brassica napus]
Length=192

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 77/126 (61%), Gaps = 6/126 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY G++ L +A P++G+ VK ACNNTK  +++ TKTDKNG+F    P  
Sbjct  64   AVQGMVYCKSCKYSGINTLLEASPLQGSTVKFACNNTKRGVTMETKTDKNGYFFMLAPNK  123

Query  413  VSSAGYRKCKVYLVK----SPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP--YNLYTVGP  252
            +++ G+  C+ +       +    C+  +    G  GA L P+     A   Y L++VGP
Sbjct  124  LTTYGFHTCRAWPTNPGPAAATVTCTVPSQLNNGTTGAMLKPSKSINIAERGYVLFSVGP  183

Query  251  FAFEPS  234
            FAFEP+
Sbjct  184  FAFEPA  189



>ref|XP_009113681.1| PREDICTED: gibberellin-regulated protein 14-like [Brassica rapa]
Length=339

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G V+CKSC+Y   D+L  AKP++GAVV+L C + K ++   TKTDKNG+FL   PK 
Sbjct  211  AVQGTVFCKSCQYASFDSLIGAKPVEGAVVRLLCKSKK-NIVAETKTDKNGYFLLLGPKT  269

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-------YNLYTVG  255
            V++ G+R C+VYLVKS   +C++ +    G  GA L P   K  +        Y ++ VG
Sbjct  270  VTNYGFRGCRVYLVKSKDYKCNKVSKLFGGDVGAVLKPEKRKGKSAVVINQLIYGIFNVG  329

Query  254  PFAFEPSKKVLCPR  213
            PFAF+P    +CP+
Sbjct  330  PFAFDP----VCPK  339



>ref|XP_006859021.1| hypothetical protein AMTR_s00068p00169090 [Amborella trichopoda]
 gb|ERN20488.1| hypothetical protein AMTR_s00068p00169090 [Amborella trichopoda]
Length=174

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 4/133 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G++YCKSC Y   D L  A P++GA  +L CN++K  ++   KTDKNG+F    P+ 
Sbjct  40   AVEGVIYCKSCNYSANDTLLGATPLQGATARLECNSSKQVVTAEGKTDKNGYFFIEAPRN  99

Query  413  -VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYNLYTVGPFAFE  240
             V++  + KCKV+L  SPL+ C + T+   G  G+PL     L    P  +++ GP A+ 
Sbjct  100  KVTNYAFHKCKVFLASSPLATCQKATDLHGGITGSPLRFHQVLDSGYPLAVFSTGPLAYA  159

Query  239  PSKKVLCPR**HP  201
            P+   +C    HP
Sbjct  160  PTNATVCAH--HP  170



>emb|CDY46612.1| BnaA09g27390D [Brassica napus]
Length=321

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 84/134 (63%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G V+CKSC+Y   D+L  AKP++GA+V+L C + K ++   TKTDKNG+FL   PK 
Sbjct  193  AVQGTVFCKSCQYASFDSLIGAKPVEGALVRLLCKSKK-NIVAETKTDKNGYFLLLGPKT  251

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-------YNLYTVG  255
            V++ G+R C+VYLVKS   +C++ +    G  GA L P   K  +        Y ++ VG
Sbjct  252  VTNYGFRGCRVYLVKSKDYKCNKVSKLFGGDVGAVLKPEKRKGKSAVVINQLIYGIFNVG  311

Query  254  PFAFEPSKKVLCPR  213
            PFAF+P    +CP+
Sbjct  312  PFAFDP----VCPK  321



>ref|XP_006415676.1| hypothetical protein EUTSA_v10008255mg [Eutrema salsugineum]
 gb|ESQ34029.1| hypothetical protein EUTSA_v10008255mg [Eutrema salsugineum]
Length=313

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 81/136 (60%), Gaps = 16/136 (12%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG VYCKSCKY   D L  AKP+KGAVV+L C + K  ++ TT TD NG+F    PK 
Sbjct  185  AVRGTVYCKSCKYAYADTLNDAKPVKGAVVRLVCKSKKKIVAETT-TDMNGYFWLLAPKT  243

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---------PYNLYT  261
            V++ G+R C+VYLVKS   +C++ +    G  GA L   P K P           Y ++ 
Sbjct  244  VTNYGFRGCRVYLVKSNDKKCNKVSKLFGGDVGAEL--KPEKRPGKSSVVINKFTYGIFN  301

Query  260  VGPFAFEPSKKVLCPR  213
            VGPFAF+P    +CP+
Sbjct  302  VGPFAFDP----VCPK  313



>ref|XP_010460614.1| PREDICTED: gibberellin-regulated protein 14-like [Camelina sativa]
Length=325

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG V+CKSCKY   D+L  AKP++GA V+L C + K  +S  T TDKNG+F    PK 
Sbjct  197  AVRGTVFCKSCKYAAFDSLTGAKPVEGATVRLVCKSKKNIISEAT-TDKNGYFFLLAPKT  255

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP--TPLKLPA-----PYNLYTVG  255
            V++ G+R C+VYLVKS   +C++ +    G  GA L P  +P K        PY ++ VG
Sbjct  256  VTNYGFRGCRVYLVKSKDYKCNKVSKLFGGDVGAVLKPERSPGKSTVVINKLPYGIFNVG  315

Query  254  PFAFEPSKKVLCPR  213
            PFAF P+    CP+
Sbjct  316  PFAFNPA----CPK  325



>gb|KCW76233.1| hypothetical protein EUGRSUZ_D00613 [Eucalyptus grandis]
Length=167

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 80/160 (50%), Gaps = 38/160 (24%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPI-----------------------------------  519
            AV+G+VYCKSCKY GV+ L  A P+                                   
Sbjct  7    AVQGVVYCKSCKYSGVETLLGATPVLVLYFFLYGVVVISCFSPMSHISRSCRFDDEVSFF  66

Query  518  KGAVVKLACNNTKYHLSV-TTKTDKNGFFLFYMPKIVSSAGYRKCKVYLVKSPLSQCSEK  342
             GAVVKL CNNTKY  +V T KTDKNG+F    PK +++  + KC   L  SP+  C + 
Sbjct  67   AGAVVKLECNNTKYRPTVQTAKTDKNGYFFLKAPKTITTYAFHKCMASLASSPVPSCQKP  126

Query  341  TNYKLGKDGAPLIPT-PLKLP-APYNLYTVGPFAFEPSKK  228
            +    G  GA L P  P+ +   PY ++TVGPFAFEP  K
Sbjct  127  SALHGGTVGAVLRPEKPVMIDKLPYTVFTVGPFAFEPQCK  166



>ref|XP_010478196.1| PREDICTED: gibberellin-regulated protein 14-like [Camelina sativa]
Length=325

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG V+CKSCKY   D+L  AKP++GA V+L C + K  +S  T TDKNG+F    PK 
Sbjct  197  AVRGTVFCKSCKYAAFDSLTGAKPVEGATVRLVCKSKKNIISEAT-TDKNGYFFLLAPKT  255

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP--TPLKLPA-----PYNLYTVG  255
            V++ G+R C+VYLVKS   +C++ +    G  GA L P  +P K        PY ++ VG
Sbjct  256  VTNYGFRGCRVYLVKSKDYKCNKVSKLFGGDVGAVLKPERSPGKSTVVINKLPYGIFNVG  315

Query  254  PFAFEPSKKVLCPR  213
            PFAF P+    CP+
Sbjct  316  PFAFNPA----CPK  325



>ref|XP_009102921.1| PREDICTED: gibberellin-regulated protein 14-like [Brassica rapa]
Length=319

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 83/134 (62%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G V+CKSCKY   D+L  AKP++GA V+L C + K ++   T+TDKNG+FL   PK 
Sbjct  191  AVQGTVFCKSCKYASYDSLTGAKPVEGAKVRLVCKSKK-NIVAETETDKNGYFLLLAPKT  249

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP--TPLKLPA-----PYNLYTVG  255
            V++ G+R C+ YLVKS   +C++ +    G  GA L P  TP K         Y ++ VG
Sbjct  250  VTNFGFRGCRAYLVKSKDYKCNKVSKLFGGDVGAVLKPVKTPGKSSVVINKLTYGVFNVG  309

Query  254  PFAFEPSKKVLCPR  213
            PFAF+P    +CP+
Sbjct  310  PFAFDP----VCPK  319



>ref|XP_004505067.1| PREDICTED: pistil-specific extensin-like protein-like [Cicer 
arietinum]
Length=272

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 75/134 (56%), Gaps = 18/134 (13%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCKY GVD L  A  + GAVVKL CNNTKY L +  ++DKNG+F    PK 
Sbjct  150  AVQGVVYVKSCKYSGVDTLLGATSLIGAVVKLQCNNTKYKLVIKDESDKNGYFFIEAPKT  209

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN-------LYTVG  255
            ++S    KC V LV +P     + +N   G  GA L P       PY        LYTVG
Sbjct  210  ITSYAAHKCNVVLVSAP--NGLKASNLHGGVTGAVLRPE-----KPYVSKGLHFLLYTVG  262

Query  254  PFAFEPSKKVLCPR  213
            P AFEP     CPR
Sbjct  263  PLAFEPK----CPR  272



>emb|CDY15682.1| BnaA07g08530D [Brassica napus]
Length=301

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 82/134 (61%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G V+CKSCKY   D+L  AKP++GA V+L C + K ++   T+TDKNG+FL   PK 
Sbjct  173  AVQGTVFCKSCKYASYDSLTGAKPVEGAKVRLVCKSKK-NIVAETETDKNGYFLLLAPKT  231

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-------YNLYTVG  255
            V++ G+R C+ YLVKS   +C++ +    G  GA L P   +  +        Y ++ VG
Sbjct  232  VTNFGFRGCRAYLVKSKDYKCNKVSKLFGGDVGAVLKPVKTRGKSSVVINKLTYGVFNVG  291

Query  254  PFAFEPSKKVLCPR  213
            PFAF+P    +CP+
Sbjct  292  PFAFDP----VCPK  301



>gb|AAX82550.1| 120 kDa pistil extensin-like protein [Nicotiana longiflora]
Length=361

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 78/126 (62%), Gaps = 3/126 (2%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            + G V+CKSC  +G+  LYKA P++GAVV+L C+N     +V T  TDKNG F+  +P  
Sbjct  235  IVGRVHCKSCNNRGLPTLYKASPLQGAVVELVCHNNARKANVQTAMTDKNGEFVI-IPMS  293

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YNLYTVGPFAFEP  237
            ++ A   KCKVYLVKSP   C+  TN+  GK GA L P P  +  P ++ + VGP  FE 
Sbjct  294  LTRADVHKCKVYLVKSPKPICNVPTNFNGGKSGALLKPRPGPVQPPMFDYHGVGPSIFEA  353

Query  236  SKKVLC  219
            S K+ C
Sbjct  354  SSKLPC  359



>ref|XP_002881302.1| hypothetical protein ARALYDRAFT_482331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57561.1| hypothetical protein ARALYDRAFT_482331 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 83/136 (61%), Gaps = 19/136 (14%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG+VYCK+CKY GV+N+   KP+K AVV+L C N K  +S  TKTD  G+F+   PK 
Sbjct  111  AVRGVVYCKACKYAGVNNI---KPVKDAVVRLVCKNNKNPVS-ETKTDTKGYFMLLAPKT  166

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---------PYNLYT  261
            V++   + C+ +LVKSP ++CS+ + +  G  G+ L   P+  P           Y +Y 
Sbjct  167  VTNYDIKNCRAFLVKSPDAKCSKVSTFNGGYKGSVL--KPVLKPGFSSVIIKKFKYGVYN  224

Query  260  VGPFAFEPSKKVLCPR  213
            VGPFAFEP+    CP+
Sbjct  225  VGPFAFEPT----CPK  236



>emb|CDX94600.1| BnaC07g10580D [Brassica napus]
Length=301

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 80/128 (63%), Gaps = 12/128 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G V+CKSCKY   D+L  AKP++GA V+L C + K ++   T+TDKNG+F+   PK 
Sbjct  173  AVQGTVFCKSCKYASYDSLTGAKPVEGAKVRLVCKSKK-NIVAETETDKNGYFMLLAPKT  231

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---------PYNLYT  261
            V++ G+R+C+ YLVKS   +C++ +    G  GA L   P+K P           Y ++ 
Sbjct  232  VTNFGFRRCRAYLVKSKDYKCNKVSKLFGGDVGAVL--KPVKTPGKSSVVINKLTYGVFN  289

Query  260  VGPFAFEP  237
            VGPFAF+P
Sbjct  290  VGPFAFDP  297



>gb|ACJ84438.1| unknown [Medicago truncatula]
 gb|AFK43186.1| unknown [Medicago truncatula]
Length=275

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 75/130 (58%), Gaps = 9/130 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPK  417
            AV+G+VY KSCKY GVD L  A  I GAVVKL CNNTKY L    + TDKNG+F    PK
Sbjct  152  AVQGVVYVKSCKYAGVDTLLGATQILGAVVKLQCNNTKYKLVQKVQTTDKNGYFFIEGPK  211

Query  416  IVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAF  243
             ++S    KC + L+ +P     + +N   G  GA L P    +    P+ LYTVGP AF
Sbjct  212  NITSYAAHKCNIVLISAP--NGLKPSNLHGGLTGAGLRPEKPFVAKGLPFILYTVGPLAF  269

Query  242  EPSKKVLCPR  213
            EP     CPR
Sbjct  270  EPK----CPR  275



>gb|KEH31054.1| pollen Ole e I family allergen [Medicago truncatula]
Length=276

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 75/130 (58%), Gaps = 9/130 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPK  417
            AV+G+VY KSCKY GVD L  A  I GAVVKL CNNTKY L    + TDKNG+F    PK
Sbjct  153  AVQGVVYVKSCKYAGVDTLLGATQILGAVVKLQCNNTKYKLVQKVQTTDKNGYFFIEGPK  212

Query  416  IVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAF  243
             ++S    KC + L+ +P     + +N   G  GA L P    +    P+ LYTVGP AF
Sbjct  213  NITSYAAHKCNIVLISAP--NGLKPSNLHGGLTGAGLRPEKPFVAKGLPFILYTVGPLAF  270

Query  242  EPSKKVLCPR  213
            EP     CPR
Sbjct  271  EPK----CPR  276



>ref|XP_006305266.1| hypothetical protein CARUB_v10009642mg [Capsella rubella]
 gb|EOA38164.1| hypothetical protein CARUB_v10009642mg [Capsella rubella]
Length=341

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG V+CKSCKY   D+L  AKP +GA V+L C + K  +S  T TDKNG+F    PK 
Sbjct  213  AVRGTVFCKSCKYAAYDSLTGAKPAEGATVRLVCKSKKNIISEAT-TDKNGYFFLLAPKT  271

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP--TPLKLPA-----PYNLYTVG  255
            V++ G+R C+VYLVKS   +C++ +    G  GA L P  +P K        PY ++ VG
Sbjct  272  VTNYGFRGCRVYLVKSKDYKCNKVSKLFGGDVGAVLKPERSPGKSTVVINKLPYGIFNVG  331

Query  254  PFAFEPSKKVLCPR  213
            PFAF P+    CP+
Sbjct  332  PFAFNPA----CPK  341



>ref|XP_010540450.1| PREDICTED: pistil-specific extensin-like protein [Tarenaya hassleriana]
Length=244

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 73/134 (54%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCK CKY GV+ L  AKP+KGAVV+  C      +     TD+ G+F    PK 
Sbjct  116  AVQGMVYCKDCKYAGVETLLGAKPVKGAVVRFMCKGKTGSVKEAI-TDEKGYFFLLAPKT  174

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA-------PYNLYTVG  255
            V++ G+R C V LVKS   +CS+ +    G  G  L P   K           Y L+ VG
Sbjct  175  VNNYGFRGCMVKLVKSANPKCSKPSKLHGGDVGGVLTPVKDKSKRIIVVNNLKYGLFDVG  234

Query  254  PFAFEPSKKVLCPR  213
            PFAFEPS    CPR
Sbjct  235  PFAFEPS----CPR  244



>gb|AFK48736.1| unknown [Medicago truncatula]
Length=276

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 74/130 (57%), Gaps = 9/130 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPK  417
            AV+G+VY KSCKY GVD L  A  I GAVVKL CNNTKY L    + TDKNG+F    PK
Sbjct  153  AVQGVVYVKSCKYAGVDTLLGATQILGAVVKLQCNNTKYKLVQKVQTTDKNGYFFIEGPK  212

Query  416  IVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAF  243
             ++S    KC + L+ +P     + +N   G  GA L P    +    P+  YTVGP AF
Sbjct  213  NITSYAAHKCNIVLISAP--NGLKPSNLHGGLTGAGLRPEKPFVAKGLPFIFYTVGPLAF  270

Query  242  EPSKKVLCPR  213
            EP     CPR
Sbjct  271  EPK----CPR  276



>gb|AAX82555.1| 120 kDa pistil extensin-like protein [Nicotiana bonariensis]
Length=353

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 13/136 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            + G V+CKSC  +G+  LYKA P++GAVVKL C+N     +V T  TDKNG F+  MP  
Sbjct  217  IVGHVHCKSCNSRGLPTLYKASPLQGAVVKLVCHNNARKANVQTAMTDKNGEFVI-MPMS  275

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIPT-PLKLPAP-------YNL  267
            ++ A   KCKVYL KSP   C+  TN+  GK GA   P++P  P   P P       ++ 
Sbjct  276  LTKADVHKCKVYLGKSPKPICNVPTNFNGGKSGALLKPILPPKPHVNPGPGPVQPPMFDY  335

