BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26704_g1_i1 len=1742 path=[1:0-1741]

Length=1742
                                                                      Score     E

sp|Q53UH4.1|DUSKY_IPONI  RecName: Full=Anthocyanidin 3-O-glucosid...    850   0.0      Ipomoea nil [qian niu]
sp|Q53UH5.1|DUSKY_IPOPU  RecName: Full=Anthocyanidin 3-O-glucosid...    849   0.0      Ipomoea purpurea
gb|AHJ60266.1|  anthocyanidin 3-O-glucoside-2''-O-glucosyltransfe...    848   0.0      
dbj|BAD95885.1|  glucosyltransferase                                    822   0.0      Ipomoea nil [qian niu]
dbj|BAD95884.1|  glucosyltransferase                                    822   0.0      Ipomoea nil [qian niu]
gb|ABL74480.1|  glucosyltransferase                                     812   0.0      Ipomoea batatas [batate]
ref|XP_006449435.1|  hypothetical protein CICLE_v10015186mg             516   6e-175   
ref|XP_006467704.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    510   8e-173   
ref|XP_003539949.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    508   4e-172   
gb|KHN41619.1|  UDP-glycosyltransferase 79B6                            504   2e-170   
ref|XP_006449434.1|  hypothetical protein CICLE_v10017784mg             500   1e-168   
ref|XP_007025500.1|  UDP-Glycosyltransferase superfamily protein        499   2e-168   
ref|XP_007132682.1|  hypothetical protein PHAVU_011G115700g             498   3e-168   
gb|KHN07772.1|  UDP-glycosyltransferase 79B6                            498   7e-168   
ref|XP_007213494.1|  hypothetical protein PRUPE_ppa022356mg             497   9e-168   
ref|XP_003526249.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    497   1e-167   
ref|XP_004304716.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       497   1e-167   
ref|XP_010262362.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    497   3e-167   
ref|XP_004485850.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       496   3e-167   
ref|XP_003607531.1|  Glucosyltransferase                                496   4e-167   
ref|XP_007025501.1|  UDP-Glycosyltransferase superfamily protein        494   1e-166   
gb|AES89730.2|  UDP-glucosyltransferase family protein                  493   4e-166   
ref|XP_010111152.1|  UDP-glycosyltransferase                            491   3e-165   
gb|KDO77743.1|  hypothetical protein CISIN_1g039043mg                   489   6e-165   
ref|XP_010035826.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    489   1e-164   
ref|XP_002522508.1|  UDP-glucosyltransferase, putative                  488   5e-164   Ricinus communis
ref|XP_004499897.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       488   5e-164   
ref|XP_008245371.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    487   1e-163   
ref|XP_007213460.1|  hypothetical protein PRUPE_ppa024453mg             484   7e-163   
ref|XP_010035825.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    485   7e-163   
ref|XP_003607533.1|  Glucosyltransferase                                487   2e-162   
gb|KDP21029.1|  hypothetical protein JCGZ_21500                         483   2e-162   
ref|XP_007132838.1|  hypothetical protein PHAVU_011G128700g             483   2e-162   
gb|ACU24192.1|  unknown                                                 483   4e-162   Glycine max [soybeans]
ref|XP_003593675.1|  Anthocyanidin 3-O-glucosyltransferase              483   4e-162   
gb|KHN36711.1|  UDP-glycosyltransferase 79B6                            482   1e-161   
ref|XP_011045872.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    481   4e-161   
ref|XP_008371703.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    479   9e-161   
ref|XP_007132927.1|  hypothetical protein PHAVU_011G136700g             479   9e-161   
ref|XP_004307624.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       477   6e-160   
ref|XP_004505528.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       475   6e-159   
ref|XP_008465522.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    475   1e-158   
ref|XP_010277785.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    474   1e-158   
ref|XP_009353146.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    473   3e-158   
ref|XP_007132923.1|  hypothetical protein PHAVU_011G136400g             471   1e-157   
ref|XP_008371430.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    471   2e-157   
ref|XP_004144610.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       469   1e-156   
ref|XP_003530810.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    469   2e-156   
ref|XP_004169305.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    468   7e-156   
ref|XP_006377437.1|  hypothetical protein POPTR_0011s05910g             464   4e-155   
ref|XP_008455479.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    464   2e-154   
ref|XP_003540019.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    462   3e-154   
emb|CDO96715.1|  unnamed protein product                                459   6e-153   
gb|ADV71366.1|  glycosyltransferase GT10J15                             459   7e-153   
ref|XP_008455481.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    450   4e-149   
gb|AFK39154.1|  unknown                                                 448   1e-148   
ref|XP_007149722.1|  hypothetical protein PHAVU_005G093600g             448   1e-148   
ref|XP_004144602.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       446   9e-148   
ref|XP_010686377.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    446   9e-148   
gb|KHN27959.1|  UDP-glycosyltransferase 79B3                            446   1e-147   
ref|XP_004487587.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       445   2e-147   
ref|XP_008383670.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    444   6e-147   
ref|XP_003543300.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    444   7e-147   
ref|XP_003540412.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    444   7e-147   
ref|XP_003596670.1|  Anthocyanidin 3-O-glucosyltransferase              442   2e-146   
ref|XP_003596668.1|  Anthocyanidin 3-O-glucosyltransferase              442   4e-146   
ref|XP_003596675.1|  Anthocyanidin 3-O-glucosyltransferase              442   4e-146   
gb|AFK34819.1|  unknown                                                 442   5e-146   
gb|AES66927.2|  UDP-glucosyltransferase family protein                  441   7e-146   
ref|XP_004487588.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       440   2e-145   
ref|XP_011087015.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    439   6e-145   
ref|XP_004487585.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       436   1e-143   
ref|XP_008455478.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    435   3e-143   
ref|XP_004487586.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       434   4e-143   
ref|XP_004487589.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       433   1e-142   
ref|XP_004487584.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       432   2e-142   
ref|XP_008349217.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    432   3e-142   
ref|XP_003596667.1|  Anthocyanidin 3-O-glucosyltransferase              432   4e-142   
ref|XP_010093489.1|  UDP-glycosyltransferase                            431   6e-142   
gb|AES66918.2|  UDP-glucosyltransferase family protein                  431   1e-141   
ref|XP_009352835.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    427   3e-140   
ref|XP_006373006.1|  hypothetical protein POPTR_0017s06940g             423   1e-139   
ref|XP_009352834.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    425   2e-139   
ref|XP_007132948.1|  hypothetical protein PHAVU_011G138500g             424   2e-139   
ref|XP_004144600.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       424   3e-139   
ref|XP_004248461.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    423   9e-139   
gb|AES66921.2|  UDP-glucosyltransferase family protein                  421   3e-138   
gb|AES66919.2|  UDP-glucosyltransferase family protein                  421   4e-138   
ref|XP_003543299.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    420   1e-137   
ref|XP_002282825.3|  PREDICTED: UDP-glycosyltransferase 79B6-like       420   2e-137   Vitis vinifera
gb|EYU43362.1|  hypothetical protein MIMGU_mgv1a019428mg                419   2e-137   
ref|XP_003596671.1|  Anthocyanidin 3-O-glucosyltransferase              417   1e-136   
gb|KGN43487.1|  hypothetical protein Csa_7G041320                       416   5e-136   
ref|XP_004144601.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       416   6e-136   
ref|XP_004164964.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       416   7e-136   
ref|XP_004301656.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       415   1e-135   
ref|XP_007149716.1|  hypothetical protein PHAVU_005G093300g             415   2e-135   
gb|KHN36713.1|  UDP-glycosyltransferase 79B6                            414   2e-135   
gb|KHN27960.1|  UDP-glycosyltransferase 79B3                            416   2e-135   
ref|XP_007132949.1|  hypothetical protein PHAVU_011G138600g             414   4e-135   
ref|XP_010062848.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    413   5e-135   
ref|XP_010260356.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    414   7e-135   
ref|XP_010245594.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    413   8e-135   
ref|XP_010062847.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    411   3e-134   
ref|XP_010260530.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    411   5e-134   
gb|EYU28028.1|  hypothetical protein MIMGU_mgv1a006231mg                410   1e-133   
ref|XP_009767952.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    410   2e-133   
emb|CDP05961.1|  unnamed protein product                                409   3e-133   
ref|XP_010041982.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    409   4e-133   
ref|XP_010666234.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    408   6e-133   
ref|XP_009610402.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    407   1e-132   
gb|KCW69984.1|  hypothetical protein EUGRSUZ_F03295                     405   6e-132   
ref|XP_004293911.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       405   8e-132   
ref|XP_007021598.1|  UDP-Glycosyltransferase superfamily protein        405   1e-131   
gb|KCW69983.1|  hypothetical protein EUGRSUZ_F03293                     404   3e-131   
ref|XP_002523261.1|  UDP-glucosyltransferase, putative                  403   5e-131   Ricinus communis
ref|NP_200217.1|  anthocyanidin 3-O-glucoside 2'''-O-xylosyltrans...    403   6e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866015.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase      402   2e-130   
ref|XP_006593292.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    398   9e-130   
ref|XP_010695817.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    398   3e-129   
ref|XP_006281777.1|  hypothetical protein CARUB_v10027945mg             399   4e-129   
ref|XP_007021621.1|  UDP-Glycosyltransferase superfamily protein        399   6e-128   
ref|XP_006401632.1|  hypothetical protein EUTSA_v10013471mg             395   8e-128   
ref|XP_010093983.1|  UDP-glycosyltransferase                            394   2e-127   
ref|XP_007021619.1|  UDP-Glycosyltransferase superfamily protein        395   3e-127   
gb|KDO77744.1|  hypothetical protein CISIN_1g017557mg                   390   4e-127   
gb|AEM37037.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase 2         394   4e-127   
gb|AEM37036.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase 1         393   6e-127   
ref|XP_006361070.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    392   7e-127   
ref|XP_010520927.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    391   4e-126   
ref|XP_010474328.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    388   4e-125   
emb|CAN63557.1|  hypothetical protein VITISV_034121                     387   4e-125   Vitis vinifera
ref|XP_009339314.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       387   6e-125   
ref|XP_010098447.1|  UDP-glycosyltransferase                            387   9e-125   
gb|KDP36254.1|  hypothetical protein JCGZ_09819                         385   3e-124   
ref|XP_010482811.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    386   3e-124   
ref|XP_008355387.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       385   6e-124   
dbj|BAF75891.1|  glucosyltransferase                                    384   2e-123   Dianthus caryophyllus [carnation]
ref|XP_003527222.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       380   3e-122   
ref|XP_006281795.1|  hypothetical protein CARUB_v10027966mg             380   4e-122   
ref|XP_002866013.1|  glycosyltransferase family protein                 380   4e-122   
ref|NP_200212.1|  UDP-glycosyltransferase 79B6                          379   6e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27016.1|  hypothetical protein AALP_AA8G323600                    379   7e-122   
ref|XP_010442979.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    379   1e-121   
gb|KDO58530.1|  hypothetical protein CISIN_1g012080mg                   379   3e-121   
ref|XP_010442976.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    378   3e-121   
ref|XP_006451768.1|  hypothetical protein CICLE_v10008184mg             378   3e-121   
ref|XP_006401633.1|  hypothetical protein EUTSA_v10013535mg             376   1e-120   
ref|XP_008226432.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       377   2e-120   
gb|AFJ52975.1|  UDP-glycosyltransferase 1                               376   2e-120   
ref|XP_002316802.1|  glycosyltransferase family protein                 375   3e-120   Populus trichocarpa [western balsam poplar]
ref|XP_011008292.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    375   6e-120   
ref|XP_003596676.1|  Anthocyanidin 3-O-glucosyltransferase              372   8e-120   
ref|XP_010537036.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       374   8e-120   
ref|XP_008226430.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       375   1e-119   
gb|AFJ52978.1|  UDP-glycosyltransferase 1                               374   1e-119   
ref|XP_010674067.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       372   5e-119   
ref|XP_009132454.1|  PREDICTED: UDP-glycosyltransferase 79B6            372   7e-119   
gb|KHN13063.1|  UDP-glycosyltransferase 79B3                            372   8e-119   
ref|XP_002282717.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       371   1e-118   Vitis vinifera
ref|XP_010446338.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    371   1e-118   
ref|XP_008386210.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       372   1e-118   
ref|XP_003634640.2|  PREDICTED: UDP-glycosyltransferase 79B9-like       370   3e-118   
ref|XP_010675464.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       368   2e-117   
ref|XP_007213912.1|  hypothetical protein PRUPE_ppa005654mg             368   2e-117   
ref|XP_002866011.1|  glycosyltransferase family protein                 367   4e-117   
ref|XP_009340538.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       367   6e-117   
ref|NP_194487.1|  UDP-glycosyltransferase 79B3                          367   7e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30258.1|  hypothetical protein AALP_AA7G237800                    365   2e-116   
ref|XP_002867497.1|  glycosyltransferase family protein                 364   6e-116   
ref|NP_194486.1|  UDP-glycosyltransferase 79B2                          364   7e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008350006.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    363   2e-115   
ref|XP_004146274.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       363   2e-115   
ref|XP_008226434.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       362   3e-115   
ref|XP_009127123.1|  PREDICTED: UDP-glycosyltransferase 79B10-like      362   3e-115   
ref|XP_010644165.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       362   4e-115   
ref|XP_009132456.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       361   7e-115   
ref|NP_189604.1|  UDP-glycosyltransferase 79B4                          361   8e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386212.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    362   8e-115   
ref|XP_004166346.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    362   9e-115   
gb|KGN57635.1|  hypothetical protein Csa_3G236030                       363   1e-114   
gb|AAM65481.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamnosylt...    360   1e-114   Arabidopsis thaliana [mouse-ear cress]
emb|CDY65923.1|  BnaCnng49110D                                          360   2e-114   
emb|CDY28802.1|  BnaA02g09940D                                          360   2e-114   
ref|XP_011082711.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    360   3e-114   
dbj|BAE99810.1|  putative flavonol 3-O-glucosyltransferase              359   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009340549.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       360   3e-114   
ref|NP_200210.1|  UDP-glycosyltransferase 79B9                          358   6e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006361401.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    359   8e-114   
ref|XP_010446327.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       358   1e-113   
ref|XP_008226433.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       357   1e-113   
emb|CAN63797.1|  hypothetical protein VITISV_026414                     357   3e-113   Vitis vinifera
ref|XP_011082713.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    357   4e-113   
ref|XP_008456016.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    357   8e-113   
ref|XP_010442973.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       355   1e-112   
ref|XP_010446317.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       355   2e-112   
gb|AAL09791.1|  AT4g27560/T29A15_50                                     355   3e-112   Arabidopsis thaliana [mouse-ear cress]
emb|CDY03578.1|  BnaC03g68370D                                          354   4e-112   
ref|XP_010482808.1|  PREDICTED: UDP-glycosyltransferase 79B9            353   6e-112   
ref|XP_006397072.1|  hypothetical protein EUTSA_v10028656mg             353   8e-112   
ref|XP_004236775.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    353   2e-111   
ref|XP_010442978.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    350   4e-111   
ref|XP_010433351.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    350   1e-110   
ref|XP_009628388.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    349   3e-110   
ref|NP_176672.1|  UDP-glycosyltransferase 79B11                         349   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176671.1|  UDP-glycosyltransferase 79B10                         348   9e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285228.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       347   2e-109   Vitis vinifera
ref|XP_009107252.1|  PREDICTED: UDP-glycosyltransferase 79B5-like       347   2e-109   
emb|CAN63555.1|  hypothetical protein VITISV_034119                     347   3e-109   Vitis vinifera
ref|XP_006401636.1|  hypothetical protein EUTSA_v10013536mg             346   5e-109   
ref|XP_010421894.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       346   6e-109   
emb|CDY59372.1|  BnaA08g29640D                                          345   1e-108   
ref|XP_002888294.1|  glycosyltransferase family protein                 345   1e-108   
ref|XP_010448113.1|  PREDICTED: UDP-glycosyltransferase 79B3-like...    345   2e-108   
ref|XP_006282036.1|  hypothetical protein CARUB_v10028277mg             343   3e-108   
ref|XP_004238162.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       343   9e-108   
ref|XP_010446347.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    341   1e-107   
ref|XP_002285222.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       342   2e-107   Vitis vinifera
gb|EPS58858.1|  glucosyltransferase                                     341   4e-107   
gb|KFK35925.1|  hypothetical protein AALP_AA4G054400                    340   7e-107   
ref|XP_010319271.1|  PREDICTED: UDP-glycosyltransferase 79B8 isof...    342   7e-107   
ref|XP_006287748.1|  hypothetical protein CARUB_v10000959mg             340   9e-107   
ref|XP_006286630.1|  hypothetical protein CARUB_v10002468mg             340   1e-106   
ref|XP_004236774.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    342   1e-106   
emb|CBI20246.3|  unnamed protein product                                339   1e-106   
ref|XP_002872446.1|  glycosyltransferase family protein                 339   1e-106   
ref|NP_179877.1|  UDP-glycosyltransferase 79B8                          339   1e-106   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98680.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamnosyl...    339   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496151.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       338   3e-106   
gb|AFJ52976.1|  UDP-glycosyltransferase 1                               339   5e-106   
ref|XP_010438412.1|  PREDICTED: UDP-glycosyltransferase 79B8            337   8e-106   
ref|XP_010479520.1|  PREDICTED: UDP-glycosyltransferase 79B5            337   1e-105   
gb|EYU44977.1|  hypothetical protein MIMGU_mgv1a006277mg                337   1e-105   
ref|XP_011096374.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    338   1e-105   
emb|CDP05960.1|  unnamed protein product                                337   1e-105   
ref|XP_010421892.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       337   1e-105   
ref|XP_010437944.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       337   2e-105   
gb|EYU41034.1|  hypothetical protein MIMGU_mgv1a006102mg                336   4e-105   
ref|XP_006393137.1|  hypothetical protein EUTSA_v10012257mg             335   7e-105   
ref|XP_003596801.1|  Pentatricopeptide repeat-containing protein        347   9e-105   
ref|XP_002888295.1|  predicted protein                                  335   1e-104   
ref|XP_010455377.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       334   1e-104   
ref|XP_009147894.1|  PREDICTED: UDP-glycosyltransferase 79B5-like...    334   2e-104   
ref|XP_006289841.1|  hypothetical protein CARUB_v10003451mg             334   2e-104   
ref|XP_010496152.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       333   2e-104   
ref|XP_006289802.1|  hypothetical protein CARUB_v10003406mg             333   3e-104   
emb|CDY70505.1|  BnaAnng33940D                                          332   1e-103   
ref|XP_004238163.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    331   3e-103   
ref|XP_010455375.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       331   3e-103   
emb|CBI20242.3|  unnamed protein product                                327   8e-103   
ref|NP_974524.1|  UDP-glycosyltransferase 79B7                          329   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393133.1|  hypothetical protein EUTSA_v10012012mg             329   2e-102   
ref|XP_010455340.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       328   2e-102   
ref|XP_006354934.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       328   4e-102   
ref|XP_006286772.1|  hypothetical protein CARUB_v10003323mg             327   7e-102   
ref|XP_006393134.1|  hypothetical protein EUTSA_v10011473mg             325   4e-101   
ref|XP_010437932.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       325   6e-101   
gb|AFJ52977.1|  UDP-glycosyltransferase 1                               325   9e-101   
emb|CDY68468.1|  BnaC03g71890D                                          323   2e-100   
ref|XP_007021622.1|  UDP-Glycosyltransferase superfamily protein,...    322   5e-100   
ref|NP_175473.1|  UDP-glycosyltransferase 79B5                          322   1e-99    Arabidopsis thaliana [mouse-ear cress]
gb|EPS67374.1|  hypothetical protein M569_07398                         322   1e-99    
emb|CDY43058.1|  BnaA03g12050D                                          320   2e-99    
ref|XP_009132457.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       319   5e-99    
emb|CBI20245.3|  unnamed protein product                                318   9e-99    
gb|EYU19000.1|  hypothetical protein MIMGU_mgv1a021196mg                318   4e-98    
emb|CDY43844.1|  BnaC03g14770D                                          311   5e-96    
ref|XP_002891582.1|  glycosyltransferase family protein                 311   1e-95    
ref|NP_001275829.1|  1,6-rhamnosyltransferase                           311   2e-95    
ref|XP_002309370.1|  hypothetical protein POPTR_0006s19340g             310   6e-95    Populus trichocarpa [western balsam poplar]
gb|EPS58859.1|  hypothetical protein M569_15954                         308   1e-94    
emb|CAN63798.1|  hypothetical protein VITISV_026415                     307   2e-94    Vitis vinifera
gb|ABO21828.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    308   3e-94    Petunia axillaris [large white petunia]
emb|CAA50376.1|  anthocyanin 3 glucoside: rhamnosyltransferase          308   3e-94    Petunia x hybrida [garden petunia]
ref|XP_010442975.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       307   4e-94    
gb|ABO21820.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    308   5e-94    Petunia axillaris [large white petunia]
gb|AAO42032.1|  unknown protein                                         306   5e-94    Arabidopsis thaliana [mouse-ear cress]
gb|ABO21805.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    308   5e-94    Petunia axillaris [large white petunia]
ref|NP_192688.2|  UDP-glycosyltransferase 79B7                          306   5e-94    Arabidopsis thaliana [mouse-ear cress]
gb|ABO21810.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    307   8e-94    
emb|CAA81057.1|  UDP rhamnose: anthocyanidin-3-glucoside rhamnosy...    307   8e-94    
emb|CDY43057.1|  BnaA03g12040D                                          304   1e-93    
gb|ABO21818.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    306   2e-93    
ref|XP_006421028.1|  hypothetical protein CICLE_v10004868mg             306   2e-93    
gb|KDO40622.1|  hypothetical protein CISIN_1g037721mg                   306   2e-93    
sp|Q43716.1|UFOG_PETHY  RecName: Full=Anthocyanidin 3-O-glucosylt...    306   2e-93    
gb|EYU28029.1|  hypothetical protein MIMGU_mgv1a006905mg                304   3e-93    
gb|ABO21830.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    305   5e-93    
gb|ABO21809.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    304   9e-93    
gb|KFK27014.1|  hypothetical protein AALP_AA8G323200                    299   4e-92    
ref|XP_006848503.1|  hypothetical protein AMTR_s00013p00259270          301   2e-91    
emb|CBI20248.3|  unnamed protein product                                308   3e-91    
ref|XP_009587143.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    301   5e-91    
ref|XP_003596666.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamn...    296   8e-91    
ref|XP_004247056.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    298   2e-90    
ref|XP_010909163.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    298   4e-90    
dbj|BAC10994.1|  rhamnosyl transferase                                  297   5e-90    
ref|XP_006367560.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    297   6e-90    
gb|AFJ52973.1|  UDP-glycosyltransferase 1                               296   1e-89    
ref|XP_009416585.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    295   2e-89    
ref|XP_010909266.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    295   3e-89    
ref|XP_010683332.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    294   7e-89    
gb|KCW69986.1|  hypothetical protein EUGRSUZ_F03297                     292   1e-88    
ref|XP_009761380.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    293   3e-88    
emb|CDY65922.1|  BnaCnng49100D                                          292   4e-88    
ref|XP_006354953.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    290   8e-88    
ref|XP_008778568.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    291   1e-87    
ref|XP_004496085.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    289   6e-87    
ref|XP_010683409.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       288   2e-86    
ref|XP_010683331.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       285   2e-85    
ref|XP_010696238.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    285   2e-85    
ref|XP_010696239.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    285   2e-85    
ref|XP_010683329.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    285   3e-85    
ref|XP_010683330.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    285   3e-85    
ref|XP_007144190.1|  hypothetical protein PHAVU_007G135800g             284   5e-85    
ref|XP_003591655.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    284   5e-85    
emb|CAN71740.1|  hypothetical protein VITISV_005149                     295   9e-85    
ref|NP_001275524.1|  anthocyanidin 3-O-glucosyltransferase-like         282   2e-84    
ref|XP_002509496.1|  UDP-glucosyltransferase, putative                  282   3e-84    
ref|XP_011089649.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    281   5e-84    
gb|KHN11172.1|  UDP-glycosyltransferase 79B3                            278   1e-83    
gb|KCW69985.1|  hypothetical protein EUGRSUZ_F03296                     277   3e-83    
gb|KHN30680.1|  Anthocyanidin 3-O-glucosyltransferase                   278   8e-83    
ref|XP_003606381.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    276   3e-82    
gb|KHG23094.1|  hypothetical protein F383_29773                         271   1e-80    
ref|XP_006401634.1|  hypothetical protein EUTSA_v10016070mg             268   3e-80    
emb|CDP03925.1|  unnamed protein product                                269   3e-79    
ref|XP_003556320.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    267   2e-78    
gb|KHN00987.1|  Anthocyanidin 3-O-glucosyltransferase                   260   3e-76    
gb|AAR06923.1|  UDP-glycosyltransferase 79A2                            258   3e-75    
gb|AAN40684.1|  UDP-glucosyltransferase                                 257   7e-75    
gb|KHN19033.1|  UDP-glycosyltransferase 79B6                            249   8e-74    
gb|KHN28417.1|  UDP-glycosyltransferase 79B3                            252   1e-73    
dbj|BAJ85176.1|  predicted protein                                      251   1e-72    
ref|XP_010111557.1|  Anthocyanidin 3-O-glucosyltransferase              251   4e-72    
ref|XP_010091273.1|  Anthocyanidin 3-O-glucosyltransferase              249   9e-72    
ref|XP_010091274.1|  Anthocyanidin 3-O-glucosyltransferase              249   1e-71    
ref|XP_002442800.1|  hypothetical protein SORBIDRAFT_08g003060          248   4e-71    
ref|NP_001067852.2|  Os11g0457300                                       243   3e-69    
gb|EAY80827.1|  hypothetical protein OsI_36007                          241   1e-68    
ref|XP_002448983.1|  hypothetical protein SORBIDRAFT_05g002850          241   1e-68    
ref|XP_003560486.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    240   3e-68    
ref|XP_002448982.1|  hypothetical protein SORBIDRAFT_05g002840          239   6e-68    
ref|XP_004979787.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    237   4e-67    
ref|XP_004980748.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    234   2e-66    
ref|XP_004979714.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    234   6e-66    
ref|XP_003606382.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    230   1e-65    
gb|ABA93458.1|  Flavonol 3-O-glucosyltransferase, putative, expre...    233   1e-65    
gb|ACU17706.1|  unknown                                                 224   1e-64    
ref|NP_001131009.1|  uncharacterized protein LOC100192114 precursor     229   2e-64    
gb|ABR18123.1|  unknown                                                 228   9e-64    
ref|XP_007149718.1|  hypothetical protein PHAVU_005G0935001g            216   2e-62    
ref|XP_008455548.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    216   8e-62    
emb|CDY43062.1|  BnaA03g12090D                                          219   2e-61    
ref|XP_003560487.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    221   5e-61    
ref|XP_006371492.1|  hypothetical protein POPTR_0019s12250g             213   9e-61    
emb|CDP03916.1|  unnamed protein product                                217   1e-60    
ref|XP_006360080.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       215   2e-60    
ref|XP_008246180.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       213   2e-60    
ref|XP_004979244.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    218   4e-60    
ref|XP_010445097.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       213   5e-60    
ref|XP_007146549.1|  hypothetical protein PHAVU_006G050000g             215   8e-60    
ref|XP_007149720.1|  hypothetical protein PHAVU_005G0935000g            206   1e-58    
gb|EEE52059.1|  hypothetical protein OsJ_33813                          213   2e-58    
emb|CDP03917.1|  unnamed protein product                                210   4e-58    
gb|ABR16053.1|  unknown                                                 212   1e-57    
ref|XP_010064901.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    206   2e-57    
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    209   6e-57    
ref|XP_011084237.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       208   1e-56    
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    207   4e-56    
ref|XP_006354893.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       200   1e-55    
ref|XP_004161742.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       205   2e-55    
ref|XP_010430891.1|  PREDICTED: UDP-glycosyltransferase 79B4            199   3e-55    
ref|XP_007021620.1|  UDP-Glycosyltransferase superfamily protein        202   3e-55    
gb|KDP29791.1|  hypothetical protein JCGZ_18726                         203   1e-54    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830          202   3e-54    
ref|XP_010023429.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       202   5e-54    
gb|KCW59683.1|  hypothetical protein EUGRSUZ_H02441                     201   5e-54    
ref|XP_010535333.1|  PREDICTED: UDP-glycosyltransferase 91C1            201   6e-54    
emb|CDP01583.1|  unnamed protein product                                201   9e-54    
gb|AES88578.2|  UDP-glucosyltransferase family protein                  198   1e-53    
ref|XP_006846035.1|  hypothetical protein AMTR_s00155p00094050          201   1e-53    
gb|EPS70335.1|  hypothetical protein M569_04423                         199   3e-53    
ref|XP_004289519.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    199   3e-53    
gb|EPS58464.1|  hypothetical protein M569_16352                         194   4e-53    
gb|KDP29789.1|  hypothetical protein JCGZ_18724                         199   5e-53    
ref|XP_010456823.1|  PREDICTED: UDP-glycosyltransferase 79B7-like       192   8e-53    
ref|XP_003607534.1|  Anthocyanidin 3-O-glucosyltransferase              189   9e-53    
ref|XP_007149721.1|  hypothetical protein PHAVU_005G0935000g            189   3e-52    
ref|XP_011017699.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       196   3e-52    
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    197   4e-52    
ref|XP_007018258.1|  UDP-Glycosyltransferase superfamily protein        196   4e-52    
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g             196   6e-52    
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    196   6e-52    
ref|XP_004136252.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    195   7e-52    
ref|XP_004250157.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    194   2e-51    
gb|EYU37211.1|  hypothetical protein MIMGU_mgv1a018729mg                194   2e-51    
ref|XP_006360400.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    194   2e-51    
ref|XP_006354894.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       188   3e-51    
ref|XP_003593678.1|  Anthocyanidin 3-O-glucosyltransferase              187   3e-51    
ref|XP_006301862.1|  hypothetical protein CARUB_v10022332mg             189   4e-51    
ref|XP_010023432.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       193   6e-51    
sp|Q66PF2.1|URT1_FRAAN  RecName: Full=Putative UDP-rhamnose:rhamn...    193   7e-51    
ref|XP_010680364.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    192   9e-51    
ref|XP_007134322.1|  hypothetical protein PHAVU_010G037600g             191   1e-50    
ref|XP_010023433.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       192   1e-50    
gb|KDP29785.1|  hypothetical protein JCGZ_18720                         192   2e-50    
ref|XP_002527371.1|  UDP-glucosyltransferase, putative                  192   2e-50    
gb|KDP29780.1|  hypothetical protein JCGZ_18715                         191   2e-50    
ref|XP_008788932.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    192   3e-50    
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                          191   3e-50    
ref|XP_010061561.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       191   3e-50    
ref|XP_011015214.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    191   4e-50    
ref|XP_004240255.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    191   4e-50    
ref|XP_009415710.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    190   6e-50    
ref|XP_008440526.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       190   6e-50    
ref|XP_008466142.1|  PREDICTED: UDP-glycosyltransferase 91C1            190   7e-50    
ref|XP_007208586.1|  hypothetical protein PRUPE_ppa023071mg             190   7e-50    
gb|AES79436.2|  UDP-glucosyltransferase family protein                  189   1e-49    
dbj|BAN91400.1|  flavonol 3-O-glucoside (1->6) rhamnosyltransferase     185   1e-49    
gb|KDP29783.1|  hypothetical protein JCGZ_18718                         189   1e-49    
ref|XP_004489091.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    189   1e-49    
gb|KDP41496.1|  hypothetical protein JCGZ_15903                         189   3e-49    
ref|XP_003552084.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       188   3e-49    
ref|XP_007134315.1|  hypothetical protein PHAVU_010G036900g             187   3e-49    
ref|XP_006451091.1|  hypothetical protein CICLE_v10010307mg             188   4e-49    
gb|KDP29779.1|  hypothetical protein JCGZ_18714                         188   4e-49    
ref|XP_006301339.1|  hypothetical protein CARUB_v10021749mg             184   4e-49    
emb|CAN63799.1|  hypothetical protein VITISV_026416                     181   4e-49    
ref|XP_009774870.1|  PREDICTED: UDP-glycosyltransferase 91C1            188   4e-49    
ref|XP_009623131.1|  PREDICTED: UDP-glycosyltransferase 91C1            188   5e-49    
ref|XP_010501682.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       181   7e-49    
emb|CDP00928.1|  unnamed protein product                                187   8e-49    
emb|CDP00929.1|  unnamed protein product                                187   9e-49    
ref|XP_011015202.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    187   9e-49    
ref|XP_010547586.1|  PREDICTED: UDP-glycosyltransferase 91B1            187   1e-48    
gb|KFK32776.1|  hypothetical protein AALP_AA6G287200                    182   1e-48    
ref|XP_009800982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    187   1e-48    
ref|XP_003623218.1|  Anthocyanidin 3-O-glucosyltransferase              187   1e-48    
ref|XP_004287583.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       187   2e-48    
ref|XP_004288528.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       186   2e-48    
gb|AHL38585.1|  glycosyltransferase                                     191   2e-48    
ref|XP_006836294.1|  hypothetical protein AMTR_s00092p00017910          186   2e-48    
ref|XP_011084238.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    186   3e-48    
gb|KFK29804.1|  hypothetical protein AALP_AA7G181400                    185   3e-48    
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                  186   3e-48    
ref|XP_006282295.1|  hypothetical protein CARUB_v10028581mg             185   3e-48    
ref|XP_004287868.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    186   3e-48    
gb|KCW82042.1|  hypothetical protein EUGRSUZ_C03411                     185   3e-48    
ref|XP_010051440.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       185   3e-48    
ref|XP_002270331.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    185   4e-48    
ref|XP_002318358.2|  hypothetical protein POPTR_0012s01130g             184   7e-48    
ref|XP_008219240.1|  PREDICTED: UDP-glycosyltransferase 91C1            184   7e-48    
gb|KHN27169.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            184   7e-48    
gb|KEH23150.1|  UDP-glucosyltransferase family protein                  184   7e-48    
ref|XP_004250156.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    184   8e-48    
ref|XP_006353159.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    184   8e-48    
ref|XP_003535899.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    184   1e-47    
ref|XP_004287416.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       184   1e-47    
ref|XP_004288503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    184   1e-47    
ref|XP_003593144.1|  Glucosyltransferase                                184   1e-47    
gb|KEH20103.1|  UDP-glucosyltransferase family protein                  183   1e-47    
ref|XP_008811282.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    183   1e-47    
ref|XP_010934416.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    183   1e-47    
ref|XP_010060107.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    183   2e-47    
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    183   2e-47    
ref|XP_007156463.1|  hypothetical protein PHAVU_003G288100g             183   2e-47    
ref|XP_007222833.1|  hypothetical protein PRUPE_ppa005106mg             183   2e-47    
ref|XP_010440988.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       184   2e-47    
ref|XP_011099970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    184   2e-47    
ref|XP_008378603.1|  PREDICTED: UDP-glycosyltransferase 91C1            183   2e-47    
ref|XP_007212397.1|  hypothetical protein PRUPE_ppa016365mg             178   3e-47    
emb|CAN80742.1|  hypothetical protein VITISV_015059                     182   4e-47    
ref|XP_010442438.1|  PREDICTED: UDP-glycosyltransferase 91C1            182   5e-47    
ref|XP_007012764.1|  UDP-Glycosyltransferase superfamily protein        182   5e-47    
ref|XP_006852901.1|  hypothetical protein AMTR_s00033p00222830          182   5e-47    
ref|XP_010646446.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    181   6e-47    
gb|AIE12480.1|  UGT3                                                    182   6e-47    
ref|XP_008789644.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    181   6e-47    
emb|CDP01584.1|  unnamed protein product                                181   8e-47    
ref|XP_004289539.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       181   9e-47    
ref|XP_010047532.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       181   9e-47    
ref|XP_007134316.1|  hypothetical protein PHAVU_010G037000g             181   1e-46    
ref|XP_004151488.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       181   1e-46    
ref|XP_010254573.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       181   1e-46    
ref|XP_002270369.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    181   1e-46    
gb|AFK37289.1|  unknown                                                 181   1e-46    
ref|XP_006294142.1|  hypothetical protein CARUB_v10023135mg             181   1e-46    
ref|XP_010938322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    180   2e-46    
ref|XP_008378602.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       181   2e-46    
ref|XP_010482257.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    180   3e-46    
gb|KCW79472.1|  hypothetical protein EUGRSUZ_C00857                     179   3e-46    
gb|KEH20104.1|  UDP-glucosyltransferase family protein                  179   4e-46    
ref|XP_010417017.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       179   4e-46    
ref|XP_009364807.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    180   4e-46    
ref|XP_010934404.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    180   4e-46    
ref|XP_010910495.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    179   5e-46    
gb|AGU14093.1|  UDP-glycosyltransferase                                 179   5e-46    
emb|CBI20247.3|  unnamed protein product                                177   5e-46    
ref|XP_010047531.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       179   5e-46    