Query  266  YTVGPFAFEPSKKVLC  219
            + VGPF FE S K+ C
Sbjct  336  HGVGPFIFEASSKLPC  351



>ref|XP_010108175.1| hypothetical protein L484_014500 [Morus notabilis]
 gb|EXC18100.1| hypothetical protein L484_014500 [Morus notabilis]
Length=302

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 72/129 (56%), Gaps = 7/129 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VYCKSCKY G   L  A P+  A V+L C N +Y       TDKNG+F      I
Sbjct  177  AVQGVVYCKSCKYAGAKTLLGATPVANATVRLVCKN-RYKTVDYANTDKNGYFYLIARDI  235

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL--IPTPLKLPAPYNLYTVGPFAFE  240
            V+S G R C+  L+ SPL  C   +    G +GA L    + +    P++LYTVGPFAFE
Sbjct  236  VTSYGIRGCRASLLSSPLPHCQRPSLLHDGLNGAILRFEKSFVSGKKPFSLYTVGPFAFE  295

Query  239  PSKKVLCPR  213
            P     CPR
Sbjct  296  PK----CPR  300



>gb|AAC15893.1| 120 kDa style glycoprotein [Nicotiana alata]
Length=461

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 81/137 (59%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            + G V+CKSC  +G+  LYKA P++GAVVKL C+N     +V T  TDKNG F+  MP  
Sbjct  325  IVGHVHCKSCNSRGLPTLYKASPLQGAVVKLVCHNNARKANVQTAMTDKNGEFVI-MPMS  383

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIPT---------PLKLPAPYN  270
            ++ A   KCKVYL KSP   C+  TN+  GK GA   P++P          P++ P  ++
Sbjct  384  LTRADVHKCKVYLGKSPKPICNVPTNFNGGKSGALLKPILPPKPHVNPGPGPVQPPM-FD  442

Query  269  LYTVGPFAFEPSKKVLC  219
             + VGPF FE S K+ C
Sbjct  443  YHGVGPFIFEASSKLPC  459



>ref|XP_008794128.1| PREDICTED: pistil-specific extensin-like protein [Phoenix dactylifera]
Length=192

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 73/128 (57%), Gaps = 3/128 (2%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMP-KI  414
            V G++YC+SCK +  D L  A P+ GAV +L CNN+++   +   T+ +G+FL   P + 
Sbjct  62   VEGVIYCRSCKLRNYDRLLDASPLPGAVAELRCNNSRHEFKLNGTTNADGYFLIQAPMRK  121

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGPFAFE  240
            V++ G  KCKV+L+ SPL+ C+  +N   G  GA L    +    P    L+  G F F 
Sbjct  122  VTTFGSHKCKVFLMSSPLASCNRLSNLSGGVTGAYLRFERITKVGPDQSALFAAGYFEFS  181

Query  239  PSKKVLCP  216
            P+K  LCP
Sbjct  182  PAKTTLCP  189



>ref|XP_006468215.1| PREDICTED: extensin-like [Citrus sinensis]
Length=273

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V+G+VYCKSCKY G D L  A  + GA VKL CNNTKY L+V  KTDKNG+F    PK +
Sbjct  152  VQGVVYCKSCKYAGADTLLGATAVLGATVKLQCNNTKYPLNVVGKTDKNGYFRIKAPKTI  211

Query  410  SSAGYRKCKVYLVKSPLSQCSE  345
            +S G  KCK++LV SP + C++
Sbjct  212  TSYGAHKCKLFLVTSPSASCAK  233



>gb|KCW74554.1| hypothetical protein EUGRSUZ_E03269 [Eucalyptus grandis]
Length=205

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 57/86 (66%), Gaps = 4/86 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            A++G+VYCKSC+Y     L  AKPI GAVVKL C NTKY    T  TDKNG+F    PK 
Sbjct  100  AIQGVVYCKSCEY----TLNGAKPIIGAVVKLWCKNTKYPAWATATTDKNGYFFLEAPKT  155

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTN  336
            VS+    KCKV+LV SP+  CSE +N
Sbjct  156  VSNFATHKCKVFLVSSPIPSCSEPSN  181



>ref|XP_009335890.1| PREDICTED: pistil-specific extensin-like protein [Pyrus x bretschneideri]
Length=205

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 73/123 (59%), Gaps = 6/123 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+V  +  +Y   D L  A P++G  VKL CNN+K  + V  KTDK  +FL   PK 
Sbjct  80   AVEGVVLLQVLQYSRFDTLVGASPLQGVTVKLLCNNSKNPMVVKAKTDKRDYFLIAAPKN  139

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPL----KLPAPYNLYTVGPFA  246
            ++++   KC+V L  SPL+ CS+ T++  G+ GA L P       KL  P++ Y+VGPF+
Sbjct  140  ITTSLSHKCRVSLFTSPLTSCSKPTSFHAGQKGAILRPVKAFVTKKL--PFSPYSVGPFS  197

Query  245  FEP  237
             EP
Sbjct  198  LEP  200



>gb|KEH32955.1| pollen Ole e I family allergen [Medicago truncatula]
Length=393

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 72/123 (59%), Gaps = 7/123 (6%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VY KSC + GVD L  A P+ GAVVKL C+N K+ L +  KTDK G+F    PK 
Sbjct  270  AVEGVVYVKSCNHTGVDTLKGATPLFGAVVKLQCDNAKHKLVLKAKTDKKGYFYIGGPKN  329

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP----APYNLYTVGPFA  246
            ++    R C V L  +P  +  + +N   G  GAPL+  P+K P        LYTVGPFA
Sbjct  330  IAGYSTRHCNVVLDTAP--KVLKPSNLHGGLSGAPLL-KPVKRPVSKGVSLKLYTVGPFA  386

Query  245  FEP  237
            FEP
Sbjct  387  FEP  389



>ref|XP_010925565.1| PREDICTED: proline-rich protein 1-like [Elaeis guineensis]
Length=193

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 4/130 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNN-TKYHLSVTTKTDKNGFFLFYMP-  420
            AV G++YC+SCK +  D L  A P+ GAV +L CNN ++  L +   T+ +G+FL   P 
Sbjct  61   AVEGVIYCRSCKLRNYDRLLDASPLPGAVAELRCNNGSRRELKLNGTTNADGYFLIQAPM  120

Query  419  KIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKL-PAPYNLYTVGPFA  246
            + V++ G  KCKV+L+ SPL+ C+ + N   G  G  L     +K+ P  + L+  G F 
Sbjct  121  RKVTTFGSHKCKVFLMSSPLASCNRRGNLSGGVTGVYLRFERIIKVGPNQWALFAAGYFE  180

Query  245  FEPSKKVLCP  216
            F P+K  LCP
Sbjct  181  FCPAKTTLCP  190



>ref|XP_009796660.1| PREDICTED: pistil-specific extensin-like protein [Nicotiana sylvestris]
Length=414

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 76/136 (56%), Gaps = 13/136 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            + G V+CKSC  +G+  LYKA P++GAVVKL C+N     +V T  TDKNG F+  MP  
Sbjct  278  IVGHVHCKSCNSRGLPTLYKASPLQGAVVKLVCHNNARKANVQTAMTDKNGEFVI-MPMS  336

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKL-----------PAPYNL  267
            ++ A   KCKVYLVKSP   C+  TN+  GK GA L P                P  ++ 
Sbjct  337  LTRADVHKCKVYLVKSPKPICNVPTNFNGGKSGALLKPILPPKPPVNPGPGPVQPPMFDF  396

Query  266  YTVGPFAFEPSKKVLC  219
            + VGPF FE S K  C
Sbjct  397  HGVGPFIFEASSKRPC  412



>gb|AAX82548.1| 120 kDa pistil extensin-like protein [Nicotiana tabacum]
Length=343

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 77/141 (55%), Gaps = 23/141 (16%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            V G V+CKSC  +G+  LYKA P++GAVVKL C+N     +V T  TDKNG F+  MP  
Sbjct  207  VVGRVHCKSCNSRGLPTLYKASPLQGAVVKLVCHNNARKANVQTAMTDKNGEFVI-MPMP  265

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAP----------------LIPTPLKLP  282
            ++ A   KCKVYLVKS    C+  TN+  GK GA                 L+  P+   
Sbjct  266  LTRADIHKCKVYLVKSTKPICNVPTNFNGGKSGALLKPILPPKPPVNPGPALVQPPM---  322

Query  281  APYNLYTVGPFAFEPSKKVLC  219
              ++ + VGPF FE S K+ C
Sbjct  323  --FDFHGVGPFIFEASSKLPC  341



>ref|XP_009617411.1| PREDICTED: pistil-specific extensin-like protein [Nicotiana tomentosiformis]
Length=407

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 78/136 (57%), Gaps = 13/136 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            V G V+CKSC  +G+  LYKA P++GAVVKL C+N     +V T  TDKNG F+  MP  
Sbjct  271  VVGRVHCKSCNSRGLPTLYKASPLQGAVVKLVCHNNARKANVQTAMTDKNGEFVI-MPMP  329

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP-----------LKLPAPYNL  267
            ++ A   KCKVYLVKS    C+  TN+  GK GA LIP             L  P  ++ 
Sbjct  330  LTRADIHKCKVYLVKSTKPICNVPTNFNGGKSGALLIPILPPKPPVNPGPALVQPPMFDF  389

Query  266  YTVGPFAFEPSKKVLC  219
            + VGPF FE S K+ C
Sbjct  390  HGVGPFIFEASSKLPC  405



>ref|XP_006347170.1| PREDICTED: pistil-specific extensin-like protein-like [Solanum 
tuberosum]
Length=422

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 73/137 (53%), Gaps = 14/137 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V G+VYCK C   GV NL  A P++GA  +L C N K  +  +  TDKNG F    PK +
Sbjct  281  VNGIVYCKPCNSYGVPNLLNATPLQGASARLVCYNGKNAIVQSAITDKNGEFRL-TPKSL  339

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---------PLIPTPLKL----PAPYN  270
              A   KCKVYLVKSP   C+  TN+  GK GA         P I TP  +    P   +
Sbjct  340  IGADIGKCKVYLVKSPNPTCNVPTNFNGGKTGALLQHVVPPKPPIVTPAVIVPVQPPMSD  399

Query  269  LYTVGPFAFEPSKKVLC  219
            LY VGPF FE S KV C
Sbjct  400  LYGVGPFIFEASSKVPC  416



>ref|XP_010317327.1| PREDICTED: LOW QUALITY PROTEIN: pistil-specific extensin-like 
protein [Solanum lycopersicum]
Length=662

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 72/134 (54%), Gaps = 11/134 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V G+VYCK C   GV NL  A PI+GA  +L C N K  +  +  TDKNG F    PK +
Sbjct  524  VNGVVYCKPCNSYGVPNLLNAIPIQGASARLVCYNGKNAMVQSAITDKNGEFRI-TPKSL  582

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA----------PLIPTPLKLPAPYNLYT  261
              A   KCKVYLVKSP   C+  TN+  GK GA          P++   +  P   +LY 
Sbjct  583  MGADIGKCKVYLVKSPNPTCNVPTNFNGGKTGALLQHVVPPKPPIVTAAVVQPPMSDLYG  642

Query  260  VGPFAFEPSKKVLC  219
            VGPF FE S K+ C
Sbjct  643  VGPFIFEASSKIPC  656



>gb|AAX82554.1| 120 kDa pistil extensin-like protein [Nicotiana forgetiana]
Length=343

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 75/136 (55%), Gaps = 13/136 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            + G V+CKSC  +G+  LYKA P++GAVVKL C+N      V T  TDKNG F+  MP  
Sbjct  207  IVGHVHCKSCNSRGLPTLYKASPLQGAVVKLVCHNNARKADVQTAMTDKNGEFVI-MPMS  265

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKL-----------PAPYNL  267
            ++ A   KCKVYL KSP   C+  TN+  GK GA L P                P  ++ 
Sbjct  266  LTRADVHKCKVYLGKSPKPICNVPTNFNGGKSGALLKPILPPKPPVNPGPGPVQPPMFDY  325

Query  266  YTVGPFAFEPSKKVLC  219
            + VGPF FE S K+ C
Sbjct  326  HGVGPFIFEASSKLPC  341



>gb|AAX82552.1| 120 kDa pistil extensin-like protein, partial [Nicotiana langsdorffii]
Length=132

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 72/131 (55%), Gaps = 13/131 (10%)
 Frame = -2

Query  575  YCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKIVSSAG  399
            +CKSC  +G   LYKA P++GAVVKL C+N     +V T  TDKNG F+  MP  ++ A 
Sbjct  1    HCKSCNSRGFPTLYKASPLQGAVVKLVCHNNARKANVQTAMTDKNGEFVI-MPMSLTRAD  59

Query  398  YRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKL-----------PAPYNLYTVGP  252
              KCKVYL KSP   CS  TN+  GK GA L P                P  ++ + VGP
Sbjct  60   VHKCKVYLGKSPKPICSVPTNFNGGKSGALLKPILPPKPPVNPGPGPVQPPMFDYHGVGP  119

Query  251  FAFEPSKKVLC  219
            F FE S K+ C
Sbjct  120  FIFEASSKLPC  130



>gb|AAX82553.1| 120 kDa pistil extensin-like protein [Nicotiana langsdorffii]
Length=367

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 76/136 (56%), Gaps = 13/136 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            + G V+CKSC  +G+  LYKA P++GAVVKL C+N     +V T  TDKNG F+  MP  
Sbjct  231  IVGHVHCKSCNSRGLPTLYKASPLQGAVVKLVCHNNGRKANVQTAMTDKNGEFVI-MPMS  289

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKL-----------PAPYNL  267
            ++ A   KCKVYL KSP   C+  TN+  GK GA L P                P  ++ 
Sbjct  290  LTRADVHKCKVYLGKSPKPICNVPTNFNGGKSGALLKPILPPKPPVNPGPGPVQPPMFDY  349

Query  266  YTVGPFAFEPSKKVLC  219
            + VGPF FE S K+ C
Sbjct  350  HGVGPFIFEASSKLPC  365



>ref|XP_010916048.1| PREDICTED: pistil-specific extensin-like protein [Elaeis guineensis]
Length=171

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G++YC+SCK  G D    A P+ GAV KL C  +   ++VT  TDKNG+FL    K 
Sbjct  42   AVEGVIYCRSCKLPGYDKSIDASPLPGAVAKLQCTGSAPGVTVTGTTDKNGYFLIQTNK-  100

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN-LYTVGPFAFE  240
            V++ G  KC+V+L  SPLS C+          GA L     +K+ +    LY+ G FAF 
Sbjct  101  VTNYGAHKCQVFLESSPLSYCNVPVYPTAKGSGASLKFERNIKVGSGLQALYSAGAFAFA  160

Query  239  PSKKVLCPR  213
            P+K   CPR
Sbjct  161  PAKGSSCPR  169



>sp|Q03211.1|PEXLP_TOBAC RecName: Full=Pistil-specific extensin-like protein; Short=PELP; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA78397.1| pistil extensin like protein [Nicotiana tabacum]
Length=426

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 75/135 (56%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V GLVYCKSC   GV  L  A  ++GAVVKL C   K  +   T  +K  F +  MPK +
Sbjct  291  VSGLVYCKSCNSYGVPTLLNASLLQGAVVKLICYGKKTMVQWATTDNKGEFRI--MPKSL  348

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIP-----TPLKLPAP---YNLY  264
            ++A   KCKVYLVKSP   C+  TN+  GK G    PL+P     TP  +P      +LY
Sbjct  349  TTADVGKCKVYLVKSPNPNCNVPTNFNGGKSGGLLKPLLPPKQPITPAVVPVQPPMSDLY  408

Query  263  TVGPFAFEPSKKVLC  219
             VGPF FE S K+ C
Sbjct  409  GVGPFIFEASSKMPC  423



>emb|CAA78396.1| pistil extensin like protein, partial CDS [Nicotiana tabacum]
Length=264

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 72/132 (55%), Gaps = 10/132 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V GLVYCKSC   G   L     + GAVVKL C N K  +  +  TD  G F   +PK +
Sbjct  132  VNGLVYCKSCNSYGFPTLLNTSLLPGAVVKLVCYNGKKTMVQSATTDNKGEFRI-IPKSL  190

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIP-----TPLKLPAPYNLYTVG  255
            + A   KCK+YLVKSP   C+  TN+  GK G    PL+P     TP  +P   +LY VG
Sbjct  191  TRADVGKCKLYLVKSPNPNCNVPTNFNGGKSGGLLKPLLPPKQPITPAAVPL-SDLYGVG  249

Query  254  PFAFEPSKKVLC  219
            PF FE S K+ C
Sbjct  250  PFIFEASSKMPC  261



>gb|KEH30305.1| pollen Ole e I family allergen [Medicago truncatula]
Length=338

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 74/128 (58%), Gaps = 11/128 (9%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            +RG+VY KSCKY G+D L +AKP+ GAVVKL CNNTKY L    +TDK+G F    PKI+
Sbjct  220  IRGVVYVKSCKYSGLDTLKEAKPLLGAVVKLQCNNTKYKLD---ETDKDGHFSLVGPKII  276

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFEP  237
            +    ++C V LV +P      K +   G  GA L P    +    P+ L+   P AFEP
Sbjct  277  TIYTAKQCNVVLVSAPHGLKPSKLHD--GISGAILRPKRRFVSKGVPFILFATQPLAFEP  334

Query  236  SKKVLCPR  213
            +    CPR
Sbjct  335  N----CPR  338



>ref|XP_006347026.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Solanum 
tuberosum]
Length=474

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            V G V CKSC  +G+ +L+KA P+ GA VKL C+N     +V T  TDKNG F    P  
Sbjct  347  VVGHVNCKSCSSRGLPSLFKASPLHGASVKLVCHNNGRKANVQTALTDKNGDFSI-TPIS  405

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIPTPLKLPAPYNLYTVGPFAF  243
            ++ A   KC+VYLVKSP   C+  TNY  GK GA   P++P     P  ++ + VGPF F
Sbjct  406  LARADVHKCRVYLVKSPKPICNVATNYNNGKSGAVLKPILPPGNHGPM-FDFFGVGPFIF  464

Query  242  EPSKKVLC  219
            E   K  C
Sbjct  465  EAPNKFPC  472



>ref|XP_009796661.1| PREDICTED: pistil-specific extensin-like protein [Nicotiana sylvestris]
Length=422

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 75/136 (55%), Gaps = 15/136 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V GLVYCKSC   GV  L  A  ++GAVVKL C   K  +   T  +K  F +  MPK +
Sbjct  287  VSGLVYCKSCNSYGVPTLLNASLLQGAVVKLICYGKKAMVQWGTTDNKGEFRI--MPKSL  344

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIP---------TPLKLPAPYNL  267
            ++A   KCKVYLVKSP   C+  TN+  GK G    PL+P          P++ P   +L
Sbjct  345  TTADVGKCKVYLVKSPNPNCNVPTNFNGGKSGGLLKPLLPPKQPITPAFVPVQPPM-SDL  403

Query  266  YTVGPFAFEPSKKVLC  219
            Y VGPF FE S K+ C
Sbjct  404  YGVGPFIFEASSKMPC  419



>emb|CAA78393.1| pistil extensin like protein [Nicotiana tabacum]
Length=393

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 72/132 (55%), Gaps = 10/132 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V GLVYCKSC   G   L     + GAVVKL C N K  +  +  TD  G F   +PK +
Sbjct  261  VNGLVYCKSCNSYGFPTLLNTSLLPGAVVKLVCYNGKKTMVQSATTDNKGEFRI-IPKSL  319

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIP-----TPLKLPAPYNLYTVG  255
            + A   KCK+YLVKSP   C+  TN+  GK G    PL+P     TP  +P   +LY VG
Sbjct  320  TRADVGKCKLYLVKSPNPNCNVPTNFNGGKSGGLLKPLLPPKQPITPAAVPL-SDLYGVG  378

Query  254  PFAFEPSKKVLC  219
            PF FE S K+ C
Sbjct  379  PFIFEASSKMPC  390



>ref|XP_009617406.1| PREDICTED: pistil-specific extensin-like protein [Nicotiana tomentosiformis]
Length=428

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 72/132 (55%), Gaps = 10/132 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V GLVYCKSC   G   L     + GAVVKL C N K  +  +  TD  G F   +PK +
Sbjct  296  VNGLVYCKSCNSYGFPTLLNTSLLPGAVVKLVCYNGKKTMVQSATTDNKGEFRI-IPKSL  354

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIP-----TPLKLPAPYNLYTVG  255
            + A   KCK+YLVKSP   C+  TN+  GK G    PL+P     TP  +P   +LY VG
Sbjct  355  TRADVGKCKLYLVKSPNPNCNVPTNFNGGKSGGLLKPLLPPKQPITPAAVPL-SDLYGVG  413

Query  254  PFAFEPSKKVLC  219
            PF FE S K+ C
Sbjct  414  PFIFEASSKMPC  425



>gb|AAA87047.1| pistil extensin-like protein [Nicotiana alata]
Length=430

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 74/135 (55%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V GLVYCKSC   GV  L  A  ++GAVVKL C   K  +   T  +K  F +  MPK +
Sbjct  295  VNGLVYCKSCNSYGVPTLLNASLLQGAVVKLICYGKKAMVQWATTDNKGEFRI--MPKSL  352

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIP-----TPLKLPAP---YNLY  264
            ++    KCKVYLVKSP   C+  TN+  GK G    PL+P     TP  +P      +LY
Sbjct  353  TTTDVGKCKVYLVKSPNPNCNVPTNFNGGKSGGLLKPLLPPKQPITPAVVPVQPPMSDLY  412

Query  263  TVGPFAFEPSKKVLC  219
             VGPF FE S K+ C
Sbjct  413  GVGPFIFEASSKMPC  427



>ref|XP_004232890.1| PREDICTED: pistil-specific extensin-like protein [Solanum lycopersicum]
Length=363

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 73/131 (56%), Gaps = 8/131 (6%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK-TDKNGFFLFYMPKI  414
            V G V CKSC  +G+ +L+KA P+ GA VKL C+N      V T  TDKNG F    P  
Sbjct  232  VVGRVNCKSCSNRGLPSLFKAFPLHGASVKLVCHNNGRKAHVQTALTDKNGDFSI-TPIS  290

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA---PLIPTPLKLPAP---YNLYTVGP  252
            ++ A   KC+VYLVKSP S C+  TN+  GK GA   P++P     P     ++ + VGP
Sbjct  291  LTRADVHKCRVYLVKSPKSICNVPTNFNNGKSGAQLKPILPPGNHGPGHGLMFDFFGVGP  350

Query  251  FAFEPSKKVLC  219
            F FE   K  C
Sbjct  351  FIFEAPNKFPC  361



>ref|XP_003597360.1| Pistil-specific extensin-like protein [Medicago truncatula]
 gb|AES67611.1| pollen protein Ole E I-like protein [Medicago truncatula]
Length=341

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 66/121 (55%), Gaps = 4/121 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            A+ G+VY KSC + GVD L  A P+ GAVVKL CNN KY L +  KTDK G+F    PK 
Sbjct  219  AIEGVVYVKSCNHVGVDTLKGATPLLGAVVKLQCNNYKYMLVLKAKTDKKGYFYIGAPKN  278

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKL--PAPYNLYTVGPFAFE  240
            ++S   R C V L  +  S   + +N   G  GA L P    +       LY VGPF FE
Sbjct  279  ITSCITRHCNVVLDSA--SNGLKPSNLHGGFTGALLKPVKQSVSKSVSLKLYIVGPFVFE  336

Query  239  P  237
            P
Sbjct  337  P  337



>ref|XP_003614300.1| Pistil-specific extensin-like protein [Medicago truncatula]
 gb|AES97258.1| pollen Ole e I family allergen [Medicago truncatula]
Length=342

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 66/120 (55%), Gaps = 4/120 (3%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V G+VY KSC + GVD L  A P+ GA+VKL CNN K+ L +  KTDK G+F    PK +
Sbjct  221  VEGVVYVKSCNHNGVDTLKGATPLLGAIVKLQCNNAKHKLVLKAKTDKKGYFYIGGPKNI  280

Query  410  SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP--APYNLYTVGPFAFEP  237
                 R C V L  SP  +  + +N   G  GA L P    +       L+TVGPFAFEP
Sbjct  281  VGYSTRHCNVVLDNSP--KALKPSNLHGGLTGALLKPVKRSVSKGISLKLFTVGPFAFEP  338



>ref|XP_010418646.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=115

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 12/107 (11%)
 Frame = -2

Query  512  AVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNY  333
            AVV+L C N K  +S  TKTDKNG+F+F  PK V+S G + C+ +LVKSP ++CS+ +  
Sbjct  14   AVVRLVCKNKKSSIS-ETKTDKNGYFMFLAPKTVTSYGIKGCRAFLVKSPDAKCSKVSTL  72

Query  332  KLGKDGAPLIP-------TPLKLPAPYNLYTVGPFAFEPSKKVLCPR  213
              G  GA L P       T +     Y +Y VGPFAF+P+    CP+
Sbjct  73   HGGDKGAYLKPVVKPGNSTTIINKFTYGIYNVGPFAFDPA----CPK  115



>gb|KEH29657.1| pollen Ole e I family allergen [Medicago truncatula]
Length=277

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 69/124 (56%), Gaps = 7/124 (6%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKP---IKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYM  423
            AV G+VY KSCK+ GVD L  A     ++GAVVKL CNNTK+++    KTDKNG+F    
Sbjct  152  AVEGVVYVKSCKHAGVDTLSNATSLNGVEGAVVKLQCNNTKHNVVRKGKTDKNGYFYIKG  211

Query  422  PKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGPF  249
            PK +S     KC V LV +P     + +N   G  GA +      +   +N  LY V P 
Sbjct  212  PKDISIFAVHKCNVVLVSAP--NGLKPSNINGGITGARIKHKKSFVSKAHNLILYNVKPL  269

Query  248  AFEP  237
            AFEP
Sbjct  270  AFEP  273



>ref|XP_006468216.1| PREDICTED: forkhead box protein B2-like [Citrus sinensis]
Length=220

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V+G+VYCKSCKY G D L  A  + GA +KL CNNTKY L+V  KTDKNG+F    PK +
Sbjct  142  VQGVVYCKSCKYAGADTLLGATAVLGATLKLQCNNTKYPLNVVGKTDKNGYFRIKAPKTI  201

Query  410  SSAGYRKCK  384
             S G  KCK
Sbjct  202  ISYGAHKCK  210



>gb|KEH41863.1| pollen Ole e I family allergen [Medicago truncatula]
Length=343

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VY KSC + GVD L  A P+ GA+VKL CNNTKY L +  KT+K G+F    PK 
Sbjct  221  AVEGVVYVKSCNHTGVDTLKGATPLPGAIVKLQCNNTKYKLVLKAKTNKKGYFYIGGPKN  280

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGA--PLIPTPLKLPAPYNLYTVGPFAFE  240
            ++    R C V L  +P  +  + +N   G  GA   L+   +       L++VGPFAFE
Sbjct  281  ITGYSTRHCNVVLDSAP--KVLKPSNLHGGVIGALLKLVKRSMSKGVYVKLFSVGPFAFE  338

Query  239  P  237
            P
Sbjct  339  P  339



>gb|KEH31055.1| pollen Ole e I family allergen [Medicago truncatula]
Length=402

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 65/130 (50%), Gaps = 22/130 (17%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV+G+VY KSCK+ G D L  A  I GAVVKL CNNTK ++ +  KTDKNG+F       
Sbjct  280  AVQGVVYVKSCKHAGGDTLLGATSIIGAVVKLRCNNTKQYVVLKGKTDKNGYFYIKGSNN  339

Query  413  VSSAGYRKCKVYLVKSP-----------LSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNL  267
            +SS   RKC V LV +P           ++    K       +G P I           L
Sbjct  340  ISSYAARKCNVVLVSAPNGLKPSNLHGGITGAVLKAKKSFVSEGHPFI-----------L  388

Query  266  YTVGPFAFEP  237
            Y V P AFEP
Sbjct  389  YNVAPLAFEP  398



>ref|XP_010499343.1| PREDICTED: gibberellin-regulated protein 14-like [Camelina sativa]
Length=325

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 71/134 (53%), Gaps = 12/134 (9%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AVRG V+CKSCKY   D+L  AKP++GA V+L C + K  +S  T TDKNG+F       
Sbjct  197  AVRGTVFCKSCKYAAFDSLTGAKPVEGATVRLVCKSKKNIISEAT-TDKNGYFFLLAXXX  255

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP--TPLKLPA-----PYNLYTVG  255
                       YLVKS   +C++ +    G  GA L P  +P K        PY ++ VG
Sbjct  256  XXXXXXXXXXXYLVKSKDYKCNKVSKLFGGDVGAVLKPERSPGKSTVVINKLPYGIFNVG  315

Query  254  PFAFEPSKKVLCPR  213
            PFAF P+    CP+
Sbjct  316  PFAFNPA----CPK  325



>ref|XP_010911389.1| PREDICTED: pistil-specific extensin-like protein [Elaeis guineensis]
Length=172

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 72/130 (55%), Gaps = 4/130 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G++YC SCK  G D    A P+ GAV +L C+++   ++V   TD++G+FL    K 
Sbjct  42   AVVGIIYCMSCKLPGYDKYIDASPLPGAVARLQCSSSAPGVTVKGTTDRHGYFLIQTNK-  100

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN-LYTVGPFAFE  240
            V++ G  KC+V+L  SP   C+        + GAPL      K+ +    LYT G FAF 
Sbjct  101  VTNYGAHKCRVFLESSPFPYCNLPVYPAGKRSGAPLKFERNRKVGSGQQALYTAGGFAFA  160

Query  239  PSK-KVLCPR  213
            P+K +  CPR
Sbjct  161  PAKGRSSCPR  170



>gb|AAD30268.1|AF117607_1 putative hybrid proline-rich protein PRP1 [Trifolium subterraneum]
Length=97

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 58/103 (56%), Gaps = 8/103 (8%)
 Frame = -2

Query  515  GAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTN  336
            GAVVKL CNNTKY L  T +TDKNG+F    PK ++S    KC V LV +P     + +N
Sbjct  1    GAVVKLQCNNTKYKLVQTHETDKNGYFFIEGPKSITSYAAHKCNVVLVSAP--NGLKPSN  58

Query  335  YKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFEPSKKVLCPR  213
               G  GA L P    +    P+ +YTVGP AFEP     CPR
Sbjct  59   LHGGLTGAGLRPGKPYVSKGLPFIVYTVGPLAFEPK----CPR  97



>gb|KEH29658.1| pollen Ole e I family allergen [Medicago truncatula]
Length=252

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 66/121 (55%), Gaps = 4/121 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VY KSCK+ GV+ L  A  + GAVVKL CNNTK+++    KTDKNG+F     K 
Sbjct  130  AVEGVVYVKSCKHAGVETLSNATSLNGAVVKLQCNNTKHNVVRKGKTDKNGYFYIKGSKD  189

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN--LYTVGPFAFE  240
            +SS    KC V L  +P     + +N   G  GA L      +   +   LY V P AFE
Sbjct  190  ISSFAAHKCNVVLDSAP--NGLKPSNLHGGVTGAVLKRKKSFVSKGHVLILYNVKPLAFE  247

Query  239  P  237
            P
Sbjct  248  P  248



>ref|XP_006847391.1| hypothetical protein AMTR_s00153p00017940 [Amborella trichopoda]
 gb|ERN08972.1| hypothetical protein AMTR_s00153p00017940 [Amborella trichopoda]
Length=175

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 67/137 (49%), Gaps = 10/137 (7%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMPK  417
            V G+VYC+SC+ KG  +L +AKPI GA V +AC + K  +      KTD  G+F   +  
Sbjct  46   VEGMVYCQSCELKGTHSLSEAKPIAGAKVGVACKDEKGRVKWYQAHKTDSYGYFYASVIG  105

Query  416  IV-SSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLYTVGPFAFE  240
               S      C  YL+ SP  +C+  TN   G +G+PL            LY  GP AF 
Sbjct  106  FAPSMDALSSCTAYLLSSPDPECNLLTNINGGFEGSPLRYKGNLKAGKVLLYATGPLAFR  165

Query  239  PSKKVLCPR**HPCMHY  189
            P++   C    HP  HY
Sbjct  166  PAR---C----HPLTHY  175



>ref|XP_002881352.1| hypothetical protein ARALYDRAFT_482434 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57611.1| hypothetical protein ARALYDRAFT_482434 [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 67/130 (52%), Gaps = 10/130 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKL---AC-NNTKYHLSVTTKTDKNGFFLFY  426
            AV G+VYCKSCKY GVD L +A P++   ++    AC    K       KTDKNG+F   
Sbjct  48   AVEGMVYCKSCKYSGVDTLLEASPLQALCLRSDGKACMQQHKERCDNGDKTDKNGYFFML  107

Query  425  MPKIVSSAGYRKCKVYLVK----SPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN--LY  264
             PK +++  +  C+ +       +    C+  +    G  GA L P+       ++  L+
Sbjct  108  APKKLTTYAFHTCRAWPTNPGPTTATMTCTVPSKLNNGITGAMLKPSKTINIGEHDYVLF  167

Query  263  TVGPFAFEPS  234
            +VGPFAFEP+
Sbjct  168  SVGPFAFEPA  177



>gb|KDP44722.1| hypothetical protein JCGZ_01222 [Jatropha curcas]
Length=156

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 66/130 (51%), Gaps = 10/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SC + G  +   AKPI+ A + + C N +  +S     +TD+NG+F      
Sbjct  20   VEGMVYCQSCDHYGSWSFNGAKPIRSAKISVICKNHRKQVSYYKAVETDENGYFYAQLDG  79

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN--LYT  261
            F M   +     + C V LV SPL+ CS  +N   G  GAPL     +   + Y   +Y+
Sbjct  80   FKMGHSLLDHPLQSCHVKLVSSPLANCSLLSNVNYGIYGAPLRFENKILRGSHYEAVVYS  139

Query  260  VGPFAFEPSK  231
             GP AF P+ 
Sbjct  140  AGPLAFRPAH  149



>ref|XP_003630140.1| Pistil-specific extensin-like protein [Medicago truncatula]
 gb|AET04616.1| pollen protein Ole E I-like protein [Medicago truncatula]
Length=296

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 63/121 (52%), Gaps = 11/121 (9%)
 Frame = -2

Query  569  KSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIVSSAGYRK  390
            KSC Y G D L KA P+ G VVKL CNNTKY L    +TDK+G F    PKI++    ++
Sbjct  185  KSCNYSGFDTLKKATPLLGPVVKLQCNNTKYKLD---ETDKDGHFSLVGPKIITIYTAKQ  241

Query  389  CKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTP--LKLPAPYNLYTVGPFAFEPSKKVLCP  216
            C V LV +P     + +N   G  G  L P    +    P+ L+   P AFEPS    CP
Sbjct  242  CDVVLVSAP--HGLKPSNLHNGITGVILRPKRRFVSKGVPFILFGTQPLAFEPS----CP  295

Query  215  R  213
             
Sbjct  296  H  296



>ref|XP_006435786.1| hypothetical protein CICLE_v10033597mg [Citrus clementina]
 ref|XP_006486526.1| PREDICTED: uncharacterized protein LOC102615938 [Citrus sinensis]
 gb|ESR49026.1| hypothetical protein CICLE_v10033597mg [Citrus clementina]
 gb|KDO68894.1| hypothetical protein CISIN_1g030578mg [Citrus sinensis]
Length=175