>sp|Q53UH4.1|DUSKY_IPONI RecName: Full=Anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase; 
AltName: Full=3-O-glucoside-2''-O-glucosyltransferase; 
Short=In3GGT; AltName: Full=Protein dusky; Short=Dy [Ipomoea 
nil]
 dbj|BAD95881.1| glucosyltransferase [Ipomoea nil]
 dbj|BAD95883.1| glucosyltransferase [Ipomoea nil]
Length=459

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/456 (100%), Positives = 456/456 (100%), Gaps = 0/456 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1     MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61    SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA
Sbjct  121   WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  180

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL
Sbjct  181   HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL  240

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF
Sbjct  241   AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  300

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPPFEAESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE
Sbjct  301   AALKPPFEAESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD
Sbjct  421   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  456



>sp|Q53UH5.1|DUSKY_IPOPU RecName: Full=Anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase; 
AltName: Full=3-O-glucoside-2''-O-glucosyltransferase; 
Short=Ip3GGT; AltName: Full=Protein dusky; Short=Dy [Ipomoea 
purpurea]
 dbj|BAD95882.1| glucosyltransferase [Ipomoea purpurea]
Length=459

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/456 (99%), Positives = 455/456 (99%), Gaps = 0/456 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1     MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61    SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA
Sbjct  121   WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  180

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL
Sbjct  181   HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL  240

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF
Sbjct  241   AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  300

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPPFE ES+EAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE
Sbjct  301   AALKPPFETESVEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EIGREVRGNHDKLRGFL+NADLDSKYMDSFNQKLQD
Sbjct  421   EIGREVRGNHDKLRGFLMNADLDSKYMDSFNQKLQD  456



>gb|AHJ60266.1| anthocyanidin 3-O-glucoside-2''-O-glucosyltransferase [Ipomoea 
purpurea]
Length=459

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/456 (99%), Positives = 455/456 (99%), Gaps = 0/456 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGSQA TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1     MGSQAATYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61    SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA
Sbjct  121   WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  180

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL
Sbjct  181   HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL  240

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF
Sbjct  241   AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  300

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPPFEAES+EAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE
Sbjct  301   AALKPPFEAESVEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD
Sbjct  421   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  456



>dbj|BAD95885.1| glucosyltransferase [Ipomoea nil]
Length=464

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/443 (100%), Positives = 443/443 (100%), Gaps = 0/443 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1     MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61    SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA
Sbjct  121   WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  180

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL
Sbjct  181   HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL  240

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF
Sbjct  241   AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  300

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPPFEAESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE
Sbjct  301   AALKPPFEAESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  336   EIGREVRGNHDKLRGFLLNADLD  268
             EIGREVRGNHDKLRGFLLNADLD
Sbjct  421   EIGREVRGNHDKLRGFLLNADLD  443



>dbj|BAD95884.1| glucosyltransferase [Ipomoea nil]
Length=464

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/443 (100%), Positives = 443/443 (100%), Gaps = 0/443 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI
Sbjct  1     MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH
Sbjct  61    SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  120

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA
Sbjct  121   WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  180

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL
Sbjct  181   HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLL  240

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF
Sbjct  241   AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  300

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPPFEAESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE
Sbjct  301   AALKPPFEAESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  336   EIGREVRGNHDKLRGFLLNADLD  268
             EIGREVRGNHDKLRGFLLNADLD
Sbjct  421   EIGREVRGNHDKLRGFLLNADLD  443



>gb|ABL74480.1| glucosyltransferase [Ipomoea batatas]
Length=459

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/456 (95%), Positives = 443/456 (97%), Gaps = 0/456 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGSQATT+HMAMYPWFGVGHLT FFRLANKLA KGHRISFLIPKNTQSKL SFNLHPHL+
Sbjct  1     MGSQATTHHMAMYPWFGVGHLTAFFRLANKLASKGHRISFLIPKNTQSKLASFNLHPHLV  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             SFVPI VPSIPGLPPGAETTSDVPF STHLLMEAMDKTQ DIEIILK+L+VDVVF+DFTH
Sbjct  61    SFVPITVPSIPGLPPGAETTSDVPFSSTHLLMEAMDKTQTDIEIILKNLEVDVVFFDFTH  120

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLP LARKIGIKSVFYSTISPLMHG+ALSPERRV GKQLTEADMMKAPASFPDPSIKLHA
Sbjct  121   WLPGLARKIGIKSVFYSTISPLMHGFALSPERRVAGKQLTEADMMKAPASFPDPSIKLHA  180

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQF+KPVLL
Sbjct  181   HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFKKPVLL  240

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK++FQELLWGLELTGMPFF
Sbjct  241   AGPALPVPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKEQFQELLWGLELTGMPFF  300

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALK PF  +SIEAAIPEEL+EKI G+GIVHG WVQQQLFLQHPSVGCFVSHCGWASLSE
Sbjct  301   AALKAPFGTDSIEAAIPEELREKIHGKGIVHGGWVQQQLFLQHPSVGCFVSHCGWASLSE  360

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS
Sbjct  361   ALVNDCQIVLLPQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKS  420

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD
Sbjct  421   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  456



>ref|XP_006449435.1| hypothetical protein CICLE_v10015186mg [Citrus clementina]
 gb|ESR62675.1| hypothetical protein CICLE_v10015186mg [Citrus clementina]
Length=458

 Score =   516 bits (1328),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 265/447 (59%), Positives = 349/447 (78%), Gaps = 1/447 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GHLT +  ++NKLA +GH+ISF++P NTQ+K E FNLH HLI+F+PI VP
Sbjct  7     HIAMYPWFAMGHLTSYLHISNKLAERGHKISFILPTNTQTKFEPFNLHKHLITFIPITVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP G ETT+DVPFP   LLM AMD T+  IE I++D+K ++VF+DFT+WLPSLARK
Sbjct  67    CVDGLPSGTETTTDVPFPLHPLLMTAMDLTEPAIEAIVRDIKPNIVFFDFTYWLPSLARK  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKS+ + TISP   GY LSPER+   K LTEAD+++ P  FP   IKL AHEARG  A
Sbjct  127   LGIKSIAFVTISPATVGYLLSPERKFPDKVLTEADLLQPPQGFPPSKIKLRAHEARGLAA  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
              TV  FGG ++F +R+   ++E D + + TCREIEG +CDY+E+QF+K V+LAGP LP P
Sbjct  187   ATVKDFGG-LSFMERLLLCLTECDAIGFKTCREIEGAYCDYVESQFEKRVILAGPVLPEP  245

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
             + S +E+++      FK  S+I+CA GSEC L+KD+FQEL+ G ELTG+PFFAALKPP  
Sbjct  246   TTSVLEEEFETLFSSFKAKSLIFCALGSECVLKKDQFQELISGFELTGLPFFAALKPPTG  305

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ++IE+A+PE  +++++GRG VHG WVQQQL L+HPSVGCFV+HCG  SLSEA+VN+CQ+
Sbjct  306   HDTIESALPEGFEDRVKGRGFVHGGWVQQQLILKHPSVGCFVTHCGSGSLSEAMVNECQL  365

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQIIN+R+M   LKVGVEVE+G+EDG+F+R+ VCKAVKAVMD+ SE+G++ R 
Sbjct  366   VLLPNVGDQIINSRLMGEDLKVGVEVERGDEDGLFTRDGVCKAVKAVMDDDSEVGKDARQ  425

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             NH KLR FL++  L++ Y+D F Q+L 
Sbjct  426   NHAKLREFLISPGLENSYVDGFVQELH  452



>ref|XP_006467704.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Citrus sinensis]
Length=458

 Score =   510 bits (1314),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 262/447 (59%), Positives = 348/447 (78%), Gaps = 1/447 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GHLT +  ++NKLA +GH+ISF++P NT +K E FNLH HL++F+PI VP
Sbjct  7     HIAMYPWFAMGHLTSYLHISNKLAERGHKISFILPTNTHTKFEPFNLHKHLVTFIPITVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP G ETT+DVPFP   LLM AMD T+  IE I++D+K ++VF+DFT+WLPSLARK
Sbjct  67    CVDGLPSGTETTTDVPFPLHPLLMTAMDLTEPAIEAIVRDIKPNIVFFDFTYWLPSLARK  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKS+ + TISP   GY LSPER++  K LTEAD+++ P  FP   IKL AHEARG  A
Sbjct  127   LGIKSIAFVTISPATVGYLLSPERKLRDKVLTEADLLQPPQGFPPSKIKLRAHEARGLAA  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
              TV  FGG ++F +R+   ++E D + + TCREIEG +CDY+E+QF+K V+LAGP LP P
Sbjct  187   ATVKDFGG-LSFMERLLLCLTECDAIGFKTCREIEGAYCDYVESQFEKRVILAGPVLPEP  245

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
               S +E+++      FK  S+I+CA GSEC L+KD+FQEL+ G ELTG+PFFAALKPP  
Sbjct  246   PASVLEEEFEMLFSSFKAKSLIFCALGSECVLKKDQFQELILGFELTGLPFFAALKPPTG  305

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ++IE+A+PE  +++++GRG VHG WVQQQL L+HPSVGCFV+HCG  SLSEA+VN+CQ+
Sbjct  306   HDTIESALPEGFEDRVKGRGFVHGGWVQQQLILKHPSVGCFVTHCGSGSLSEAMVNECQL  365

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQIIN+R+M   LKVGVEVE+G+EDG+F+R+ VCKAVKAVMD+ SE+G++ R 
Sbjct  366   VLLPNVGDQIINSRLMGEDLKVGVEVERGDEDGLFTRDGVCKAVKAVMDDDSEVGKDARQ  425

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             NH +LR FL++  L++ Y+D F Q+L 
Sbjct  426   NHAELREFLISPGLENSYVDGFVQELH  452



>ref|XP_003539949.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=461

 Score =   508 bits (1309),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 338/448 (75%), Gaps = 0/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPW  +GH T F  L NKLA +GH+ISF+ P   Q+KLE+FNLHP+ I+FV I VP
Sbjct  7     HIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEAFNLHPNSITFVTITVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPP A+TT+DV +P    +M AMD T++DIE +L  LK D+VFYDFTHW+P+LA+ 
Sbjct  67    HVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLSGLKPDLVFYDFTHWMPALAKS  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIK+V Y T S +M GY L P R   G  L E+D+M+ P  +PD SIKLHAHEAR F A
Sbjct  127   LGIKAVHYCTASSVMVGYTLPPARYHQGTNLIESDLMEPPEGYPDSSIKLHAHEARAFAA  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
             +    FG ++ F+DR F A++E+D LAY TCREIEG + DYIE QF KPVL  GP +  P
Sbjct  187   KRKDTFGSNVLFYDRQFIALNEADVLAYRTCREIEGPYLDYIEKQFNKPVLATGPVILDP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
               S +E+K+S WLG F+ GSV+YC FGSECTL  ++FQEL+ GLELTGMPF AA+K P  
Sbjct  247   PTSDLEEKFSTWLGGFEPGSVVYCCFGSECTLGPNQFQELVLGLELTGMPFLAAVKAPLG  306

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              E++E+A+PE  +E+++GRG V+G WV QQL L HPSVGCF++HCG  SLSEALVN CQ+
Sbjct  307   FETVESAMPEGFEERVKGRGFVYGGWVLQQLILAHPSVGCFITHCGSGSLSEALVNKCQL  366

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQI+NAR+M  +L+VGVEVEKG+EDG+++RESVCKAV  VMD ++E  + VRG
Sbjct  367   VLLPNVGDQILNARMMGNNLEVGVEVEKGDEDGMYTRESVCKAVSIVMDGENETSKRVRG  426

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH ++R  LLN DL+S Y+DSF  +LQ+
Sbjct  427   NHARIRELLLNKDLESSYVDSFCMRLQE  454



>gb|KHN41619.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=460

 Score =   504 bits (1298),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 338/448 (75%), Gaps = 1/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPW  +GH T F  L NKLA +GH+ISF+ P   Q+KLE+FNLHP+ I+FV I VP
Sbjct  7     HIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEAFNLHPNSITFVTITVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPP A+TT+DV +P    +M AMD T++DIE  L+ LK D+VFYDFTHW+P+LA+ 
Sbjct  67    HVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIET-LRGLKPDLVFYDFTHWMPALAKS  125

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIK+V Y T S +M GY L P R   G  L E+D+M+ P  +PD SIKLHAHEAR F A
Sbjct  126   LGIKAVHYCTASSVMVGYTLPPARYHQGTNLIESDLMEPPEGYPDSSIKLHAHEARAFAA  185

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
             +    FG ++ F+DR F A++E+D LAY TCREIEG + DYIE QF KPVL  GP +  P
Sbjct  186   KRKDTFGSNVLFYDRQFIALNEADVLAYRTCREIEGPYLDYIEKQFNKPVLATGPVILDP  245

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
               S +E+K+S WLG F+ GSV+YC FGSECTL  ++FQEL+ GLELTGMPF AA+K P  
Sbjct  246   PTSDLEEKFSTWLGGFEPGSVVYCCFGSECTLGPNQFQELVLGLELTGMPFLAAVKAPLG  305

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              E++E+A+PE  +E+++GRG V+G WV QQL L HPSVGCF++HCG  SLSEALVN CQ+
Sbjct  306   FETVESAMPEGFEERVKGRGFVYGGWVLQQLILAHPSVGCFITHCGSGSLSEALVNKCQL  365

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQI+NAR+M  +L+VGVEVEKG+EDG+++RESVCKAV  VMD ++E  + VRG
Sbjct  366   VLLPNVGDQILNARMMGNNLEVGVEVEKGDEDGMYTRESVCKAVSIVMDGENETSKRVRG  425

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH ++R  LLN DL+S Y+DSF  +LQ+
Sbjct  426   NHARIRELLLNKDLESSYVDSFCMRLQE  453



>ref|XP_006449434.1| hypothetical protein CICLE_v10017784mg [Citrus clementina]
 gb|ESR62674.1| hypothetical protein CICLE_v10017784mg [Citrus clementina]
Length=458

 Score =   500 bits (1287),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 267/456 (59%), Positives = 344/456 (75%), Gaps = 3/456 (1%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+  T+H+AMYPWF +GHLT F  +ANKLA +GHRISFL+P    +K E  NLH  LI
Sbjct  1     MGSE--TFHIAMYPWFAMGHLTPFLHIANKLAERGHRISFLLPAKAITKFEPSNLHRDLI  58

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             +F+P+ VP + GLPPGAETT+DVPFP   LLM AMD T+  IE +L+ LK D VF+DFTH
Sbjct  59    TFIPVSVPRVDGLPPGAETTNDVPFPLHPLLMTAMDLTEPAIESVLRRLKPDFVFFDFTH  118

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLP LARK GIKSV Y  ISP   GY LSPER++  + LT+ D+++ P  FP   I+L A
Sbjct  119   WLPPLARKFGIKSVLYCIISPATIGYLLSPERKLRERTLTDNDLLRPPQGFPTSKIRLRA  178

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEARG  A TV +FGG ++F  R   ++SE D + + TCREIEG +CDYI +QF KPV+L
Sbjct  179   HEARGLAAATVKEFGGGLSFAKRNLLSLSECDAIGFKTCREIEGPYCDYIGSQFGKPVIL  238

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             +GPALP   +  +E++W   LG FK  S+I+CAFGSEC L K++FQEL+ G EL+G+PF 
Sbjct  239   SGPALPESPRLALEERWETLLGSFKSKSLIFCAFGSECVLNKEQFQELVLGFELSGLPFL  298

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              ALKPP   ++IE+A+PE  +E+++GRG +HG WVQQQL L+HPSVGCFV+HCG  SLSE
Sbjct  299   VALKPPVGHDTIESALPEGFEERVKGRGFIHGGWVQQQLILKHPSVGCFVTHCGSGSLSE  358

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK-  340
             A+VN+CQ+VLLP VGDQIINAR+M   LKVGVEVEKG+EDG+F+R+ VCKAVKAV+D+  
Sbjct  359   AMVNECQLVLLPNVGDQIINARLMGEELKVGVEVEKGDEDGLFTRDGVCKAVKAVIDDDH  418

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             SE+G+E++ NH K R FL +  L++ ++D F QKL 
Sbjct  419   SEVGKEIKENHAKWREFLRSERLENSHLDGFVQKLH  454



>ref|XP_007025500.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY28122.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   499 bits (1284),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 260/449 (58%), Positives = 339/449 (76%), Gaps = 0/449 (0%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T+H+A+YPWF +GH+T F  +ANKLA +GH+ISF +P  TQ K+E+FNLHP LI+F+PI 
Sbjct  5     TFHIALYPWFALGHITAFVHIANKLAERGHKISFFLPAKTQRKVEAFNLHPDLITFIPIT  64

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GLP GAETT+DVPFP   L+M AMD T+ DIE  L +LK   VF+DFT WLP+L+
Sbjct  65    VPHVEGLPHGAETTNDVPFPLHPLIMTAMDLTEPDIEASLLELKPHFVFFDFTCWLPALS  124

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGF  1039
             R++GIKSV Y  +S    GY LSP R+++ K LT  D+++ P  FP  SIKL  HEARG 
Sbjct  125   RRLGIKSVLYCIVSSATIGYLLSPARKILEKGLTGHDLLEPPKGFPSSSIKLRTHEARGL  184

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
              A T M +G  I+F  R   ++S+ D +++ TCREIEG FCDYI  QF+K V+ AGP +P
Sbjct  185   AAVTTMDYGSGISFVQRQLRSLSDCDAISFKTCREIEGPFCDYIGHQFEKTVIFAGPVVP  244

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
              P K  +E++W   L  F+  +VI+CAFGSEC L+KD+FQEL+ GLE TG+PF  ALKPP
Sbjct  245   EPPKLALEERWEKLLSSFQAKTVIFCAFGSECVLKKDQFQELVLGLEQTGLPFLVALKPP  304

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               AE+IE+A+PE  +E++QGRG+VHG WV QQL L+HPSVGCFV+HCG  SL+EA+VNDC
Sbjct  305   MGAETIESALPEGFQERVQGRGLVHGGWVPQQLILRHPSVGCFVTHCGSGSLAEAMVNDC  364

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             Q+VLLP VGDQIINAR+M+  L++GVEVEKG+EDG+F ++ VCKAVKAVMD+ SE+G+E 
Sbjct  365   QLVLLPNVGDQIINARLMAGDLRIGVEVEKGDEDGLFKKDGVCKAVKAVMDDDSEVGKEA  424

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             R NH K + FLL   L++ YMD+F +KL 
Sbjct  425   RVNHAKWKEFLLGPGLENSYMDAFVEKLH  453



>ref|XP_007132682.1| hypothetical protein PHAVU_011G115700g [Phaseolus vulgaris]
 gb|ESW04676.1| hypothetical protein PHAVU_011G115700g [Phaseolus vulgaris]
Length=457

 Score =   498 bits (1283),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 250/448 (56%), Positives = 331/448 (74%), Gaps = 1/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPW  +GH T F  L NKLA +GHRISF+ P   Q+KLE FNLHP LI+FV I VP
Sbjct  7     HIAMYPWLAMGHQTAFLHLCNKLAIRGHRISFITPPKAQAKLEPFNLHPELITFVTITVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPP A+TT+DV +P    +M AMD T++DIE +L DLK D+VFYDFTHW+P+L +K
Sbjct  67    HVEGLPPDAQTTADVTYPLQPNIMTAMDLTKDDIETLLTDLKPDLVFYDFTHWMPTLTKK  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIK+V Y T S +M GY L P R   G  L+E+D+M+ P  +PD SIKLHAHEAR F  
Sbjct  127   LGIKAVHYCTASSVMVGYTLPPARYYQGIDLSESDLMEPPKGYPDSSIKLHAHEARAFAG  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
             +    FG D+ F+DR FTA++E+D LAY TCREIEG + DYI  +F KPVL +GP +  P
Sbjct  187   KRKDTFGSDVLFYDRQFTALNEADVLAYRTCREIEGPYLDYIGNEFNKPVLASGPVILEP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
               S +E+K+S WLG F+ G+V+YC FGSECTLR ++FQEL+ GLELTGMPF AA+KPP  
Sbjct  247   PTSELEEKFSTWLGGFEPGTVVYCCFGSECTLRPEQFQELVLGLELTGMPFLAAVKPPVG  306

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
               ++E+A+PE  +E+++GRG V+G WV QQL L HPSVGCF++HCG  SLSEALVN C++
Sbjct  307   FHTVESAMPEGFEERVKGRGFVYGGWVMQQLILAHPSVGCFITHCGSGSLSEALVNKCRL  366

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQI+NAR+M+ +L          EDG+++++SVCKAV  VMDE++E  ++V  
Sbjct  367   VLLPNVGDQILNARMMANNL-EVGVEVDKGEDGMYTKDSVCKAVSIVMDEENETSKKVTV  425

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH ++R  LL+ DL+S Y+D+F  +L++
Sbjct  426   NHTRIRETLLDKDLESYYLDNFCTRLRE  453



>gb|KHN07772.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=459

 Score =   498 bits (1281),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 258/448 (58%), Positives = 335/448 (75%), Gaps = 0/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPW  +GH T F  L NKLA +GH+ISF+ P   Q+KLE FNLHP+ I+FV I VP
Sbjct  7     HIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEPFNLHPNSITFVTINVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPP A+TT+DV +P    +M AMD T++DIE +L  LK D+VFYDFTHW+P+LA++
Sbjct  67    HVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLTGLKPDLVFYDFTHWMPALAKR  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIK+V Y T S +M GY LSP R   G  L E+D+M+ P  +PD SIKL  HEAR F A
Sbjct  127   LGIKAVHYCTASSVMVGYTLSPVRFHQGTDLMESDLMEPPEGYPDSSIKLQTHEARAFAA  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
             +    FG ++ F+DR F A++E+D LAY TCREIEG + DYI  QF KPV+  GP +  P
Sbjct  187   KRKDTFGSNVLFYDRQFIALNEADLLAYRTCREIEGPYMDYIGKQFNKPVVATGPVILDP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
                 +E+K+S WLG F+ GSV+YC FGSECTLR ++F EL+ GLELTGMPF AA+K P  
Sbjct  247   PTLDLEEKFSTWLGGFEPGSVVYCCFGSECTLRPNQFLELVLGLELTGMPFLAAVKAPLG  306

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              E++E+A+PE  +E+++GRG V+G WVQQQL L HPSVGCF++HCG  SLSEALVN CQ+
Sbjct  307   FETVESAMPEGFQERVKGRGFVYGGWVQQQLILAHPSVGCFITHCGSGSLSEALVNKCQL  366

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQI+NAR+M  +L+VGVEVEKG+EDG++++ESVCKAV  VMD ++E  + VR 
Sbjct  367   VLLPNVGDQILNARMMGTNLEVGVEVEKGDEDGMYTKESVCKAVSIVMDCENETSKRVRA  426

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH ++R  LLN DL+S Y+DSF  +LQ+
Sbjct  427   NHARIRELLLNKDLESSYVDSFCMRLQE  454



>ref|XP_007213494.1| hypothetical protein PRUPE_ppa022356mg [Prunus persica]
 gb|EMJ14693.1| hypothetical protein PRUPE_ppa022356mg [Prunus persica]
Length=450

 Score =   497 bits (1280),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 271/446 (61%), Positives = 333/446 (75%), Gaps = 2/446 (0%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPWFG+GHLT F  ++NKLA +GHRISF  P   Q KLE+FNLH H ISF+PI VP + 
Sbjct  1     MYPWFGMGHLTSFLHISNKLAERGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDVPHVD  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK--I  1210
             GLPPG ETT+DVPFP   LL+ AMD T+  IE  L +L+ + VF+DFTHWLP L  K  I
Sbjct  61    GLPPGTETTADVPFPLHSLLVTAMDLTRPAIEQALCELRPNFVFFDFTHWLPELLHKLDI  120

Query  1209  GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTAR  1030
             GIKSV Y TISP   G+ +SPER++  K LTEAD+M+ P SFP  SIKL  HEAR     
Sbjct  121   GIKSVHYCTISPATVGFLISPERKLFEKSLTEADLMEPPPSFPASSIKLQTHEARALVGA  180

Query  1029  TVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPS  850
             T+M++G  +TF +R   + S  D +A+ TCRE+EG +CDY+ETQF KPV+LAGP +P   
Sbjct  181   TLMEYGRGVTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKPVILAGPVVPESP  240

Query  849   KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfea  670
              + +++KW+ W   F+  +VIYCAFGSEC L K +FQELL G ELTG+PFFAALKPP   
Sbjct  241   TTELDEKWAKWFDGFEAKTVIYCAFGSECILNKAQFQELLLGFELTGLPFFAALKPPMGV  300

Query  669   esieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIV  490
             ESIEAA+PE  +E++QGRGIVHG WVQQ L L+HPSVGCFV+HCG  SLSEAL+N+C++V
Sbjct  301   ESIEAALPEGFEERVQGRGIVHGGWVQQPLILKHPSVGCFVTHCGSGSLSEALMNECRLV  360

Query  489   LLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGN  310
             LLP VGDQIINAR+MS  LKVGVEVEKG+EDGVF+ E VCKAVK VMD++SE+ +EVR N
Sbjct  361   LLPNVGDQIINARMMSRDLKVGVEVEKGDEDGVFTTEGVCKAVKTVMDDESEVAKEVRTN  420

Query  309   HDKLRGFLLNADLDSKYMDSFNQKLQ  232
             H K R F     L++  +DSF QKL 
Sbjct  421   HAKWREFFTGKGLENSCLDSFEQKLH  446



>ref|XP_003526249.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=459

 Score =   497 bits (1280),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 257/448 (57%), Positives = 335/448 (75%), Gaps = 0/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPW  +GH T F  L NKLA +GH+ISF+ P   Q+KLE FNLHP+ I+FV I VP
Sbjct  7     HIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEPFNLHPNSITFVTINVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPP A+TT+DV +P    +M AMD T++DIE +L  LK D+VFYDFTHW+P+LA++
Sbjct  67    HVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLTGLKPDLVFYDFTHWMPALAKR  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIK+V Y T S +M GY L+P R   G  L E+D+M+ P  +PD SIKL  HEAR F A
Sbjct  127   LGIKAVHYCTASSVMVGYTLTPSRFHQGTDLMESDLMEPPEGYPDSSIKLQTHEARTFAA  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
             +    FG ++ F+DR F A++E+D LAY TCREIEG + DYI  QF KPV+  GP +  P
Sbjct  187   KRKDTFGSNVLFYDRQFIALNEADLLAYRTCREIEGPYMDYIGKQFNKPVVATGPVILDP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
                 +E+K+S WLG F+ GSV+YC FGSECTLR ++F EL+ GLELTGMPF AA+K P  
Sbjct  247   PTLDLEEKFSTWLGGFEPGSVVYCCFGSECTLRPNQFLELVLGLELTGMPFLAAVKAPLG  306

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              E++E+A+PE  +E+++GRG V+G WVQQQL L HPSVGCF++HCG  SLSEALVN CQ+
Sbjct  307   FETVESAMPEGFQERVKGRGFVYGGWVQQQLILAHPSVGCFITHCGSGSLSEALVNKCQL  366

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQI+NAR+M  +L+VGVEVEKG+EDG++++ESVCKAV  VMD ++E  + VR 
Sbjct  367   VLLPNVGDQILNARMMGTNLEVGVEVEKGDEDGMYTKESVCKAVSIVMDCENETSKRVRA  426

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH ++R  LLN DL+S Y+DSF  +LQ+
Sbjct  427   NHARIRELLLNKDLESSYVDSFCMRLQE  454



>ref|XP_004304716.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=463

 Score =   497 bits (1280),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 261/451 (58%), Positives = 340/451 (75%), Gaps = 2/451 (0%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T H+AMYPWF +GHL+ F  ++NKLA +GHRISF +P+ TQ+KL+ +NLHP LI+F P+ 
Sbjct  8     TLHIAMYPWFAMGHLSPFLHISNKLAERGHRISFFLPQKTQAKLQYYNLHPDLITFYPLT  67

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             +P + GLP GAETT+DVPFP   L++ AMD T+  IE  L++LK D+VFYDF+HWLP L 
Sbjct  68    IPHVEGLPQGAETTADVPFPLHTLVVTAMDLTRPQIEKFLRELKPDLVFYDFSHWLPQLL  127

Query  1218  RKI--GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             R++   IKSV Y  ISP+  GY LSPER++  K L   D+++AP SFP   IKL  HEAR
Sbjct  128   RELDGNIKSVLYCIISPVTIGYLLSPERKLTEKPLVATDLLEAPTSFPSSIIKLRTHEAR  187

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
             G T  T  ++G  +TF +R  T++ E D + + TCRE EG+FCDYIE Q +KPV+LAGP 
Sbjct  188   GLTYVTNQEYGRGVTFLERQLTSLGECDAIGFKTCREFEGKFCDYIEEQMKKPVILAGPV  247

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P P  S +E++W++WLG F+ GSVIYCAFGSEC L+K + QEL+ G ELTG+PFFAALK
Sbjct  248   VPAPPSSALEERWAEWLGGFEPGSVIYCAFGSECVLKKKQLQELVLGFELTGLPFFAALK  307

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
              P   ESIEAA+PE  +E+++GRG+VH  WVQQ L L HPSVG FV+HCG  SL+EA++N
Sbjct  308   TPVGLESIEAALPEGFEERVKGRGVVHSGWVQQPLILNHPSVGYFVTHCGSGSLAEAMMN  367

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
              C++VLLP VGDQIINAR+M   L+VGVEVEKG+EDG+FS+E VCKAV+AVMD++SE+G+
Sbjct  368   HCRLVLLPHVGDQIINARMMGGDLRVGVEVEKGDEDGLFSKEGVCKAVEAVMDDESEVGK  427

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             EV+ NH K R F  N  L+  Y+D F Q+L 
Sbjct  428   EVKANHAKWREFFSNKGLEKTYIDCFEQRLH  458



>ref|XP_010262362.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=475

 Score =   497 bits (1279),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 331/460 (72%), Gaps = 2/460 (0%)
 Frame = -3

Query  1605  IGSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHP  1426
             +G   +   T H+AMYPW+ +GHLT F  ++NKLA +GHR+SF +P  TQSKL S NLHP
Sbjct  1     MGGAVADVDTLHIAMYPWYAMGHLTPFLHISNKLAERGHRVSFFLPTKTQSKLNSNNLHP  60

Query  1425  HLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYD  1246
             +LI+F+P+VVP + GLPPGAETT+DVP     L+M AMD TQ +IE  L+ LK  +VF+D
Sbjct  61    NLITFIPVVVPHVDGLPPGAETTADVPHSLHSLIMTAMDLTQPEIEASLRQLKPHIVFFD  120

Query  1245  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGK-QLTEADMMKAPASFPDPSI  1069
             F +W+P+LAR +GIKS+ Y  ISP+  GY LSP R  +    L E+ +M  P  FP  +I
Sbjct  121   FAYWVPALARSLGIKSIHYCIISPVTIGYLLSPSRNNISDVDLYESSLMHPPPGFPAAAI  180

Query  1068  KLHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQK  889
             KLH++EAR       +++G  ITF++R   A+S+ D LA+  CREIEG +CDY+ETQF+K
Sbjct  181   KLHSNEARRLALVANIEYGKGITFYERQNIALSDCDALAFRACREIEGSYCDYLETQFRK  240

Query  888   pvllagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             PVL++G  +PV  +  +E++W  WLG F+  SV+YCAFGSEC L  D+F+EL+ GLELTG
Sbjct  241   PVLVSGSVVPVAPRDGLEERWVKWLGGFEANSVVYCAFGSECILSLDQFRELVMGLELTG  300

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF AALK P   ++IEAA+PE  +E++ GRG+VHG+WVQQQL L+HPSVGCFV+HCG  
Sbjct  301   LPFLAALKLPIGTDTIEAALPEGFEERVGGRGVVHGQWVQQQLILEHPSVGCFVTHCGSG  360

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             SL E+LVN CQ+VLLP +GDQI+NAR+M   L       +   DG+F+RESVCKAVK VM
Sbjct  361   SLMESLVNKCQVVLLPHIGDQILNARMMGGDL-KVGVEVEKGGDGLFTRESVCKAVKMVM  419

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             DE SEIGREV+ NH K R F L   ++S Y+ +F   LQD
Sbjct  420   DEDSEIGREVKANHKKWRDFFLTEGIESSYIQNFVHGLQD  459



>ref|XP_004485850.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Cicer arietinum]
 gb|AGU14087.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   496 bits (1277),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 259/450 (58%), Positives = 338/450 (75%), Gaps = 0/450 (0%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             A  +H+AMYPWF +GHLT +  ++NKLA +GH+ISFL+PKNT SKLE FNLHP+LISF+P
Sbjct  3     ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFLMPKNTISKLEHFNLHPNLISFIP  62

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I +P + GLP G+ETT+D+PF    LLM AMD T+  IE  L++L+  +VF+DFT+WLP+
Sbjct  63    ITIPHVHGLPLGSETTADLPFSLHSLLMTAMDLTEPIIEDSLRELRPHMVFFDFTYWLPA  122

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             LA ++GIK++ Y TISP   GY +SPER++  K LTEAD++  P SFP  +IKL  HEAR
Sbjct  123   LACQLGIKALHYCTISPATVGYLISPERKLHEKSLTEADLINPPPSFPPSAIKLQPHEAR  182

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
             G    TV  +G DI+F +R   A +  D + + TCRE+EG +CDY+E Q +K V LAGP 
Sbjct  183   GLATSTVNGYGKDISFMERQLIAFTSCDAIVFKTCREMEGLYCDYLERQMRKQVFLAGPV  242

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
              P P  ST+++KW  WLG+FK  +VI+CAFGSEC L+ ++F+ELL G ELT +PF AALK
Sbjct  243   FPNPPTSTLKEKWVTWLGRFKPKTVIFCAFGSECILKSNQFKELLLGFELTKIPFIAALK  302

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
              P  AE+I++A PE   E+ +GRG+V G+WVQQQL L HPSVGCFV+HCG  SL+EA+VN
Sbjct  303   LPIGAETIKSAFPEGFSERTKGRGVVEGDWVQQQLILSHPSVGCFVTHCGSGSLTEAMVN  362

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             +CQ+VLLP  GDQ INARIMS  LKVGVEVEK +E+G+F+RE+VCKAV  VMD +SE+G 
Sbjct  363   ECQLVLLPHAGDQFINARIMSGDLKVGVEVEKCKENGLFTREAVCKAVMDVMDNESELGH  422

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
              VR NH K R FLL+  L++ Y+D+  QKL
Sbjct  423   MVRTNHAKWREFLLSKGLENSYVDNLVQKL  452



>ref|XP_003607531.1| Glucosyltransferase [Medicago truncatula]
 gb|AES89728.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=462

 Score =   496 bits (1276),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 251/456 (55%), Positives = 333/456 (73%), Gaps = 3/456 (1%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             + ++  H+AMYPWF +GH T F  LANKLA KGH+I+F  PK+ QSKLE FNL+P LI+F
Sbjct  2     ASSSPLHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITF  61

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
             + I VP + GLP  AETT+DVP+P    +M AMD TQ DIE  L +LK  +VFYDFTHW+
Sbjct  62    ITIKVPHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFTHWI  121

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             PSL +++GIK+  Y  IS +M GY+L+P R   G  LTE D+M+ P  +PD SI+LH+HE
Sbjct  122   PSLTKRLGIKAFHYCIISSIMVGYSLTPARYSQGNNLTEFDLMQPPYGYPDSSIRLHSHE  181

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
             A+   A     FG ++ F+DR   A++E+D L Y TCREIEG + DY++ QF K VL +G
Sbjct  182   AKALAAMRKNTFGSNVLFYDRQAIALNEADALGYRTCREIEGPYLDYVQKQFNKSVLTSG  241

Query  870   palpvPSKST--MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             P L +       +++KW+ WLG FK  SV+YC FGSECTL  ++FQEL+ GLEL+GMPFF
Sbjct  242   PVLQILENPNYVLDEKWATWLGGFKADSVVYCCFGSECTLIPNQFQELILGLELSGMPFF  301

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPPF   +IE A+PE L E+I+GRG+V+G WVQQQL L+HPSVGCF++HCG  SLSE
Sbjct  302   AALKPPFGFATIEEALPEGLAERIKGRGVVYGGWVQQQLILEHPSVGCFITHCGSGSLSE  361

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALVN CQ+VLLP  GD+I+NARIM+ +L       + +EDG+++++SVCKAV  VMD+++
Sbjct  362   ALVNKCQLVLLPNFGDRILNARIMANNL-KVGVEVEKDEDGLYTKDSVCKAVSIVMDDEN  420

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             E  + VR NH K+R  LLN DL+S Y+D+F +KLQ+
Sbjct  421   ETSKTVRANHAKIREMLLNKDLESSYIDNFCKKLQE  456



>ref|XP_007025501.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY28123.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   494 bits (1273),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 260/447 (58%), Positives = 332/447 (74%), Gaps = 0/447 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             HMAMYPWF VGH+T F  ++NKLA +GH+ISF +P  TQSK E FNLHP +I+F+PI VP
Sbjct  7     HMAMYPWFAVGHITSFLHISNKLAERGHKISFFLPTKTQSKFEPFNLHPDVITFIPIKVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              I GLP G ETT+D+PF    LLM AMD T+  IE  L++LK   +F+DFT W+P+L  +
Sbjct  67    HIDGLPLGTETTTDIPFSLQPLLMAAMDLTEPAIEASLRELKPHFLFFDFTFWMPALCHR  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKS++Y TISP   GY +SP R+++ K LT +D+M+ P  FP  SIKL  HEARG  A
Sbjct  127   LGIKSMYYCTISPATVGYLISPTRKILEKGLTGSDLMEPPLGFPSSSIKLRDHEARGLAA  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
              T  ++G  I+F  R  TA++E D + + TCREIEG +CDY+E QF+KPV+LAGP  P P
Sbjct  187   ATTREYGSGISFVVRQLTALNECDAIGFKTCREIEGPYCDYVEKQFEKPVILAGPVAPEP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
                T+E++W   L  F+  +VI+CAFGSEC L KD+FQEL+ GLELTG+PF  ALK P  
Sbjct  247   PNKTLEERWEKLLSSFQAQTVIFCAFGSECVLNKDQFQELVLGLELTGLPFLVALKAPMG  306

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
             AE+ E+A+PE  +E+++GRG VHG WV QQL L HPSVGCFV+HCG  SLSEA+VNDCQ+
Sbjct  307   AETAESALPEGFQERVKGRGFVHGSWVPQQLILSHPSVGCFVTHCGSGSLSEAMVNDCQL  366

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQIINAR+M+  LKVGVEVEKGEEDG+F ++ VCKAV A+MD+ SE+G+E R 
Sbjct  367   VLLPHVGDQIINARLMAGDLKVGVEVEKGEEDGLFRKDDVCKAVMAMMDDDSEVGKEARA  426

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             NH K + FLL   L+  Y+DSF +KL 
Sbjct  427   NHAKWKDFLLGKGLEISYIDSFVEKLH  453



>gb|AES89730.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=462

 Score =   493 bits (1269),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 253/454 (56%), Positives = 331/454 (73%), Gaps = 3/454 (1%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             ++  H+AMYPWF +GH T F  LANKLA KGH+I+F  PK+ QSKLE FNL+P LI+F+ 
Sbjct  4     SSPLHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITFIT  63

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I VP + GLP  AETT+DVP+P    +M AMD TQ DIE  L +LK  +VFYDFTHW+PS
Sbjct  64    IKVPHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFTHWIPS  123

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             L +++ IK+  Y  IS +M GY L+P R   GK LTE D+M+ P+ +P  SIKLH+HEA+
Sbjct  124   LTKRLDIKAFHYCIISSIMIGYTLAPSRYSKGKDLTEFDLMQPPSGYPGSSIKLHSHEAK  183

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
              F A     +G ++ F+DR   A++E+D L Y TCREIEG + DYI+ QF KPVL +GP 
Sbjct  184   AFAAMRKNTYGSNVLFYDRQAIALNEADALGYKTCREIEGPYLDYIQKQFNKPVLTSGPV  243

Query  864   lpvPSKST--MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             LP+   S   +++ W+ WLG+FK  SV+YC FGSEC L+ + FQEL+ GLELTGMPFFAA
Sbjct  244   LPILENSNYVLDENWATWLGRFKTDSVVYCCFGSECVLKPNTFQELMLGLELTGMPFFAA  303

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPPF  E+IE A+PE   E+++GRG+V+G WVQQQL L+HPSVGCF++HCG  SLSEAL
Sbjct  304   LKPPFGFETIEEALPEGFSERVEGRGVVYGGWVQQQLILEHPSVGCFITHCGSGSLSEAL  363

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             VN CQ+VLLP VGDQI+NAR+M  +L       +  EDG +++++VCKAV  VM+++ EI
Sbjct  364   VNKCQLVLLPNVGDQILNARMMGNNL-KVGVEVEKGEDGFYTKDNVCKAVSIVMNDEDEI  422

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              + VR NH K+R  LLN DL+S Y+D+F  KLQ+
Sbjct  423   SKTVRSNHTKIREMLLNKDLESSYIDNFCMKLQE  456



>ref|XP_010111152.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXC30543.1| UDP-glycosyltransferase [Morus notabilis]
Length=460

 Score =   491 bits (1263),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 264/448 (59%), Positives = 331/448 (74%), Gaps = 2/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GHLT F  ++NKLA +GHRISF IP  TQ KL SFNLHPHLISF+PI VP
Sbjct  6     HIAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPTETQPKLSSFNLHPHLISFLPIDVP  65

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              +PGLPP AETT+D+P+    LLM AMD T+  IE  L  LK   VF+DFTHWLP  AR+
Sbjct  66    HVPGLPPTAETTNDIPYALFSLLMTAMDLTRPAIEASLVQLKPHFVFFDFTHWLPQSARR  125

Query  1212  IG-IKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPS-IKLHAHEARGF  1039
             IG IK++ Y TISP   GY +SPER +  K L E+D++  P SFP  S I+L AHEARG 
Sbjct  126   IGNIKTLLYCTISPAAVGYLISPERELNEKSLKESDLLVPPKSFPSLSCIRLSAHEARGL  185

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
                TV + G  I+F +R   A+++SD + + T RE+EG +CDYIE QF K V+LAGP +P
Sbjct  186   VKETVKELGAGISFLERQLIALNDSDAIGFKTSREMEGVYCDYIERQFGKKVILAGPVVP  245

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
              P  S +E+KW+++LG F    VI+CAFGSEC L  D+FQEL+ GLELTG+PF  ALKPP
Sbjct  246   EPPNSALEEKWANFLGNFGCKKVIFCAFGSECVLENDQFQELIIGLELTGLPFLVALKPP  305

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
                E IE A+PE  +E+++ RGIVHG WVQQQL L+H SVGCFV+HCG  SL E L+N+C
Sbjct  306   KGYEKIECALPEGFEERVKERGIVHGGWVQQQLILRHSSVGCFVTHCGSGSLLEGLMNEC  365

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             Q+VL+P VGDQIINAR+MS  L+VGVEV++G E G F+RE VCKAVK VMD++SE+G+EV
Sbjct  366   QLVLVPNVGDQIINARMMSGDLRVGVEVKRGNESGAFTREGVCKAVKDVMDDESEVGKEV  425

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             R NHDK R FLL+  L+  Y+D F ++L
Sbjct  426   RTNHDKWREFLLSKGLEDSYIDCFVEEL  453



>gb|KDO77743.1| hypothetical protein CISIN_1g039043mg, partial [Citrus sinensis]
Length=449

 Score =   489 bits (1260),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 261/445 (59%), Positives = 336/445 (76%), Gaps = 1/445 (0%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             +YPWF +GHLT F  +ANKLA +GHRISFL+P    +K E  NLH +LI+F+P+ VP + 
Sbjct  1     IYPWFAMGHLTPFLHIANKLAERGHRISFLLPAKAITKFEPSNLHRNLITFIPVSVPRVD  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLPPGAETT+DVPFP   LLM AMD T+  IE +L+ LK D VF+DFTHWLP LARK GI
Sbjct  61    GLPPGAETTNDVPFPLHPLLMTAMDLTEPAIESVLRHLKPDFVFFDFTHWLPPLARKFGI  120

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTARTV  1024
             KSV Y  ISP   GY LSPER++  + LT+ D+++ P  FP   I+L AHEARG  A TV
Sbjct  121   KSVLYCIISPATIGYLLSPERKLRERTLTDNDLLRPPQGFPTSKIRLRAHEARGLAAATV  180

Query  1023  MKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSKS  844
              +FGG ++F  R   ++SE D + + TCREIEG +CDYI +QF KPV+L+GPALP   + 
Sbjct  181   KEFGGGLSFAKRNLLSLSECDAIGFKTCREIEGPYCDYIGSQFGKPVILSGPALPESPRF  240

Query  843   TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeaes  664
              +E++W   LG FK  S+I+CAFGSEC L K++FQEL+ G EL+G+PF  ALKPP   ++
Sbjct  241   ALEERWETLLGSFKSKSLIFCAFGSECVLNKEQFQELVLGFELSGLPFLVALKPPVGHDT  300

Query  663   ieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVLL  484
             IE+A+PE  +E+++GRG +HG WVQQQL L+HPSVGCFV+HCG  SLSEA+VN+CQ+VLL
Sbjct  301   IESALPEGFEERVKGRGFIHGGWVQQQLILKHPSVGCFVTHCGSGSLSEAMVNECQLVLL  360

Query  483   PQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK-SEIGREVRGNH  307
             P VGDQIINAR+M   LKVGVEVEKG+EDG+F+R+ VCKAVKAV+D+  SE+G+E++ NH
Sbjct  361   PNVGDQIINARLMGEELKVGVEVEKGDEDGLFTRDGVCKAVKAVIDDDHSEVGKEIKENH  420

Query  306   DKLRGFLLNADLDSKYMDSFNQKLQ  232
              K R FL +  L++ Y+D F QKL 
Sbjct  421   AKWREFLRSERLENSYLDGFVQKLH  445



>ref|XP_010035826.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Eucalyptus grandis]
 gb|KCW47284.1| hypothetical protein EUGRSUZ_K01076 [Eucalyptus grandis]
Length=457

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 274/448 (61%), Positives = 339/448 (76%), Gaps = 0/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPW  +GHLT F  LANKLA KGH+ISFL+P  TQ+KLE FN HP LI+FVPI +P
Sbjct  7     HIAMYPWLAMGHLTPFLHLANKLAKKGHKISFLVPPRTQAKLEHFNRHPDLITFVPIAIP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPP AETTSDVP+P   L+M AMD T+  +  +L+ LK   V +DFTHWLP++AR 
Sbjct  67    HVEGLPPDAETTSDVPYPLHPLIMTAMDHTEPTVHQLLQTLKPHCVLHDFTHWLPAIARD  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKSV Y  ISP+   Y LSP R +   +LTEAD M  PA +P+ SIKLH HEAR   A
Sbjct  127   LGIKSVHYCIISPVTVSYTLSPVRHLSAHKLTEADYMVPPAGYPNSSIKLHLHEARALIA  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                  +G +I F DR+F    ESD L++ +CREIE  + +Y+++QF KPVLL+GP +P P
Sbjct  187   IRYKTYGSNIGFSDRMFAGYVESDILSFRSCREIEQPYIEYLKSQFGKPVLLSGPVIPEP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
             S S +++KW +WLG FK+GSVIYCAFGSECT++KD+FQELL GLELTG+PF AALKPPF 
Sbjct  247   STSGLDEKWVEWLGDFKDGSVIYCAFGSECTMQKDQFQELLLGLELTGLPFLAALKPPFG  306

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
               SIE A+PE  +E++QGRGIVHG WVQQQL LQHP++GCF++HCG +S  EALVN CQ+
Sbjct  307   TSSIEEALPEGFEERVQGRGIVHGGWVQQQLILQHPAIGCFITHCGTSSTIEALVNKCQL  366

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLPQVGDQI NAR+M  +LKVGVEVEKGEEDG  ++ESVCKAV  VMDE    G EVR 
Sbjct  367   VLLPQVGDQIFNARMMGNNLKVGVEVEKGEEDGRLTKESVCKAVNTVMDEGDAYGNEVRE  426

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH K+R  LL+  L+S YMD F+Q+LQ+
Sbjct  427   NHAKIREILLDKKLESTYMDCFDQELQN  454



>ref|XP_002522508.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF39808.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=457

 Score =   488 bits (1255),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 261/455 (57%), Positives = 343/455 (75%), Gaps = 2/455 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MG +  T+H+ MYPWF +GHLT F  L+NKLA +GH+ISFL+P  T  K + FNLHP LI
Sbjct  1     MGEE--TFHIVMYPWFALGHLTSFLHLSNKLAERGHKISFLLPSKTIKKFQPFNLHPDLI  58

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F+P+ VP + GLPPG+ETT+DVPF    LLM AMD T++ IE  L +LK + VF+DFTH
Sbjct  59    IFIPVTVPHVDGLPPGSETTTDVPFSLHSLLMTAMDLTESVIEFHLTNLKPNFVFFDFTH  118

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLP+L RK+G+KSV Y TISP   GY +SPER+++ K LT AD+MK P +FP  SIKL A
Sbjct  119   WLPALCRKLGVKSVHYCTISPATVGYLISPERKLLEKSLTAADLMKPPLNFPPSSIKLRA  178

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEA+G  A T   +G  I+F +R   + +E D +++ TC E+EG +C Y+E QF KPV+L
Sbjct  179   HEAQGLAAVTTKPYGSSISFLERQLHSFNECDAISFKTCMEMEGPYCHYVERQFGKPVIL  238

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             AGP +P    S +++K S+ L   + G V++CAFGSEC L+K++ QEL+ GLELTG+PF 
Sbjct  239   AGPVVPKSPSSVLDEKISNMLDNSEAGKVVFCAFGSECILKKNQLQELVLGLELTGLPFL  298

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPP  AE+IE+A+PE  +E+++G+G V+G WVQQQL L+HPSVGCF++HCG  SLSE
Sbjct  299   AALKPPMGAETIESALPEGFEERVKGKGYVYGGWVQQQLILKHPSVGCFITHCGSGSLSE  358

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             A+VN CQ+VLLP VGDQIINAR+M   LK+GVEVEKGEEDG+F+++ V KAVKAVMD+ S
Sbjct  359   AMVNKCQLVLLPNVGDQIINARLMDGDLKIGVEVEKGEEDGLFTKDGVRKAVKAVMDDDS  418

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             E+G+EVR NH K R FLL+  L++ Y+D+F  KL 
Sbjct  419   EVGKEVRTNHMKWREFLLSKGLENSYIDAFVNKLH  453



>ref|XP_004499897.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Cicer arietinum]
 gb|AGU14119.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   488 bits (1255),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 257/450 (57%), Positives = 334/450 (74%), Gaps = 0/450 (0%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             A  +H+AMYPWF +GHLT +  ++NKLA +GH+ISF IPKNT SKLE FNLHP+LISF+P
Sbjct  3     ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFFIPKNTISKLEHFNLHPNLISFIP  62

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I +P + GLP G+ETT+D+PF    LLM AMD T+  IE  L++L+  +VF+DFT+WLP+
Sbjct  63    ITIPHVDGLPLGSETTADLPFSLHSLLMTAMDLTEPIIEDSLRELRPHMVFFDFTYWLPA  122

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             LA ++GIK++ Y TISP   GY +SPER++  K LTEAD++  P SFP  +IKL  HEAR
Sbjct  123   LACQLGIKALHYCTISPATVGYLISPERKLHEKSLTEADLINPPPSFPPSAIKLQPHEAR  182

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
             G    TV  +G DI+F  R   A +  D + + TCRE+EG +CDY+E Q +K V LAGP 
Sbjct  183   GLATSTVKGYGKDISFMQRQLIAFTSCDAIVFKTCREMEGLYCDYLERQMRKQVFLAGPV  242

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
              P P   T+E+KW  WLG FK  +VI+CAFGSEC L+ ++F+ELL G ELT +PF AALK
Sbjct  243   FPKPPTFTLEEKWVTWLGGFKPKTVIFCAFGSECILKSNQFKELLLGFELTKIPFLAALK  302

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP  AE+I++A+PE   E+ +GRG+V G+WVQQQL L HPSVGCFV+HCG  SL+EA++N
Sbjct  303   PPIGAETIKSALPEGFSERTKGRGVVEGDWVQQQLILSHPSVGCFVTHCGSGSLTEAMIN  362

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             +CQ+VLLP  GDQ INARIMS  LKVGVEVEK +E+G+F+R++VCKAV  VMD +SE+  
Sbjct  363   ECQLVLLPHAGDQFINARIMSGDLKVGVEVEKCKENGLFTRKAVCKAVMDVMDNESELSH  422

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
              VR NH K R FLL+  L++ Y+D   QKL
Sbjct  423   MVRTNHAKWREFLLSKGLENSYVDDLVQKL  452



>ref|XP_008245371.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Prunus mume]
Length=456

 Score =   487 bits (1253),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 269/451 (60%), Positives = 333/451 (74%), Gaps = 5/451 (1%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T H+AMYPWFG+GHLT F  ++NKLA +GHRISF  P   Q KLE+FNLH H ISF+PI 
Sbjct  5     TLHIAMYPWFGMGHLTSFLHISNKLAERGHRISFFSPSKVQQKLEAFNLHSHRISFIPID  64

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GLPPG ETT+DVPFP   LL+ AMD T+  IE  L +L+ + VF+DFTHWLP+L 
Sbjct  65    VPHVDGLPPGTETTADVPFPLHSLLVTAMDLTRPAIEQALCELRPNFVFFDFTHWLPALL  124

Query  1218  RK--IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
              K  IGIKSV Y TISP   G+ +SPER+++ K LTEAD+M+ P SFP  SIKL  HEAR
Sbjct  125   HKLDIGIKSVHYCTISPATVGFLISPERKLLEKSLTEADLMEPPPSFPASSIKLQTHEAR  184

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                  T+M++G  +TF +R   + S  D +A+ TCRE+EG +CDY+ETQF KPV+LAGP 
Sbjct  185   ALVGATLMEYGRGVTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKPVILAGPV  244

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P    + +++KW+ W   F+  +VIYCAFGSEC L K +FQELL G ELTG+PFFAALK
Sbjct  245   VPESPTTELDEKWAKWFDGFEAKTVIYCAFGSECILNKAQFQELLLGFELTGLPFFAALK  304

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP   ESIEAA+PE  +E+ QGRGIVHG WV        PSVGCFV+HCG  SLSEAL+N
Sbjct  305   PPMGVESIEAALPEGFEERGQGRGIVHGGWVXXX---XXPSVGCFVTHCGSGSLSEALMN  361

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             +C++VLLP VGDQIINAR+MS  LKVGVEVEKG+EDGVF+ E VCKAVK VMD++SE+ +
Sbjct  362   ECRLVLLPNVGDQIINARMMSRDLKVGVEVEKGDEDGVFTTEGVCKAVKTVMDDESEVAK  421

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             EVR NH K R F     L++ ++DSF QKL 
Sbjct  422   EVRTNHAKWREFFTGKGLENSWLDSFEQKLH  452



>ref|XP_007213460.1| hypothetical protein PRUPE_ppa024453mg [Prunus persica]
 gb|EMJ14659.1| hypothetical protein PRUPE_ppa024453mg [Prunus persica]
Length=450

 Score =   484 bits (1247),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 265/446 (59%), Positives = 330/446 (74%), Gaps = 2/446 (0%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPWF +GHLT F  ++NKLA +GHRISF  P   Q KLE+FNLH H ISF+PI VP + 
Sbjct  1     MYPWFAMGHLTSFLHISNKLAQRGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDVPHVD  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK--I  1210
             GLPPG ETT+DVP     LL+ AMD T+  IE  L +L+ + VF+DFTHWLP L  K  I
Sbjct  61    GLPPGTETTADVPSLLQPLLVTAMDLTRPAIEQALCELRPNFVFFDFTHWLPELLHKLDI  120

Query  1209  GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTAR  1030
             GIKSV+Y TISP   G+ + PER+++   LTEAD+M+ P SFP  SIKL  HEAR     
Sbjct  121   GIKSVYYCTISPATVGFLMCPERKLLEISLTEADLMEPPPSFPASSIKLQTHEARALVGA  180

Query  1029  TVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPS  850
             ++M+FG  +TF +R   + S  D +A+ TCRE+EG +CDY+ETQF KPV+LAGP +P   
Sbjct  181   SLMEFGRGVTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKPVILAGPVVPESP  240

Query  849   KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfea  670
              + +++KW+ W   FK  +VIYCAFGSEC L K +FQELL G ELTG+PFFAALKPP   
Sbjct  241   TTELDEKWAKWFDGFKAKTVIYCAFGSECILNKAQFQELLLGFELTGLPFFAALKPPMGV  300