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 64/135 (47%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SCK  G  +L  A+PI  A V + C N +  +S     +TD NG+F      
Sbjct  40   VEGMVYCQSCKNFGTWSLSDAEPIPSAKVSVICKNQRDQVSYYKAFETDGNGYFFAELEG  99

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F M   +     + C V LV SPL  CS  +N   G  GAPL     KL        +Y 
Sbjct  100  FKMSHYLLEHPLQSCLVKLVSSPLENCSLLSNLNYGMYGAPLRYEKKKLMGRNYEAVIYA  159

Query  260  VGPFAFEPSKKVLCP  216
             GP AF P+    CP
Sbjct  160  AGPLAFRPAD---CP  171



>ref|XP_008454812.1| PREDICTED: uncharacterized protein LOC103495126 [Cucumis melo]
Length=167

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 65/131 (50%), Gaps = 10/131 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL----  432
            AV GLVYC++CK  G  +L +AKPI GA + + C N    +      +T+K+G+F     
Sbjct  35   AVEGLVYCQNCKKVGTWSLTEAKPISGAKISVICKNHNDQVKFYKVYQTNKDGYFYAELV  94

Query  431  -FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN--LY  264
             + M   V     + CKV  V SPLS C+  TN   G  GAPL       L   Y   +Y
Sbjct  95   GYQMNHPVLDHPLQACKVKPVSSPLSDCNLLTNLNYGLTGAPLRYEKKFVLGHNYRAAVY  154

Query  263  TVGPFAFEPSK  231
              GP AF P K
Sbjct  155  AAGPLAFHPQK  165



>ref|XP_004148198.1| PREDICTED: uncharacterized protein LOC101207189 [Cucumis sativus]
 ref|XP_004173670.1| PREDICTED: uncharacterized LOC101207189 [Cucumis sativus]
 gb|KGN50679.1| hypothetical protein Csa_5G211030 [Cucumis sativus]
Length=166

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 10/131 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL----  432
            A+ GLVYC++CK  G  +L +AKPI GA + + C N    +      +T+K+G+F     
Sbjct  34   AIEGLVYCQNCKKIGTWSLTEAKPISGAKISVICKNHNDQVKFYKVYQTNKDGYFYAELV  93

Query  431  -FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN--LY  264
             + M   V     + CKV  V SPLS C+  TN   G  GAPL       +   Y   +Y
Sbjct  94   GYQMNHPVLDHPLQACKVKPVSSPLSDCNLLTNLNYGLTGAPLRFEKKFVVGTNYRAAVY  153

Query  263  TVGPFAFEPSK  231
              GP AF P K
Sbjct  154  AAGPLAFHPQK  164



>ref|XP_007008896.1| Pollen Ole e 1 allergen and extensin family protein [Theobroma 
cacao]
 gb|EOY17706.1| Pollen Ole e 1 allergen and extensin family protein [Theobroma 
cacao]
Length=176

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 65/135 (48%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SC   G  +L KA+PI  A V + C N    +S     +TD NG+F      
Sbjct  40   VEGVVYCQSCDNYGSWSLSKAEPIASAKVSVICRNDMDQVSFYKAFETDGNGYFFAELEG  99

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F M   +     + C+V LV SPL  C+  +N   G +G+PL     +L        +Y 
Sbjct  100  FQMSHSLLDHPLQSCRVKLVSSPLENCNLLSNVNYGLNGSPLRYENKRLHRKDYEVVVYA  159

Query  260  VGPFAFEPSKKVLCP  216
             GP AF P+    CP
Sbjct  160  AGPLAFRPAN---CP  171



>ref|XP_006353443.1| PREDICTED: proline-rich protein 1-like [Solanum tuberosum]
Length=176

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 65/136 (48%), Gaps = 15/136 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMPK  417
            V G+VYC+SC   G  +L KAKPI GA V + C N K  +S     KTD+ G+    +  
Sbjct  40   VEGMVYCQSCDNYGSWSLSKAKPIAGAKVSVICKNYKKRVSFYKAFKTDETGYLFAELDG  99

Query  416  IVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGKDGAPL--IPTPLKLPAPYN--LY  264
                  Y       C+V LV SPL  C   TN   G  GA L  +   LK  + Y   +Y
Sbjct  100  FKMGHSYLDHPLHSCRVKLVDSPLENCDVFTNVNYGITGARLRFLDKTLK-RSNYEAVIY  158

Query  263  TVGPFAFEPSKKVLCP  216
              GPFAF P+    CP
Sbjct  159  AAGPFAFRPAH---CP  171



>ref|XP_011076823.1| PREDICTED: proline-rich protein 1 [Sesamum indicum]
Length=184

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 61/128 (48%), Gaps = 10/128 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G VYC+SCK+ G   +  +KPI+ A + + C + +  +S     +TDKNG+F      
Sbjct  43   VEGTVYCQSCKHYGTWTVEGSKPIQAATISVICKDHRNRVSYYKACETDKNGYFYAELKG  102

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F M           CKV LV SPL  C+  TN   G  GAPL     ++        +Y 
Sbjct  103  FKMGHSFLDHPLHSCKVKLVSSPLQTCNHLTNVNYGLYGAPLHYEDKRIFGNNYEAVIYA  162

Query  260  VGPFAFEP  237
             GP AF P
Sbjct  163  AGPLAFRP  170



>ref|XP_009414280.1| PREDICTED: uncharacterized protein LOC103995419 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 69/148 (47%), Gaps = 24/148 (16%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMP  420
            AV G+VYC+ CKY G  NL  A+P+  A V + C + K+ +    + +TD+NG+F     
Sbjct  34   AVEGMVYCQKCKYVGSWNLDGARPLPSAKVSIICKDHKHRVIFYDSAETDRNGYFY----  89

Query  419  KIVSSAGYRK--------CKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPY---  273
            K++  A  R         C   L+ SP + C+  TN   G  GA L          +   
Sbjct  90   KLLDGAHLRSATFDPVTACTARLLASPDASCNRLTNVNYGIQGAKLRDESKTNSGEHCET  149

Query  272  NLYTVGPFAFEPSKKVLCPR**HPCMHY  189
             LY  GP AF+P   V C    HP  HY
Sbjct  150  ELYAAGPLAFKP---VHC----HPRTHY  170



>ref|XP_008233793.1| PREDICTED: proline-rich protein 1 [Prunus mume]
Length=178

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 62/129 (48%), Gaps = 10/129 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G++YC+SC + G  +L  A+PI  A V + C N K  +S   +  TD  G+F      
Sbjct  43   VEGMIYCQSCDHYGTWSLTDAEPIPSAKVSVICKNHKDQVSFYKSFVTDLKGYFYAQLEG  102

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F M   +       C V LV SPL+ CS+ +N   G  GAPL     +L        +Y 
Sbjct  103  FKMAHSILDHPLHGCHVKLVSSPLANCSDLSNVNNGLYGAPLHSENKRLLGRNYEAVIYA  162

Query  260  VGPFAFEPS  234
             GP AF PS
Sbjct  163  AGPLAFRPS  171



>ref|XP_002315144.1| hypothetical protein POPTR_0010s19280g [Populus trichocarpa]
 gb|EEF01315.1| hypothetical protein POPTR_0010s19280g [Populus trichocarpa]
Length=179

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 62/130 (48%), Gaps = 10/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SCKY G  +L  AKPI  A V + C N+   ++     +TD  G+F      
Sbjct  43   VEGMVYCQSCKYSGSWSLTGAKPIPSAKVSVICKNSNKQVTFYKAFETDAYGYFYANLDG  102

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPY---NLYT  261
            F M  IV       C   LV SPL  CS  +N   G  GAPL      L   +    +Y 
Sbjct  103  FKMSNIVLDHPLHGCHAKLVSSPLPNCSLLSNINYGLYGAPLRFKNKVLRGTHYEVVIYA  162

Query  260  VGPFAFEPSK  231
             GP AF P++
Sbjct  163  AGPLAFRPAQ  172



>gb|KCW65700.1| hypothetical protein EUGRSUZ_G03079 [Eucalyptus grandis]
Length=176

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 65/129 (50%), Gaps = 10/129 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SCKY G  +L +AKP+  A V + C N K  ++   T +T+++G+F      
Sbjct  39   VEGMVYCQSCKYFGTWSLDEAKPVGSAKVSVVCKNYKNRVTYYKTFQTEESGYFYAELKG  98

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL---IPTPLKLPAPYNLYT  261
            + M   +       C V LV SPL  C+  +N   G  GAPL     T  +      +Y 
Sbjct  99   YEMSNPILDHPLHACHVKLVSSPLEGCNLLSNINYGMYGAPLRYEDKTLYRKEYEVVVYA  158

Query  260  VGPFAFEPS  234
             GP AF PS
Sbjct  159  AGPLAFRPS  167



>ref|XP_011035895.1| PREDICTED: proline-rich protein 3-like [Populus euphratica]
Length=179

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 63/130 (48%), Gaps = 10/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SCKY G  +L  AKPI  A V + C N+   ++     +TD  G+F      
Sbjct  43   VEGMVYCQSCKYSGSWSLTGAKPIPSAKVSVICKNSNKQVTFYKAFETDAYGYFYAHLDG  102

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPY---NLYT  261
            F M   V       C V LV SPL+ CS  ++   G  GAPL      L   +    +Y 
Sbjct  103  FKMSNNVLDHPLHGCHVKLVSSPLTNCSLLSDINYGLHGAPLRFKNKVLRGTHYEAVIYA  162

Query  260  VGPFAFEPSK  231
             GP AF P++
Sbjct  163  AGPLAFRPAQ  172



>ref|XP_010693071.1| PREDICTED: proline-rich protein 3 [Beta vulgaris subsp. vulgaris]
Length=184

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 62/129 (48%), Gaps = 10/129 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SCKY G  +L +AKPI GA + + C N K  +S      T+ +G+F      
Sbjct  49   VEGIVYCQSCKYAGAWSLDEAKPIAGAHISVICRNQKDRISYYKAYTTNGDGYFYAKLQG  108

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F M   +     + C V LV SP+  C   TN   G +GA L     K+        +Y 
Sbjct  109  FSMKHQLLDHPLQACVVKLVSSPIDSCDVFTNINYGVNGAKLRYENKKIMTKNYEAVIYA  168

Query  260  VGPFAFEPS  234
             GP AF P 
Sbjct  169  AGPLAFRPD  177



>ref|XP_010042582.1| PREDICTED: proline-rich protein 1-like [Eucalyptus grandis]
Length=181

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 65/127 (51%), Gaps = 10/127 (8%)
 Frame = -2

Query  584  GLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----FY  426
            G+VYC+SCKY G  +L +AKP+  A V + C N K  ++   T +T+ +G+F      + 
Sbjct  46   GMVYCQSCKYFGTWSLDEAKPVGSAKVSVVCKNYKNRVTYYKTFQTEASGYFYAELKGYE  105

Query  425  MPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL---IPTPLKLPAPYNLYTVG  255
            M   V       C+V LV SPL  C+  +N   G  GAPL     T  +  +   +Y  G
Sbjct  106  MSHPVLDHPLHACRVKLVSSPLEGCNLLSNINYGMYGAPLRYEDKTLYRKESEAVVYAAG  165

Query  254  PFAFEPS  234
            P AF PS
Sbjct  166  PLAFRPS  172



>ref|XP_003604741.1| Pistil-specific extensin-like protein [Medicago truncatula]
 gb|AES86938.1| pollen Ole e I family allergen [Medicago truncatula]
Length=347

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 65/120 (54%), Gaps = 11/120 (9%)
 Frame = -2

Query  569  KSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIVSSAGYRK  390
            KSCK  G+D L  A P+ GAVVKL CN+TKY L    +TDK+G F    PKI++    ++
Sbjct  236  KSCKSSGLDTLKGATPLLGAVVKLQCNSTKYKLD---ETDKDGHFSLVGPKIITLFTAKQ  292

Query  389  CKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKL--PAPYNLYTVGPFAFEPSKKVLCP  216
            C V LV +P     + +N   G  GA L P    +    P+ L+   P AFEP    +CP
Sbjct  293  CNVVLVSAP--HGPKPSNLHHGITGAILRPKRRFVFKGVPFILFATQPLAFEP----ICP  346



>ref|XP_009415187.1| PREDICTED: pistil-specific extensin-like protein [Musa acuminata 
subsp. malaccensis]
Length=162

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 64/133 (48%), Gaps = 9/133 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G +YCK C+  G      A P+ GAV  L CN+++   S +  TD  G FL    K 
Sbjct  37   AVEGAIYCK-CELPGYVGSLGASPLPGAVAMLRCNSSRPGASASAVTDVRGRFLIQTTK-  94

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL--IPTPLKLPAPYNLYTVGPFAFE  240
            V++    KCK++LV SPL  C     +     G PL  +   +       LYTVGPF   
Sbjct  95   VTNYEIHKCKLFLVSSPLPGCDVPAGH---YGGFPLKFVRNTVAGATKRALYTVGPFKLA  151

Query  239  PSKKVLCPR**HP  201
            P+   LCP   HP
Sbjct  152  PADPSLCPH--HP  162



>gb|EMS64653.1| hypothetical protein TRIUR3_21399 [Triticum urartu]
Length=168

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 58/130 (45%), Gaps = 9/130 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V G V+CK C+Y G      A PI  A   L C   K+ LSV   TD  G+F     + 
Sbjct  43   GVEGAVWCKGCRYAGYVKSRNASPIPNAAALLRCKRGKWALSVWGATDGRGYFQIQTAQQ  102

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-----IPTPLKLPAPYNLYTVGPF  249
             +    + CKVY++ SP+  C      + G  G+PL     +  P  L A   LYT G F
Sbjct  103  SAPFTSKDCKVYVLGSPVRACGVPVKPR-GNKGSPLKFRKFVTLPDGLQA---LYTAGDF  158

Query  248  AFEPSKKVLC  219
             F P K   C
Sbjct  159  VFGPKKPGKC  168



>emb|CDP13982.1| unnamed protein product [Coffea canephora]
Length=177

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 64/130 (49%), Gaps = 10/130 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL----  432
             + G+VYC+SC++ G  +L  AKPI  + + + C + K  +S     +TD NG+F     
Sbjct  40   GIEGVVYCQSCEHYGTWSLSGAKPISNSTIGVICKDYKKRVSFYKAFQTDANGYFYAELK  99

Query  431  -FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKL-PAPYN--LY  264
             F M   +       C V LV SP   C+  TN   G +GAPL     +L  + Y   +Y
Sbjct  100  GFKMGHSLLDHPLHSCSVKLVSSPQENCNSLTNVNYGLNGAPLRYEDKRLIGSRYEAVVY  159

Query  263  TVGPFAFEPS  234
              GP AF P+
Sbjct  160  AAGPLAFRPA  169



>ref|XP_009345277.1| PREDICTED: proline-rich protein 1-like [Pyrus x bretschneideri]
Length=176

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 67/135 (50%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SC + G  +L +A+PI  A + + C + K  +S   +  TD  G+F      
Sbjct  41   VEGVVYCQSCDHYGTWSLTEAEPIPSAKISVICKDHKGQVSFYKSFVTDVKGYFYAQLDG  100

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F + + +       CKV LV SPL +CSE +N   G  GAPL     +L        +Y 
Sbjct  101  FKIGQHLLDHPLHGCKVKLVSSPLEKCSELSNVNYGLYGAPLRYEDKRLWGRNYEAVVYA  160

Query  260  VGPFAFEPSKKVLCP  216
             GP AF PS    CP
Sbjct  161  AGPLAFRPSN---CP  172



>ref|XP_009776548.1| PREDICTED: proline-rich protein 1 [Nicotiana sylvestris]
Length=176

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 62/130 (48%), Gaps = 12/130 (9%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMPK  417
            V G+VYC+SC   G  +L  AKPI  A V + C N    +S     +TDKNG+    +  
Sbjct  40   VEGMVYCQSCDNYGSWSLSGAKPIAAAKVSVICKNYMKRVSYYKAFQTDKNGYLFAELDG  99

Query  416  IVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGKDGAPL--IPTPLKLPAPYN--LY  264
                  Y       C+V LV SPL  C   TN   G  GAPL  +   L+  + Y   +Y
Sbjct  100  FKMGHSYLDHPLHSCRVKLVSSPLENCDVFTNINYGLTGAPLRFLDKTLR-QSNYEAVIY  158

Query  263  TVGPFAFEPS  234
              GPFAF P+
Sbjct  159  AAGPFAFRPA  168



>ref|XP_009632031.1| PREDICTED: proline-rich protein 1 [Nicotiana tomentosiformis]
Length=200

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 60/129 (47%), Gaps = 10/129 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMPK  417
            V G+VYC+SC   G  +L  AKPI  A V + C N    +S     +TDKNG+    +  
Sbjct  64   VEGMVYCQSCDNYGSWSLSGAKPIAAAKVSVICKNYMKRVSYYKAFQTDKNGYLFAELDG  123

Query  416  IVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGKDGAP---LIPTPLKLPAPYNLYT  261
                  Y       C+V LV SPL  C+  TN   G  GAP   L  T  +      +Y 
Sbjct  124  FKMGHSYLDHPLHSCRVKLVSSPLENCNVFTNVNYGLTGAPLRFLDKTLRRSNYEAVIYA  183

Query  260  VGPFAFEPS  234
             GPFAF P+
Sbjct  184  AGPFAFRPA  192



>ref|XP_008369286.1| PREDICTED: proline-rich protein 1 [Malus domestica]
Length=176

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 63/129 (49%), Gaps = 10/129 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SC   G  +L  A+PI  A + + C N K  +S   +   D  G+F      
Sbjct  41   VEGVVYCQSCDRYGTSSLAGAEPIPSAKISVICKNHKGQVSFYKSFVADVKGYFYAQLEG  100

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F + + +       CKV LV SPL++CSE TN   G  GAPL     +L        +Y 
Sbjct  101  FKVAQHLLDHPLHGCKVKLVSSPLAKCSELTNVNYGLYGAPLRYEDKRLWGRNYEAVVYA  160

Query  260  VGPFAFEPS  234
             GP AF PS
Sbjct  161  AGPLAFRPS  169



>ref|XP_004240912.1| PREDICTED: pistil-specific extensin-like protein [Solanum lycopersicum]
Length=176

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 63/136 (46%), Gaps = 15/136 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMPK  417
            V G+VYC+SC   G  +L KAKPI GA V + C N    +S     KTD+ G+    +  
Sbjct  40   VEGMVYCQSCDNYGSWSLSKAKPIAGAKVSVICKNYMKRVSFYKAFKTDETGYLFAELDG  99

Query  416  IVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGKDGAPL--IPTPLKLPAPYN--LY  264
                  Y       C+V LV SPL  C   TN   G  GA L  +   LK  + Y   +Y
Sbjct  100  FKMGHSYLDHPLHSCRVKLVDSPLENCDVFTNVNYGITGARLRFLDKTLK-RSNYEAVIY  158

Query  263  TVGPFAFEPSKKVLCP  216
              GPFAF P     CP
Sbjct  159  AAGPFAFRPDH---CP  171



>ref|XP_009369269.1| PREDICTED: proline-rich protein 1 [Pyrus x bretschneideri]
Length=176

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 63/129 (49%), Gaps = 10/129 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SC   G  +L  A+PI  A + + C N K  +S   +   D  G+F      
Sbjct  41   VEGVVYCQSCDRYGTSSLAGAEPIPSAKISVICKNHKGQVSFYKSFVADVKGYFYAQLEG  100

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F + + +       CKV LV SPL++CSE TN   G  GAPL     +L        +Y 
Sbjct  101  FKVGQHLLDHPLHGCKVKLVSSPLAKCSELTNVNYGLYGAPLRYEDKRLWGRNYEAVVYA  160

Query  260  VGPFAFEPS  234
             GP AF PS
Sbjct  161  AGPLAFRPS  169



>ref|XP_010067554.1| PREDICTED: proline-rich protein 1 [Eucalyptus grandis]
Length=181

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 64/127 (50%), Gaps = 10/127 (8%)
 Frame = -2

Query  584  GLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----FY  426
            G+VYC+SCKY G  +L +AKP+  A V + C N K  ++   T +T+++G+F      + 
Sbjct  46   GMVYCQSCKYFGTWSLDEAKPVGSAKVSVVCKNYKNRVTYYKTFQTEESGYFYAELKGYE  105

Query  425  MPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL---IPTPLKLPAPYNLYTVG  255
            M   +       C V LV SPL  C+  +N   G  GAPL     T  +      +Y  G
Sbjct  106  MSNPILDHPLHACHVKLVSSPLEGCNLLSNINYGMYGAPLRYEDKTLYRKEYEVVVYAAG  165

Query  254  PFAFEPS  234
            P AF PS
Sbjct  166  PLAFRPS  172



>ref|XP_004972155.1| PREDICTED: uncharacterized protein LOC101757214 [Setaria italica]
Length=171

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 62/132 (47%), Gaps = 11/132 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC--NNTKYHLSVTTKTDKNGFFLFYMP  420
            AV G+V+CK+C+Y G      A P+  A   L C  +     LSV+  TD +G FL    
Sbjct  44   AVEGVVWCKTCRYAGYVRSMDASPLPNATALLRCRRDGDPRALSVSNTTDADGCFLIQAD  103

Query  419  KIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-----IPTPLKLPAPYNLYTVG  255
               +    + CKVY+ +SP + C+        K GAPL     +P P +L A    YT G
Sbjct  104  WQSAPFKSKDCKVYVQRSPAAGCAVPVK-PAAKKGAPLKFRRFVPLPDELQA---RYTAG  159

Query  254  PFAFEPSKKVLC  219
             F F P +   C
Sbjct  160  NFTFAPEEPAKC  171



>gb|KHN31297.1| hypothetical protein glysoja_022951 [Glycine soja]
Length=174

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 61/130 (47%), Gaps = 10/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V   VYC+SC + G  +L  AKPI  A V + C +   H+S     +TDKNG+       
Sbjct  39   VEATVYCQSCDHFGTWSLIGAKPIPSAKVSVTCKSHNGHVSYYKVFETDKNGYLYAPLEG  98

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--LYT  261
            F M   +       C V  V SPL  CS  +N   G +GAPL     KL    Y   +Y 
Sbjct  99   FKMQHYILDHPLHSCYVKPVWSPLESCSLLSNVNYGLNGAPLRYENKKLHGSKYEAVIYA  158

Query  260  VGPFAFEPSK  231
             GP AF PS+
Sbjct  159  AGPLAFRPSE  168



>ref|XP_003552266.1| PREDICTED: uncharacterized protein LOC100782212 [Glycine max]
Length=174

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 61/130 (47%), Gaps = 10/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V   VYC+SC + G  +L  AKPI  A V + C +   H+S     +TDKNG+       
Sbjct  39   VEATVYCQSCDHFGTWSLIGAKPIPSAKVSVTCKSHNGHVSYYKVFETDKNGYLYAPLEG  98

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--LYT  261
            F M   +       C V  V SPL  CS  +N   G +GAPL     KL    Y   +Y 
Sbjct  99   FKMQHYILDHPLHSCYVKPVWSPLESCSLLSNVNYGLNGAPLRYENKKLHGSKYEAVIYA  158

Query  260  VGPFAFEPSK  231
             GP AF PS+
Sbjct  159  AGPLAFRPSE  168



>ref|XP_010692250.1| PREDICTED: mucin-2-like isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1963

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 58/106 (55%), Gaps = 24/106 (23%)
 Frame = -2

Query  590   VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC---------NNTKYHLSVTTKTDKNGF  438
             V+G++YC SC        Y   PIKGAV K++C         N TK+ + +T +TDKNGF
Sbjct  1742  VQGVIYCSSC--------YNNSPIKGAVAKISCESNSNNGEYNPTKFSM-LTPETDKNGF  1792

Query  437   FL-FYMPKIVSSAGYRK---CKVYLVKSPLSQCSEKTNYKLGKDGA  312
             FL  + P+ +    Y K   CKVYL  SP   C+  TN  LGK GA
Sbjct  1793  FLATFTPEQL--GTYLKPTDCKVYLESSPSYSCNVATNINLGKSGA  1836



>ref|XP_008374269.1| PREDICTED: proline-rich protein 1-like [Malus domestica]
 ref|XP_008354163.1| PREDICTED: proline-rich protein 1-like [Malus domestica]
Length=176

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 66/135 (49%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SC + G  +L +A+PI  A + + C + K  +S   +  TD  G+F      
Sbjct  41   VEGVVYCQSCDHYGTWSLTEAEPIPSAKISVICKDHKGQVSFYKSFVTDVKGYFYAQLDG  100

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
            F + + +       CKV LV SPL +C E +N   G  GAPL     +L        +Y 
Sbjct  101  FKIGQHLLDHPLHGCKVKLVSSPLEKCXELSNVNYGLYGAPLRYEDKRLWGRNYEAVVYA  160

Query  260  VGPFAFEPSKKVLCP  216
             GP AF PS    CP
Sbjct  161  AGPLAFRPSN---CP  172



>ref|XP_002528329.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34087.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 67/135 (50%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G VYC+SC + G  +L +A+PI  A V + C N    +S     +TD++G+F      
Sbjct  38   VEGKVYCQSCDHYGSWSLSEAEPIPSAKVSVICRNHLRQVSFYKAYQTDEHGYFYAQLDG  97

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN---LYT  261
            F M   +     + C V LV SP+++CS  +N   G +GAPL      L   +    +Y 
Sbjct  98   FKMGHNILDHPLQSCYVKLVSSPIAKCSLLSNVNYGINGAPLRYENKILRGSHYEAVVYA  157

Query  260  VGPFAFEPSKKVLCP  216
             GP AF P+    CP
Sbjct  158  AGPLAFRPAH---CP  169



>ref|XP_010692253.1| PREDICTED: mucin-2-like isoform X4 [Beta vulgaris subsp. vulgaris]
Length=1795

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 58/106 (55%), Gaps = 24/106 (23%)
 Frame = -2

Query  590   VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC---------NNTKYHLSVTTKTDKNGF  438
             V+G++YC SC        Y   PIKGAV K++C         N TK+ + +T +TDKNGF
Sbjct  1574  VQGVIYCSSC--------YNNSPIKGAVAKISCESNSNNGEYNPTKFSM-LTPETDKNGF  1624

Query  437   FL-FYMPKIVSSAGYRK---CKVYLVKSPLSQCSEKTNYKLGKDGA  312
             FL  + P+ +    Y K   CKVYL  SP   C+  TN  LGK GA
Sbjct  1625  FLATFTPEQL--GTYLKPTDCKVYLESSPSYSCNVATNINLGKSGA  1668



>ref|XP_010692252.1| PREDICTED: mucin-2-like isoform X3 [Beta vulgaris subsp. vulgaris]
Length=1812

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 58/106 (55%), Gaps = 24/106 (23%)
 Frame = -2

Query  590   VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC---------NNTKYHLSVTTKTDKNGF  438
             V+G++YC SC        Y   PIKGAV K++C         N TK+ + +T +TDKNGF
Sbjct  1591  VQGVIYCSSC--------YNNSPIKGAVAKISCESNSNNGEYNPTKFSM-LTPETDKNGF  1641

Query  437   FL-FYMPKIVSSAGYRK---CKVYLVKSPLSQCSEKTNYKLGKDGA  312
             FL  + P+ +    Y K   CKVYL  SP   C+  TN  LGK GA
Sbjct  1642  FLATFTPEQL--GTYLKPTDCKVYLESSPSYSCNVATNINLGKSGA  1685



>ref|XP_006646281.1| PREDICTED: uncharacterized protein LOC102722358 [Oryza brachyantha]
Length=176

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 60/131 (46%), Gaps = 23/131 (18%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V G+V+C +C+Y G      A P+  A   L C   K+ LSV   TD  G+FL    K 
Sbjct  47   GVEGVVWCNACRYAGYVKSKHASPLPNAAALLRCRRGKWALSVWGATDARGYFLIQTGKQ  106

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIP-----TPLK----LPAPYNL--  267
            V++   + C+VY+ +SP   C           G PL P     +PLK    +P P  L  
Sbjct  107  VAAFASKDCRVYVPRSPSRAC-----------GVPLQPGRRKGSPLKFREFVPLPDGLQG  155

Query  266  -YTVGPFAFEP  237
             Y+ G F F P
Sbjct  156  RYSAGNFVFGP  166



>ref|XP_010692251.1| PREDICTED: mucin-2-like isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1880

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 58/106 (55%), Gaps = 24/106 (23%)
 Frame = -2

Query  590   VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC---------NNTKYHLSVTTKTDKNGF  438
             V+G++YC SC        Y   PIKGAV K++C         N TK+ + +T +TDKNGF
Sbjct  1659  VQGVIYCSSC--------YNNSPIKGAVAKISCESNSNNGEYNPTKFSM-LTPETDKNGF  1709

Query  437   FL-FYMPKIVSSAGYRK---CKVYLVKSPLSQCSEKTNYKLGKDGA  312
             FL  + P+ +    Y K   CKVYL  SP   C+  TN  LGK GA
Sbjct  1710  FLATFTPEQL--GTYLKPTDCKVYLESSPSYSCNVATNINLGKSGA  1753



>ref|XP_007163570.1| hypothetical protein PHAVU_001G245200g [Phaseolus vulgaris]
 gb|ESW35564.1| hypothetical protein PHAVU_001G245200g [Phaseolus vulgaris]
Length=175

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 62/130 (48%), Gaps = 10/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V   VYC+SC + G  ++  AKPI  A V + C +   H+S     +TDKNG+       
Sbjct  40   VEATVYCQSCDHFGTWSMIGAKPISSAKVSVTCKSYNGHVSYYKVFETDKNGYLYAPLEG  99

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP-APYN--LYT  261
            F M   V       C V  V SPL  CS  +N   G +GAPL     +L  + Y   +Y 
Sbjct  100  FKMQHYVLDHPLHSCYVKPVWSPLESCSLLSNVNYGLNGAPLRYENKRLHGSKYEAVIYA  159

Query  260  VGPFAFEPSK  231
             GP AF PS+
Sbjct  160  AGPLAFRPSE  169



>ref|XP_008656828.1| PREDICTED: uncharacterized protein LOC103636245 [Zea mays]
 gb|AFW83786.1| hypothetical protein ZEAMMB73_366011 [Zea mays]
Length=174

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 64/131 (49%), Gaps = 11/131 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V G+V+CKSC+Y+G      A P++ A   L C + +  LSV + T+ +G+FL      
Sbjct  48   GVEGVVWCKSCRYRGYVESRDASPLRNASALLRCRHGRRALSVWSATNAHGYFLVQTGAQ  107

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKD-GAPL-----IPTPLKLPAPYNLYTVGP  252
             +    R CKVY+ +SP+  C  +     G++ G+PL     +     L A    Y+ G 
Sbjct  108  AAPFTSRNCKVYVPRSPVRGC--RVAVSPGRNKGSPLKFRRFVTRTDGLQA---RYSAGS  162

Query  251  FAFEPSKKVLC  219
            F F P  +  C
Sbjct  163  FTFAPQDRSKC  173



>ref|XP_008675090.1| PREDICTED: pistil-specific extensin-like protein [Zea mays]
 tpg|DAA57801.1| TPA: pistil-specific extensin-like protein [Zea mays]
Length=238

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V G++YCKSCK KG +    A P++GA   + C   K   +  T TD NG+FL     + 
Sbjct  111  VEGVIYCKSCKGKGYNTGIDASPLQGATAMMVCYGRKVVNATGTVTDANGYFLIMFYDMA  170

Query  410  SSAGYRKCKVYLVKSPLSQCSE  345
            S +  + CK+YLV SP  QCS+
Sbjct  171  SFSS-KTCKMYLVSSPTPQCSK  191



>ref|NP_001152656.1| pistil-specific extensin-like protein precursor [Zea mays]
 gb|ACG48776.1| pistil-specific extensin-like protein precursor [Zea mays]
Length=239

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V G++YCKSCK KG +    A P++GA   + C   K   +  T TD NG+FL     + 
Sbjct  112  VEGVIYCKSCKGKGYNTGIDASPLQGATAMMVCYGRKVVNATGTVTDANGYFLIMFYDMA  171

Query  410  SSAGYRKCKVYLVKSPLSQCSE  345
            S +  + CK+YLV SP  QCS+
Sbjct  172  SFSS-KTCKMYLVSSPTPQCSK  192



>ref|XP_002440125.1| hypothetical protein SORBIDRAFT_09g026510 [Sorghum bicolor]
 gb|EES18555.1| hypothetical protein SORBIDRAFT_09g026510 [Sorghum bicolor]
Length=172

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 65/127 (51%), Gaps = 3/127 (2%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V+G+V+CKSC+Y G      A P+ GA V L C + +  ++V  ++  +G+FL    + 
Sbjct  46   GVQGVVWCKSCRYHGYFAPMDASPLPGAKVYLRCKHGRRAVTVAGQSGASGYFLIQTSQQ  105

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPL--KLPAPYNLYTVGPFAFE  240
            VS+   ++C+VY+ +SP+  C     Y  G+ G PL       +      +Y+VG   F 
Sbjct  106  VSAFTSQQCRVYVPRSPVRACGVPA-YPSGRKGLPLKFQEFVKRGNGLQGMYSVGNRFFR  164

Query  239  PSKKVLC  219
            P  +  C
Sbjct  165  PKYRGKC  171



>gb|KHN04779.1| hypothetical protein glysoja_031879 [Glycine soja]
Length=166

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 61/130 (47%), Gaps = 10/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V   VYC+SC + G  +L  AKPI  A V + C +   H+S     +TDK+G+       
Sbjct  31   VEATVYCQSCDHFGTWSLIGAKPIPSAKVSVTCKSHNGHVSYYKVFETDKDGYLYAPLEG  90

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--LYT  261
            F M   +       C V  V SPL  CS  +N   G +GAPL     KL    Y   +Y 
Sbjct  91   FKMQHYILDHPLHSCYVKPVWSPLESCSLLSNVNYGLNGAPLRYENKKLHGSKYEAVIYA  150

Query  260  VGPFAFEPSK  231
             GP AF PS+
Sbjct  151  AGPLAFRPSE  160



>ref|XP_002458427.1| hypothetical protein SORBIDRAFT_03g033370 [Sorghum bicolor]
 gb|EES03547.1| hypothetical protein SORBIDRAFT_03g033370 [Sorghum bicolor]
Length=212

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V G++YCKSCK KG +    A P++GA   + C   K   +  T TD NG+FL  M   V
Sbjct  85   VEGVIYCKSCKGKGYNTGIDASPLQGATAMMICYGRKVVNATGTVTDANGYFLI-MFYDV  143

Query  410  SSAGYRKCKVYLVKSPLSQCSE  345
             +   R CK+YL+ SP  QCS+
Sbjct  144  KNFNARTCKMYLLSSPTPQCSK  165



>ref|XP_004308952.1| PREDICTED: proline-rich protein 3-like [Fragaria vesca subsp. 
vesca]
Length=171

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 67/134 (50%), Gaps = 13/134 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMP-  420
            V G+VYC+SC Y+G   L  AK +  A V + C N    +    T + + NG+    +  
Sbjct  37   VEGMVYCQSCDYRGWS-LTGAKSLPLAKVSVVCKNNIGQVGYYKTFQANANGYVYAELEG  95