Query  669   esieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIV  490
             ESIEAA+PE  +E++QG+GIVHG WVQQ L L+HPSVGCFV+HCG  SLSEALVN+C++V
Sbjct  301   ESIEAALPEGFEERVQGKGIVHGGWVQQPLILKHPSVGCFVTHCGSGSLSEALVNECRLV  360

Query  489   LLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGN  310
             LLP +GDQIINAR+MS  LKVGVEVEK +EDGVF+ E VCKAVK VMD++SE+ +EV  N
Sbjct  361   LLPNMGDQIINARMMSRDLKVGVEVEKEDEDGVFTTEGVCKAVKTVMDDESEVAKEVWTN  420

Query  309   HDKLRGFLLNADLDSKYMDSFNQKLQ  232
             H K R FL   +L++  +DSF QKL 
Sbjct  421   HAKWREFLSGKELENSCLDSFEQKLH  446



>ref|XP_010035825.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Eucalyptus grandis]
 gb|KCW47287.1| hypothetical protein EUGRSUZ_K01079 [Eucalyptus grandis]
Length=457

 Score =   485 bits (1248),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 271/448 (60%), Positives = 337/448 (75%), Gaps = 0/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPW  +GHLT F  LANKLA KGH+ISFLIP  T++KLE FN HP LI+FVPI +P
Sbjct  7     HIAMYPWLAMGHLTPFLHLANKLAKKGHKISFLIPPRTRAKLEHFNRHPDLITFVPIAIP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPP AETTSDVP+P   L+M AMD T+  +  +L+ LK   VF+DFTHWLP++A  
Sbjct  67    HVEGLPPDAETTSDVPYPLHPLIMTAMDHTEPTVRQLLQTLKPHCVFHDFTHWLPAIAHD  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKSV Y  ISP+   Y LSP R +   +LTEAD M  PA +P+ SIKLH HEAR   A
Sbjct  127   LGIKSVHYCIISPVTVSYTLSPARHLSAHKLTEADYMVPPAGYPNSSIKLHLHEARALIA  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                  +G +I F DR+F    ESD L++ +CREIE  + +Y+++QF KPVLL+GP +P P
Sbjct  187   IRYKTYGSNIGFSDRMFAGYVESDILSFRSCREIEQPYIEYLKSQFGKPVLLSGPVIPEP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
             S S +++KW +WLG FK+GSVIYCAFGSECT++KD+FQELL GLELTG+PF AALKPPF 
Sbjct  247   STSGLDEKWVEWLGDFKDGSVIYCAFGSECTMQKDQFQELLLGLELTGLPFLAALKPPFG  306

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
               SIE A+P   +E++QGRG VHG WVQQQL LQHP++GCF++HCG +S  EALVN CQ+
Sbjct  307   TSSIEEALPVGFEERVQGRGTVHGGWVQQQLILQHPAIGCFITHCGTSSTIEALVNKCQL  366

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLPQVGDQI NAR+M  +LKVGVEVEKGEEDG  ++ESVCKAV  VMDE    G EVR 
Sbjct  367   VLLPQVGDQIFNARMMGNNLKVGVEVEKGEEDGRLTKESVCKAVNTVMDEGDAYGNEVRE  426

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH K+R  LL+  L+S Y+D F+Q+LQ+
Sbjct  427   NHAKIREILLDKKLESTYIDCFDQELQN  454



>ref|XP_003607533.1| Glucosyltransferase [Medicago truncatula]
Length=552

 Score =   487 bits (1254),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 250/448 (56%), Positives = 327/448 (73%), Gaps = 3/448 (1%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             ++  H+AMYPWF +GH T F  LANKLA KGH+I+F  PK+ QSKLE FNL+P LI+F+ 
Sbjct  4     SSPLHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLITFIT  63

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I VP + GLP  AETT+DVP+P    +M AMD TQ DIE  L +LK  +VFYDFTHW+PS
Sbjct  64    IKVPHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNLKPQIVFYDFTHWIPS  123

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             L +++ IK+  Y  IS +M GY L+P R   GK LTE D+M+ P+ +P  SIKLH+HEA+
Sbjct  124   LTKRLDIKAFHYCIISSIMIGYTLAPSRYSKGKDLTEFDLMQPPSGYPGSSIKLHSHEAK  183

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
              F A     +G ++ F+DR   A++E+D L Y TCREIEG + DYI+ QF KPVL +GP 
Sbjct  184   AFAAMRKNTYGSNVLFYDRQAIALNEADALGYKTCREIEGPYLDYIQKQFNKPVLTSGPV  243

Query  864   lpvPSKST--MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             LP+   S   +++ W+ WLG+FK  SV+YC FGSEC L+ + FQEL+ GLELTGMPFFAA
Sbjct  244   LPILENSNYVLDENWATWLGRFKTDSVVYCCFGSECVLKPNTFQELMLGLELTGMPFFAA  303

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPPF  E+IE A+PE   E+++GRG+V+G WVQQQL L+HPSVGCF++HCG  SLSEAL
Sbjct  304   LKPPFGFETIEEALPEGFSERVEGRGVVYGGWVQQQLILEHPSVGCFITHCGSGSLSEAL  363

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             VN CQ+VLLP VGDQI+NAR+M  +L       +  EDG +++++VCKAV  VM+++ EI
Sbjct  364   VNKCQLVLLPNVGDQILNARMMGNNL-KVGVEVEKGEDGFYTKDNVCKAVSIVMNDEDEI  422

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSF  247
              + VR NH K+R  LLN DL+S Y+D+F
Sbjct  423   SKTVRSNHTKIREMLLNKDLESSYIDNF  450



>gb|KDP21029.1| hypothetical protein JCGZ_21500 [Jatropha curcas]
Length=458

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 265/452 (59%), Positives = 333/452 (74%), Gaps = 1/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
              T+H+AMYPWF +GHLT F  L+NKLA +GH+ISFL+P  T+S  E FNL+P+LI+ +PI
Sbjct  4     NTFHIAMYPWFALGHLTSFLHLSNKLAERGHKISFLLPPKTKSNFEPFNLYPNLITLIPI  63

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +P + GLPPG+ETT+DVPFP   L+M AMD TQ  IE  L++LK   VF+DFTHWLP+L
Sbjct  64    DIPHVDGLPPGSETTADVPFPLHPLIMTAMDLTQPTIEFHLRNLKPHFVFFDFTHWLPAL  123

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQL-TEADMMKAPASFPDPSIKLHAHEAR  1045
             +RK+ IKSV Y TISP   GY L PE ++   ++ TE D+M  P SFP  SIKL AHEAR
Sbjct  124   SRKLNIKSVHYYTISPATVGYLLRPEIKIADNKIRTEVDLMNPPPSFPRSSIKLRAHEAR  183

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                A    +FG  I+F  R +   SE D +++ TC E+EG +C+YIE QF K V+LAGP 
Sbjct  184   HLAAGAKREFGSGISFSQRQWICFSECDAVSFKTCTEMEGPYCNYIEKQFCKKVILAGPV  243

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P P    ++Q+    L  F+EGSVI+CAFG+EC L KD+FQELL GLE TG+PFFAALK
Sbjct  244   VPEPPSLVLDQEIERILDNFEEGSVIFCAFGTECLLNKDQFQELLLGLESTGLPFFAALK  303

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP   E IE+A+PE  +E+++GRG V+G+WVQQQL LQHPSVGCFV+HCG  SLSEA+V 
Sbjct  304   PPIGVEKIESALPEGFQERVKGRGFVYGDWVQQQLILQHPSVGCFVTHCGSGSLSEAMVT  363

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
              CQ+VLLP VGDQIINAR+M   LKVGVEVEKGEEDG+FS+  VCKAVKAVM+  SE+  
Sbjct  364   KCQLVLLPNVGDQIINARLMGGDLKVGVEVEKGEEDGLFSKNGVCKAVKAVMNNDSEVKE  423

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EV+ NH K R FLL+  L+  Y+D F QKL +
Sbjct  424   EVKQNHTKWREFLLSQGLEDSYIDGFVQKLHE  455



>ref|XP_007132838.1| hypothetical protein PHAVU_011G128700g [Phaseolus vulgaris]
 gb|ESW04832.1| hypothetical protein PHAVU_011G128700g [Phaseolus vulgaris]
Length=457

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 244/453 (54%), Positives = 330/453 (73%), Gaps = 1/453 (0%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             +A   H+AMYPW  +GH   F  L NKLA  GHRISF+ P   Q+KLE FNLHP LI+FV
Sbjct  2     EARPLHIAMYPWLAMGHQIPFLHLCNKLAIGGHRISFITPPKAQAKLEPFNLHPELITFV  61

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
              I VP + GLPP A+TT+DV +P    +M AMD T++DI+ +L  LK D+VFYDFTHW+P
Sbjct  62    TITVPHVEGLPPDAQTTADVTYPLQPNIMTAMDLTKDDIQTLLTHLKPDLVFYDFTHWMP  121

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA  1048
             +L +K+GIK+V Y  +S +M GY L+P R   G  L+E+D+M+ P  +P+ SIKLHAHEA
Sbjct  122   TLTKKLGIKAVHYCIVSSVMVGYTLTPARYYQGVDLSESDLMEPPQGYPNSSIKLHAHEA  181

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
               F  +    FG D+ F+DR FTA++E+D LAY TCREIEG + DYI  QF KPVL +GP
Sbjct  182   CAFARKRKDTFGSDVLFYDRQFTAMNEADVLAYRTCREIEGPYLDYIGNQFNKPVLASGP  241

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              +  P  + +E+K+S WLG F+ G+++YC FGSECTLR ++FQEL+ GLELTGMPF AA+
Sbjct  242   VILEPPTTELEEKFSTWLGGFEPGTMVYCCFGSECTLRPEQFQELVLGLELTGMPFLAAV  301

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   E++E+A+PE  +E+++GRG V+G WV QQL L HPSVGCF++HCG  SLSEALV
Sbjct  302   KPPVGFETVESAMPEGFEERVKGRGFVYGGWVMQQLILAHPSVGCFITHCGSGSLSEALV  361

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             N CQ+VLLP VGDQI+NAR+M+ +L       +  EDG++++++VCK V  VMDE++E  
Sbjct  362   NKCQLVLLPNVGDQILNARMMANNL-EVGVEVEKGEDGMYTKDNVCKVVSIVMDEENETS  420

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             ++VR NH ++R  LL+ DL+S Y  +F  +L++
Sbjct  421   KKVRDNHTRIRETLLDKDLESYYFHNFCTRLRE  453



>gb|ACU24192.1| unknown [Glycine max]
Length=458

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 261/453 (58%), Positives = 335/453 (74%), Gaps = 1/453 (0%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             A++ H+AM+PWF +GHLT +  L+NKLA +GHRISF IPK TQ KLE FNL PHLI+F P
Sbjct  3     ASSMHIAMFPWFAMGHLTPYLHLSNKLAKRGHRISFFIPKRTQHKLEQFNLFPHLITFYP  62

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L +LK  +VF+DFT+WLP+
Sbjct  63    INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLIELKPQIVFFDFTYWLPN  122

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             L R++GIKS  Y  +SP    Y  SP R      LTE D+M+ P  +P  SIKLHAHEA+
Sbjct  123   LTRRLGIKSFQYMIVSPATVAYNASPPRMQNSVNLTEVDLMQPPLGYPVSSIKLHAHEAK  182

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                ++   +FG  + F+DR++  +S SD + +  CREIEG + DY+E QF K VLL+GP 
Sbjct  183   FLASKRNWEFGSGVLFYDRLYGGLSPSDAIGFKGCREIEGPYVDYLEEQFGKSVLLSGPI  242

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P P  + +E KW  WL +FK  SVI+CA GSE  L  D+FQE L GLELTG+PF A LK
Sbjct  243   IPEPPNTVLEGKWGSWLERFKPDSVIFCALGSEWKLPHDQFQEFLLGLELTGLPFLAVLK  302

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
              P   E++EAA+PE  KE+++ RGIVHG W+QQQL L+HPSVGCF++HCG  SL+EALVN
Sbjct  303   TPIGFETLEAALPEGFKERVEERGIVHGGWIQQQLILEHPSVGCFITHCGAGSLTEALVN  362

Query  504   DCQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
              CQIVLLPQV GD I+NAR+M  +LK+GVEVEKGEEDG F++ESV KAVK VMD+++E+G
Sbjct  363   KCQIVLLPQVDGDHIVNARMMGENLKIGVEVEKGEEDGWFTKESVSKAVKIVMDDENEVG  422

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             REVR NH KLR FL++ +L+S  +D F QKL+D
Sbjct  423   REVRTNHAKLRNFLVSHNLESACVDGFCQKLRD  455



>ref|XP_003593675.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES63926.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 256/450 (57%), Positives = 332/450 (74%), Gaps = 0/450 (0%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             A  +H+AMYPWF +GHLT +  ++NKLA +GH+ISFL+P+NT SKLE FNLHP LISFVP
Sbjct  3     ANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFLMPRNTISKLEHFNLHPDLISFVP  62

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I +P + GLP G+ETT+D+PF    LLM AMD T+  IE  L++L+  +VF+DFT+WLP+
Sbjct  63    ITIPHVDGLPLGSETTADIPFSLHSLLMTAMDLTEPIIEDTLRELRPHMVFFDFTYWLPA  122

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             LA ++GIK++ Y TISP   GY +SPER++  K LTE D++  P SFP  +IKL  HEAR
Sbjct  123   LACRLGIKALHYCTISPATVGYLISPERKLHEKSLTEEDLIDPPPSFPPSAIKLQPHEAR  182

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
             G    TV  +G DI+F  R   + +  D + + TCRE+EG +CDY+E   +K V+LAGP 
Sbjct  183   GLATATVKGYGKDISFTKRQLISFTSCDAIVFKTCREMEGPYCDYLEKTMRKQVILAGPV  242

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             LP P  +T+E+KW  WLG FK  +VI+CAFGSEC L+ ++F+ELL G ELTGMPF AALK
Sbjct  243   LPDPPTTTLEEKWVTWLGGFKSKTVIFCAFGSECILKSNQFKELLLGFELTGMPFLAALK  302

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP  A++++ A+PE   E+ +GR IV G+WVQQQL L H SVGCFV+HCG  SL+EA+V 
Sbjct  303   PPIGAKTMKLALPEGFIERTKGRAIVVGDWVQQQLILSHQSVGCFVTHCGSGSLTEAMVT  362

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQ+VLLP  GDQ INARIMS  LKVGVEVEK E+DG+F++E+VCKAVK VMD + E+G 
Sbjct  363   DCQLVLLPHAGDQFINARIMSGDLKVGVEVEKSEDDGLFTKEAVCKAVKTVMDSEGELGH  422

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
              VR NH K   FLL+  L++ Y+D   QKL
Sbjct  423   MVRTNHAKWGKFLLSQGLENSYVDDLVQKL  452



>gb|KHN36711.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=458

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 260/453 (57%), Positives = 335/453 (74%), Gaps = 1/453 (0%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             A++ H+AM+PWF +GHLT +  L+NKLA +GHRISF IPK TQ KLE FNL PHLI+F P
Sbjct  3     ASSMHIAMFPWFAMGHLTPYLHLSNKLAKRGHRISFFIPKRTQHKLEQFNLFPHLITFYP  62

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L +LK  +VF+DFT+WLP+
Sbjct  63    INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLIELKPQIVFFDFTYWLPN  122

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             L R++GIKS  Y  +SP    Y  SP R      LTE D+M+ P  +P  SIKLHAHEA+
Sbjct  123   LTRRLGIKSFQYMIVSPATVAYNASPPRMQNSVNLTEVDLMQPPLGYPVSSIKLHAHEAK  182

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                ++   +FG  + F+DR++  +S SD + +  CREIEG + DY+E QF K VLL+GP 
Sbjct  183   FLASKRNWEFGSGVLFYDRLYGGLSLSDAIGFKGCREIEGPYVDYLEEQFGKSVLLSGPI  242

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P P  + +E +W  WL +FK  SVI+CA GSE  L  D+FQE L GLELTG+PF A LK
Sbjct  243   IPEPPNTVLEGRWGSWLERFKPDSVIFCALGSEWKLPHDQFQEFLLGLELTGLPFLAVLK  302

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
              P   E++EAA+PE  KE+++ RGIVHG W+QQQL L+HPSVGCF++HCG  SL+EALVN
Sbjct  303   TPIGFETLEAALPEGFKERVEERGIVHGGWIQQQLILEHPSVGCFITHCGAGSLTEALVN  362

Query  504   DCQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
              CQIVLLPQV GD I+NAR+M  +LK+GVEVEKGEEDG F++ESV KAVK VMD+++E+G
Sbjct  363   KCQIVLLPQVDGDHIVNARMMGENLKIGVEVEKGEEDGWFTKESVSKAVKIVMDDENEVG  422

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             REVR NH KLR FL++ +L+S  +D F QKL+D
Sbjct  423   REVRTNHAKLRNFLVSHNLESACVDGFCQKLRD  455



>ref|XP_011045872.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Populus euphratica]
Length=462

 Score =   481 bits (1237),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 266/460 (58%), Positives = 339/460 (74%), Gaps = 4/460 (1%)
 Frame = -3

Query  1608  GIGSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  1429
              I +  S+A   H+AMYPWF +GHLT F   +NKLA +GHR+SF +PK TQSK E FNLH
Sbjct  4     NIAARSSKA--LHIAMYPWFALGHLTAFVHFSNKLAERGHRVSFFLPKKTQSKFEPFNLH  61

Query  1428  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  1249
             P LI+F+PI VP + GLP G ETT++VPFP   LLM AMD T++ IE  L+ L    VF+
Sbjct  62    PDLITFIPITVPHVDGLPTGTETTTNVPFPLHPLLMTAMDLTEHVIEDHLRILNPHFVFF  121

Query  1248  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSI  1069
             DFTHWLP L+RK GIKSV +  ISP   GY LSPER++  + LT AD+M+ P SFP   I
Sbjct  122   DFTHWLPVLSRKHGIKSVHFCIISPATIGYLLSPERKL--ESLTAADLMQPPPSFPPSLI  179

Query  1068  KLHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQK  889
             KL AHEARG  A TV ++G +I+F +R   A+S+ D +A+ TCRE+EG + DYIE QF K
Sbjct  180   KLRAHEARGMCAVTVQQYGSNISFQERNLYALSQCDAMAFKTCREMEGPYSDYIEDQFGK  239

Query  888   pvllagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             PV+LAGP +P P  S +E+K +  L  FK  ++++CAFGSEC L+KD+FQEL+ GLELT 
Sbjct  240   PVILAGPIVPEPPNSVLEEKIAKMLDNFKAETLVFCAFGSECILKKDQFQELVLGLELTS  299

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PFFA LKPP  AE+IE+A+PE  +E+++GRG V+  WVQQQL L+HPSVGCFV+HCG  
Sbjct  300   LPFFAVLKPPIGAETIESALPEGFEERVKGRGFVYTGWVQQQLILRHPSVGCFVTHCGSG  359

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             SLSE +VN CQ+VLLP  GDQIINAR++   L VGVEV+KGEEDG+F+R  VC+AVKAVM
Sbjct  360   SLSEGMVNKCQLVLLPNAGDQIINARVVGGDLNVGVEVKKGEEDGLFTRHGVCEAVKAVM  419

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             D+ SE+G+ VR NH K R FLL   L++ Y+D F  KL +
Sbjct  420   DDDSEVGKLVRANHAKWREFLLGKGLENSYVDGFVHKLHE  459



>ref|XP_008371703.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=459

 Score =   479 bits (1234),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 263/453 (58%), Positives = 329/453 (73%), Gaps = 2/453 (0%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             A   H AMYPWF +GHLT F  ++NKLA +GHRISF IP  T  KLE+FNL+P  I+F+P
Sbjct  3     AKKLHXAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPVKTLQKLEAFNLYPDRIAFIP  62

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I VP +PGLPPG ETT+DVPFP   LLM AMD T+ +I   L++LK D VF+DFT W+P 
Sbjct  63    INVPHVPGLPPGTETTADVPFPLHSLLMTAMDLTRPEIGQALRELKPDFVFFDFTQWMPE  122

Query  1224  LARKI--GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             L  ++  G KS+ Y TISP    Y  +PER ++ KQ T AD+M  P SFP  SI L  HE
Sbjct  123   LLHELDMGTKSIHYCTISPATVLYLSTPERNLMEKQPTVADLMLPPPSFPASSITLRTHE  182

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
             ARG     + +FG  +TF  R F + S  D +A+ TCREIEG +CDYI TQ +KPV LAG
Sbjct  183   ARGLVDVMLKEFGRGVTFMQRQFRSFSGCDAIAFKTCREIEGPYCDYIGTQLRKPVFLAG  242

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P +P      +++KWS WL +F+  S+IYCAFGSEC L+ D+FQELL G E+TG+PFFAA
Sbjct  243   PVVPETPTKELDEKWSKWLERFEAKSMIYCAFGSECILKIDQFQELLXGFEITGLPFFAA  302

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP  AESIE+A+PE   E+ + RG+V+G WVQQ LFL+HPSVGCFV+HCG  SLSEAL
Sbjct  303   LKPPMGAESIESALPEGFAERTRERGVVYGGWVQQPLFLRHPSVGCFVTHCGSGSLSEAL  362

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             VN+CQ+VLLP VGDQIINAR+MS  LKVGVEVEKG+ DG+F++E V KAV+AVM++  E+
Sbjct  363   VNECQLVLLPNVGDQIINARVMSRDLKVGVEVEKGDLDGLFTKEGVSKAVEAVMEDGGEV  422

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
               EVR NH K R FL   +L++ Y++SF QKL 
Sbjct  423   AEEVRSNHAKWRDFLCRKELENSYLNSFEQKLH  455



>ref|XP_007132927.1| hypothetical protein PHAVU_011G136700g [Phaseolus vulgaris]
 gb|ESW04921.1| hypothetical protein PHAVU_011G136700g [Phaseolus vulgaris]
Length=452

 Score =   479 bits (1233),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 267/455 (59%), Positives = 337/455 (74%), Gaps = 8/455 (2%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
              A + H+AMYPWF +GHLT F  LANKLA +GH+ISF IPK TQ+KLE+ NL P LI+FV
Sbjct  2     NAASLHIAMYPWFAMGHLTPFLHLANKLAKRGHKISFFIPKRTQAKLENLNLRPSLITFV  61

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF-THWL  1231
             PI VP + GLP GAETTSDVP     L+  AMD T+ DIE++L +LK  +V +DF T+WL
Sbjct  62    PISVPHVDGLPCGAETTSDVPSSLFPLIASAMDLTEKDIELLLLELKPHIVLFDFATYWL  121

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             P+LAR+IGIKS+ Y  ISP   GY  SP R+       E DM K P+ FPD S+KLH HE
Sbjct  122   PNLARRIGIKSLQYWIISPATIGYMASPARK------REDDMRKPPSGFPDCSVKLHEHE  175

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
              R F A   ++FG  I  +DRI      SD + +  CREIEG + DY+ETQF KPVLL+G
Sbjct  176   VRFFAASRKLEFGNGILLYDRISIGADLSDHIGFKGCREIEGPYVDYLETQFGKPVLLSG  235

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P +P  S ST+E KW +WLG+FK GSVIYCA GSE +L++++ +EL+ GLELTGMPF AA
Sbjct  236   PLVPESSNSTLEAKWGEWLGRFKAGSVIYCALGSENSLQQNQLKELVLGLELTGMPFLAA  295

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP E ES+E A+P+  KE++Q RG+V+G WVQQQL L HPSVGCF++HCG ASL+EAL
Sbjct  296   LKPPNEFESLEDALPKGFKERVQERGVVYGGWVQQQLILAHPSVGCFITHCGAASLTEAL  355

Query  510   VNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             VN CQ+VLLP++G D IINAR M   L+V VEVEKGEEDG+F++ESV KAVK VMD+++E
Sbjct  356   VNQCQLVLLPRLGSDFIINARTMGEKLRVAVEVEKGEEDGLFTKESVGKAVKIVMDDENE  415

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +GREVR NH+K+R  LL+   +S  +D+F  KL+D
Sbjct  416   LGREVRANHNKVRNLLLSDSFESTCVDAFCHKLRD  450



>ref|XP_004307624.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=459

 Score =   477 bits (1228),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 264/451 (59%), Positives = 332/451 (74%), Gaps = 2/451 (0%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T H+AMYPWF +GHLT +  ++NKLA +GH+ISF IP  TQ K+  FNLHPHLISF+PI 
Sbjct  5     TMHIAMYPWFAMGHLTSYLHISNKLAERGHKISFFIPIKTQPKMVQFNLHPHLISFIPIN  64

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP I GLP G ETT+D+P      L  AMD T+  IE  L+++  + VFYDF++WLP+  
Sbjct  65    VPHIDGLPLGTETTADIPLHLHPHLATAMDLTRPQIEQSLREINPNFVFYDFSYWLPAFL  124

Query  1218  RKIG--IKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             R++G  IKSV Y TISP   GY +SPER++  K LTE +  +AP SFP  SIKL  HEAR
Sbjct  125   RQLGKTIKSVHYCTISPATVGYLISPERKLSEKTLTEFEYREAPTSFPSSSIKLRPHEAR  184

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
             G       ++G  ITF  R      + D +A+ TCRE+EG FCDY+ETQ +KPV+LAGP 
Sbjct  185   GLAYGANKEYGRGITFLKRQQINFGDCDAIAFKTCRELEGPFCDYLETQLRKPVILAGPV  244

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P P  S +E+KW++WLG F   +VI+CAFGSEC LRK++ QELL G ELTG+PFFAALK
Sbjct  245   VPDPPSSHLEEKWANWLGGFDSKTVIFCAFGSECILRKEQLQELLLGFELTGLPFFAALK  304

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP   ESIE+A+P+   E+++G+GIV+G WVQQ L L+HPSVGCFV+HCG  SLSEALVN
Sbjct  305   PPTGVESIESALPQGFLERVEGKGIVYGGWVQQPLILKHPSVGCFVTHCGSGSLSEALVN  364

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             +CQ+VLLP VGDQIINAR+MS  LKVGVEVEKG+EDG+FS+E VCKAVKAV+DE SE+ +
Sbjct  365   ECQLVLLPNVGDQIINARMMSGDLKVGVEVEKGDEDGLFSKEGVCKAVKAVIDEDSEVEK  424

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             EVR NH K R F  +  L+S Y++ F  KL 
Sbjct  425   EVRANHAKWREFFSSKGLESSYIEDFVHKLH  455



>ref|XP_004505528.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
 gb|AGU14090.1| UDP-glycosyltransferase [Cicer arietinum]
Length=465

 Score =   475 bits (1222),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 241/448 (54%), Positives = 322/448 (72%), Gaps = 1/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF +GH T F  L+NKLA KGH+I+F  P+  +SKL+ FNLHP  I+F+ I VP
Sbjct  8     HIAMFPWFAMGHQTAFLHLSNKLAKKGHKITFFTPQKAESKLKPFNLHPESITFITITVP  67

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              +  LPP ++TT+DVP+P    +M AMD T+ DIE  L +LK  +VFYDFTHW+PS+ + 
Sbjct  68    HVDPLPPNSQTTADVPYPLQPHIMTAMDLTRPDIESHLLNLKPHIVFYDFTHWIPSVTKA  127

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIK + Y T S +M GY LSP R   GK LTE D+M+ P  +PD SIKL  HEA+ F A
Sbjct  128   LGIKCLHYCTASSVMVGYTLSPARYSKGKDLTEFDLMEPPPGYPDSSIKLFQHEAKSFAA  187

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
             +    FG ++ F+DR   A++E+D L Y TCREIEG + DYI+  F KPVL +GP +   
Sbjct  188   KRTEYFGSNVLFYDRQSIALNEADALGYRTCREIEGPYLDYIQKVFNKPVLASGPVILEK  247

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
               S +E+K +    +F++ SV+YC FGSECTL+ D+F EL+ GLELTG PFFAALKPPF 
Sbjct  248   PNSCLEEKGTYGFNRFEKNSVVYCCFGSECTLKPDQFTELVLGLELTGKPFFAALKPPFG  307

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
               ++E A+PE  K+++ G+G V G WVQQQL L+H S+GCF++HCG  SLSEALVN CQ+
Sbjct  308   FATVEEALPEGFKKRVAGKGAVFGGWVQQQLILEHSSIGCFITHCGSGSLSEALVNKCQL  367

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VLLP VGDQI+NAR+M  +L         +E+G F++ESVC+AVK VMD+++EI +EVRG
Sbjct  368   VLLPNVGDQILNARMMGNNL-KVGVEVVKDENGFFTKESVCEAVKIVMDDENEISKEVRG  426

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH K+R  LLN DL+S Y+D+F +KLQ+
Sbjct  427   NHAKIREMLLNKDLESSYIDTFCKKLQE  454



>ref|XP_008465522.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=479

 Score =   475 bits (1222),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 257/455 (56%), Positives = 330/455 (73%), Gaps = 1/455 (0%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             S  T  H+AMYPWF +GHLT F  L+NKLA KGH+ISF IP  T  K E  NL P+LI+F
Sbjct  13    SSHTCLHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITF  72

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
             +PI+VP + GLP GAETT DVP+P  +L+M +MD TQ  I ++L+ LK  ++ +DFTHWL
Sbjct  73    IPIIVPHVDGLPRGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQSLKPHLILFDFTHWL  132

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             P LA ++GIKS+ Y   S  M  Y L+P R+    +LTE D+MK P  +P  +I LH HE
Sbjct  133   PKLASQLGIKSIHYCVTSAAMIAYTLTPSRQFSKNELTEEDLMKPPIGYPSSTINLHPHE  192

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla-  874
             AR F ++   KFG D+ F+DR F + S+ D + + TC EIEG F +Y++T+F+KP+LL  
Sbjct  193   ARVFASKRKWKFGSDVLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQTEFRKPILLTG  252

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
                    +   +E+KW  WL  FKEGSV+YCAFGSECTL+ ++FQELL G EL  MPF A
Sbjct  253   SVLPEPLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFLA  312

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             ALKPPF AE++EAA+PE   +++ GRG+V+G W+QQ+  L+HPSVGCFV+HCG  SL EA
Sbjct  313   ALKPPFGAETVEAALPEGFTKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSLKEA  372

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             LVN CQ+VLLPQVGDQIINAR+M  +L+VGVEVEK EEDG F++ESVCKAVK VMDE +E
Sbjct  373   LVNKCQLVLLPQVGDQIINARMMGSNLRVGVEVEKREEDGWFTKESVCKAVKIVMDEDNE  432

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             IG+EVR NH K+R  LL  DL+  Y+DSF+  L D
Sbjct  433   IGKEVRTNHSKIRDLLLKKDLEQSYIDSFSHNLCD  467



>ref|XP_010277785.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=462

 Score =   474 bits (1220),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 261/458 (57%), Positives = 331/458 (72%), Gaps = 4/458 (1%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MG+  +T+H+ MYPWF  GHLT F  L+NKLA +GHRISFL+P   ++KLE+FNLHP LI
Sbjct  1     MGTD-STFHVVMYPWFAFGHLTPFLHLSNKLAERGHRISFLLPTKARAKLEAFNLHPDLI  59

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              FVP+VVP + GLP GAETT+DVP     L+M AMD+TQ D+E  LKDLK D +F+DFTH
Sbjct  60    RFVPLVVPHVDGLPAGAETTNDVPLHLQPLIMSAMDRTQPDVEAALKDLKPDFIFFDFTH  119

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPE--RRVVGKQLTEADMMKAPASF-PDPSIK  1066
              +P LAR++GIKS+ Y   S     Y L+P   +   G QL+E D+M  P  F P  SIK
Sbjct  120   CIPPLARRLGIKSIQYCITSAATIAYLLAPASIKLEEGAQLSEDDLMHQPPGFPPSSSIK  179

Query  1065  LHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKp  886
             LH HEAR  T  T  ++G  ++F +RI  A+ +SD + + +C EIEG FC+Y+E Q+ K 
Sbjct  180   LHRHEARKMTFITYREYGSGVSFHERITWALRDSDAVCFRSCSEIEGPFCEYLEKQYGKI  239

Query  885   vllagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
             VLL+GP LP P  S++E +W+ WL  FK GSV+YCAFGSEC L KD+FQEL+ G ELTG+
Sbjct  240   VLLSGPILPEPPTSSLEDRWAKWLDGFKAGSVVYCAFGSECFLEKDQFQELVLGFELTGL  299

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PFF ALKPP   E++E A+PE   E+++GRG+V G WVQQQL L HPS+GCFVSH GWAS
Sbjct  300   PFFVALKPPIGTETMEEALPEGFTERVRGRGVVEGGWVQQQLILGHPSIGCFVSHSGWAS  359

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             L E+LVN  Q+VLLP  GDQ ++AR+MS  LKVGVEVE+ EEDG F+RE+VCKAVK VMD
Sbjct  360   LIESLVNQPQLVLLPYSGDQFVHARLMSGDLKVGVEVERREEDGWFTRENVCKAVKMVMD  419

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             E +E+GREVR N  +LR   L    DS Y+D F +KL+
Sbjct  420   EDNEVGREVRANRLRLRDVFLKQGFDSSYIDGFIEKLR  457



>ref|XP_009353146.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=459

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 261/449 (58%), Positives = 329/449 (73%), Gaps = 2/449 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GHLT F  ++NKLA +GHRISF IP  T  KLE+FNL+P  I+F+PI VP
Sbjct  7     HVAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPVKTLQKLEAFNLYPDRIAFIPINVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              +PGLPPG ETT+DVPFP   LLM  MD T+ +I   L++LK D VF+DFT W+P L  +
Sbjct  67    HVPGLPPGTETTADVPFPLHSLLMTTMDLTRPEIGQALRELKPDFVFFDFTQWMPELLHE  126

Query  1212  I--GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGF  1039
             +  G KS+ Y TISP    Y  + ER ++ KQ T AD+M  P SFP  SI L  HEARG 
Sbjct  127   LDMGTKSIHYCTISPATVLYLSTLERNLMEKQPTAADLMLPPPSFPASSITLRTHEARGL  186

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
              A  + +FG  +TF  R F + S  D +A+ TCREIEG +CDYI TQ +KPVLLAGP +P
Sbjct  187   VAVMLKEFGRGVTFMQRQFRSFSGCDAIAFKTCREIEGPYCDYIGTQLRKPVLLAGPGVP  246

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
                   +++KWS WL  F+  S+IYCAFGSEC L+ D+FQELL G E+TG+PFFAALKPP
Sbjct  247   ETPTKELDEKWSKWLEGFEAKSMIYCAFGSECILKIDQFQELLLGFEITGLPFFAALKPP  306

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               AESIE+A+PE  +E+ + RG+V+G WVQQ LFL+HPSVGCFV+HCG  SLSEALVN+C
Sbjct  307   MGAESIESALPEGFEERTRERGVVYGGWVQQPLFLRHPSVGCFVTHCGSGSLSEALVNEC  366

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             Q+VLLP VGDQIINAR+MS  LKVGVEVEKG+ DG+F++E V KAV+AVM++  E+  EV
Sbjct  367   QLVLLPNVGDQIINARVMSRDLKVGVEVEKGDLDGLFTKEGVSKAVEAVMEDGGEVAEEV  426

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             R NH K R FL   +L++ Y++SF +KL 
Sbjct  427   RSNHAKWREFLCGKELENSYLNSFERKLH  455



>ref|XP_007132923.1| hypothetical protein PHAVU_011G136400g [Phaseolus vulgaris]
 gb|ESW04917.1| hypothetical protein PHAVU_011G136400g [Phaseolus vulgaris]
Length=461

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 246/450 (55%), Positives = 335/450 (74%), Gaps = 2/450 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GH++ +  LANKLA +GH+ISF++PK T+SK+E FNL+P L++F+PI +P
Sbjct  9     HIAMYPWFAIGHISAYLHLANKLAKRGHKISFIVPKLTKSKVEHFNLYPQLVTFIPITMP  68

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPP AETT D       L+M  MD+T+ DIE++L +LK ++VF+D+T W+P+LAR 
Sbjct  69    LVDGLPPHAETTFDATISLGKLIMTGMDRTEKDIELLLLELKPNIVFFDYTCWMPNLARS  128

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTE--ADMMKAPASFPDPSIKLHAHEARGF  1039
             +GIKSV Y T+S +   Y    E++   K + E   +++  PA FPDPSIKL AHE R  
Sbjct  129   LGIKSVHYITLSMIFESYMECMEKQFSEKNIAEHELNLLNPPAGFPDPSIKLQAHEVRQL  188

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
             T+    +FG  + ++DRI T+   SD +A+  CREIEG + D++E  + KP+LL+GP +P
Sbjct  189   TSVVNSEFGSGVRYYDRISTSTRLSDAVAFRGCREIEGLYADFLEISYGKPLLLSGPVIP  248

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
              P  S +E++W++WL  FKE SV+YCAFGSEC L +D+ +ELL GLELTG PF AALK P
Sbjct  249   EPHTSPLEEEWAEWLSGFKEESVVYCAFGSECRLHQDQLKELLVGLELTGFPFLAALKAP  308

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
                ES+EAA+P+   E+++GRGIVHG WVQQ L L HPS+GCF++HCG ASL EALV++C
Sbjct  309   IGFESVEAAMPKGFSERVRGRGIVHGSWVQQTLILDHPSIGCFITHCGVASLLEALVSNC  368

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIV+LP   DQ++NAR++S S+K GV+VEKGEEDG+F++ESVC AVK VMD +SE+GREV
Sbjct  369   QIVVLPNFIDQLLNARMISSSIKAGVQVEKGEEDGLFTKESVCAAVKTVMDLESEVGREV  428

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH KLR  LL  DL++ Y+D F QKLQ+
Sbjct  429   RENHLKLRNLLLTKDLENTYLDGFCQKLQE  458



>ref|XP_008371430.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=459

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 257/449 (57%), Positives = 323/449 (72%), Gaps = 2/449 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GHL  F    NKLA +GHRISF +P  T  KL++FNL+P  I+F+PI VP
Sbjct  7     HVAMYPWFAMGHLIAFLHTCNKLAERGHRISFFVPVQTLQKLQAFNLYPDRIAFIPINVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPPG ETT+DVPFP   LLM AMD T+  +   L++LK D VF+DFTHW+P L  +
Sbjct  67    HVDGLPPGTETTTDVPFPLHSLLMTAMDLTRPAVGQALRELKPDFVFFDFTHWMPELLHE  126

Query  1212  I--GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGF  1039
             +  GIKS+ Y  ISP   GY  +PER    K  T AD+M  P SFP  SI L  HEARG 
Sbjct  127   LDMGIKSIHYCIISPATIGYLSTPERNPTEKLPTAADLMLPPPSFPASSITLRTHEARGL  186

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
              A  + +FG  +TF  R F + S  D +A+ TCRE+EG + DYIETQ++KPV+LAG  +P
Sbjct  187   VAVLLKEFGRGMTFMQRQFLSFSGCDAIAFKTCREMEGPYSDYIETQYKKPVILAGSVVP  246

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
               S + +++KW+ WL  F+  S+IYCAFGSEC L+ D+FQELL G ELTG+PFFAALKPP
Sbjct  247   ETSTTELDEKWAKWLEGFEAKSMIYCAFGSECILKIDQFQELLLGFELTGLPFFAALKPP  306

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               AESIE+A+PE  +E+ +GRG+V+G WVQQ LFL+HPSVGCFV+HCG  SLSEALVN+C
Sbjct  307   MGAESIESALPEGFEERTRGRGVVYGGWVQQPLFLRHPSVGCFVTHCGSGSLSEALVNEC  366

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             Q+VLLP VGDQIINAR+M   LKVGVEVEK + DG+F++E V KAV+AVM++  E+  EV
Sbjct  367   QLVLLPNVGDQIINARMMGCDLKVGVEVEKRDLDGLFTKEGVAKAVEAVMEDGGELAEEV  426

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             R NH K R F     L + Y+DSF QKL 
Sbjct  427   RSNHAKWREFFSGQGLGNSYLDSFEQKLH  455



>ref|XP_004144610.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cucumis sativus]
 gb|KGN43443.1| hypothetical protein Csa_7G037470 [Cucumis sativus]
Length=477

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 253/452 (56%), Positives = 329/452 (73%), Gaps = 1/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             T+ H+AMYPWF +GHLT F  L+NKLA KGH+ISF IP  T  K E  NL P+LI+F+P+
Sbjct  14    TSLHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPV  73

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
             +VP + GLP GAETT DVP+P  +L+M +MD TQ  I ++L+ LK  ++ +DFTHWLP L
Sbjct  74    IVPHVHGLPHGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQTLKPHLILFDFTHWLPKL  133

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A ++GIKS+ Y   S  M  Y L+P R+    +LTE D+MK P  +P  +I LH HEAR 
Sbjct  134   ASQLGIKSIHYCVTSAAMIAYTLTPSRQFYKNELTEEDLMKPPVGYPSSTINLHPHEARV  193

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla-gpa  865
             F ++   KFG D+ F+DR F + S+ D + + TC EIEG F +Y++ +F+KPVLL     
Sbjct  194   FASKRKWKFGSDVLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQFEFRKPVLLTGSVL  253

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
                 +   +E+KW  WL  FKEGSV+YCAFGSECTL+ ++FQELL G EL  MPF AALK
Sbjct  254   PETLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFLAALK  313

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PPF AE++EAA+PE   +++ GRG+V+G W+QQ+  L+HPSVGCFV+HCG  SL EALVN
Sbjct  314   PPFGAETVEAALPEGFAKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSLKEALVN  373

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
              CQ+VLLPQVGDQIINAR+M  +L+VGVEVEK +EDG F++ESVCKAVK VMDE +EIG+
Sbjct  374   KCQLVLLPQVGDQIINARMMGNNLRVGVEVEKRQEDGWFTKESVCKAVKIVMDEDNEIGK  433

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EVR NH K+R  LL  DL+  Y+DSF+  + D
Sbjct  434   EVRTNHSKIRDLLLKKDLEESYIDSFSYNICD  465



>ref|XP_003530810.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=466

 Score =   469 bits (1206),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 258/462 (56%), Positives = 331/462 (72%), Gaps = 7/462 (2%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             M S  + +H+AMYPWF +GHLT F  ++NKLA +GH+ISFL+PKNT  +L  FNLHPHLI
Sbjct  2     MSSNTSLFHVAMYPWFALGHLTSFLHISNKLAERGHKISFLMPKNTIPRLSHFNLHPHLI  61

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTH-LLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
              FVPI VP + GLP G+ETTSD+P  S H LLM AMD T+  IE  LK LK  +VF+DFT
Sbjct  62    FFVPITVPHVDGLPLGSETTSDLPNYSKHSLLMTAMDLTEPVIETCLKHLKPHMVFFDFT  121

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ--LTEADMMKAPASFPDP-SI  1069
             HWLP+LA K+GIK++ Y TISP   GY +SPER+++ ++  LTEAD++  P SFP   +I
Sbjct  122   HWLPALACKLGIKALHYCTISPATVGYLISPERKLLLEKNSLTEADLINPPPSFPPSSTI  181

Query  1068  KLHAHEARGFTARTVMKFG-GDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQ  892
             +LH HEAR      V  +G G I+F +R   + +    + + TCRE+EG +CDY+E Q +
Sbjct  182   RLHPHEARELATAAVKNYGNGGISFVERQLISFASCHAVVFKTCREMEGPYCDYLERQMR  241

Query  891   KpvllagpalpvPS-KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLEL  715
             K V LAGP LP    +S +E+KW  WLG FK  +VI+CAFGSEC L+ D+F+ELL G EL
Sbjct  242   KQVFLAGPVLPDTPLRSKLEEKWVTWLGSFKPKTVIFCAFGSECFLKSDQFKELLLGFEL  301

Query  714   TGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCG  535
             TGMPF AALKPP  AE+IE+A+PE   E+ +GRG+VHG+WVQQ L L HPSVGCFV+HCG
Sbjct  302   TGMPFLAALKPPIGAEAIESALPEGFNERTKGRGVVHGDWVQQLLILSHPSVGCFVTHCG  361

Query  534   WASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKA  355
               SL+EA+VN+CQ+VLLP  GDQ INARIMS  L       +  EDG+F+RE+VCK ++A
Sbjct  362   SGSLTEAMVNECQLVLLPHAGDQFINARIMSGDL-KVGVEVEKSEDGLFTREAVCKVLRA  420

Query  354   VMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             VMD  SE+G+ VR NH K R FL +  L++ Y+D FNQ L  
Sbjct  421   VMDSDSEVGQMVRTNHAKWRKFLFSKGLENSYVDHFNQNLHS  462



>ref|XP_004169305.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B1-like 
[Cucumis sativus]
Length=477

 Score =   468 bits (1203),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 252/452 (56%), Positives = 328/452 (73%), Gaps = 1/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             T+ H+AMYPWF +GHLT F  L+NKLA KGH+ISF IP  T  K E  NL P+LI+F+P+
Sbjct  14    TSLHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPV  73

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
             +VP + GLP GAETT DVP+P  +L+M +MD TQ  I ++L+ L   ++ +DFTHWLP L
Sbjct  74    IVPHVHGLPHGAETTCDVPYPLHNLIMTSMDLTQPQITLLLQTLNPXLILFDFTHWLPKL  133

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A ++GIKS+ Y   S  M  Y L+P R+    +LTE D+MK P  +P  +I LH HEAR 
Sbjct  134   ASQLGIKSIHYCVTSAAMIAYTLTPSRQFYKNELTEEDLMKPPVGYPSSTINLHPHEARV  193

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla-gpa  865
             F ++   KFG D+ F+DR F + S+ D + + TC EIEG F +Y++ +F+KPVLL     
Sbjct  194   FASKRKWKFGSDVLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQFEFRKPVLLTGSVL  253

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
                 +   +E+KW  WL  FKEGSV+YCAFGSECTL+ ++FQELL G EL  MPF AALK
Sbjct  254   PETLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFLAALK  313

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PPF AE++EAA+PE   +++ GRG+V+G W+QQ+  L+HPSVGCFV+HCG  SL EALVN
Sbjct  314   PPFGAETVEAALPEGFAKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSLKEALVN  373

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
              CQ+VLLPQVGDQIINAR+M  +L+VGVEVEK +EDG F++ESVCKAVK VMDE +EIG+
Sbjct  374   KCQLVLLPQVGDQIINARMMGNNLRVGVEVEKRQEDGWFTKESVCKAVKIVMDEDNEIGK  433

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EVR NH K+R  LL  DL+  Y+DSF+  + D
Sbjct  434   EVRTNHSKIRDLLLKKDLEESYIDSFSYNICD  465



>ref|XP_006377437.1| hypothetical protein POPTR_0011s05910g [Populus trichocarpa]
 gb|ERP55234.1| hypothetical protein POPTR_0011s05910g [Populus trichocarpa]
Length=446

 Score =   464 bits (1195),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 262/445 (59%), Positives = 335/445 (75%), Gaps = 2/445 (0%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPWF +GHLT F   +NKLA +GHR+SF +PK TQSK E FNLHP LI+F+PI VP + 
Sbjct  1     MYPWFALGHLTAFVHFSNKLAERGHRVSFFLPKKTQSKFEPFNLHPDLITFIPITVPHVD  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLP G ETT+DVPFP   LLM AMD T++ I+  L+ L    +F+DFTHWLP L+RK GI
Sbjct  61    GLPTGTETTTDVPFPLHPLLMTAMDLTEHVIKDHLRILNPHFIFFDFTHWLPELSRKHGI  120

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTARTV  1024
             KSV +  ISP   GY LSPER++  + LT AD+M+ P SFP  SIKL AHEARG  A TV
Sbjct  121   KSVHFCIISPATIGYMLSPERKL--ESLTAADLMQPPPSFPPSSIKLRAHEARGICAVTV  178

Query  1023  MKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSKS  844
              +FG +I+F +R   ++S+ D +A+  CRE+EG + DYIE QF KPV+LAGP +P P  S
Sbjct  179   KQFGSNISFQERNIYSLSQCDAIAFKACREMEGPYSDYIEDQFGKPVILAGPIVPEPPNS  238

Query  843   TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeaes  664
              +E+K +  L  FK  ++++CAFGSEC L+KD+FQEL+ GLELT +PFFA LKPP  AE+
Sbjct  239   VLEEKIAKMLDSFKAETLVFCAFGSECILKKDQFQELVLGLELTSLPFFAVLKPPIGAET  298

Query  663   ieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVLL  484
             IE+A+PE  +E+++GRG+V+  WVQQQL L+HPSVGCFV+HCG  SLSE +VN CQ+VLL
Sbjct  299   IESALPEGFEERVKGRGLVYTGWVQQQLILRHPSVGCFVTHCGSGSLSEGMVNKCQLVLL  358

Query  483   PQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNHD  304
             P VGDQIINAR++   LKVGVEV+KGEEDG+F+R  VC+AVKAVMD+ SE+G+ VR NH 
Sbjct  359   PNVGDQIINARVVGGDLKVGVEVKKGEEDGLFTRHGVCEAVKAVMDDDSEVGKLVRANHA  418

Query  303   KLRGFLLNADLDSKYMDSFNQKLQD  229
             K R FLL  +L++ Y+D F  KL +
Sbjct  419   KWREFLLGKELENSYVDGFVHKLHE  443



>ref|XP_008455479.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=469

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 326/455 (72%), Gaps = 2/455 (0%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             +  ++ H+AMYPWF  GHL  + ++ANKLA KGHRISFLIP NTQ KL+ FN  P+LI+F
Sbjct  2     AATSSLHIAMYPWFAFGHLIPYLQIANKLAKKGHRISFLIPSNTQPKLQPFNHFPNLITF  61

Query  1410  VPIVVPSIPGLPPGAETTSDVP-FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             +PI+VP + GLP GAETT+DV       L+M AMD TQ  IE  L+ +K    F+DFT+W
Sbjct  62    LPIIVPHVNGLPQGAETTADVSNLQQFSLIMTAMDLTQPQIESFLQHVKPHFFFFDFTYW  121

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAH  1054
             +P LA + GIKS+++S IS     Y   P R++ G   T  D MK P  FP   IKLH+H
Sbjct  122   MPKLASQFGIKSIYHSVISATTFAYVYPPSRQLCGHDFTVDDFMKPPLGFPSSVIKLHSH  181

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             EA+ + + + MKFG D+ FF R FT + ESD +A+ + REIEG F DY+ET+F+KPVLL+
Sbjct  182   EAKFYASMSHMKFGSDVLFFHRHFTGLCESDAIAFKSSREIEGPFIDYLETEFKKPVLLS  241

Query  873   gpa-lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP        +T+EQ+W++ L +FK GSVIYCAFGSECTL KD+ QEL+ G ELT +PFF
Sbjct  242   GPDGNIQEPTTTLEQRWAECLSEFKAGSVIYCAFGSECTLTKDQLQELVLGFELTNLPFF  301

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             A LKPP   ++I AA+PE  +++IQGRG+V+G WVQQQ  L+HPS+GCFV+HCG  SLSE
Sbjct  302   AVLKPPHGMDTINAALPEGFEQRIQGRGVVYGGWVQQQHILEHPSIGCFVTHCGAGSLSE  361

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALV  CQ+V LP +GD    AR +S  LKVGVEVE+ +EDGVF++ESVCKAVK VMDE++
Sbjct  362   ALVKKCQLVFLPHIGDHFFRARTLSSCLKVGVEVERRQEDGVFNKESVCKAVKTVMDEEN  421

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             E G+E+R N  KLR  L++ DL+  Y+++F  KL 
Sbjct  422   ESGKEIRANLAKLRELLVDKDLEESYINNFIHKLH  456



>ref|XP_003540019.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
 gb|KHN27788.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=455

 Score =   462 bits (1190),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 272/459 (59%), Positives = 341/459 (74%), Gaps = 9/459 (2%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             M + A   H+AMYPWF +GHLT F  LANKLA +GH+ISF IP+ TQ+KLE  NLHP+LI
Sbjct  1     MDADAAPLHIAMYPWFAMGHLTPFLHLANKLAKRGHKISFFIPRRTQAKLEDLNLHPNLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF-T  1240
             +FVPI VP + GLP  AETTSDVP     L+  AMD T+ +IE++L DLK  +V +DF T
Sbjct  61    TFVPINVPHVDGLPYDAETTSDVPSSLFPLIATAMDLTEKNIELLLLDLKPHIVLFDFST  120

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLH  1060
             +WLP+LAR+IGIKS+ Y  ISP   GY  SP R+       E DM K P+ FPD SIKLH
Sbjct  121   YWLPNLARRIGIKSLQYWIISPATVGYMASPARQ------REDDMRKPPSGFPDCSIKLH  174

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
             AHE R   A   ++FG  + F+DRI      SD + +  CREIEG + DY+ETQF KPVL
Sbjct  175   AHEVRFLAAARKLEFGNGVLFYDRISVGADLSDAIGFKGCREIEGPYVDYLETQFGKPVL  234

Query  879   lagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPF  700
             L GP +P PS ST++ KW +WLG+FK GSVIY AFGSE +L++++  ELL GLELTGMPF
Sbjct  235   LTGPLVPEPSNSTLDAKWGEWLGRFKAGSVIYIAFGSEHSLQQNQLNELLLGLELTGMPF  294

Query  699   FAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLS  520
             FAALKPP E ESIE A+P+  KE++Q RG+V+G WVQQQL L HPSVGCF++HCG ASL+
Sbjct  295   FAALKPPIEFESIEKALPKGFKERVQERGVVYGGWVQQQLILAHPSVGCFITHCGGASLT  354

Query  519   EALVNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM-D  346
             EALVN CQ+VLLP++G D IINAR M   L+VGVEVEKGEEDG+F++ESVCKAVK VM D
Sbjct  355   EALVNRCQLVLLPRLGSDFIINARTMGGKLRVGVEVEKGEEDGLFTKESVCKAVKTVMDD  414

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             E  ++GREVR NH+K+R  LL+ + ++  +D+F+ +LQD
Sbjct  415   EIDQLGREVRANHNKVRSLLLSNNFETSCVDAFSHRLQD  453



>emb|CDO96715.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   459 bits (1180),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 249/439 (57%), Positives = 323/439 (74%), Gaps = 7/439 (2%)
 Frame = -3

Query  1545  VGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIPGLPPGA  1366
             +GHLT F  ++NKLA  GH+I FL+P+ TQ++L+ FNL+P LI F+P+ VP + GLPPGA
Sbjct  1     MGHLTAFLHMSNKLADGGHKIFFLLPRKTQAQLKQFNLYPDLIDFIPLCVPQVEGLPPGA  60

Query  1365  ETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGIKSVFYS  1186
             ETT+D+PF     L  AMD TQ  IE IL+++K  VVF+DFTHWLP LAR++GIKS+F+ 
Sbjct  61    ETTADIPFHLQPNLRLAMDSTQPQIESILQEIKPQVVFFDFTHWLPKLARRLGIKSIFFI  120

Query  1185  TISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT-ARTVMKFGG  1009
             T+S    GY         G+Q T+AD+MKAP  FP   IKL +HEARG   A  V + G 
Sbjct  121   TMSSATSGYTFR------GEQTTDADLMKAPPGFPSSCIKLLSHEARGLNFAGKVKEIGS  174

Query  1008  DITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSKSTMEQK  829
              ++F +R+  +  + D + + TCRE+EG +C++IE +F+KPV+LAGP LP    +T+E+K
Sbjct  175   GLSFLERLLISAEDCDAIGFKTCREMEGPYCEFIERKFKKPVILAGPVLPEQPTTTLEEK  234

Query  828   WSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeaesieaai  649
             W  WL  FK  SVI+CAFGSEC L+KD+FQELL GLELTG+PF AALKPP  +E+IE A+
Sbjct  235   WEKWLSGFKAKSVIFCAFGSECRLQKDQFQELLKGLELTGLPFLAALKPPIGSETIEMAL  294

Query  648   peELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVLLPQVGD  469
             PE   E+IQGR +V+G WVQQQL L H SVGCFV+HCG  SLSE LVN+CQ+VLLPQ GD
Sbjct  295   PEGFNERIQGRSVVYGGWVQQQLILAHSSVGCFVTHCGSGSLSEGLVNECQMVLLPQFGD  354

Query  468   QIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNHDKLRGF  289
             Q INAR+M   L+VGVEVEKG+EDG+F++E VCKA++ VMD+ SEIG+EVR NH K R F
Sbjct  355   QFINARLMGGDLRVGVEVEKGDEDGLFTKEGVCKAIRMVMDDGSEIGKEVRANHAKWRDF  414

Query  288   LLNADLDSKYMDSFNQKLQ  232
             LL    +S Y+D F  K++
Sbjct  415   LLREGTESSYIDEFINKMK  433



>gb|ADV71366.1| glycosyltransferase GT10J15 [Pueraria montana var. lobata]
Length=460

 Score =   459 bits (1182),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 261/455 (57%), Positives = 339/455 (75%), Gaps = 1/455 (0%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             + AT  H+A++PWF +GHLT    L+NKLA +GH+ISF+IPK TQ+KL+  NLHPHLI+F
Sbjct  4     TSATPLHIAIFPWFAMGHLTPTLHLSNKLAQRGHKISFIIPKTTQTKLQHLNLHPHLITF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
             VPI VP + GLP  AETTSD+PF    LL  A+D+T+ DIE++L+ LK  +VF+DF HWL
Sbjct  64    VPIKVPHVDGLPHDAETTSDLPFSLFPLLATALDRTEKDIELLLRKLKPQIVFFDFQHWL  123

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             P+L R +GIKSV Y    PL   Y  +  R+  G++LTE D+M+ P  FPD   K HAHE
Sbjct  124   PNLTRSLGIKSVMYFITHPLSAAYLGNGPRKSQGRELTELDLMEPPQGFPDSCFKFHAHE  183

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
              R   A   ++FG  +  +DR+ T+   +D + +  C+EI+G + +Y+ET + KPVLL+G
Sbjct  184   LRFLVAARKLEFGSGVFLYDRLHTSTILADAIGFKGCKEIDGPYAEYLETVYGKPVLLSG  243

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P LP P  ST+E+KW  W G+F  GSVI+CA+GSE  L +++FQELL GLELTG PF AA
Sbjct  244   PLLPEPPNSTLEEKWVAWFGRFNPGSVIFCAYGSESPLPQNQFQELLLGLELTGFPFLAA  303

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP   ESIE A+PE   E++Q RGI HG WVQQQL L HPS+GCF++HCG AS++EAL
Sbjct  304   LKPPNGFESIEDALPEGFGERVQERGIAHGGWVQQQLILGHPSIGCFITHCGAASVTEAL  363

Query  510   VNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             VN CQ+VLLP++G D I+NAR+MSV LKVGVEVEKGEEDG+F++ESVCKAVK VMD+ +E
Sbjct  364   VNKCQLVLLPRLGSDHIMNARMMSVKLKVGVEVEKGEEDGLFTKESVCKAVKIVMDDGNE  423

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +GREVR NH KLR FLL+ +L+S  +DSF Q+LQD
Sbjct  424   VGREVRENHAKLRNFLLSDNLESSCVDSFCQQLQD  458



>ref|XP_008455481.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
 ref|XP_008455483.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=463

 Score =   450 bits (1157),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 239/458 (52%), Positives = 325/458 (71%), Gaps = 2/458 (0%)
 Frame = -3

Query  1599  SMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHL  1420
             S  +  ++ H+AM+PWF  GHL+ + ++ANKLA KGH+ISFLIP   ++KL+ FN  P+L
Sbjct  2     STMAATSSLHIAMFPWFAFGHLSPYLQIANKLAKKGHKISFLIPSKIRAKLQPFNHFPNL  61

Query  1419  ISFVPIVVPSIPGLPPGAETTSDVP-FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  1243
             I+FVPI+VP + GLP GAETT+DV      +L+M AMD TQ  I+ +L+ +K  V+F+DF
Sbjct  62    ITFVPIIVPHVDGLPEGAETTADVSNLHQFNLIMTAMDLTQPQIKSLLQHIKPHVIFFDF  121

Query  1242  THWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKL  1063
             T W+P LA ++GIKS++YS IS     Y  +P R++ G   T  + +K P      +IKL
Sbjct  122   TFWIPKLASQLGIKSIYYSVISATTFSYVFTPTRQLCGPDFTVDEFIKPPLGLATSAIKL  181

Query  1062  HAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpv  883
             H+HEA+  T  + M FG D+ FF R FT + ESD +A+  CREIEG F D++ ++F+KP+
Sbjct  182   HSHEAKNVTFMSNMIFGSDVRFFHRHFTGLCESDAIAFKACREIEGPFVDHLISEFKKPI  241

Query  882   llagpalpvPS-KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
             LL+GP   +   K+T+E +W +WL +FK GSVIYCAFGSECTL KD+ QEL+ G ELT  
Sbjct  242   LLSGPDGDIQEPKTTLEHRWQEWLSRFKYGSVIYCAFGSECTLTKDQLQELVLGFELTNQ  301

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PFFA  KPP   +++ AA+P+  +E+++GRG+V+G WVQQQ  L+HPS+GCFV+HCG  S
Sbjct  302   PFFAVFKPPVGVDTVTAALPDGFEERVEGRGVVYGGWVQQQHILEHPSIGCFVTHCGAGS  361

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             LSEALV  CQ+VLLP VGD I  AR +S  LKVGVEVEK E+DG F++ESVC+AVK VMD
Sbjct  362   LSEALVKKCQLVLLPHVGDHIFRARTLSSYLKVGVEVEKREDDGFFTKESVCEAVKTVMD  421

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             E +E G+E+R    KLR  LL+ DL+  Y+ +F   LQ
Sbjct  422   EGNERGKEIRATRAKLRELLLDKDLEESYISNFIHNLQ  459



>gb|AFK39154.1| unknown [Lotus japonicus]
Length=457

 Score =   448 bits (1153),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 261/449 (58%), Positives = 335/449 (75%), Gaps = 3/449 (1%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF +GHLT F  L+NKLA +GHRISFLIPK TQ+KLE  NLHP LI+FVPI VP
Sbjct  7     HIAMFPWFAMGHLTPFLHLSNKLARRGHRISFLIPKRTQAKLEHLNLHPQLITFVPITVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETTSDVPF     L  A+D T+ DIE +L DLK  +VF+DF +WLP++AR 
Sbjct  67    HVDGLPHDAETTSDVPFSLFSNLATALDLTEKDIEPLLMDLKPQIVFFDFQYWLPNMARS  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFP-DPSIKLHAHEARGFT  1036
             +GIKSV Y  ++P    Y  +P R   G ++TE D MK P  FP DP +K +AHE R   
Sbjct  127   LGIKSVQYFIVNPATSAYFGTP-RPSQGSEITEVDCMKPPLGFPDDPPLKFYAHEIRFIA  185