Query  419  -KIVSSAGY--RKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--LYTV  258
             K+  +  Y  + CKV LV SPL +C+  TN   G DGA L        +P YN  +Y  
Sbjct  96   NKMNRALDYPLQNCKVKLVSSPLQKCNLATNVNFGLDGAHLRSEGKSYTSPNYNAVIYAA  155

Query  257  GPFAFEPSKKVLCP  216
            GPFAF P+    CP
Sbjct  156  GPFAFRPAH---CP  166



>ref|XP_003538478.1| PREDICTED: uncharacterized protein LOC100805413 [Glycine max]
Length=174

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 61/130 (47%), Gaps = 10/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V   VYC+SC + G  +L  AKPI  A V + C +   H+S     +TDK+G+       
Sbjct  39   VEATVYCQSCDHFGTWSLIGAKPIPSAKVSVTCKSHNGHVSYYKVFETDKDGYLYAPLEG  98

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--LYT  261
            F M   +       C V  V SPL  CS  +N   G +GAPL     KL    Y   +Y 
Sbjct  99   FKMQHYILDHPLHSCYVKPVWSPLESCSLLSNVNYGLNGAPLRYENKKLHGSKYEAVIYA  158

Query  260  VGPFAFEPSK  231
             GP AF PS+
Sbjct  159  AGPLAFRPSE  168



>ref|XP_011001570.1| PREDICTED: uncharacterized protein LOC105108781 [Populus euphratica]
Length=179

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 62/128 (48%), Gaps = 10/128 (8%)
 Frame = -2

Query  584  GLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFY-------  426
            G+VYC+SCKY G  +L +A+PI  A V + C N K  ++     + N +  FY       
Sbjct  45   GMVYCQSCKYSGSWSLTEAEPIPSAKVSVICKNFKKEVTYYKAYETNAYGYFYAQLDDFK  104

Query  425  MPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN--LYTVG  255
            M   +       C V LV S L+ CS  +N   G  GAPL     +   + Y   +Y  G
Sbjct  105  MSNNILDHPLHGCHVKLVSSALANCSLLSNVNYGLYGAPLRFENKVLRGSNYEAVIYAAG  164

Query  254  PFAFEPSK  231
            P AF+P++
Sbjct  165  PLAFQPAQ  172



>ref|XP_002273190.2| PREDICTED: pistil-specific extensin-like protein [Vitis vinifera]
 emb|CBI25443.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 63/135 (47%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SC   G  +L  A+PI  A V + C + K  +S     +TD NG+F      
Sbjct  42   VEGMVYCQSCDQFGSWSLTGAEPIPAAKVSVICKDHKDQVSFYKAFETDGNGYFYAELDG  101

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN---LYT  261
            F M   +       C V LV SPL  C+  +N   G  G+PL     +L   +    +Y 
Sbjct  102  FKMSHNILDHPLHSCHVKLVSSPLENCNLLSNVNYGLYGSPLRYENKRLFGKHYEAVIYA  161

Query  260  VGPFAFEPSKKVLCP  216
             GP AF P+    CP
Sbjct  162  AGPLAFRPAH---CP  173



>ref|XP_010233505.1| PREDICTED: pistil-specific extensin-like protein [Brachypodium 
distachyon]
Length=174

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 55/121 (45%), Gaps = 4/121 (3%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACN-NTKYHLSVTTKTDKNGFFLFYMPK  417
             V G V+C+ C+Y G D    A P+  A  +L C    K+ L  +  TD+ G F    PK
Sbjct  46   GVEGAVWCQGCRYAGYDKSKNASPLPNAAAQLLCRRGKKWALFASGSTDEGGNFRILTPK  105

Query  416  IVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL---IPTPLKLPAPYNLYTVGPFA  246
             V+    + C VY+ +SP+  C        GK G+PL      PL       +Y+ G F 
Sbjct  106  QVAPFTSKDCTVYVQRSPVGACGVALKPSGGKAGSPLKFRKFVPLSDDDLQAIYSAGEFL  165

Query  245  F  243
            F
Sbjct  166  F  166



>gb|EYU20044.1| hypothetical protein MIMGU_mgv1a014979mg [Erythranthe guttata]
Length=172

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 10/124 (8%)
 Frame = -2

Query  575  YCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMPKIVSSA  402
            +C+SC   G   L K+KPI+GA + + C + +  +S     KT KNG+F   +   V S 
Sbjct  43   HCQSCGNYGTWALSKSKPIEGATISVICKDHRNRVSFYKACKTAKNGYFYAQLKGFVMSH  102

Query  401  GY-----RKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYTVGPFA  246
             +       CKV LV SP++ C+  TN   G  GAPL     K+        +Y  GP A
Sbjct  103  SFLDHPLHACKVKLVSSPITTCNLLTNVNYGLYGAPLRYEDKKIVGTNYEAIVYAAGPLA  162

Query  245  FEPS  234
            F P+
Sbjct  163  FRPA  166



>gb|EMT11440.1| hypothetical protein F775_28378 [Aegilops tauschii]
Length=168

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 59/130 (45%), Gaps = 9/130 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V G V+CK C+Y G      A P++ A   L C   K+ LS+   TD  G+F     + 
Sbjct  43   GVEGAVWCKGCRYAGYVKSKNASPLQNAPALLRCKRGKWALSMWGATDARGYFQIQTAQQ  102

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-----IPTPLKLPAPYNLYTVGPF  249
             +    + CKVY++ SP+  C      +  K G+PL     +  P  L A   LYT G F
Sbjct  103  SAPFTSKDCKVYVLGSPVRACGVPVKPRRNK-GSPLKFRKFVTLPDGLQA---LYTAGDF  158

Query  248  AFEPSKKVLC  219
             F P K   C
Sbjct  159  VFGPKKPGKC  168



>ref|XP_010921542.1| PREDICTED: uncharacterized protein LOC105045075 [Elaeis guineensis]
Length=171

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 63/129 (49%), Gaps = 10/129 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VYC++C + G  +L  AKP+  A V +AC + K  ++       NG   FY P +
Sbjct  36   AVEGMVYCQNCAHVGSWSLAGAKPLPSAKVSIACKDHKNRVASYKAVQANGEGYFYAP-L  94

Query  413  VSSAGYR------KCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLYT  261
                 Y        C V L+ SP ++C+  TN   G +G+ L     ++ A     ++Y 
Sbjct  95   AGLEDYHVNRPTDACSVRLLSSPDARCNVLTNVNHGTEGSRLQDKNKRVMAGGYGADIYA  154

Query  260  VGPFAFEPS  234
             GP AF P+
Sbjct  155  AGPLAFRPA  163



>ref|XP_003619134.1| Pistil-specific extensin-like protein [Medicago truncatula]
 gb|AES75352.1| pollen Ole e I family allergen [Medicago truncatula]
Length=255

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 58/130 (45%), Gaps = 22/130 (17%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            AV G+VY KSC + G D L  A  + GAVVK  C+N KY   +  KT+K G+      K 
Sbjct  133  AVEGVVYVKSCHHAGFDTLKGATLLFGAVVKFQCHNAKYKFVLKAKTNKEGYIYIGSSKN  192

Query  413  VSSAGYRKCKVYLVKSP-----------LSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNL  267
            +SS     C V L  +P           L+    K+  ++   G  LI            
Sbjct  193  ISSYASGHCNVVLESAPNGLKPSNLHGGLTGAHPKSVKRIVSKGVSLI-----------R  241

Query  266  YTVGPFAFEP  237
            YTV P AFEP
Sbjct  242  YTVDPLAFEP  251



>ref|XP_002312174.1| hypothetical protein POPTR_0008s07200g [Populus trichocarpa]
 gb|EEE89541.1| hypothetical protein POPTR_0008s07200g [Populus trichocarpa]
Length=179

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 61/128 (48%), Gaps = 10/128 (8%)
 Frame = -2

Query  584  GLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFY-------  426
            G+VYC+SCKY G  +L +A+PI  A V + C N K  ++     + N +  FY       
Sbjct  45   GMVYCQSCKYSGSWSLTEAEPIPSAKVSVICKNFKKQVTYYKAYETNAYGYFYAQLDDFK  104

Query  425  MPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN--LYTVG  255
            M   +       C V L+ S L+ CS  +N   G  GAPL     +   + Y   +Y  G
Sbjct  105  MSNNILDHPLHGCHVKLISSSLANCSLLSNVNYGLYGAPLRFENKVLRGSHYEAVIYAAG  164

Query  254  PFAFEPSK  231
            P AF P++
Sbjct  165  PLAFRPAQ  172



>emb|CAN84127.1| hypothetical protein VITISV_041870 [Vitis vinifera]
Length=178

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 62/135 (46%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC SC   G  +L  A+PI  A V + C + K  +S     +TD NG+F      
Sbjct  42   VEGMVYCXSCDQFGSWSLTGAEPIPAAKVSVICKDHKDQVSFYKAFETDGNGYFYAELDG  101

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN---LYT  261
            F M   +       C V LV SPL  C+  +N   G  G+PL     +L   +    +Y 
Sbjct  102  FKMSHNILDHPLHSCHVKLVSSPLENCNLLSNVNYGLYGSPLRYENKRLFGKHYEAVIYA  161

Query  260  VGPFAFEPSKKVLCP  216
             GP AF P+    CP
Sbjct  162  AGPLAFRPAH---CP  173



>gb|EAZ10663.1| hypothetical protein OsJ_00493 [Oryza sativa Japonica Group]
Length=194

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 68/138 (49%), Gaps = 19/138 (14%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTK-----YHLSVTTKTDKNGFFL--  432
            V G VYC+SC+++   +L  A+P++GA V + C + K     + L+V    D++G+FL  
Sbjct  59   VEGKVYCQSCEHRNSWSLDGARPLRGAEVSVTCRDAKNRAAWWRLAV---ADESGYFLAE  115

Query  431  FYMPKIVSSAGYR---KCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--  270
            F + +     G      C   L+ SP  +C   TN   G  GAPL     + P   Y+  
Sbjct  116  FGVTRASDFLGADPRGACYARLLSSPDRKCDGLTNINAGMVGAPLRDEGKRWPGQGYDNV  175

Query  269  LYTVGPFAFEPSKKVLCP  216
            +Y  GP AF P+    CP
Sbjct  176  VYAAGPLAFRPAN---CP  190



>ref|XP_004969808.1| PREDICTED: pistil-specific extensin-like protein-like [Setaria 
italica]
Length=243

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V G++YCKSCK KG +    A P+ GA   + C   K   +  T TD NG+FL  M   +
Sbjct  116  VEGVIYCKSCKGKGYNTGIDASPLPGATAMMVCYGRKVVNATGTVTDGNGYFLI-MFYDM  174

Query  410  SSAGYRKCKVYLVKSPLSQCSE  345
             +   R CK+YLV SP  QC++
Sbjct  175  QNFNARTCKMYLVSSPTPQCNK  196



>dbj|BAD68108.1| hypothetical protein [Oryza sativa Japonica Group]
Length=223

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 68/138 (49%), Gaps = 19/138 (14%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTK-----YHLSVTTKTDKNGFFL--  432
            V G VYC+SC+++   +L  A+P++GA V + C + K     + L+V    D++G+FL  
Sbjct  88   VEGKVYCQSCEHRNSWSLDGARPLRGAEVSVTCRDAKNRAAWWRLAV---ADESGYFLAE  144

Query  431  FYMPKIVSSAGYR---KCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--  270
            F + +     G      C   L+ SP  +C   TN   G  GAPL     + P   Y+  
Sbjct  145  FGVTRASDFLGADPRGACYARLLSSPDRKCDGLTNINAGMVGAPLRDEGKRWPGQGYDNV  204

Query  269  LYTVGPFAFEPSKKVLCP  216
            +Y  GP AF P+    CP
Sbjct  205  VYAAGPLAFRPAN---CP  219



>ref|XP_004500509.1| PREDICTED: uncharacterized protein LOC101506005 [Cicer arietinum]
Length=175

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 61/128 (48%), Gaps = 10/128 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V   VYC+SC++ G  +L  AKPI  A V ++C   + H+S     +T+KNG+       
Sbjct  40   VETTVYCQSCEHSGTWSLTGAKPIPSAKVSVSCKTHRGHVSYYKVFETNKNGYLYAPLEG  99

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--LYT  261
            F M   +       C V  V SPL  CS  TN   G +G+PL     +L    Y   +Y 
Sbjct  100  FKMQNYILDHPLHSCYVKPVWSPLESCSLLTNVNYGLNGSPLRYDNKRLRGSNYEAVIYA  159

Query  260  VGPFAFEP  237
             GP AF P
Sbjct  160  SGPLAFHP  167



>ref|XP_003591488.1| Pistil-specific extensin-like protein [Medicago truncatula]
Length=180

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 62/134 (46%), Gaps = 18/134 (13%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACN-------NTKYHLSVTTKTDKNGFF  435
             V+GLVYCKS          K  P++GAV ++ C         TK    +   T+  G+F
Sbjct  51   GVQGLVYCKSGS--------KLIPLEGAVTRIECEAADEYGFETKPFSFLNDATNAKGYF  102

Query  434  L---FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLY  264
            L   F    +      ++C+V+L  SPL+ C+  T++  G  GA L           NLY
Sbjct  103  LATLFQQELVAEKRVLKECRVFLEASPLNNCNYPTDFNKGISGAELHSYHFLHDNKMNLY  162

Query  263  TVGPFAFEPSKKVL  222
            TVGPF F  + K +
Sbjct  163  TVGPFVFTSTPKSI  176



>ref|XP_003600960.1| hypothetical protein MTR_3g071470 [Medicago truncatula]
 gb|AES71211.1| pollen Ole e I family allergen [Medicago truncatula]
Length=168

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 60/130 (46%), Gaps = 14/130 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V   VYC++C++ G  +L  AKPI  A V + C N K H+S     +TDKNG+       
Sbjct  33   VETTVYCQTCEHSGTWSLNGAKPIPSAKVSVTCKNHKGHVSYYKVFQTDKNGYLYAQLEE  92

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-----IPTPLKLPAPYNL  267
            F M   +       C V  + SPL  CS   N   G +G+PL     I    +  A   +
Sbjct  93   FKMQHDILDHPLHACFVKPIWSPLEGCSLLANVNYGLNGSPLRYENKILRGRRYEAV--I  150

Query  266  YTVGPFAFEP  237
            Y  GP AF P
Sbjct  151  YAAGPLAFHP  160



>gb|EMT24165.1| hypothetical protein F775_00706 [Aegilops tauschii]
Length=168

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 66/131 (50%), Gaps = 11/131 (8%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHL-SVTTKTDKNGFFLFYMPK  417
             V+G+V+C++C+Y G +   +A P++GAVV L C +    L  V   T + G+F+    +
Sbjct  42   GVQGMVWCRTCRYSGYNADMEASPLQGAVVYLQCRHGPRRLKRVGGVTGQGGYFIIQSSQ  101

Query  416  IVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-----IPTPLKLPAPYNLYTVGP  252
            + S    ++CKVY+  S  + CS       GK G PL     +     L A   LY+VG 
Sbjct  102  MASFTS-KECKVYVESSSSAVCSLADQPAAGK-GLPLKFESFVKQGDGLQA---LYSVGN  156

Query  251  FAFEPSKKVLC  219
            F F PS    C
Sbjct  157  FMFRPSDPNKC  167



>gb|EAY72659.1| hypothetical protein OsI_00525 [Oryza sativa Indica Group]
Length=196

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 66/138 (48%), Gaps = 19/138 (14%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTK-----YHLSVTTKTDKNGFFLFY  426
            V G VYC+SC+++   +L  A+P++GA V + C + K     + L+V    D++G+FL  
Sbjct  61   VEGKVYCQSCEHRNSWSLDGARPLRGAEVSVTCRDAKNRAAWWRLAV---ADESGYFLAE  117

Query  425  M-----PKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--  270
                     + +     C   L+ SP  +C   TN   G  GAPL     + P   Y+  
Sbjct  118  FGVTGASDFLGADPRGACYARLLSSPDRKCDGLTNINAGMVGAPLRDEGKRWPGQGYDNV  177

Query  269  LYTVGPFAFEPSKKVLCP  216
            +Y  GP AF P+    CP
Sbjct  178  VYAAGPLAFRPAN---CP  192



>gb|EAY72647.1| hypothetical protein OsI_00513 [Oryza sativa Indica Group]
Length=189

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 66/137 (48%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK---TDKNGFFLFYMP  420
            V G+VYC+SC  +   +L  AKP+  A V + C++   H+ V  +    + NG+FL  + 
Sbjct  52   VEGMVYCQSCAQRNTHSLEGAKPLPKAEVSVICHDANNHVMVRCRRAVANDNGYFLAELD  111

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGK-DGAPLIPTPLKLPAP--YN-L  267
            +   S  Y     + C V L  SP  +C+  TN      +GAPL     +      YN +
Sbjct  112  ETKVSDFYMGDPRKACYVQLRASPDFECNNPTNINYSSIEGAPLRDEGKRWADHDYYNVM  171

Query  266  YTVGPFAFEPSKKVLCP  216
            Y  GP AF P+   +CP
Sbjct  172  YATGPLAFRPT---ICP  185



>ref|XP_010558065.1| PREDICTED: pistil-specific extensin-like protein [Tarenaya hassleriana]
Length=186

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 64/136 (47%), Gaps = 13/136 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMP  420
            AV G+VYC++C   G  +L  AKPI GA V + C N    +S     +TD +G F   + 
Sbjct  46   AVEGMVYCQACDKFGSWSLEGAKPISGAKVSVICKNHYQQVSFYKVYQTDSSGHFYAELK  105