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
             +   + FG  I F DR       +D +A+  CREIEG + DY+E+ ++KPVLL+GP LP 
Sbjct  186   SFAKVVFGSGIFFPDRFGMGTRFADLMAFKGCREIEGPYVDYLESVYKKPVLLSGPLLPE  245

Query  855   PSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppf  676
             PS ST+E+KW  WLGKFK GSV++CA+GSE  L++++FQELL GLEL+G PF AALKPP 
Sbjct  246   PSTSTLEEKWVSWLGKFKAGSVVFCAYGSEGPLQQNQFQELLLGLELSGFPFLAALKPPT  305

Query  675   eaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQ  496
               ESIE A+PE   E++ GRGI +G W+QQQL L+HPSVGCF++HCG AS++EALVN CQ
Sbjct  306   GFESIEEALPEGFLERVHGRGIAYGGWIQQQLILEHPSVGCFITHCGGASITEALVNTCQ  365

Query  495   IVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             +VLLP++G D + NAR+MS  L+VGVEVEKGEEDG+F++ESVCKAVK VMD++SE+G+EV
Sbjct  366   MVLLPRLGSDHVTNARVMSAKLRVGVEVEKGEEDGLFTKESVCKAVKTVMDDESELGKEV  425

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             R NH KLR  LL+ +L+S  +D+F Q+LQ
Sbjct  426   RANHTKLRNLLLSENLESSCVDTFCQRLQ  454



>ref|XP_007149722.1| hypothetical protein PHAVU_005G093600g [Phaseolus vulgaris]
 gb|ESW21716.1| hypothetical protein PHAVU_005G093600g [Phaseolus vulgaris]
Length=458

 Score =   448 bits (1153),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 256/453 (57%), Positives = 334/453 (74%), Gaps = 1/453 (0%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
              ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF +P+ TQSKLE FNL P LI+F P
Sbjct  3     GSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFVPRRTQSKLEQFNLFPDLITFFP  62

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L DLK  +VF+DFT+WLP+
Sbjct  63    INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTERDIELLLLDLKPQIVFFDFTYWLPN  122

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             +  ++GIKS  Y  +SP    Y  +P R      LTE D+M+ P  +P  SIKLHAHEA+
Sbjct  123   ITSRLGIKSFQYFIVSPATVSYTTAPPRMNHKGSLTELDLMQPPLGYPVSSIKLHAHEAK  182

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                ++   +FG  + F+DR+   +  SD + +  CREIEG F DY+  QF K V+L+GP 
Sbjct  183   FLASKRNWEFGSGVLFYDRLNNGLMLSDAIGFKGCREIEGPFVDYLAEQFGKSVVLSGPI  242

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P P  + +++KWS WLG FK+GSV++CA GSE  L   +FQELL GLELTG+PF A +K
Sbjct  243   IPEPPNTVLDEKWSAWLGSFKDGSVVFCALGSEWKLPHGQFQELLLGLELTGLPFLAVVK  302

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
              P   E+IEAA+PE  KE+I+GRGIVH  W+QQQL L+H SVGCF++HCG  SL+EALVN
Sbjct  303   VPIGFETIEAALPEGFKERIEGRGIVHSGWIQQQLILEHSSVGCFITHCGAGSLTEALVN  362

Query  504   DCQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
              CQ+VLLPQ+ GD IINAR+M  +LKVGVEVEKGEEDG F++ESV KAVK VMDE++E+G
Sbjct  363   KCQMVLLPQLDGDHIINARMMGSNLKVGVEVEKGEEDGWFTKESVSKAVKIVMDEENEVG  422

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             REVR NH KLR FL++ DL+S  +D+F QKLQ+
Sbjct  423   REVRENHAKLRNFLVSHDLESICVDNFCQKLQN  455



>ref|XP_004144602.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 ref|XP_004164963.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 gb|KGN43484.1| hypothetical protein Csa_7G041300 [Cucumis sativus]
Length=460

 Score =   446 bits (1148),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 238/455 (52%), Positives = 322/455 (71%), Gaps = 2/455 (0%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             +  ++ H+AM+PWF  GHL  + ++ANKLA KGH+ISFLIP  TQ KL+ FN  P+LI+F
Sbjct  2     AATSSLHIAMFPWFAFGHLAPYLQIANKLAKKGHKISFLIPSKTQVKLQPFNHFPNLITF  61

Query  1410  VPIVVPSIPGLPPGAETTSDVP-FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             VPI+VP + GLP GAE T+DV      +L+M AMD TQ  I+ +L+ +K  V+F+DFT W
Sbjct  62    VPIIVPHVDGLPEGAEITADVSNLHEFNLIMTAMDLTQPQIKTLLQLIKPHVIFFDFTFW  121

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAH  1054
             +P LA ++GIKS++YS IS     Y  +P R++ G   T  + M+ P      +IKLH+H
Sbjct  122   IPKLASQLGIKSIYYSVISATTFSYVFTPTRQLCGPDFTVDEFMQPPLGLAISAIKLHSH  181

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             EA+  T  + M FG D+ FF R FT + E+D +A+  C EIEG F D++ ++F+KPVLL+
Sbjct  182   EAKNVTFMSNMIFGSDVRFFHRHFTGLCEADAIAFKACGEIEGPFVDFLISEFKKPVLLS  241

Query  873   gpalpvPS-KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP   +   K+T+E +W +WL KFK GSVIYCAFGSECTL KD+FQEL+ G ELT +PF 
Sbjct  242   GPDGDIQEPKTTLEHRWQEWLSKFKSGSVIYCAFGSECTLTKDQFQELVLGFELTNLPFL  301

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             A LKPP   +++ AA+P+  +E+++GRG+V+G WVQQQ  L+HPS+GCFV+HCG  SLSE
Sbjct  302   AVLKPPVGVDTVTAALPDGFEERVEGRGVVYGGWVQQQHILEHPSIGCFVTHCGAGSLSE  361

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             ALV  CQ+VLLP VGD    AR +S  LKVGVEVEK E+DG F++ESVC+AVK +MDE +
Sbjct  362   ALVKKCQLVLLPHVGDHFFRARTLSSCLKVGVEVEKREDDGFFTKESVCEAVKTLMDEGN  421

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             E G+E+R    KLR  LL+ DL+  Y+ +F   LQ
Sbjct  422   ERGKEIRATRAKLRELLLDKDLEESYIINFIHNLQ  456



>ref|XP_010686377.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=466

 Score =   446 bits (1148),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 315/449 (70%), Gaps = 1/449 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM PWF  GH+T F  LANKLA KGH ISF IP  T+ K  S N HPHLI+ +PI +P
Sbjct  12    HIAMCPWFAFGHITSFLHLANKLAEKGHTISFFIPTKTKLKFVSHNHHPHLITLIPITLP  71

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
             S+ GL  GAETT+DVP  S  L+M AMD+TQ+ IE  L  +K D +F+DFT W+P +ARK
Sbjct  72    SVHGLHVGAETTADVPASSRSLIMAAMDQTQDTIESHLAHIKPDFIFFDFTEWIPKVARK  131

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
               IKSVFYST+  +   Y L   R++     +E DM + P  FP PSI+L AHEAR  ++
Sbjct  132   HQIKSVFYSTVYLVTVAYLLPQPRKLAINCFSEEDMKQPPPGFPLPSIRLRAHEARSLSS  191

Query  1032  RTVMKFGGD-ITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
              +  +FGG  ++  +R+  A  + D +   TCRE+EG +CD+++  + KPVLLAGP +P 
Sbjct  192   ASKAEFGGGGMSLLERVSEAFQQCDAVCIKTCREMEGSYCDFMQKNYGKPVLLAGPVVPE  251

Query  855   PSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppf  676
                + +++ +  WL     GSV+YCA GSECTL+KD+FQEL+ GLELTGMPF AALK P 
Sbjct  252   LPATQLDEYFDRWLKGCGNGSVVYCALGSECTLQKDQFQELILGLELTGMPFLAALKLPT  311

Query  675   eaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQ  496
             E  ++E+A+PE  KE+ +GRGIVH  WVQQQL LQH SVGCF++HCG  SLSEA+V+ CQ
Sbjct  312   ECSTLESALPEGFKERTKGRGIVHIGWVQQQLVLQHSSVGCFLTHCGAGSLSEAMVSQCQ  371

Query  495   IVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             I++LPQ  DQ +NAR+MS+ L++GVEVE  + DG F+RE+VCKAV  VMD ++E+GREVR
Sbjct  372   IIMLPQAVDQSVNARLMSLDLRLGVEVEMRDRDGFFTREAVCKAVVTVMDAENEVGREVR  431

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH K R FLL   L+  Y++ F Q LQD
Sbjct  432   ANHAKWREFLLKEGLEDAYINGFIQSLQD  460



>gb|KHN27959.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=461

 Score =   446 bits (1146),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 252/456 (55%), Positives = 336/456 (74%), Gaps = 2/456 (0%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             + A   H+A++PWF +GHLT    L+NKLA +GHRISF++PK TQ+KL+  NLHPHLI+F
Sbjct  4     ASAAPLHVAIFPWFAMGHLTPILHLSNKLAQRGHRISFIVPKRTQTKLQHLNLHPHLITF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
             VPI VP + GLP  AETTSD+PF    LL  A+D+T+ DIE++L++LK   VF+DF HWL
Sbjct  64    VPITVPRVDGLPQDAETTSDIPFSLFPLLATALDRTEKDIELLLRELKPQFVFFDFQHWL  123

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPS-IKLHAH  1054
             P+L R +GIKSV Y  ++PL   Y  +  R+  G++LTE D M+ P  FPD + IK   H
Sbjct  124   PNLTRSLGIKSVAYFIVNPLSIAYLGNGPRQSQGRELTEVDFMEPPQGFPDDACIKFQPH  183

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             E R   +   ++FG  +  +DR+ T+   +D + +  CREIEG + +Y+ET + KPVLL+
Sbjct  184   ELRFLVSTRKLEFGSGVFLYDRLHTSTCLADAIGFKGCREIEGPYAEYLETVYGKPVLLS  243

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP LP P  +T+E+KW  WLG+FK GSVI+CA+GSE  L +++FQELL GLELTG PF A
Sbjct  244   GPLLPEPPNTTLEEKWVAWLGRFKPGSVIFCAYGSESPLPQNQFQELLLGLELTGFPFLA  303

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             ALKPP    SIE A+PE   E+++GRG+  G WVQQQL L+HPSVGCF++HCG AS++EA
Sbjct  304   ALKPPNGFVSIEEALPEGFSERVKGRGVACGGWVQQQLILEHPSVGCFITHCGAASVTEA  363

Query  513   LVNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             LVN CQ+V LP++G D +INAR+ S  LKVGVEVEKG+EDG+F++ESVCKAVK VM++ +
Sbjct  364   LVNKCQLVFLPRLGADHVINARMFSKKLKVGVEVEKGDEDGLFTKESVCKAVKTVMEDGN  423

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             E+GR+VR NH KLR FLL+  L+S  +D F Q+LQD
Sbjct  424   EVGRKVRENHAKLRNFLLSDSLESTCVDGFCQQLQD  459



>ref|XP_004487587.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cicer arietinum]
 gb|AGU14138.1| UDP-glycosyltransferase [Cicer arietinum]
Length=455

 Score =   445 bits (1144),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 256/454 (56%), Positives = 333/454 (73%), Gaps = 3/454 (1%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             +A   H+AM+PWF +GH T F  L+NKLA +GH+ISF IPK T +KL+  NLHPHLI+F 
Sbjct  2     EAPPLHIAMFPWFAMGHFTPFLHLSNKLAQRGHKISFFIPKKTLNKLQHLNLHPHLITFF  61

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
              I VP + GLP GAETTSDVPFP   L+  AMD+T+ DIE++LK+LK  +VF+DF HWLP
Sbjct  62    TINVPHVDGLPHGAETTSDVPFPLFPLIATAMDQTEKDIELLLKELKPQIVFFDFQHWLP  121

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA  1048
             +L +K+GIKSV    ++P+   Y     R   G++LTE D++K P+ FPD  I LH+HE 
Sbjct  122   NLTKKLGIKSVQNWIMNPISTAYL--GNRPSQGRELTEVDLLKPPSGFPDSCINLHSHEL  179

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             R   +   ++FG  + FFDR+ +    SD +A+  C+EI+G + DYIE   +KPV L+GP
Sbjct  180   RFLVSFKKLEFGSGVLFFDRLESGSKLSDAIAFKGCKEIDGIYADYIEMVLRKPVFLSGP  239

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              LP P+ S++E+KW  WL  FK GSV+YCA+G+E  L  ++FQELL GLELTG PF  AL
Sbjct  240   LLPEPTLSSLEEKWVSWLNGFKHGSVVYCAYGTESALEHNQFQELLLGLELTGFPFLVAL  299

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   ESIE A+P+   E+++ RGIV+G WVQQQL L+H SVGCF++HCG AS++E LV
Sbjct  300   KPPIGFESIEEALPKGFNERVKERGIVYGGWVQQQLILEHSSVGCFITHCGAASITEGLV  359

Query  507   NDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             N CQ+VLLP VG D I+NAR+MS  LKVGVEVEKGEEDG+F++ESVCKAV  VMDE +EI
Sbjct  360   NTCQLVLLPHVGADYILNARMMSAKLKVGVEVEKGEEDGLFTKESVCKAVNIVMDEGNEI  419

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             GREVR NH K+R FLL+ +L+S  +DSF +KL D
Sbjct  420   GREVRANHAKMRNFLLSENLESSCVDSFCRKLYD  453



>ref|XP_008383670.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=471

 Score =   444 bits (1143),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 254/457 (56%), Positives = 335/457 (73%), Gaps = 9/457 (2%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             + H+AMYPWF +GHLT +  L+NKLA +GHRISF +P  TQ KL++ NLHPHLISF+PI 
Sbjct  9     SLHIAMYPWFAMGHLTPYLHLSNKLAERGHRISF-VPTKTQQKLQALNLHPHLISFIPIT  67

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GL PGAETT+DVPFPS  LLM AMD TQ  I   + +L  D VF+DFT WLP L 
Sbjct  68    VPHVDGLLPGAETTNDVPFPSYSLLMTAMDLTQPAILQAICELNPDFVFFDFTPWLPKLL  127

Query  1218  RKIG--IKSVFYSTISPLMHGYALSPERRVVGKQ--LTE----ADMMKAPASFPDPSIKL  1063
             R++G  IKS+ Y  I+P + GY  SPER+V+ ++  LTE     D++  P SFP  SIKL
Sbjct  128   RQLGTGIKSINYIIITPALVGYVRSPERKVLMEKSVLTEDDLINDLINPPPSFPPSSIKL  187

Query  1062  HAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpv  883
              AHEAR      + +FG      DR+  ++++ D +A+ TCRE+EG++CDY+ETQ +KPV
Sbjct  188   PAHEARMLAPFLLKEFGSGTKLIDRLIISLNDCDAVAFRTCREMEGKYCDYLETQLRKPV  247

Query  882   llagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMP  703
             LLAGP +P    + +++KW+ WL  F+  SVIYCAFG+EC L+ D+ QELL G ELTG+P
Sbjct  248   LLAGPVVPETPTTELDEKWAKWLESFEAKSVIYCAFGTECVLKIDQLQELLLGFELTGLP  307

Query  702   FFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASL  523
             FFAALKPP   E++E+A+PE  + +++GRG+V   WVQQ L L+HPSVGCFV+HCG +SL
Sbjct  308   FFAALKPPMGVEAVESALPEGFEGRVKGRGVVSWGWVQQPLILKHPSVGCFVTHCGPSSL  367

Query  522   SEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDE  343
              E LV++CQ+VLLP V DQ+  AR+M   L+VGV+VEKGEEDGVF++E VCKAV+ VMDE
Sbjct  368   MEGLVSECQLVLLPNVADQLAIARVMGRDLRVGVKVEKGEEDGVFTKEGVCKAVRDVMDE  427

Query  342   KSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +SE+G+EVR NH K R FL +  L++ Y+DSF +KL 
Sbjct  428   ESEVGKEVRRNHTKWREFLSSKGLENSYVDSFVEKLH  464



>ref|XP_003543300.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
 gb|KHN36712.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=468

 Score =   444 bits (1142),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 333/455 (73%), Gaps = 1/455 (0%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             + A   H+A++PWF +GHLT    L+NKLA +GHRISF+ PK TQ+KL+  NLHPHLI+F
Sbjct  4     ANAAPLHIAIFPWFAMGHLTPSLHLSNKLAQRGHRISFIGPKKTQTKLQHLNLHPHLITF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
             VPI VP + GLP  AETTSDVPF    L+ EAMD+T+ DIEI+L++LK  +VF+DF HWL
Sbjct  64    VPIKVPHVNGLPHDAETTSDVPFSLFPLIAEAMDRTEKDIEILLRELKPQIVFFDFQHWL  123

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             P+L R++GIKSV Y  I+PL   Y  +  R+  G++LTE D+M  P  FPD  IK   HE
Sbjct  124   PNLTRRLGIKSVMYVIINPLSTAYFANGPRKSKGRELTELDLMVPPQGFPDSCIKFQPHE  183

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
              R       ++FG  +  +DR  TA S +D + +  C+EI+G + +Y+ET + KPVLL+G
Sbjct  184   LRFLVGVRKLEFGSGVLLYDRYHTAASMADAIGFKGCKEIDGPYAEYLETVYGKPVLLSG  243

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P LP P  +T+E KW  WLG+F  GSV++CA+GSE  L +++ QELL GLELTG PF AA
Sbjct  244   PLLPEPPNTTLEGKWVSWLGRFNPGSVVFCAYGSESRLPQNQLQELLLGLELTGFPFLAA  303

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP   ESIE A+PE  +E++QGRGIV   WVQQQL L HPSVGCF++HCG ASL+EAL
Sbjct  304   LKPPNGFESIEEALPEGFRERVQGRGIVDEGWVQQQLILGHPSVGCFITHCGAASLTEAL  363

Query  510   VNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             VN C++V LP +G DQ+IN R+ S  L+VGVE+EKGEEDG+F++ESVCKAVK VMD+ +E
Sbjct  364   VNKCRLVFLPHLGADQLINCRMFSRKLRVGVEIEKGEEDGLFTKESVCKAVKIVMDDGNE  423

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +GREVR NH KLR FLL+ +++S+ +D F + L D
Sbjct  424   VGREVRENHSKLRNFLLSDNVESECVDGFCKGLHD  458



>ref|XP_003540412.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=478

 Score =   444 bits (1143),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 251/456 (55%), Positives = 336/456 (74%), Gaps = 2/456 (0%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             + A   H+A++PWF +GHLT    L+NKLA +GHRISF++PK TQ+KL+  NLHPHLI+F
Sbjct  21    TSAAPLHVAIFPWFAMGHLTPILHLSNKLAQRGHRISFIVPKRTQTKLQHLNLHPHLITF  80

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
             VPI VP + GLP  AETTSD+PF    LL  A+D+T+ DIE++L++LK   VF+DF HWL
Sbjct  81    VPITVPRVDGLPQDAETTSDIPFSLFPLLATALDRTEKDIELLLRELKPQFVFFDFQHWL  140

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPS-IKLHAH  1054
             P+L R +GIKSV Y  ++PL   Y  +  R+  G++LTE D M+ P  FPD + IK   H
Sbjct  141   PNLTRSLGIKSVAYFIVNPLSIAYLGNGPRQSQGRELTEVDFMEPPQGFPDDACIKFQPH  200

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             E R   +   ++FG  +  +DR+ T+   +D + +  CREIEG + +Y+ET + KPVLL+
Sbjct  201   ELRFLVSTRKLEFGSGVFLYDRLHTSTCLADAIGFKGCREIEGPYAEYLETVYGKPVLLS  260

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP LP P  +T+E+KW  WLG+FK GSVI+CA+GSE  L +++FQELL GLELTG PF A
Sbjct  261   GPLLPEPPNTTLEEKWVAWLGRFKPGSVIFCAYGSESPLPQNQFQELLLGLELTGFPFLA  320

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             ALKPP    SIE A+PE   E+++GRG+  G WVQQQL L+HPSVGCF++HCG AS++EA
Sbjct  321   ALKPPNGFVSIEEALPEGFSERVKGRGVACGGWVQQQLILEHPSVGCFITHCGAASVTEA  380

Query  513   LVNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             LVN CQ++ LP++G D +INAR+ S  LKVGVEVEKG+EDG+F++ESVCKAVK VM++ +
Sbjct  381   LVNKCQLLFLPRLGADHVINARMFSKKLKVGVEVEKGDEDGLFTKESVCKAVKTVMEDGN  440

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             E+GR+VR NH KLR FLL+  L+S  +D F Q+LQD
Sbjct  441   EVGRKVRENHAKLRNFLLSDSLESTCVDGFCQQLQD  476



>ref|XP_003596670.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=458

 Score =   442 bits (1138),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 337/449 (75%), Gaps = 1/449 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF +GHLT +   +NKLA +GH+ISF IPKNT +KL+  NLHP+LI+F PI VP
Sbjct  8     HIAMFPWFAMGHLTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITVP  67

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETTSDVPF    L+  AMD+T   IE++LK+LK  +VF+DF +WLP+L +K
Sbjct  68    HVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDFQYWLPNLTQK  127

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKS+ Y   +P+   Y  +  R+  GK LT+ D+ K PA FPD SIK H+HE R   +
Sbjct  128   LGIKSLQYLIWNPISSAYLGNIPRKSQGKYLTKDDLKKPPAGFPDSSIKFHSHELRFLAS  187

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                ++FG  +  +DR+ T    SD +++  CREI+G + DY+ET F KPVLL+GP LP P
Sbjct  188   TRKIEFGSGVLLYDRVDTGTKSSDAVSFKGCREIDGLYADYLETVFGKPVLLSGPLLPEP  247

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
              K+T+E+KW  WL +FK GSVI+CA+GSE  L  ++FQELL GLELTG PF AALKPP  
Sbjct  248   PKATLEEKWLTWLKEFKHGSVIFCAYGSEGPLETNQFQELLLGLELTGFPFLAALKPPIG  307

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ESIE A+PE   E+I+G+GIV+G W+QQQL L+HPSVGCF++HCG AS++E LVN CQ+
Sbjct  308   FESIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASITEGLVNTCQL  367

Query  492   VLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             VLLP+ G D I+NAR+MS +LKVG+EVE+GEEDG+F++ESV  AV+ VMD+++E+G+EVR
Sbjct  368   VLLPRAGADHIMNARMMSSTLKVGIEVERGEEDGLFTKESVGNAVRIVMDDENEVGKEVR  427

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH K+R FLL+++L+S  ++SF QKL D
Sbjct  428   ANHAKMRNFLLSSNLESSCVNSFCQKLYD  456



>ref|XP_003596668.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=461

 Score =   442 bits (1137),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 252/449 (56%), Positives = 331/449 (74%), Gaps = 1/449 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H++M+PWF +GH T +   +NKLA +GH+ISF IPKNT +KL+  NLHP+LI+F PI VP
Sbjct  8     HISMFPWFAMGHFTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITVP  67

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETTSDVPF    L+  AMD+T   IE++LK+LK  +VF+DF +WLP+L +K
Sbjct  68    HVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDFQYWLPNLTQK  127

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKS+ Y   SP+   Y  S  R+  G  LTE D+ K P  FPD SIK H+HE R   +
Sbjct  128   LGIKSLQYLIWSPISPAYLGSIPRKSQGTYLTEDDLKKPPTGFPDSSIKFHSHELRFLAS  187

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                 +FG  +  +DR+ T    SD +++  CREI+G + DY+ET F KPVLL+GP LP  
Sbjct  188   TRKQEFGSGVLLYDRVDTGTKFSDAVSFKGCREIDGLYADYLETVFGKPVLLSGPLLPEA  247

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
              KST+E+KW  WL  FK GSV++CA+GSE  L+ ++FQELL GLELTG PF AALKPP  
Sbjct  248   PKSTLEEKWLTWLEGFKHGSVVFCAYGSEGPLQHNQFQELLLGLELTGFPFLAALKPPIG  307

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              +SIE A+PE   E++ G+GIV+G W+QQQL L+HPSVGCF++HCG AS++E LVN CQ+
Sbjct  308   FDSIEEALPEGFNERVNGKGIVYGNWIQQQLILEHPSVGCFITHCGAASITEGLVNTCQL  367

Query  492   VLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             VLLP+ G D I+NAR+MS  LKVGVEVEKGEEDG+F++ESVCKAVK VMD+++E+G+ VR
Sbjct  368   VLLPRAGTDHIMNARMMSSKLKVGVEVEKGEEDGLFTKESVCKAVKIVMDDENEVGKAVR  427

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH K+R FLL+++L+S  +DSF QKL D
Sbjct  428   ANHAKMRNFLLSSNLESSCVDSFCQKLYD  456



>ref|XP_003596675.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES66926.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   442 bits (1136),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 331/447 (74%), Gaps = 1/447 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPKNT +KL+  NL+P+LI+F PI VP
Sbjct  8     HIAMFPWFAMGHLTPYLHLSNKLALRGHKISFFIPKNTLNKLQYLNLYPNLITFFPITVP  67

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETTSDVPF    L+  AMD+T+ DIEI+LK++K  +VF+DF +WLP L + 
Sbjct  68    HVNGLPLDAETTSDVPFSLVPLIATAMDQTEKDIEILLKEIKPQIVFFDFQYWLPKLTKN  127

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             + IKS+ Y  ++P+   Y    ++  +GK LT+ D+MK P+ FPD  IK + HE R   +
Sbjct  128   LDIKSLQYIILTPVSTAYLGCLQKLSLGKDLTDVDIMKPPSGFPDSCIKFYKHELRFLAS  187

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                + FG  +  FDR+    + +D + +  C E++G + DYIET F KPVLL+GP LP P
Sbjct  188   TRKIAFGSGVFLFDRLHIGTTSADAVGFKGCNEVDGPYADYIETVFGKPVLLSGPVLPEP  247

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
             + +T+E+KW  WL  F+ GSV++CA+GSE  L K++F ELL GLELTG PF AALKPP  
Sbjct  248   TNTTLEEKWISWLKGFENGSVVFCAYGSEGPLEKNQFLELLLGLELTGFPFLAALKPPIG  307

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ESIE A+PE   E+I+G+GIV+G W+QQQL L+HPSVGCF++HCG AS++E LVN CQ+
Sbjct  308   FESIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASITEGLVNTCQL  367

Query  492   VLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             VLLP++G D I+NAR+MS   KVGVEVEKG+EDG+F++ESVCKA K VMD+++EIGREVR
Sbjct  368   VLLPRLGSDHIMNARVMSSKFKVGVEVEKGDEDGLFTKESVCKAAKIVMDDENEIGREVR  427

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKL  235
              NH K+R FLL+ +L+S  +DSF QKL
Sbjct  428   ANHAKMRNFLLSNNLESSCVDSFCQKL  454



>gb|AFK34819.1| unknown [Medicago truncatula]
Length=458

 Score =   442 bits (1136),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 246/447 (55%), Positives = 331/447 (74%), Gaps = 1/447 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPKNT +KL+  NL+P+LI+F PI VP
Sbjct  8     HIAMFPWFAMGHLTPYLHLSNKLALRGHKISFFIPKNTLNKLQYLNLYPNLITFFPITVP  67

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETTSDVPF    L+  AMD+T+ DIEI+LK++K  +VF+DF +WLP L + 
Sbjct  68    HVNGLPLDAETTSDVPFSLVPLIATAMDQTEKDIEILLKEIKPQIVFFDFQYWLPKLTKN  127

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             + IKS+ Y  ++P+   Y    ++  +GK LT+ D+MK P+ FPD  IK + HE R   +
Sbjct  128   LDIKSLQYIILTPVSTAYLGCLQKLSLGKDLTDVDIMKPPSGFPDSCIKFYKHELRFLAS  187

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                + FG  +  FDR+    + +D + +  C E++G + DYIET F KPVLL+GP LP P
Sbjct  188   TGKIAFGSGVFLFDRLHIGTTSADAVGFKGCNEVDGPYADYIETVFGKPVLLSGPVLPEP  247

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
             + +T+E+KW  WL  F+ GSV++CA+GSE  L K++F ELL GLELTG PF AALKPP  
Sbjct  248   TNTTLEEKWISWLKGFENGSVVFCAYGSEGPLEKNQFLELLLGLELTGFPFLAALKPPIG  307

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ESIE A+PE   E+I+G+GIV+G W+QQQL L+HPSVGCF++HCG AS++E LVN CQ+
Sbjct  308   FESIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASITEGLVNTCQL  367

Query  492   VLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             VLLP++G D I+NAR+MS   KVGVEVEKG+EDG+F++ESVCKA K VMD+++EIGREVR
Sbjct  368   VLLPRLGSDHIMNARVMSSKFKVGVEVEKGDEDGLFTKESVCKAAKIVMDDENEIGREVR  427

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKL  235
              NH K+R FLL+ +L+S  +DSF QKL
Sbjct  428   ANHAKMRNFLLSNNLESSCVDSFCQKL  454



>gb|AES66927.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=459

 Score =   441 bits (1135),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 248/452 (55%), Positives = 331/452 (73%), Gaps = 1/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IP  TQ+KLE FNL+P+LI+F P+
Sbjct  5     SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPTKTQTKLEQFNLYPNLITFYPL  64

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP I GLP GAETTSDV F    L+M AMD+TQ  +E++L  L   +VF+DF  W+P +
Sbjct  65    NVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLAQLNPKMVFFDFAFWIPKI  124

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A+ +GIKS  Y  +SP    Y LSP R      LTE D+MK P  +P+ S  L++HEA+ 
Sbjct  125   AQSLGIKSFQYWIVSPATISYTLSPSRMCESINLTEFDLMKPPKGYPNSSFTLYSHEAKY  184

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                +   +FG  + F+DR+F  +S SD + +  CR+IEG + DY+E +F KPVLL+GP L
Sbjct  185   LALKRNFEFGSGVLFYDRLFNGLSLSDAIGFKGCRQIEGPYVDYLEQEFGKPVLLSGPVL  244

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
             P P K+ +++KW  WLG FK+GS++YCA GSEC L  ++FQELL GLELTG PF A LKP
Sbjct  245   PEPPKTVLDEKWGSWLGGFKDGSLVYCALGSECKLTLEQFQELLLGLELTGYPFLAILKP  304

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P   E++E A PEE +E+++ +GIVH  W+QQQL L+H SVGCFV+HCG  SL+E L N+
Sbjct  305   PVGFETVEDAFPEEFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTEGLTNN  364

Query  501   CQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             CQ+VL+P +  D IINA+IM + LKVGVEV+KGEEDG+F++ESVC+AVK VMD+++EIGR
Sbjct  365   CQMVLIPHLDADHIINAKIMGMKLKVGVEVKKGEEDGLFTKESVCEAVKIVMDDENEIGR  424

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EVR NHDKLR  LLN DL+S  +D F +KLQ+
Sbjct  425   EVRNNHDKLRNLLLNQDLESSCVDGFCEKLQE  456



>ref|XP_004487588.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
 gb|AGU14137.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 330/449 (73%), Gaps = 1/449 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF +GHLT F  L+NKLA +GH+ISF IPK TQ+KL+  NLHPHLI+F  I VP
Sbjct  7     HIAMFPWFAMGHLTPFLHLSNKLAQRGHKISFFIPKKTQTKLQHLNLHPHLITFFTINVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP GAETTSDVPF    L+  AMD+T  DIE++LK+LK  +VF+DF HWLP+L +K
Sbjct  67    HVDGLPYGAETTSDVPFSLFPLIATAMDQTDKDIELLLKELKPQIVFFDFQHWLPNLTKK  126

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
              GIKS+ Y   +P+   Y  +  R+  G++L E D+MK P+ FPD  I LH+HE R   +
Sbjct  127   HGIKSLQYLIWNPISTAYLGTGPRQSQGRELNEVDLMKPPSGFPDTCINLHSHELRFLVS  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                ++FG  I  +DR+      +D +A+  C+EI+G + +Y+ + F K VLL+GP LP P
Sbjct  187   SRKLEFGSGILLYDRVDLGARLADVIAFKGCKEIDGPYVEYLGSVFGKSVLLSGPILPEP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
               ST+E+KW  WL  FK+GSV+YCA+GSE  L  ++F+ELL GLELTG PF AALKPP  
Sbjct  247   PMSTLEEKWVSWLNGFKQGSVVYCAYGSESALEHNQFKELLLGLELTGFPFLAALKPPVG  306

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ESIE A+P+   E+++GRGI +G WVQQQL L H S+GCF++HCG AS++E LVN CQ+
Sbjct  307   FESIEEALPQGFNERVKGRGIAYGGWVQQQLILGHTSIGCFITHCGAASITEGLVNTCQL  366

Query  492   VLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             VLLP++G D I+NAR+MS  LKVGVE+EKGEEDG+F++ESVCKAV  VMDE++E+GREVR
Sbjct  367   VLLPRLGSDHIMNARMMSAKLKVGVEIEKGEEDGLFTKESVCKAVNIVMDEENELGREVR  426

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH KLR FLL  +L+S  +DSF Q+L D
Sbjct  427   ANHAKLRNFLLCNNLESSSVDSFCQELYD  455



>ref|XP_011087015.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Sesamum indicum]
Length=452

 Score =   439 bits (1128),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 243/452 (54%), Positives = 316/452 (70%), Gaps = 10/452 (2%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
              +  + MYPWF +GHLT F  +++K A KGH+I F++P  TQSKL+ FNLHP+LI F+PI
Sbjct  4     NSLKIVMYPWFAMGHLTAFLHISDKFAEKGHKIFFILPTKTQSKLDQFNLHPNLIKFIPI  63

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLP G+ETT+DVPFP   LL  AMD T+  IE  L++LK   VF+DFTHWLP+L
Sbjct  64    TVPQVDGLPDGSETTADVPFPMYSLLRHAMDLTEPVIEGFLRELKPHFVFFDFTHWLPAL  123

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEAD-MMKAPASFPDPSIKLHAHEAR  1045
             AR++GIKSV Y TISP    Y    E          AD  ++ P  FP  +I LH HEAR
Sbjct  124   ARRLGIKSVHYCTISPASVAYLFRDE--------PAADAFLEPPPGFPPSAISLHKHEAR  175

Query  1044  GFT-ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             G      + +FG  + F  R+  A  E D + + +C E+EG+FC+++E +F+KP++LAGP
Sbjct  176   GVDWINNIKEFGNGMKFVQRVLMAAEECDAMCFKSCNEMEGRFCEFLEKKFKKPMILAGP  235

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              LP P  S +++KW+ WL +FK  SVI+C+FGSE  L +D+FQEL+ G ELTG PF AAL
Sbjct  236   VLPEPPTSMLDEKWAKWLDQFKAKSVIFCSFGSEARLERDQFQELILGFELTGFPFLAAL  295

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP  AE++E A+PE  K++   RG VHG WVQQQL L HPSVGCFV+HCGW SLSEA+V
Sbjct  296   KPPIGAETVEEALPEGFKKRSAERGAVHGGWVQQQLILSHPSVGCFVTHCGWGSLSEAMV  355

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             N+CQ+VLLP VGDQ INAR+M   LKVGVEVEKG+EDG+F+RE V   ++ VM++ SEIG
Sbjct  356   NECQLVLLPHVGDQPINARLMGGDLKVGVEVEKGDEDGLFTREGVMNVIRLVMEDGSEIG  415

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +E+R  H + R FLL   L+S Y D F  +LQ
Sbjct  416   KEIRTKHAEWREFLLREGLESSYFDDFVHRLQ  447



>ref|XP_004487585.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Cicer arietinum]
 gb|AGU14140.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   436 bits (1120),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 251/454 (55%), Positives = 331/454 (73%), Gaps = 1/454 (0%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             +A   H+AM+PWF +GH T F  L+NKLA +GH+ISF IPK T +KL+  NLHPHLI+F 
Sbjct  2     EAPPLHLAMFPWFAMGHFTPFLHLSNKLAQRGHKISFFIPKKTLNKLQHLNLHPHLITFF  61

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
              I VP + GLP GAETTSDVPF    L+  AMD+T  +IE++LK+LK  +VF+DF +WLP
Sbjct  62    TINVPHVDGLPYGAETTSDVPFSLFPLIATAMDQTDKEIELLLKELKPQIVFFDFQYWLP  121

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA  1048
             +L +K+GIKSV Y  I+P+   Y  +  R+  G++LTEAD+MK P+ FP   IK H++E 
Sbjct  122   NLTKKLGIKSVQYMIINPMTTAYLGTGPRQSQGRELTEADLMKPPSGFPGSCIKFHSYEL  181

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             R   +   + FG  +    R+ T  S +D + Y  C+EI+G + +Y+ T + KPVLL+GP
Sbjct  182   RYLASIGNVVFGSGVLLMYRLDTGTSLADAIGYKGCKEIDGPYVEYLRTIYGKPVLLSGP  241

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              LP P+ S++E+KW  WL  FK GSV+YCA+GSE  L  ++F+ELL GLELTG PF  AL
Sbjct  242   LLPEPTLSSLEEKWVSWLKGFKLGSVVYCAYGSESALEHNQFKELLLGLELTGFPFLVAL  301

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   ESIE A+P+   E+++GRGI++G WVQQQL L+H SVGCF++HCG AS++E LV
Sbjct  302   KPPIGFESIEEALPQGFNERVKGRGIIYGGWVQQQLILEHSSVGCFITHCGAASITEGLV  361

Query  507   NDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             N CQ+VLLP VG D I+NAR+MS  LKVGVEVEKGEEDG+F++ESVCKAV  VMDE++E+
Sbjct  362   NMCQLVLLPHVGSDHIMNARMMSAKLKVGVEVEKGEEDGLFTKESVCKAVNTVMDEENEV  421

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             GREVR NH KLR  LL+ +L S  +DSF Q+L D
Sbjct  422   GREVRANHAKLRNILLSNNLKSSCVDSFCQELYD  455



>ref|XP_008455478.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=460

 Score =   435 bits (1118),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 244/457 (53%), Positives = 328/457 (72%), Gaps = 2/457 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             M    +  H+AMYPWF +GHL  F ++ NKLA KGHRISF IP  TQ KL+ FN  P+LI
Sbjct  1     MEEAPSGLHIAMYPWFALGHLIAFLQIGNKLANKGHRISFFIPSKTQPKLQPFNHFPNLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPS-THLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
             +FVPI VP + GLP GAETT+DV  PS   L+M +MD+T+ +I   L+D+K +V+FYD  
Sbjct  61    TFVPITVPHVDGLPLGAETTADVSHPSQIPLIMTSMDRTEPEIASRLQDIKPEVIFYDLA  120

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGK-QLTEADMMKAPASFPDPSIKL  1063
             +W+P LA  +GIKSV+++ +S +   Y      +  G   LT  D++  P  FP  SIKL
Sbjct  121   YWVPKLAHPLGIKSVYFTAVSAVTMSYIQCKLWKFPGHYNLTRDDLLHPPPDFPCSSIKL  180

Query  1062  HAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpv  883
             HAHEA+   +   MKFGGDITFF+RI  A+S+ + +A  +CREIEG F DY+E+  ++P+
Sbjct  181   HAHEAQYLASFGRMKFGGDITFFERISNALSQCNAIALKSCREIEGPFIDYLESIVERPI  240

Query  882   llagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMP  703
             LL G     P  +++E++W++WL +FK GSVIYCAFGSEC L K++FQELL GLEL+ +P
Sbjct  241   LLPGTVNLEPLTTSLEERWANWLSEFKSGSVIYCAFGSECILTKNQFQELLLGLELSNLP  300

Query  702   FFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASL  523
             FF ALKPP   +++EAA+P+  K++I+GRGIV+G WVQQQ  L HPS+GCF++HCG  SL
Sbjct  301   FFVALKPPDGIDTVEAALPKGFKQRIEGRGIVYGGWVQQQQILDHPSIGCFITHCGAESL  360

Query  522   SEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDE  343
             SEA+V  CQ+VL  +  DQ+  AR MS  LKVGVE+EKGEEDGVFS+ESVCKAVK VMDE
Sbjct  361   SEAVVKKCQLVLFSRTTDQLFRARSMSKFLKVGVEIEKGEEDGVFSKESVCKAVKTVMDE  420

Query  342   KSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             ++E G+E+R N +KLR  L++ DL+  Y+++F   L 
Sbjct  421   ENESGKEIRANKEKLRELLVDKDLEESYINNFIHSLH  457



>ref|XP_004487586.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
Length=459

 Score =   434 bits (1116),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 243/452 (54%), Positives = 331/452 (73%), Gaps = 1/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPK TQ+KLE FNL+P+LI+F P+
Sbjct  5     SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFFPL  64

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLP GAETTSDV F    L+M AMD+TQN IE++L  L   ++F+DFT WLP +
Sbjct  65    NVPHVDGLPLGAETTSDVSFSLGPLIMTAMDQTQNQIELLLTQLNPQIIFFDFTFWLPKI  124

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             ++ +GIKS  Y  ++P    Y  SP R    ++LTE D+MK P  +P  S  L  HEA+ 
Sbjct  125   SQSLGIKSFLYLIVNPATTSYTTSPLRMCEAEKLTEVDLMKPPKGYPISSFNLQFHEAKH  184

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
               ++  ++FG  + F+DRIF  +S +D + +  CREIEG + DY++ QF KPVLL+GP L
Sbjct  185   LASKRKLEFGSGVLFYDRIFHGLSFADAIGFKGCREIEGSYVDYLQEQFGKPVLLSGPVL  244

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
             P   K+ +++KW  WLG FK+GS++YCA GSE  L++D+F ELL GLELTG PF A +KP
Sbjct  245   PEQPKTFLDEKWGSWLGGFKDGSLVYCALGSEWILKQDQFHELLLGLELTGFPFLAIVKP  304

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P   E+IE A+PE  KE+++ +GIVH  W+QQQL L+H SVGCFV+HCG  SL+E L+N 
Sbjct  305   PIGFETIEDALPEGFKERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTEGLMNS  364

Query  501   CQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             CQ+VLLP +  D IINA+IM   LKVGVEV+KGEEDG+F++ESVC+AVK VMD+++E+GR
Sbjct  365   CQMVLLPHLDSDHIINAKIMGRHLKVGVEVKKGEEDGLFTKESVCEAVKIVMDDENEVGR  424

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EVR NH K+R  LL+  L+S  +D+F +KLQ+
Sbjct  425   EVRINHAKVRSLLLSHGLESACVDTFCEKLQE  456



>ref|XP_004487589.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cicer arietinum]
 gb|AGU14103.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   433 bits (1113),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 245/453 (54%), Positives = 333/453 (74%), Gaps = 1/453 (0%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             +A   H+AM+PW  +GH T +  L+NKLA +GH+ISF IPKNT +KL+  NL+PHLI+FV
Sbjct  2     EAPPLHLAMFPWLAMGHFTPYLHLSNKLAKRGHKISFFIPKNTLNKLQHLNLNPHLITFV  61

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
             PI VP + GLP  AET SDVPF    L+  AMD+T+ +IE++LK+LK  +VF+DF +W+P
Sbjct  62    PITVPHVDGLPHDAETASDVPFSLLPLIATAMDETKKEIELLLKELKPQIVFFDFQYWVP  121

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA  1048
             +L +K+GIKSV Y   SP    Y     R+ +GK+LT  D+ K P+ +PD SIKLH+HE 
Sbjct  122   NLTKKLGIKSVQYWIASPYSISYFFHGPRQSLGKELTVDDLKKPPSGYPDSSIKLHSHEL  181

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             +   +   + FG  +  +DR+    S +D + +  C+EI+G +  Y+ T + KP LL+GP
Sbjct  182   QFLASSRKLVFGSGVLLYDRLHFGTSLADAIGFKGCKEIDGPYAQYLGTVYGKPSLLSGP  241

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              LP    +T+++KW  WL  FK GSV+YCA+GSE  L++++F+ELL GLELTG PF AAL
Sbjct  242   LLPESPLTTLDEKWVSWLKGFKHGSVVYCAYGSEGPLQENQFKELLLGLELTGFPFVAAL  301

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   ESIE A+P+   E+++GRGIV+G WVQQQL L+HPSVGCF++HCG AS++EALV
Sbjct  302   KPPVGFESIEEALPQGFNERVKGRGIVYGGWVQQQLILEHPSVGCFITHCGAASITEALV  361

Query  507   NDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             N CQ+VLLP+VG D I+NAR+MS  LKVGVEVEKG+EDG+F++ESVC AV  VMDE +EI
Sbjct  362   NTCQLVLLPRVGVDHIMNARMMSTKLKVGVEVEKGDEDGLFTKESVCNAVNIVMDEGNEI  421

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             GREV+ NH +LR FLL+ +L+S  +D+F QKL+
Sbjct  422   GREVKANHIQLRKFLLSENLESSCVDNFCQKLR  454



>ref|XP_004487584.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
Length=458

 Score =   432 bits (1112),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 246/452 (54%), Positives = 328/452 (73%), Gaps = 2/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AM+PWF +GHL  +  L+NKLA +GH+ISF  PK TQ+KLE FNL+P+LI+F P+
Sbjct  5     SSLHIAMFPWFAMGHLIPYLHLSNKLAKRGHKISFFTPKKTQTKLEQFNLYPNLITFYPL  64

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLP GAETTSDV      +LM AMD+TQN IE++L  LK  ++F+DF  WLP +
Sbjct  65    NVPHVDGLPFGAETTSDVAISLGPILMTAMDQTQNQIELLLTQLKPQIIFFDFVFWLPKI  124

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
              +++GIKS  Y  I+P    Y  SP R    + LTE D+MK P  +P  S  L +HEA+ 
Sbjct  125   TQRLGIKSFLYFIINPATISYTTSPPRMFEAENLTEVDLMKPPKGYPT-SFNLQSHEAKH  183

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
               +   ++FG  I F  R +  +S +D + +  CREIEG + DY++ QF KPVLL+GP L
Sbjct  184   LASTRKIEFGSGIPFSVRSYNCLSLTDAIGFKGCREIEGPYVDYLQEQFGKPVLLSGPVL  243

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
             P  SK+ +++KW  WLG FK+GS++YCA GSE  L++D+F ELL GLELTG PF A LKP
Sbjct  244   PEQSKTALDEKWGSWLGGFKDGSLVYCALGSELKLKQDQFHELLLGLELTGFPFLAILKP  303

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P   E+IE A+PE  KE+++ +GIVH  W+QQQL L+HPSVGCFV+HCG  S++E LVN+
Sbjct  304   PVGFETIEDALPEGFKERVKEKGIVHSGWIQQQLILEHPSVGCFVTHCGAGSITEGLVNN  363

Query  501   CQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             CQ+VLLPQ+ GD IINARIM   LKVGVEV+KGEEDG+F++ESV +AVK VMD+++EIGR
Sbjct  364   CQMVLLPQLNGDYIINARIMGRHLKVGVEVKKGEEDGLFTKESVYEAVKIVMDDENEIGR  423

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             EVR NH K+R  LL  DL+S  +D+F +KLQ+
Sbjct  424   EVRSNHTKVRNLLLRHDLESSCLDTFCEKLQE  455



>ref|XP_008349217.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=456

 Score =   432 bits (1110),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 252/452 (56%), Positives = 328/452 (73%), Gaps = 11/452 (2%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPWF +GHLT +  L+NKLA +GHRISF +P  TQ KL++ NLHPHLISF+PI VP + 
Sbjct  1     MYPWFAMGHLTSYLHLSNKLAERGHRISFFVPTKTQQKLQALNLHPHLISFIPITVPHVD  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI--  1210
             GLPPGAETT+DVP PS  L+M AMD TQ  I   + +L  D VF+DFT WLP L R++  
Sbjct  61    GLPPGAETTNDVPIPSYSLIMAAMDLTQPAILQAICELNPDFVFFDFTPWLPKLLRQLGT  120

Query  1209  GIKSVFYSTISPLMHGYALSPERRVVGKQ--LTEADMM----KAPASFPDPSIKLHAHEA  1048
             GIKS+ Y  ISP   GY  SPER+V+ ++  LTE D++      P SFP  SIKL AHEA
Sbjct  121   GIKSINYIIISPAFVGYVRSPERKVLMEKSVLTEDDLIYDLVNPPPSFPPSSIKLPAHEA  180

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             R      + +FG    F +R   ++++ D  A+ TCRE+EG++CDY+ETQ +KPVLLAGP
Sbjct  181   RMLAPFLLKEFGSGRKFIERQMISLNDCDAAAFRTCREMEGKYCDYLETQLRKPVLLAGP  240

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              +P    + +++KW+ WL +F+  SVIYCAFG+EC L+ D+FQELL G ELTG+PFFAAL
Sbjct  241   LVPETPTTELDEKWAKWLERFEAKSVIYCAFGTECVLKIDQFQELLLGFELTGLPFFAAL  300

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   E+IE+A+PE  + +++GRG+V   WVQQ L L+HPS   FV+HCG +SL E LV
Sbjct  301   KPPMGVEAIESALPEGFEGRVKGRGVVSWGWVQQPLMLKHPS---FVTHCGSSSLMEGLV  357

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             ++CQ+VLLP V DQ+  AR+M   L+VGVEVEKGEEDGVF++E VCKAV+ VMD +SE+G
Sbjct  358   SECQLVLLPNVADQLAIARVMGRDLRVGVEVEKGEEDGVFTKEGVCKAVRDVMDAESEVG  417

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +EVR NH KLR FL +  L++ Y+DSF +KL 
Sbjct  418   KEVRRNHAKLREFLSSKGLENSYIDSFVEKLH  449



>ref|XP_003596667.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=463

 Score =   432 bits (1110),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 246/451 (55%), Positives = 324/451 (72%), Gaps = 1/451 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPK TQ+KLE FNL+P+LI+F P+
Sbjct  9     SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFYPL  68

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP I GLP GAETTSDV F    L+M AMD+TQ  +E++L  L  ++VF+DFT WLP +
Sbjct  69    NVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLTQLNPEIVFFDFTFWLPKI  128

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A  +GIKS+    +SP    Y  SP R   G  LTE D+MK P  +P  S  L+ HEA+ 
Sbjct  129   AHNLGIKSLQCWIVSPATVSYNASPSRMCEGTNLTEFDLMKPPKGYPISSFNLYYHEAKH  188

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                +  ++FG  I F+DRI+  +S SD + +   REIEG + DY+E +F KPVLL+GP L
Sbjct  189   LALKRKLEFGSGIFFYDRIYYGLSLSDAIGFKGIREIEGPYVDYLEQEFGKPVLLSGPVL  248

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
             P P K+ +++KW  WL  FK+GS++YCA GSE  L + +F ELL GLELTG PF A LKP
Sbjct  249   PEPPKTVLDEKWGSWLNGFKDGSLVYCALGSESKLSQKQFHELLLGLELTGYPFLAILKP  308

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P   E++E A PE  +E+++ +GIVH  W+QQQL L+H SVGCFV+HCG  SL+E L+N+
Sbjct  309   PIGFETVEDAFPEGFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTEGLINN  368

Query  501   CQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             CQIVL+P + GD I N +IM   LKVGVEV KG+EDG+F++ESVC+AVK VMD+++EIGR
Sbjct  369   CQIVLMPHLDGDHITNTKIMGRELKVGVEVNKGDEDGLFTKESVCEAVKIVMDDENEIGR  428

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             EVR NHDKLR  LLN DL+S  +D F +KLQ
Sbjct  429   EVRNNHDKLRNLLLNQDLESSCVDGFCEKLQ  459



>ref|XP_010093489.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB54128.1| UDP-glycosyltransferase [Morus notabilis]
Length=458

 Score =   431 bits (1109),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 247/452 (55%), Positives = 330/452 (73%), Gaps = 5/452 (1%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             +  H+AM PWF +GH+T F  ++NKLA KGH+ISF IP  TQSK+  FNL PHLISFVPI
Sbjct  5     SPLHIAMCPWFALGHITSFLHISNKLAKKGHKISFFIPTKTQSKVSHFNLFPHLISFVPI  64

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +P + GLPPG+ETT+DVP P   L+M AMD+ + D EI+L DLK D+VF+D  HW+P L
Sbjct  65    TIPLVDGLPPGSETTNDVPRPLIPLIMTAMDRAEPDFEILLHDLKPDIVFFDSAHWIPKL  124

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTE-ADMMKAPASFPDPSIKLHAHEAR  1045
             AR++ IKSVFY T+S +  G+ LS   ++   + T+ A+ M+ P  FPD SIK   HEAR
Sbjct  125   ARRLSIKSVFYITVSAVAIGFNLSRNMKLGESKATDVAEAMQPPPGFPDSSIKRLLHEAR  184

Query  1044  GFTARTVMKFG-GDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
              +        G  ++   DRI+  V + D LA+ +CREIEG F +Y+E    KP+LLAGP
Sbjct  185   DYIDLRSKPLGPTNMRIQDRIYVGVQDCDALAFKSCREIEGPFVEYLERLILKPLLLAGP  244

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              LPV   ST+E+KW++WLG FK  +V+YCAFGSE  LRKD+ QELL GLEL+G+PF AAL
Sbjct  245   VLPVRPLSTLEEKWANWLGGFKPCTVVYCAFGSETALRKDQLQELLLGLELSGLPFLAAL  304

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             +PP E  +++ A+PE  +E+++GRG+VH  W+QQQL L+H SVGCFV+HCGW SL E L+
Sbjct  305   RPPLEVATLKEALPEGFEERVRGRGVVHEGWIQQQLMLEHKSVGCFVTHCGWGSLVEGLL  364

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK-SEI  331
             N C++V++PQVGDQ++NAR+M  +LKVGVEV KGEEDG+F+RESVC A++ VM+E  SE+
Sbjct  365   NGCELVMIPQVGDQVLNARLMGNNLKVGVEVAKGEEDGLFTRESVCNAIRTVMEENYSEV  424

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             GRE+R N  KL+  L N   D +Y+D F++KL
Sbjct  425   GREIRANRAKLQDQLFNK--DEEYIDEFSRKL  454



>gb|AES66918.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=476

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 246/451 (55%), Positives = 324/451 (72%), Gaps = 1/451 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IPK TQ+KLE FNL+P+LI+F P+
Sbjct  22    SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLITFYPL  81

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP I GLP GAETTSDV F    L+M AMD+TQ  +E++L  L  ++VF+DFT WLP +
Sbjct  82    NVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLTQLNPEIVFFDFTFWLPKI  141

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A  +GIKS+    +SP    Y  SP R   G  LTE D+MK P  +P  S  L+ HEA+ 
Sbjct  142   AHNLGIKSLQCWIVSPATVSYNASPSRMCEGTNLTEFDLMKPPKGYPISSFNLYYHEAKH  201

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                +  ++FG  I F+DRI+  +S SD + +   REIEG + DY+E +F KPVLL+GP L
Sbjct  202   LALKRKLEFGSGIFFYDRIYYGLSLSDAIGFKGIREIEGPYVDYLEQEFGKPVLLSGPVL  261

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
             P P K+ +++KW  WL  FK+GS++YCA GSE  L + +F ELL GLELTG PF A LKP
Sbjct  262   PEPPKTVLDEKWGSWLNGFKDGSLVYCALGSESKLSQKQFHELLLGLELTGYPFLAILKP  321

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P   E++E A PE  +E+++ +GIVH  W+QQQL L+H SVGCFV+HCG  SL+E L+N+
Sbjct  322   PIGFETVEDAFPEGFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTEGLINN  381

Query  501   CQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             CQIVL+P + GD I N +IM   LKVGVEV KG+EDG+F++ESVC+AVK VMD+++EIGR
Sbjct  382   CQIVLMPHLDGDHITNTKIMGRELKVGVEVNKGDEDGLFTKESVCEAVKIVMDDENEIGR  441

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             EVR NHDKLR  LLN DL+S  +D F +KLQ
Sbjct  442   EVRNNHDKLRNLLLNQDLESSCVDGFCEKLQ  472



>ref|XP_009352835.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=471

 Score =   427 bits (1098),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 252/457 (55%), Positives = 332/457 (73%), Gaps = 8/457 (2%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             + H+AMYPWF +GHLT    L+NKLA +GHR SF +P  TQ KL++ N HPHLISF+PI 
Sbjct  9     SLHIAMYPWFAMGHLTPSPPLSNKLAERGHRTSFFVPTKTQQKLQALNFHPHLISFIPIT  68

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GL PGAETT+DVPFPS  LLM+AMD TQ  I  ++ +L  + VF+DFT WLP L 
Sbjct  69    VPHVDGLLPGAETTNDVPFPSNSLLMDAMDLTQPAILQLICELNPNFVFFDFTPWLPKLL  128

Query  1218  RKIGI--KSVFYSTISPLMHGYALSPERRVVGKQ--LTEAD----MMKAPASFPDPSIKL  1063
             R++G   KS++Y  ISP + GY  SPER+V+ ++  LTE D    ++  P SFP  SIKL
Sbjct  129   RQLGTGIKSIYYIIISPAIVGYVRSPERKVLMEKSVLTEDDLINELINPPPSFPPSSIKL  188

Query  1062  HAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpv  883
              AHEAR      + +FG    F +R   ++++ D  A+  CRE+EG++CDY+ETQ +KPV
Sbjct  189   PAHEARMLAPLLLKEFGSGKKFIERQIISLNDCDAAAFRACREMEGKYCDYLETQLRKPV  248

Query  882   llagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMP  703
             L AGP +P    + +++KW+ WL +F+  SVIYCAFG+EC L+ D+FQELL G ELTG+P
Sbjct  249   LRAGPVVPETPTAELDEKWAKWLERFEAKSVIYCAFGTECVLKIDQFQELLLGFELTGLP  308

Query  702   FFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASL  523
             FFAALKPP   E+IE+A+PE  + +++GRG+V   WVQQ L L+HPSVGCFV+HCG +SL
Sbjct  309   FFAALKPPMGVEAIESALPEGFEGRVKGRGVVSWGWVQQPLMLKHPSVGCFVTHCGPSSL  368

Query  522   SEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDE  343
              E LV++CQ+VLLP V DQ+  AR+M   L+VGVEVEKGEEDGVF++E VCKAV+ VMDE
Sbjct  369   MEGLVSECQLVLLPNVADQLAIARVMGRDLRVGVEVEKGEEDGVFTKEGVCKAVRDVMDE  428

Query  342   KSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +SE+G+EVR NH K R FL    L++ Y+DSF +KL 
Sbjct  429   ESEVGKEVRRNHAKWREFLSGKGLENSYIDSFVEKLH  465



>ref|XP_006373006.1| hypothetical protein POPTR_0017s06940g [Populus trichocarpa]
 gb|ERP50803.1| hypothetical protein POPTR_0017s06940g [Populus trichocarpa]
Length=403

 Score =   423 bits (1087),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 246/449 (55%), Positives = 304/449 (68%), Gaps = 55/449 (12%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
              YH+AMYPWF  GHLT F  LANKLA  GH+ISFL+P  TQSKL+ FNLHP +I+F+PI 
Sbjct  6     AYHIAMYPWFAFGHLTPFLHLANKLAQAGHKISFLLPTRTQSKLQQFNLHPDIITFIPIT  65

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GLPPGAETTSDVPFPS                              FTH + ++ 
Sbjct  66    VPHVDGLPPGAETTSDVPFPS------------------------------FTHIMTAMD  95

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGF  1039
             R   IKS++Y  +S +  GY +SP RR+ G +LT+AD+M+ P  FPD  IKL AHEA  +
Sbjct  96    R---IKSIYYCVVSSVTIGYIMSPARRLSGNKLTKADLMQPPLGFPDLPIKLKAHEAEVY  152

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
              AR VMKFG D+ F DRI+  +S+ D + + TCREIEG + DY+  QF KPV        
Sbjct  153   IARRVMKFGSDVMFCDRIYMGMSQCDAIGFRTCREIEGPYADYVGNQFDKPV--------  204

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
                           L      SVIYCAFGSECTL KD+F+ELL GLELTGMPF AALKPP
Sbjct  205   --------------LFSGPANSVIYCAFGSECTLEKDQFEELLLGLELTGMPFLAALKPP  250

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
                ESIE A+P+  +E+I GRG+VHG WVQQQL L+HPSVGCF++HCG  SLSEAL+N C
Sbjct  251   AGYESIELALPQGFQERICGRGMVHGGWVQQQLILEHPSVGCFITHCGSGSLSEALINKC  310

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             Q+VLLP VGD I  AR+MS+ LKVGVEVEKGEEDG+F++E+V KAV+ VM+E+ E GR+V
Sbjct  311   QLVLLPHVGDHIFQARLMSLHLKVGVEVEKGEEDGLFTKETVYKAVRTVMEEEREFGRDV  370

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             + N  KLR FL    L+S Y+DSFN++L+
Sbjct  371   KTNRAKLREFLSRKSLESSYIDSFNEQLR  399



>ref|XP_009352834.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=471

 Score =   425 bits (1093),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 251/455 (55%), Positives = 332/455 (73%), Gaps = 9/455 (2%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GHLT +  L+NKLA +GHRISF +P  TQ KL++ NLHPHLISF+PI VP
Sbjct  11    HIAMYPWFAMGHLTSYLHLSNKLAERGHRISFFVPTKTQQKLQALNLHPHLISFIPITVP  70

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPPGAETT+DVPFPS  LLM+AMD TQ  I  ++ +L  + VF+DFT WLP L R+
Sbjct  71    HVDGLPPGAETTNDVPFPSYSLLMDAMDLTQPAILQLICELNPNFVFFDFTPWLPKLLRQ  130

Query  1212  IGI--KSVFYSTISPLMHGYALSPERRVVGKQ--LTE----ADMMKAPASFPDPSIKLHA  1057
             +G   KS++Y  ISP + GY  SPER+V+ ++  LTE     D++  P SFP  SIKL A
Sbjct  131   LGTGIKSIYYIIISPAIVGYVRSPERKVLMEKSVLTEDDLINDLINPPPSFPPSSIKLPA  190

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             +  R      + +FG    F +R   ++++ D  A+ TCRE+EG++CDY+ETQ +KPVLL
Sbjct  191   YGTRMLAPFLLKEFGSG-KFIERQIISLNDCDAAAFRTCREMEGKYCDYLETQLRKPVLL  249