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP-APYN--LY  264
               +S  +       C+V LV SPL  C+  +N     DG+PL     ++    Y   +Y
Sbjct  106  GFKTSPHFLDHPLHSCRVKLVSSPLEGCNLFSNINNALDGSPLRYEDKRVKWTTYEAVVY  165

Query  263  TVGPFAFEPSKKVLCP  216
              GP AF P     CP
Sbjct  166  AAGPLAFRPDH---CP  178



>dbj|BAC00573.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ22472.1| hypothetical protein OsJ_06138 [Oryza sativa Japonica Group]
Length=191

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 66/137 (48%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK---TDKNGFFLFYMP  420
            V G+VYC+SC  +   +L  AKP+  A V + C++ K  + V  +   TD NG+F   + 
Sbjct  55   VEGMVYCQSCAQRNTHSLEGAKPLPKAEVSVICHDAKNRVMVRCRRAVTDDNGYFRAELD  114

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGK-DGAPLIPTPLKLPAP--YN-L  267
            +   S  Y     + C V L  SP  +C+  TN      +GAPL     +      YN +
Sbjct  115  ETKVSDFYMGDPRKACYVRLRASPDFECNNPTNINYSSIEGAPLHDEGKRWADHDYYNVM  174

Query  266  YTVGPFAFEPSKKVLCP  216
            Y  GP AF P+   +CP
Sbjct  175  YATGPLAFRPA---ICP  188



>gb|AFW78756.1| arabinogalactan protein [Zea mays]
Length=174

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V+G+V+C +C+Y G      A P+ GA V L C +    L+V  +    G+FL    + 
Sbjct  49   GVQGVVWCNTCRYPGYFAPMDASPLPGAKVYLRCKHGLRALTVAGQCGPGGYFLIQTSQQ  108

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL  306
            VS+   ++C+VY+ +SP+  C     Y  G+ G PL
Sbjct  109  VSAFTSQQCRVYVPRSPVRACGVPA-YPAGRRGMPL  143



>ref|XP_008675692.1| PREDICTED: uncharacterized protein LOC103651770 [Zea mays]
 tpg|DAA53351.1| TPA: hypothetical protein ZEAMMB73_812537 [Zea mays]
Length=210

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 59/131 (45%), Gaps = 11/131 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK--TDKNGFFLFYMPK  417
            V GLV C+SC  +G  +L  A P+ GA V + C + K H+    +   D NG+F      
Sbjct  73   VEGLVLCQSCAARGSQSLDGAAPLPGAQVLVTCRDRKNHVMAYRRGVADHNGYFHAEFGV  132

Query  416  IVSSAGYRK-----CKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN----LY  264
              +   + K     C   L+ SP ++C+  TN   G +GAPL     +          +Y
Sbjct  133  ERADDFWAKDPRGACFARLLSSPDARCNGVTNVHGGMEGAPLRDEGKQWTDARGFRNVVY  192

Query  263  TVGPFAFEPSK  231
              GP AF P K
Sbjct  193  AAGPLAFRPGK  203



>ref|XP_004495936.1| PREDICTED: proline-rich protein 3-like [Cicer arietinum]
Length=185

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 61/126 (48%), Gaps = 17/126 (13%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACN-------NTKYHLSVTTKTDKNGFF  435
            A++GLVYCKS          K  P++GAV ++ C         T+    ++  T++ G+F
Sbjct  57   AIQGLVYCKSGS--------KLIPLEGAVTRITCEAADEFGFETRAFSFLSDATNEKGYF  108

Query  434  LFYMP--KIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLYT  261
            L  +   ++       +CK +L  SPL+ C+  T++  G  GA L           NLYT
Sbjct  109  LATLSPSEVTEKRVLNECKAFLDASPLNNCNYPTDFNKGISGAELHSYRFLHDNNINLYT  168

Query  260  VGPFAF  243
            VGPF F
Sbjct  169  VGPFLF  174



>ref|XP_004961410.1| PREDICTED: uncharacterized protein LOC101783474 [Setaria italica]
Length=166

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 0/96 (0%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V+G+V+CKSC+Y G      A P+ GA V L C + +  L+V  ++   G+FL    + 
Sbjct  39   GVQGVVWCKSCRYPGYFAPMDASPLPGAEVYLRCKHGRRALTVPGRSGPGGYFLIQTSQQ  98

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL  306
            +S+   ++C+VY+ +SP   C           G PL
Sbjct  99   MSAFTSQQCRVYVPRSPARVCGVADYPSRANKGLPL  134



>ref|XP_009631457.1| PREDICTED: proline-rich protein 1-like [Nicotiana tomentosiformis]
Length=165

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 60/129 (47%), Gaps = 10/129 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            + G+VYC+SC   G  +L +AKPI  A V + C N K  ++     + N +  FY     
Sbjct  32   IEGMVYCQSCDNYGSWSLSEAKPIAKAKVSVICKNYKKRVNFYKAFETNAYGYFYAELQG  91

Query  410  SSAGY-------RKCKVYLVKSPLSQCSEKTNYKLGKDGAPL---IPTPLKLPAPYNLYT  261
               G+         C+V LV SPL  C+  +N   G +GA L     T  +      +YT
Sbjct  92   FEMGHSYLDHPLHSCRVKLVSSPLETCNVFSNINYGLNGAKLRFEDKTIDRSDYKAVIYT  151

Query  260  VGPFAFEPS  234
             GP AF P+
Sbjct  152  AGPLAFRPT  160



>ref|XP_004307679.1| PREDICTED: uncharacterized protein LOC101312388 [Fragaria vesca 
subsp. vesca]
Length=172

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 11/130 (8%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----  432
            V G+VYC+SC + G  ++  AKPI  A V + C N K  +S     +T+ +G+F      
Sbjct  37   VEGMVYCQSCDHYGTWSMTGAKPIPSAKVSVICKNHKDQVSFYKAFQTNADGYFYAPLDG  96

Query  431  FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLK-LPAPYN--LYT  261
            F M  ++     + C V  V SPL  C   +N   G +GAPL     + + + Y   +Y+
Sbjct  97   FKMNHMLDHP-LQACHVKPVSSPLEDCRFLSNVNYGLNGAPLRYEDKRVMGSNYEAVVYS  155

Query  260  VGPFAFEPSK  231
             GP AF P  
Sbjct  156  AGPLAFRPQH  165



>ref|XP_004240229.1| PREDICTED: pistil-specific extensin-like protein [Solanum lycopersicum]
Length=170

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 63/135 (47%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            + G+VYC+SC   G  +L  AKPI  A + + C N K  ++     + N +  FY     
Sbjct  37   IEGMVYCQSCDTYGSWSLQGAKPIASAKISVICKNYKKRVNFYKAFETNEYGYFYAELQG  96

Query  410  SSAGY-------RKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN--LYT  261
               G+       + C V LV SP  +C+  +N   G +GAPL     +   + Y   +YT
Sbjct  97   YKMGHSYLDHPLQSCHVKLVNSPQEKCNVFSNINYGINGAPLRFDDKVIDRSDYKAVIYT  156

Query  260  VGPFAFEPSKKVLCP  216
             GP AF P+    CP
Sbjct  157  AGPLAFRPAD---CP  168



>emb|CDJ26671.1| unnamed protein product [Triticum aestivum]
Length=184

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 62/130 (48%), Gaps = 12/130 (9%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHL--SVTTKTDKNGFFLFYMPK  417
            V G+VYC+SC ++    L  A P+ GA V + C + K  +  S T   D NG+FL     
Sbjct  48   VEGVVYCQSCTHRNSWCLDGATPLPGAKVTVTCRDAKNRVMESRTPVADGNGYFLADF-N  106

Query  416  IVSSAGY------RKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--LY  264
            +   A Y      + C V L+ SP  +C + TN   G +GAPL     +     Y   +Y
Sbjct  107  VTEKADYYMGDPAKACFVRLLASPDRKCDDLTNVNYGIEGAPLRHEGKRWSGQGYENVVY  166

Query  263  TVGPFAFEPS  234
              GP +F+P 
Sbjct  167  AAGPLSFKPD  176



>ref|XP_008780689.1| PREDICTED: uncharacterized protein LOC103700538, partial [Phoenix 
dactylifera]
Length=103

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (54%), Gaps = 3/102 (3%)
 Frame = -2

Query  512  AVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNY  333
            AV  L CN++   ++V   TDKNG+FL    ++ +   Y KC+V+   SPLS C+     
Sbjct  1    AVAWLRCNSSGPGVTVKGTTDKNGYFLIQTNEVTNYGAY-KCRVFPGSSPLSYCNVPVYP  59

Query  332  KLGKDGAPL-IPTPLKLPAPYN-LYTVGPFAFEPSKKVLCPR  213
               + GAPL     +KL +    L+T G FAF P+K   CPR
Sbjct  60   ADQRSGAPLKFERIIKLGSGQRALHTAGAFAFAPAKGRSCPR  101



>gb|EAY72649.1| hypothetical protein OsI_00515 [Oryza sativa Indica Group]
Length=190

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 65/137 (47%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK---TDKNGFFLFYMP  420
            V G+VYC+SC  +   +L  AKP+  A V + C+N K  + V       + NG+FL  + 
Sbjct  54   VEGMVYCQSCAQRNTHSLEGAKPLPKAEVSVICHNAKNRVMVRCHRAVANDNGYFLAELD  113

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGK-DGAPLIPTPLKLPAP--YN-L  267
            +   S  Y     + C V L  SP  +C+  TN      +GAPL     +      YN +
Sbjct  114  ETKVSDFYMGDPRKACYVRLRASPDFECNNPTNINYSSIEGAPLRDEGKRWADHDYYNVM  173

Query  266  YTVGPFAFEPSKKVLCP  216
            Y  GP AF P+   +CP
Sbjct  174  YATGPLAFRPA---ICP  187



>ref|XP_008794296.1| PREDICTED: uncharacterized protein LOC103710381 [Phoenix dactylifera]
Length=175

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 64/134 (48%), Gaps = 13/134 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            + G+VYC++C + G  +L  AKP+  A V ++C + K  +S       NG   FY P + 
Sbjct  41   MEGIVYCQNCTHVGSWSLAGAKPLPSAKVSISCKDHKNRVSFYKAVQANGEGFFYAP-LA  99

Query  410  SSAGYR------KCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKL-PAPYN--LYTV  258
                Y        C V L+ SP ++C+  TN   G +GA L     ++    YN  +Y  
Sbjct  100  GLKDYHVKRPTDACLVRLLSSPDARCNVLTNVNYGIEGARLQGKNKRITTGGYNAEIYAA  159

Query  257  GPFAFEPSKKVLCP  216
            GP AF P+    CP
Sbjct  160  GPLAFRPAH---CP  170



>ref|XP_006355745.1| PREDICTED: uncharacterized protein LOC102584762 [Solanum tuberosum]
Length=167

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (47%), Gaps = 13/135 (10%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            + G+VYC+SC   G  +L  AKPI  A + + C N +  ++     + N +  FY     
Sbjct  34   IEGMVYCQSCDTYGSWSLLGAKPIASAKISVICKNYQKRVNFYKAFETNEYGYFYAELQG  93

Query  410  SSAGY-------RKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-IPTPLKLPAPYN--LYT  261
               G+       + C V LV SP  +C+  +N   G +GAPL     +   + Y   +YT
Sbjct  94   YKMGHSYLDHPLQSCHVKLVNSPQEKCNVFSNINYGINGAPLRFDDKVIDRSDYKAVIYT  153

Query  260  VGPFAFEPSKKVLCP  216
             GP AF P+    CP
Sbjct  154  AGPLAFRPTD---CP  165



>ref|XP_003536042.1| PREDICTED: proline-rich protein 3-like [Glycine max]
Length=170

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 61/129 (47%), Gaps = 17/129 (13%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTT-------KTDKNGFF  435
             ++G+VYCKS          K  P++GA+ ++AC     +   TT        TD  G+F
Sbjct  42   GIQGIVYCKSAS--------KLTPLEGALTRIACEAVDEYGFETTPFSFLSEATDSKGYF  93

Query  434  LFYM-PKIVSSAG-YRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLYT  261
            L  + P+ V   G  ++C+ +L  SPL+ CS  T+   G  GA L            LYT
Sbjct  94   LATLSPQEVEGKGVLKECRAFLDASPLNNCSYPTDVNKGISGAVLRFHRFLHDKKMKLYT  153

Query  260  VGPFAFEPS  234
            VGPF F  S
Sbjct  154  VGPFQFTAS  162



>ref|NP_001044116.1| Os01g0725900 [Oryza sativa Japonica Group]
 dbj|BAB90065.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06030.1| Os01g0725900 [Oryza sativa Japonica Group]
 gb|EAY75678.1| hypothetical protein OsI_03585 [Oryza sativa Indica Group]
Length=169

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 55/126 (44%), Gaps = 12/126 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V G V+CK+C+Y G      A P+  A   L C   K+ LSV   TD  G+FL      
Sbjct  43   GVEGAVWCKTCRYAGYVKSKDASPLPNAAALLRCRRGKWALSVWGATDARGYFLIQTGTQ  102

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL-------IPTPLKLPAPYNLYTVG  255
            V++   + C+VY+ +SP             K G+PL       +P  L+       Y+ G
Sbjct  103  VAAFTSKDCRVYVPRSPSRAACGVALQPGRKTGSPLKFRRFVALPDGLQ-----GRYSAG  157

Query  254  PFAFEP  237
             F F P
Sbjct  158  NFVFGP  163



>ref|NP_568156.1| pollen_Ole_e_I domain-containing protein [Arabidopsis thaliana]
 dbj|BAB11539.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63518.1| unknown [Arabidopsis thaliana]
 gb|ABH04452.1| At5g05500 [Arabidopsis thaliana]
 gb|AED90881.1| pollen_Ole_e_I domain-containing protein [Arabidopsis thaliana]
Length=183

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 58/136 (43%), Gaps = 13/136 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL----  432
            AV G+VYC+SC   G  +L  A+ I GA + + C N +  +S     +TD  G F     
Sbjct  44   AVEGMVYCQSCDKFGSWSLAGAEAIAGAKISIICKNHRQQVSFYKVFRTDSYGHFYGELK  103

Query  431  -FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLY  264
             F M           C+  LV SP   C+  +N     DGAPL     +L        +Y
Sbjct  104  GFKMTPHFLDHPLHSCRAKLVSSPREDCNLFSNINNALDGAPLRYEEKRLKWTNYEAVIY  163

Query  263  TVGPFAFEPSKKVLCP  216
              GP AF P     CP
Sbjct  164  AAGPLAFRPDH---CP  176



>ref|XP_011084877.1| PREDICTED: pistil-specific extensin-like protein [Sesamum indicum]
Length=175

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 10/125 (8%)
 Frame = -2

Query  575  YCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL-----FYMPK  417
            YC+SC   G  +L  AKPI+ A V + C + +  +S      TD NG+F      F M  
Sbjct  42   YCQSCNSYGSWSLTGAKPIESATVSVICKDHRNRVSFYKAFATDGNGYFYAELKGFRMSH  101

Query  416  IVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAP-YN--LYTVGPFA  246
                   + CKV LV SP+  C+  +N   G  GAPL     +L    Y   +Y  GP A
Sbjct  102  YFLDHPLQACKVKLVASPMEACNVLSNVNYGLYGAPLRYEEKRLVGSNYEAVVYAAGPLA  161

Query  245  FEPSK  231
            F P+ 
Sbjct  162  FRPAH  166



>ref|XP_010543710.1| PREDICTED: proline-rich protein 3-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010543711.1| PREDICTED: proline-rich protein 3-like isoform X2 [Tarenaya hassleriana]
Length=219

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 64/136 (47%), Gaps = 13/136 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMP  420
            AV G+VYC++C   G  +L  A+PI GA + + C N    +S     +TD NG F   + 
Sbjct  79   AVEGMVYCQACDKFGSWSLEGAEPINGAKISVICKNHYQKVSFYKVFQTDSNGHFYAELK  138

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP-APYN--LY  264
               +S  +       C+V LV SP   C+  +N     DG+PL     ++    Y   +Y
Sbjct  139  GFKTSPHFLDHPLHSCRVKLVSSPREDCNLFSNINNALDGSPLRYEDKRVKWTTYEAVVY  198

Query  263  TVGPFAFEPSKKVLCP  216
              GP AF P+    CP
Sbjct  199  ASGPLAFRPAH---CP  211



>dbj|BAC00572.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ22473.1| hypothetical protein OsJ_06139 [Oryza sativa Japonica Group]
Length=189

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 66/137 (48%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK---TDKNGFFLFYMP  420
            V G+VYC+SC  +   +L  AKP+  A V + C++ K    V  +   ++ NG+FL  + 
Sbjct  53   VEGMVYCQSCAQRNTHSLEGAKPLPKAEVSIICHDAKNRAMVRCRQAVSNDNGYFLAELD  112

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGK-DGAPLIPTPLKLPAP--YN-L  267
            +   +  Y     + C V L  SP  +C+  TN      +GAPL     +      YN +
Sbjct  113  ETKVTDFYMGDPRKACYVRLRASPDIECNNPTNINYSSIEGAPLRDEGKRWADHGYYNIM  172

Query  266  YTVGPFAFEPSKKVLCP  216
            Y  GP AF P+   +CP
Sbjct  173  YATGPLAFRPA---ICP  186



>ref|NP_001147175.1| arabinogalactan protein precursor [Zea mays]
 gb|ACG25836.1| arabinogalactan protein [Zea mays]
Length=174

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V+G+V+C +C+Y G      A P+ G+ + L C +    L+V  +    G+FL    + 
Sbjct  49   GVQGVVWCNTCRYPGYFAPMDASPLPGSKLYLRCKHGLRALTVAGQCGPGGYFLIQTSQQ  108

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL  306
            VS+   ++C+VY+ +SP+  C     Y  G+ G PL
Sbjct  109  VSAFTSQQCRVYVPRSPVRACGVPA-YPAGRRGMPL  143



>ref|XP_006644648.1| PREDICTED: pistil-specific extensin-like protein-like [Oryza 
brachyantha]
Length=219

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 5/84 (6%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFL--FYMPK  417
            V G+VYCKSCK +G ++   A P++GA V+L C   K      T TD +G+FL  FY   
Sbjct  92   VEGVVYCKSCKMRGYNSDLNASPLQGATVQLVCYGKKVVNMTGTVTDASGYFLVMFY---  148

Query  416  IVSSAGYRKCKVYLVKSPLSQCSE  345
             + +   R CKV+L  SP   C +
Sbjct  149  DLENFNARNCKVFLGSSPTPLCDK  172



>gb|EAY72654.1| hypothetical protein OsI_00520 [Oryza sativa Indica Group]
Length=191

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 65/137 (47%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK---TDKNGFFLFYMP  420
            V G+VYC+SC  +   +L  AKP+  A V + C++ K  + V  +   TD NG+F   + 
Sbjct  55   VEGMVYCQSCAQRNTHSLEGAKPLPKAEVSVICHDAKNRVMVRCRRAVTDDNGYFRAELD  114

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGK-DGAPLIPTPLKLPAP--YN-L  267
            +   S  Y     + C V L  S   +C+  TN      +GAPL     +      YN +
Sbjct  115  ETKVSDFYMGDPRKACYVRLRASSDFECNNPTNINYSSIEGAPLRDEGKRWADHDYYNVM  174

Query  266  YTVGPFAFEPSKKVLCP  216
            Y  GP AF P+   +CP
Sbjct  175  YATGPLAFRPA---ICP  188



>gb|EAY72651.1| hypothetical protein OsI_00517 [Oryza sativa Indica Group]
Length=191

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 65/137 (47%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK---TDKNGFFLFYMP  420
            V G+VYC+SC  +   +L  AKP+  A V + C++ K  + V  +   TD NG+F   + 
Sbjct  55   VEGMVYCQSCAQRNTHSLEGAKPLPKAEVSVICHDVKNRVMVRCRRAVTDDNGYFRAELD  114

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGK-DGAPLIPTPLKLPAP--YN-L  267
            +   S  Y     + C V L  S   +C+  TN      +GAPL     +      YN +
Sbjct  115  ETKVSDFYMGDPRKACYVRLRASSDFECNNPTNINYSSIEGAPLRDEGKRWADHDYYNVM  174

Query  266  YTVGPFAFEPSKKVLCP  216
            Y  GP AF P+   +CP
Sbjct  175  YATGPLAFRPA---ICP  188



>gb|EMT03252.1| hypothetical protein F775_04159 [Aegilops tauschii]
Length=182

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 52/103 (50%), Gaps = 9/103 (9%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHL--SVTTKTDKNGFFLFYMPK  417
            V G+VYC+SC ++    L  A P+ GA V + C + K  +  S T   D NG+FL     
Sbjct  46   VEGMVYCQSCTHRNSWCLDGATPLPGAKVTVTCRDAKNRVMESRTPVADGNGYFLAEF-D  104

Query  416  IVSSAGYRK------CKVYLVKSPLSQCSEKTNYKLGKDGAPL  306
            +   A Y K      C V L+ SP  +C + TN   G +GAPL
Sbjct  105  VAEKADYYKGDPAKACFVRLLASPDRKCDDLTNVNYGIEGAPL  147



>ref|XP_009387000.1| PREDICTED: uncharacterized protein LOC103974010 [Musa acuminata 
subsp. malaccensis]
Length=194

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 56/129 (43%), Gaps = 9/129 (7%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFLFYMP  420
            AV GLV C+ C   G   L  ++ +  A V + C + +  + +      D NG+    + 
Sbjct  59   AVEGLVSCQDCASVGTWELAGSRRLPAARVGITCKDHRGRVVLYRAATADDNGYVFAELY  118

Query  419  KIVSSAGY----RKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPY---NLYT  261
                  GY      C V L+ SP  +CS  T+   G  G PL      +P  Y   ++Y 
Sbjct  119  TTTMRGGYFDPAESCAVRLLVSPDDRCSSVTDVNGGDRGTPLRYQNTTIPGQYADLDVYV  178

Query  260  VGPFAFEPS  234
             GP AF+P+
Sbjct  179  AGPLAFKPA  187



>emb|CDM84204.1| unnamed protein product [Triticum aestivum]
Length=197

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V+G++YCKSCK +G +    A PI+GA V L C   K      T +D++G+FL  M   +
Sbjct  69   VQGVIYCKSCKSRGYNRGMDASPIQGATVNLVCYGRKVVNVTATVSDEHGYFLV-MFYDL  127

Query  410  SSAGYRKCKVYLVKSPLSQCSE  345
            ++   R CK+YL  SP   C +
Sbjct  128  ANFNARTCKLYLGTSPTPLCDK  149



>gb|EAY72650.1| hypothetical protein OsI_00516 [Oryza sativa Indica Group]
Length=190

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 64/137 (47%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK---TDKNGFFLFYMP  420
            V G+VYC+SC  +   +L  AKP+  A V + C++ K    V  +    D NG+F   + 
Sbjct  54   VEGMVYCQSCAQRNTHSLEGAKPLPKAEVSVICHDAKNRAIVRCRRAVADDNGYFRAELD  113

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGK-DGAPLIPTPLKLPAP--YN-L  267
            +   S  Y     + C V L  SP  +C+  TN      +GAPL     +      YN +
Sbjct  114  ETNVSDFYMGDPRKACYVRLRASPDFECNNPTNINYSSIEGAPLRDEGKRWADHDYYNIM  173

Query  266  YTVGPFAFEPSKKVLCP  216
            Y  GP AF P+   +CP
Sbjct  174  YAAGPLAFRPA---ICP  187



>ref|XP_009386691.1| PREDICTED: pistil-specific extensin-like protein [Musa acuminata 
subsp. malaccensis]
Length=190

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 61/128 (48%), Gaps = 6/128 (5%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
            A  G++YC+ CK           P+ GAVV L C + +   +   +TD +G+F +   ++
Sbjct  62   AAEGVIYCR-CKLPRYSKAVDGAPLPGAVVLLKCGSQRTVWAAKGRTDTHGYF-YLQTQL  119

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYN---LYTVGPFAF  243
               +  R C+V+++ SP+  C     Y L   GA L+    KL   YN   LYT G F F
Sbjct  120  KYKSLSRTCRVFVLWSPVGPCQVPRRYGLKGPGASLM-FERKLSDGYNTIALYTAGFFEF  178

Query  242  EPSKKVLC  219
             P K   C
Sbjct  179  GPVKSSKC  186



>ref|XP_002458425.1| hypothetical protein SORBIDRAFT_03g033350 [Sorghum bicolor]
 gb|EES03545.1| hypothetical protein SORBIDRAFT_03g033350 [Sorghum bicolor]
Length=168

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (49%), Gaps = 1/96 (1%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V G+V+CKSC+Y G      A P++ A V L C +    LSV   T+  G+FL      
Sbjct  43   GVEGVVWCKSCRYPGYVESRDASPLRNASVLLRCRHGHRALSVWNTTNAQGYFLIQTGTQ  102

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPL  306
             +      CKVY+ +SP   C    + +  K G+PL
Sbjct  103  AAPFTSNNCKVYVPRSPARGCRVAVSPRR-KKGSPL  137



>gb|AFK49503.1| unknown [Lotus japonicus]
Length=175

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 59/129 (46%), Gaps = 17/129 (13%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC-NNTKYHLSVT------TKTDKNGFF  435
            A++GLVYCKS          K  P++GA+ ++ C    +Y    T        TD  G+F
Sbjct  54   AIQGLVYCKSGS--------KLIPLEGALTRITCVAADEYGFETTPLSFLSEATDTKGYF  105

Query  434  LFYM--PKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLYT  261
            L  M    +      ++C+ +L  SP + CS+ ++   G  GA L           NLYT
Sbjct  106  LATMCPLDVAEKRVLKECRAFLEASPWNNCSDPSDINKGISGAVLHSYRFLHDKNMNLYT  165

Query  260  VGPFAFEPS  234
            VGPF F  S
Sbjct  166  VGPFLFTSS  174



>gb|KHN30673.1| Pistil-specific extensin-like protein [Glycine soja]
Length=170

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 61/129 (47%), Gaps = 17/129 (13%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTT-------KTDKNGFF  435
             ++G+VYCKS          K  P++GA+ +++C     +   TT        TD  G+F
Sbjct  42   GIQGIVYCKSAS--------KLTPLEGALTRISCEAVDEYGFETTPFSFLSEATDSKGYF  93

Query  434  LFYM-PKIVSSAG-YRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLYT  261
            L  + P+ V   G  ++C+ +L  SPL+ CS  T+   G  GA L            LYT
Sbjct  94   LATLSPQEVEGKGVLKECRAFLDASPLNNCSYPTDVNKGISGAVLRFHRFLHDKKMKLYT  153

Query  260  VGPFAFEPS  234
            VGPF F  S
Sbjct  154  VGPFLFTAS  162



>gb|EAZ13398.1| hypothetical protein OsJ_03318 [Oryza sativa Japonica Group]
Length=155

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (52%), Gaps = 0/77 (0%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKI  414
             V G V+CK+C+Y G      A P+  A   L C   K+ LSV   TD  G+FL      
Sbjct  43   GVEGAVWCKTCRYAGYVKSKDASPLPNAAALLRCRRGKWALSVWGATDARGYFLIQTGTQ  102

Query  413  VSSAGYRKCKVYLVKSP  363
            V++   + C+VY+ +SP
Sbjct  103  VAAFTSKDCRVYVPRSP  119



>ref|XP_010675451.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=650

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 17/105 (16%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC---NNTKYHLS----VTTKTDKNGFFL  432
            V+G++YC SC        Y   PI+GAV K++C   +  +Y  +    +T K+DKNG+FL
Sbjct  401  VQGVIYCNSC--------YDFTPIEGAVAKISCEAKSTDQYKAAKFSMLTPKSDKNGYFL  452

Query  431  --FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLI  303
              F   ++  +     CKVYL  SP   C+  TN  LG  GAPL 
Sbjct  453  ATFTPEQLGDNLKPTDCKVYLESSPSYTCNVATNVNLGVTGAPLT  497



>ref|XP_010675452.1| PREDICTED: DNA-directed RNA polymerase II subunit RPB1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=640

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 17/105 (16%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC---NNTKYHLS----VTTKTDKNGFFL  432
            V+G++YC SC        Y   PI+GAV K++C   +  +Y  +    +T K+DKNG+FL
Sbjct  391  VQGVIYCNSC--------YDFTPIEGAVAKISCEAKSTDQYKAAKFSMLTPKSDKNGYFL  442

Query  431  --FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLI  303
              F   ++  +     CKVYL  SP   C+  TN  LG  GAPL 
Sbjct  443  ATFTPEQLGDNLKPTDCKVYLESSPSYTCNVATNVNLGVTGAPLT  487



>ref|XP_010675453.1| PREDICTED: adhesive plaque matrix protein-like isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=633

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 17/105 (16%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLAC---NNTKYHLS----VTTKTDKNGFFL  432
            V+G++YC SC        Y   PI+GAV K++C   +  +Y  +    +T K+DKNG+FL
Sbjct  384  VQGVIYCNSC--------YDFTPIEGAVAKISCEAKSTDQYKAAKFSMLTPKSDKNGYFL  435

Query  431  --FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLI  303
              F   ++  +     CKVYL  SP   C+  TN  LG  GAPL 
Sbjct  436  ATFTPEQLGDNLKPTDCKVYLESSPSYTCNVATNVNLGVTGAPLT  480



>gb|EMT12113.1| hypothetical protein F775_09231 [Aegilops tauschii]
Length=181

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 60/130 (46%), Gaps = 12/130 (9%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHL--SVTTKTDKNGFFLFYMPK  417
            V G+VYC+SC ++    L  A  + GA V + C + K  +  S T   D NG+FL     
Sbjct  45   VEGVVYCQSCTHRNSWCLDGATALPGAKVTVTCRDAKNRVMESRTPVADGNGYFLAEF-D  103

Query  416  IVSSAGYRK------CKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPA---PYNLY  264
            +   A Y K      C V L+ SP  +C + TN   G +GAPL     +         +Y
Sbjct  104  VAEKADYYKGDPAKACFVRLLASPDRKCDDLTNVNYGIEGAPLRHEGKRWSGKGYENVVY  163

Query  263  TVGPFAFEPS  234
              GP +F+P 
Sbjct  164  AAGPLSFKPD  173



>ref|XP_007050998.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOX95155.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=237

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 60/131 (46%), Gaps = 17/131 (13%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACN-------NTKYHLSVTTKTDKNGFF  435
             ++GLVYC+S          +  P++GAV ++ C         T+    ++  TD  G+F
Sbjct  106  GIQGLVYCRSGS--------QFIPLEGAVARITCQGVDKYGYETESFSILSCATDAKGYF  157

Query  434  LFYMP--KIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLPAPYNLYT  261
            +  +   ++  S   R+CK +L  SP   C   T+   G  GAPL    L       L+T
Sbjct  158  IATVSPYEVKDSRRLRECKAFLELSPSDACDVPTDVNQGITGAPLASYHLLHDKNMKLFT  217

Query  260  VGPFAFEPSKK  228
            VGPF F P K 
Sbjct  218  VGPFFFIPQKD  228



>dbj|BAK03568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=202

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTKTDKNGFFLFYMPKIV  411
            V+G++YCKSCK +G +    A PI+GA V L C   K      T +D++G+FL  M   +
Sbjct  74   VQGVIYCKSCKSRGYNRGMDASPIQGATVHLVCYGKKVVNVSATVSDEHGYFLV-MFYDL  132

Query  410  SSAGYRKCKVYLVKSPLSQCSE  345
             +   R CK+YL  SP   C +
Sbjct  133  DNFNARNCKMYLGTSPTPLCDK  154



>gb|EAY72653.1| hypothetical protein OsI_00519 [Oryza sativa Indica Group]
Length=190

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 64/137 (47%), Gaps = 15/137 (11%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVTTK---TDKNGFFLFYMP  420
            V G+VYC+SC  +   +L   KP+  A V + C++ K    V  +    + NG+FL  + 
Sbjct  54   VEGMVYCQSCMQRNTHSLEGGKPLPKAEVSVICHDAKNRAMVRCRRAVANDNGYFLAELD  113

Query  419  KIVSSAGY-----RKCKVYLVKSPLSQCSEKTNYKLGK-DGAPLIPTPLKLPAP--YN-L  267
            +   S  Y     + C V L  SP  +C+  TN      +GAPL     +      YN +
Sbjct  114  ETKVSDFYMGDPRKACYVRLRASPDIECNNPTNINYSSIEGAPLRDEGKRWADHGYYNVM  173

Query  266  YTVGPFAFEPSKKVLCP  216
            Y  GP AF P+   +CP
Sbjct  174  YATGPLAFRPA---ICP  187



>ref|XP_010491082.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=180

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 58/136 (43%), Gaps = 13/136 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL----  432
            AV G+VYC+SC   G  +L  A+ I GA V + C N +  +S     KTD  G F     
Sbjct  41   AVEGMVYCQSCDKFGSWSLAGAEAIAGAKVSIICKNHREQVSFYKVFKTDSYGHFYGELK  100

Query  431  -FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP-APYN--LY  264
             F M           C+  LV SP   C+  +N     DGA L     +L    Y   +Y
Sbjct  101  GFKMTPHFLDHPLHSCRAKLVSSPREDCNLFSNINNALDGASLRYEEKRLKWTNYEAVVY  160

Query  263  TVGPFAFEPSKKVLCP  216
              GP AF P     CP
Sbjct  161  AAGPLAFRPDH---CP  173



>ref|XP_006655512.1| PREDICTED: pistil-specific extensin-like protein-like [Oryza 
brachyantha]
Length=193

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 50/99 (51%), Gaps = 13/99 (13%)
 Frame = -2

Query  590  VRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSVT-TKTDKNGFFLFYMPKI  414
            V+G +YCKSCK  G +    A P+  A  +L C      L++T T+TDKNG+FL  M   
Sbjct  59   VQGTIYCKSCKLSGYNRYMDASPLPNATAELVCYGADRVLNLTSTRTDKNGYFLV-MVYD  117

Query  413  VSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPT  297
            +      +C+VYL  SP   C+           AP IP+
Sbjct  118  LGMFQRSRCRVYLGSSPTPLCA-----------APFIPS  145



>ref|XP_010423467.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
 ref|XP_010452454.1| PREDICTED: pistil-specific extensin-like protein [Camelina sativa]
Length=182

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 59/136 (43%), Gaps = 13/136 (10%)
 Frame = -2

Query  593  AVRGLVYCKSCKYKGVDNLYKAKPIKGAVVKLACNNTKYHLSV--TTKTDKNGFFL----  432
            AV G+VYC+SC   G  +L  A+ I GA V + C N +  +S     KTD  G F     
Sbjct  43   AVEGMVYCQSCDKFGSWSLAGAEAIAGAKVSIICKNHREQVSFYKVFKTDSYGHFYGELK  102

Query  431  -FYMPKIVSSAGYRKCKVYLVKSPLSQCSEKTNYKLGKDGAPLIPTPLKLP-APYN--LY  264
             F M     +     C+  LV SP   C+  +N     DGA L     +L    Y   +Y
Sbjct  103  GFKMTPHFLNHPLHSCRAKLVSSPREDCNLFSNINNALDGASLRYEEKRLKWTNYEAVVY  162

Query  263  TVGPFAFEPSKKVLCP  216
              GP AF P     CP
Sbjct  163  AAGPLAFRPDH---CP  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1536719273000