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             AGP +P    + +++KW+ WL +F+  SVIYCAFG+EC L+ D+FQELL G ELTG+PFF
Sbjct  250   AGPVVPETPTAELDEKWAKWLERFEAKSVIYCAFGTECVLKIDQFQELLLGFELTGLPFF  309

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALK P   E+IE+A+PE  + +++GRG+V   WVQQ L L+HPSVGCFV+HCG +SL E
Sbjct  310   AALKLPMGVEAIESALPEGFEGRVKGRGVVSWGWVQQPLMLKHPSVGCFVTHCGPSSLME  369

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              LV++CQ+VLLP   DQI  AR+M   L+VGVEVEKGEEDG F++E VCKAV+ VMDE+S
Sbjct  370   GLVSECQLVLLPNAVDQISLARVMGRDLRVGVEVEKGEEDGDFTKEGVCKAVRDVMDEES  429

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             E+G+EVR NH K R  L +  L++ Y+DSF +KL 
Sbjct  430   EVGKEVRRNHAKWRELLSSKGLENSYIDSFVEKLH  464



>ref|XP_007132948.1| hypothetical protein PHAVU_011G138500g [Phaseolus vulgaris]
 gb|ESW04942.1| hypothetical protein PHAVU_011G138500g [Phaseolus vulgaris]
Length=448

 Score =   424 bits (1090),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 250/453 (55%), Positives = 324/453 (72%), Gaps = 11/453 (2%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             +++ H+AM+PWF +GHLT F  L+NKLA +GH+ISF IP  TQSKLE FNL P LI+F P
Sbjct  3     SSSLHIAMFPWFAMGHLTPFLHLSNKLAKRGHKISFFIPTRTQSKLEQFNLFPDLITFFP  62

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             I VP + GLP GAETTSDV F    L+M AMD+T+ DIE++L DLK  +VF+DFT+WLP+
Sbjct  63    INVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLLDLKPQIVFFDFTYWLPN  122

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             +  ++GIKS  Y  +SP    Y  SP+          +D+M+ P  +P  SIKLH  EA+
Sbjct  123   ITSRLGIKSFQYFIVSPATVSYIRSPQ----------SDLMQPPPGYPVSSIKLHLDEAK  172

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                ++   +FG  + F+DR    +  SD + +  CREIEG + DY+  Q  K VLL+GP 
Sbjct  173   FLASKRNWEFGSGVLFYDRFEYGLMLSDAIGFKGCREIEGPYVDYLAEQLGKSVLLSGPI  232

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P P  + +E+ WS WLG FK+GSVI+CA GSE  L   +FQELL GLELTG+PF A +K
Sbjct  233   IPEPPNTVLEENWSAWLGGFKDGSVIFCALGSEWKLPHGQFQELLLGLELTGLPFLAVVK  292

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
              P   E+IEAA+PE  KE ++GRGIVH  W+QQQL L+H SVGCF++HCG  SL+EALVN
Sbjct  293   VPVGFETIEAALPEGFKEGVEGRGIVHSGWIQQQLILEHSSVGCFITHCGAGSLTEALVN  352

Query  504   DCQIVLLPQV-GDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
              CQ+VLLPQ+  D IINAR+M  +LKVGVEV+KGEEDG F++ESV KAVK VMDE++E+G
Sbjct  353   KCQMVLLPQLDADHIINARMMGSNLKVGVEVQKGEEDGWFTKESVSKAVKTVMDEENEVG  412

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             REVR NH KLR  L++ DL+S  +D+F QKLQD
Sbjct  413   REVRENHAKLRNCLVSPDLESICVDNFCQKLQD  445



>ref|XP_004144600.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 ref|XP_004164965.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 gb|KGN43488.1| hypothetical protein Csa_7G041330 [Cucumis sativus]
Length=461

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 238/457 (52%), Positives = 325/457 (71%), Gaps = 2/457 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             M    ++ H+AMYPWF +GHL  F ++ NKLA KGHRISF IP  TQ KL+ FN  P+LI
Sbjct  1     MEEAPSSLHIAMYPWFALGHLIAFLQIGNKLASKGHRISFFIPSKTQPKLQPFNHFPNLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPS-THLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
             +FVPI VP + GLP GAETT+DV  PS   L+M +MD+T+ +I   L+++K + +FYD  
Sbjct  61    TFVPITVPHVDGLPLGAETTADVSHPSQIPLIMTSMDRTEPEIASRLQEIKPEAIFYDLA  120

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGK-QLTEADMMKAPASFPDPSIKL  1063
              W+P LA  +GIKSV++S +SP+  GY      +  G   LT+ D++  P  FP PSIKL
Sbjct  121   CWVPKLAHPLGIKSVYFSAVSPVTMGYIQCKLWKFPGHYNLTQDDLLHPPPDFPCPSIKL  180

Query  1062  HAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpv  883
              AHEA+   +   MKFG DITFF+R   A+S+   +A  +CREIEG F +Y+E+  ++P+
Sbjct  181   LAHEAQYLASFGQMKFGSDITFFERNSRALSQCSAMALKSCREIEGPFIEYLESIVKRPI  240

Query  882   llagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMP  703
              L G     P  +++E++W+ WL KF  GSVIYCAFGSEC L K++FQELL GLEL+ +P
Sbjct  241   FLPGFVNLEPLTTSLEERWAKWLSKFNSGSVIYCAFGSECILNKNQFQELLLGLELSNLP  300

Query  702   FFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASL  523
             FF ALKPP   +++EAA+PE  +++++GRGIV+G WVQQQ  L HPS+GCF++HCG  SL
Sbjct  301   FFVALKPPDGIDTVEAALPEGFEQRVEGRGIVYGGWVQQQQILDHPSIGCFITHCGAGSL  360

Query  522   SEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDE  343
             SEA+V  CQ+VL  +  DQ+  AR+MS   KVGVE+EKGEEDGVFS+ESVCKAVK VMDE
Sbjct  361   SEAVVKKCQLVLFSRTTDQLFRARLMSKFSKVGVEIEKGEEDGVFSKESVCKAVKTVMDE  420

Query  342   KSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             ++E G+E+R N ++LR  L++ DL+  Y+++F   L+
Sbjct  421   ENESGKEIRANKERLRESLVDKDLEESYINNFIHSLR  457



>ref|XP_004248461.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Solanum lycopersicum]
Length=456

 Score =   423 bits (1087),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 237/449 (53%), Positives = 317/449 (71%), Gaps = 10/449 (2%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPW+ +GHLT F  L+NKLA +GH++ F+ P NT SKLE FN +P LI+F  + VP + 
Sbjct  10    MYPWYAMGHLTSFLHLSNKLAHRGHKVFFVHPTNTLSKLEKFNRYPELINFKSVTVPHVD  69

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLP GAETTSDVP  + +LL +A+D T   IE +++++K   +FYDF +W+PS+ARK G+
Sbjct  70    GLPLGAETTSDVPIFNQNLLCQALDLTLPKIESLIQEIKPHFIFYDFAYWVPSVARKYGV  129

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFP-DPSIKLHAHEARGFTART  1027
             KSV Y +I+P   GY +  E        +EA+MM+ P  FP D SI LH HEAR   A  
Sbjct  130   KSVHYCSITPSSVGYLMRGENPT-----SEAEMMQPPPGFPVDSSIMLHKHEARLIIALH  184

Query  1026  VM---KFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
              M      G ++F  R+  A  + D +A+ T REIEG++C+++E +F+KPV+LAGP LP 
Sbjct  185   SMGKNSGSGSVSFTQRMLLAFQDGDAIAFKTTREIEGRYCEFVEHKFKKPVVLAGPVLPE  244

Query  855   -PSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
                 S  E+ WS WL KF+E +VI CAFGSEC L++D+FQEL+ GLELTG PFFAALKPP
Sbjct  245   PMETSNTEENWSKWLEKFQEKTVILCAFGSECKLKRDQFQELVLGLELTGYPFFAALKPP  304

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
              EA++IE A+PE  KE+ QG+GIVH  W +QQL L HPSVGCFV+HCG  SLSEAL+N+C
Sbjct  305   IEADTIEEALPEGFKERTQGKGIVHSGWAEQQLMLSHPSVGCFVTHCGGNSLSEALINEC  364

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             Q+VL+P  GDQ IN+R+    LK GVEVE+ EE+G F+++ VCKA+K VM+++SE GR++
Sbjct  365   QLVLVPNFGDQFINSRLFGGDLKAGVEVERNEENGSFTKDGVCKAIKMVMNDESEEGRKI  424

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             R N  K + FLL+  L+  Y+D   QKLQ
Sbjct  425   RANRAKWKEFLLSKGLEDSYIDGLVQKLQ  453



>gb|AES66921.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=434

 Score =   421 bits (1082),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 236/449 (53%), Positives = 320/449 (71%), Gaps = 25/449 (6%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF +GHLT +   +NKLA +GH+ISF IPKNT +KL+  NLHP+LI+F PI VP
Sbjct  8     HIAMFPWFAMGHLTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITVP  67

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETTSDVPF    L+  AMD+T   IE++LK+LK  +VF+DF +WLP+L +K
Sbjct  68    HVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDFQYWLPNLTQK  127

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKS+ Y   +P+   Y  +  R+  GK LT+ D+ K PA FPD SIK H+HE R   +
Sbjct  128   LGIKSLQYLIWNPISSAYLGNIPRKSQGKYLTKDDLKKPPAGFPDSSIKFHSHELRFLAS  187

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                ++FG  +  +DR+ T    SD +++  CREI+G + DY+ET F KPVLL+GP LP P
Sbjct  188   TRKIEFGSGVLLYDRVDTGTKSSDAVSFKGCREIDGLYADYLETVFGKPVLLSGPLLPEP  247

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
              K+T+E+KW  WL +FK GSVI+CA+GSE                        ALKPP  
Sbjct  248   PKATLEEKWLTWLKEFKHGSVIFCAYGSE------------------------ALKPPIG  283

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ESIE A+PE   E+I+G+GIV+G W+QQQL L+HPSVGCF++HCG AS++E LVN CQ+
Sbjct  284   FESIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASITEGLVNTCQL  343

Query  492   VLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             VLLP+ G D I+NAR+MS +LKVG+EVE+GEEDG+F++ESV  AV+ VMD+++E+G+EVR
Sbjct  344   VLLPRAGADHIMNARMMSSTLKVGIEVERGEEDGLFTKESVGNAVRIVMDDENEVGKEVR  403

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH K+R FLL+++L+S  ++SF QKL D
Sbjct  404   ANHAKMRNFLLSSNLESSCVNSFCQKLYD  432



>gb|AES66919.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=437

 Score =   421 bits (1081),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 237/449 (53%), Positives = 313/449 (70%), Gaps = 25/449 (6%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H++M+PWF +GH T +   +NKLA +GH+ISF IPKNT +KL+  NLHP+LI+F PI VP
Sbjct  8     HISMFPWFAMGHFTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITVP  67

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETTSDVPF    L+  AMD+T   IE++LK+LK  +VF+DF +WLP+L +K
Sbjct  68    HVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIELLLKELKPQIVFFDFQYWLPNLTQK  127

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKS+ Y   SP+   Y  S  R+  G  LTE D+ K P  FPD SIK H+HE R   +
Sbjct  128   LGIKSLQYLIWSPISPAYLGSIPRKSQGTYLTEDDLKKPPTGFPDSSIKFHSHELRFLAS  187

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                 +FG  +  +DR+ T    SD +++  CREI+G + DY+ET F KPVLL+GP LP  
Sbjct  188   TRKQEFGSGVLLYDRVDTGTKFSDAVSFKGCREIDGLYADYLETVFGKPVLLSGPLLPEA  247

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
              KST+E+KW  WL  FK GSV++CA+GSE                        ALKPP  
Sbjct  248   PKSTLEEKWLTWLEGFKHGSVVFCAYGSE------------------------ALKPPIG  283

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              +SIE A+PE   E++ G+GIV+G W+QQQL L+HPSVGCF++HCG AS++E LVN CQ+
Sbjct  284   FDSIEEALPEGFNERVNGKGIVYGNWIQQQLILEHPSVGCFITHCGAASITEGLVNTCQL  343

Query  492   VLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             VLLP+ G D I+NAR+MS  LKVGVEVEKGEEDG+F++ESVCKAVK VMD+++E+G+ VR
Sbjct  344   VLLPRAGTDHIMNARMMSSKLKVGVEVEKGEEDGLFTKESVCKAVKIVMDDENEVGKAVR  403

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH K+R FLL+++L+S  +DSF QKL D
Sbjct  404   ANHAKMRNFLLSSNLESSCVDSFCQKLYD  432



>ref|XP_003543299.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=461

 Score =   420 bits (1080),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 238/449 (53%), Positives = 318/449 (71%), Gaps = 2/449 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GH   F  L+NKLA +GH+ISF++PK TQ+K++  N HPHLI+ VPI VP
Sbjct  10    HIAMYPWFAMGHFIPFLHLSNKLAKRGHKISFIVPKRTQTKIQHLNQHPHLITLVPITVP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETTSDV F    LL  AMD+ + DIE++L++LK  +VF+DF+ WLP+LAR 
Sbjct  70    HVDGLPHDAETTSDVLFSFFPLLATAMDRIEKDIELLLRELKPQIVFFDFSFWLPNLARS  129

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKSV Y  ++ +   Y  SPER   G+ L+E D  K    FPD SI LH HEA+    
Sbjct  130   LGIKSVQYFIVNAVSVAYFGSPERYHNGRDLSETDFTKPSPGFPDSSITLHEHEAQFVVR  189

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                ++FG  +  +DR       SD + +  CREIEG + DY+ETQ  KPVLL+GP LP P
Sbjct  190   MGKVEFGSGVLMYDRFDIGTRLSDAIGFKGCREIEGPYVDYLETQHGKPVLLSGPLLPEP  249

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
               +T+E KW  WL +F  GSVI+CA+GSE TL++++F ELL GLELTG PF AALKPP  
Sbjct  250   PNTTLEGKWVKWLEEFNPGSVIFCAYGSETTLQQNQFLELLLGLELTGFPFLAALKPPNG  309

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ESIE A+PE  +E++QGRG+V+  WVQQQL L HPSVGCF++HCG  S++EALV++CQ+
Sbjct  310   FESIEEALPEGFRERVQGRGVVYEGWVQQQLILGHPSVGCFITHCGAGSITEALVSECQL  369

Query  492   VLLPQVG-DQIINARIMSVSLkv-gvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             V LP++G D +I AR+MS  LKV     +  E+DG F++ESVCKAVK VMD+++E+GR+V
Sbjct  370   VFLPRLGSDYVITARMMSRELKVGVEVEKSEEDDGSFTKESVCKAVKIVMDDENELGRQV  429

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             R NH K+R  LL+ +L+S ++D    KL+
Sbjct  430   RENHRKVRNILLSNNLESFHVDILCDKLR  458



>ref|XP_002282825.3| PREDICTED: UDP-glycosyltransferase 79B6-like [Vitis vinifera]
Length=463

 Score =   420 bits (1079),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 222/453 (49%), Positives = 304/453 (67%), Gaps = 3/453 (1%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             ++  +H+AM+PWF  GH+T F  L+NKLA +GH+I+F++PK  QS+L++ N HP LISF 
Sbjct  7     KSPKFHVAMFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQTLNFHPTLISFH  66

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
             P+ +P + GLPPGAET SD+P   THLL  AMD+  + +E  L+    D +FYD +H  P
Sbjct  67    PLSIPHVDGLPPGAETASDIPIFLTHLLATAMDRATDQLEAALRASNPDFLFYDCSHLAP  126

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHE  1051
              LA ++GIK++ Y+ +       AL P R V   + +TEA++   P+ +P  +     HE
Sbjct  127   VLASRLGIKAICYNVVCAASIAIALVPARGVSKDRPVTEAELAVPPSGYPSSTAVFRRHE  186

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
              R     +   FG  I+F++R  TA+ ESD ++  TCREIEG  CDYI TQ+ KP+ L G
Sbjct  187   GRALQFISA-PFGDGISFYERTTTAMKESDAISIRTCREIEGNLCDYIGTQYGKPIFLTG  245

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P LP PS + +E +W+ WLG FK GS+I+CAFGS+  L KD+FQEL+ GLELTG+PF  A
Sbjct  246   PVLPEPSPTPLEDRWAQWLGGFKPGSIIFCAFGSQYILEKDQFQELVLGLELTGLPFLVA  305

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP  A +IE A+PE  KE++ GR  VHG WVQQ   L HPSVGCFVSHCG+ S+ E+L
Sbjct  306   LKPPTGAATIEEALPEGFKERVGGRAAVHGGWVQQPSILSHPSVGCFVSHCGFGSMWESL  365

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             +NDCQIVL+P +GDQI+N R+++  L       + EE+G FS+ES+CKA+K+VMDE+SE+
Sbjct  366   MNDCQIVLVPHLGDQILNTRVLAGEL-QVAVEVEREENGWFSKESLCKAIKSVMDEESEV  424

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             G  VR NH K +         S Y+D F  +LQ
Sbjct  425   GGLVRKNHAKWKETFARPGFMSNYVDKFVGQLQ  457



>gb|EYU43362.1| hypothetical protein MIMGU_mgv1a019428mg [Erythranthe guttata]
Length=443

 Score =   419 bits (1077),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 310/445 (70%), Gaps = 8/445 (2%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPWF +GHLT F  ++NK A KGH+I F++P   QSKL  FN HP LI F+PI VP + 
Sbjct  1     MYPWFAMGHLTTFLHVSNKFAEKGHKIFFILPTKVQSKLNQFNHHPTLIEFIPITVPEVE  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLP G ETTSDVPF    LL  AMD T++ +E +LK++K   VF+DFT WLPSLAR +GI
Sbjct  61    GLPNGTETTSDVPFTMYSLLRHAMDLTKSTVENLLKEIKPHFVFFDFTPWLPSLARSLGI  120

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG-FTART  1027
             KS+ Y  I+     +    E  V        D ++ P+ FP   IKL+ HEAR  +    
Sbjct  121   KSIHYFIITTASAAFLFRDEPTV-------DDYIEPPSDFPPSKIKLYKHEARVIYRINN  173

Query  1026  VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSK  847
               +FG ++ + +R+  + +E D + + +CRE+EG + +++E +F+K V+LAGP LP P  
Sbjct  174   QKEFGSEMKYVERMIMSANECDAMGFKSCREMEGPYLEFLERKFKKRVILAGPVLPDPPT  233

Query  846   STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeae  667
              T+++KW++WL +FK  SVIYCAFGSE  L++++FQEL+ G E TG+PFFAALKPP  A 
Sbjct  234   CTLDEKWANWLDQFKPKSVIYCAFGSEARLQREQFQELVLGFEQTGLPFFAALKPPIGAA  293

Query  666   sieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVL  487
             ++E A+PE  +E+   RG+V G WVQQQ+ L HPSVGCFV+HCGW SLSEALVN+C++VL
Sbjct  294   TVEEALPEGFRERTMERGVVEGGWVQQQVILSHPSVGCFVTHCGWGSLSEALVNECRLVL  353

Query  486   LPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNH  307
             +P VGDQ++NAR+M   L+VGVEVEKG+EDG+F+R+ V  AV++VMD+  EIGRE+  N 
Sbjct  354   MPHVGDQLVNARLMGGDLRVGVEVEKGDEDGLFTRDGVVTAVRSVMDDDCEIGREIEANR  413

Query  306   DKLRGFLLNADLDSKYMDSFNQKLQ  232
              K R FLL   L+S Y+D F   LQ
Sbjct  414   VKWRSFLLTKGLESSYIDGFVHNLQ  438



>ref|XP_003596671.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES66922.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|AFK38670.1| unknown [Medicago truncatula]
Length=458

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 238/448 (53%), Positives = 330/448 (74%), Gaps = 1/448 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF +GH T +  L+NKLA KGH+ISF IPK TQ+KL+  NL+P+LI+F P+ VP
Sbjct  8     HIAMFPWFAMGHFTPYLHLSNKLAKKGHKISFFIPKKTQTKLQHLNLNPNLITFYPLNVP  67

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              I GLP GAET+SDVPF    L+  AMD+T+  IE +LK+L   +VF+DF +WLP+L +K
Sbjct  68    HIDGLPDGAETSSDVPFSLVPLIATAMDQTEKQIEHLLKELNPQIVFFDFQYWLPNLTQK  127

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKS+ Y   SP    Y  +  R   GK LT  D+ K P+ +PD SIKL+ HE +  ++
Sbjct  128   LGIKSLQYWITSPFSISYFWNGPRHSQGKGLTVDDLKKPPSGYPDGSIKLYQHELQFLSS  187

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                + FG  +  +DR+    S +D + +  C+E++  + +++   + KP LL+GP LP  
Sbjct  188   TRKLVFGSGVFLYDRLHIGTSLADAIGFKGCKELDEPYAEFLGNFYGKPYLLSGPLLPET  247

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
              K+T+++KW  WL  FK GSV++CA+GSE  L K++FQELL GLELTG PF AALKPP  
Sbjct  248   PKTTLDEKWESWLKGFKPGSVVFCAYGSEGPLEKNQFQELLLGLELTGFPFLAALKPPNG  307

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ESIE A+PE   E+++G+GIV+G W+QQQL L+HPSVGCF++HCG AS++EALVN CQ+
Sbjct  308   FESIEEALPEGFNERVKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASITEALVNTCQL  367

Query  492   VLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             VLLP+VG D I+NAR+MS  +KVGVEVEKG+EDG+F++ESVC+AVK VMD+++++GREVR
Sbjct  368   VLLPRVGVDHIMNARMMSEKMKVGVEVEKGDEDGLFTKESVCEAVKIVMDDENKVGREVR  427

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              NH +LR FLL+ +L+S  +D+F +KLQ
Sbjct  428   KNHSELRKFLLSENLESSCVDNFCEKLQ  455



>gb|KGN43487.1| hypothetical protein Csa_7G041320 [Cucumis sativus]
Length=473

 Score =   416 bits (1070),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 235/452 (52%), Positives = 316/452 (70%), Gaps = 2/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AMYPWF  GH+  F ++ANKLA KGHRIS  IP  T  +L+ FN  P+LI+FV I
Sbjct  18    SSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLI  77

Query  1401  VVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
              VP + GLPPGA+TT+D+  PS   LLM +MD T+ +I   L+D+K +V+FYDF +W+  
Sbjct  78    TVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAYWVTK  137

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAPASFPDPSIKLHAHEA  1048
             LA ++GI S++Y+ +S +  GY       + G   LT+ D M+ P  FP  SIKLHAHEA
Sbjct  138   LADQMGITSIYYNVVSAVTVGYVQGKIWELSGHDTLTQDDFMQPPPGFPSSSIKLHAHEA  197

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             + F + + ++F   I  FD+  T+ +  + LA  +CREIEG F  YIE + +K VLL+G 
Sbjct  198   QNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIENELKKHVLLSGA  257

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
                 P  +++E++W  WL KF  GSVIYCAFGSEC L K +FQELL GLEL+ +PF A L
Sbjct  258   VDLEPLTTSLEERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLLGLELSNLPFLAVL  317

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   +++EAA+PE  +++I+GRG+V+G WVQQQ  L+HPS+GCFV+HCG  SL+EALV
Sbjct  318   KPPEGIDTVEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFVTHCGAGSLNEALV  377

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
               CQ+VLLP V D    AR +S  LKVGVEVEK EEDG FS+ESVCKAVK VMDE++E G
Sbjct  378   RKCQLVLLPHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVCKAVKTVMDEENESG  437

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +EVR N  KLR  L++ DL+  Y+++F  KL+
Sbjct  438   KEVRANIAKLRELLVDKDLEESYINNFIHKLR  469



>ref|XP_004144601.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=462

 Score =   416 bits (1069),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 235/452 (52%), Positives = 316/452 (70%), Gaps = 2/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AMYPWF  GH+  F ++ANKLA KGHRIS  IP  T  +L+ FN  P+LI+FV I
Sbjct  7     SSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLI  66

Query  1401  VVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
              VP + GLPPGA+TT+D+  PS   LLM +MD T+ +I   L+D+K +V+FYDF +W+  
Sbjct  67    TVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAYWVTK  126

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAPASFPDPSIKLHAHEA  1048
             LA ++GI S++Y+ +S +  GY       + G   LT+ D M+ P  FP  SIKLHAHEA
Sbjct  127   LADQMGITSIYYNVVSAVTVGYVQGKIWELSGHDTLTQDDFMQPPPGFPSSSIKLHAHEA  186

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             + F + + ++F   I  FD+  T+ +  + LA  +CREIEG F  YIE + +K VLL+G 
Sbjct  187   QNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIENELKKHVLLSGA  246

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
                 P  +++E++W  WL KF  GSVIYCAFGSEC L K +FQELL GLEL+ +PF A L
Sbjct  247   VDLEPLTTSLEERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLLGLELSNLPFLAVL  306

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   +++EAA+PE  +++I+GRG+V+G WVQQQ  L+HPS+GCFV+HCG  SL+EALV
Sbjct  307   KPPEGIDTVEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFVTHCGAGSLNEALV  366

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
               CQ+VLLP V D    AR +S  LKVGVEVEK EEDG FS+ESVCKAVK VMDE++E G
Sbjct  367   RKCQLVLLPHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVCKAVKTVMDEENESG  426

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +EVR N  KLR  L++ DL+  Y+++F  KL+
Sbjct  427   KEVRANIAKLRELLVDKDLEESYINNFIHKLR  458



>ref|XP_004164964.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=462

 Score =   416 bits (1068),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 236/452 (52%), Positives = 317/452 (70%), Gaps = 2/452 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AMYPWF  GH+  F ++ANKLA KGHRIS  IP  T  +L+ FN  P+LI+FV I
Sbjct  7     SSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNLITFVLI  66

Query  1401  VVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
              VP + GLPPGA+TT+D+  PS   LLM +MD T+ +I   L+D+K +V+FYDF +W+  
Sbjct  67    TVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEIASCLQDIKPNVIFYDFAYWVTK  126

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAPASFPDPSIKLHAHEA  1048
             LA ++GI S++Y+ +S +  GY       + G   LT+ D M+ P  FP  SIKLHAHEA
Sbjct  127   LADQMGITSIYYNVVSAVTIGYVQGKIWELSGHDTLTQDDFMQPPPGFPSSSIKLHAHEA  186

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             + F + + ++F   I  FD+  T+ +  + LA  +CREIEG F  YIE + +KPVLL+G 
Sbjct  187   QNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIENELKKPVLLSGA  246

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
                 P  +++E++W  WL KF  GSVIYCAFGSEC L K +FQELL GLEL+ +PF A L
Sbjct  247   VDLEPLTTSLEERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLLGLELSNLPFLAVL  306

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   +++EAA+PE  +++I+GRG+V+G WVQQQ  L+HPS+GCFV+HCG  SL+EALV
Sbjct  307   KPPEGIDTVEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFVTHCGAGSLNEALV  366

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
               CQ+VLLP V D    AR +S  LKVGVEVEK EEDG FS+ESVCKAVK VMDE++E G
Sbjct  367   RKCQLVLLPHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVCKAVKTVMDEENESG  426

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +EVR N  KLR  L++ DL+  Y+++F  KL+
Sbjct  427   KEVRANIAKLRELLVDKDLEESYINNFIHKLR  458



>ref|XP_004301656.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   415 bits (1067),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 241/460 (52%), Positives = 318/460 (69%), Gaps = 16/460 (3%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T H+AMYPWF +GHLT F  ++NKLA +GH+ISF +P  TQSKL+ +NLHPHLI+F+P+ 
Sbjct  15    TMHVAMYPWFAMGHLTAFLHISNKLAERGHKISFFLPIKTQSKLQHYNLHPHLITFIPLN  74

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GLPPG ETT+DVP     L+  AMD T+  IE  L  L+ D VF+DF+HWLP+L 
Sbjct  75    VPHVDGLPPGTETTADVPLSLGSLVATAMDLTRPQIEQHLLKLRPDYVFFDFSHWLPALL  134

Query  1218  RKIG--IKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPA--------SFPDPSI  1069
             R++G  IKSV Y  I+P    Y LS     + ++    D++  PA        SF   SI
Sbjct  135   RQLGSNIKSVCYWVINPASVWYLLS---LGLSRKKALDDVVDDPAHPSLCFSSSF---SI  188

Query  1068  KLHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQK  889
             KL AHEAR + A   M++G  + F  R  T++S+ D + + TCRE  G F +Y E Q  K
Sbjct  189   KLKAHEARAYEAMANMEYGSGLPFVKRCLTSLSDCDAICFKTCREFAGPFRNYFEMQMNK  248

Query  888   pvllagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             PV+LAG   P P  S +E+KW  WLG F+  +VI+CA GSE  L K + Q+LL G E TG
Sbjct  249   PVILAGLVTPDPPSSRLEEKWEKWLGGFEPRTVIFCALGSEYVLTKQQLQQLLLGFERTG  308

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PFFAALK P   ESIE+A+PE  +E+++G+G+V G WVQQ + L+HP+VGCFV+HCG  
Sbjct  309   LPFFAALKSPTGVESIESALPEGFEERVKGKGVVSGSWVQQPIILKHPAVGCFVTHCGSG  368

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S++EAL+N+CQ+V LP +GD IINAR+MS  LKVGVE+EKG+EDG+F++E VCKAVKAVM
Sbjct  369   SINEALLNECQLVFLPNIGDHIINARLMSGYLKVGVEIEKGDEDGLFTKEGVCKAVKAVM  428

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             DE S++G+EVR NH K R F  N   +S Y+D F QKL +
Sbjct  429   DEDSQVGKEVRTNHAKWREFFSNKGFESSYIDGFVQKLHE  468



>ref|XP_007149716.1| hypothetical protein PHAVU_005G093300g [Phaseolus vulgaris]
 gb|ESW21710.1| hypothetical protein PHAVU_005G093300g [Phaseolus vulgaris]
Length=475

 Score =   415 bits (1067),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 247/456 (54%), Positives = 332/456 (73%), Gaps = 1/456 (0%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  1414
              + A   H+A++PWF +GHLT    L+NKLA +GHRISF++P+ TQ+KL   NLHPHLI+
Sbjct  3     AASAAPLHIAIFPWFAMGHLTPNLHLSNKLAERGHRISFIVPQRTQTKLHHLNLHPHLIT  62

Query  1413  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             F+PI +P + GLP  AETTSDVPF    LL  AMD+TQ DIE++L+DL   +VF+DF HW
Sbjct  63    FIPIKLPHVHGLPHHAETTSDVPFSLFPLLTTAMDRTQKDIELLLRDLNPQIVFFDFQHW  122

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAH  1054
             LP+L+R + IKSV Y  + PL   Y +   RR  G++LTE D+M+ P  FPD  IK   H
Sbjct  123   LPNLSRSLSIKSVMYLILHPLSSAYLVEDPRRSQGRELTELDLMEPPPGFPDSCIKFQPH  182

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             E R       ++FG  +  +DR +     +D + +  CREI+G + +Y++T + KPVLL+
Sbjct  183   ELRCLVEIRKLEFGSGVLLYDRGYKGFCSADAIGFKGCREIDGPYAEYLQTVYGKPVLLS  242

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP LP P  +T+E+KW+ WLG F  GSVI+CA+GSE  L +++ QELL GLELTG PF A
Sbjct  243   GPLLPEPPNTTLEEKWASWLGGFNPGSVIFCAYGSESPLPQNQLQELLLGLELTGFPFLA  302

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             ALKPP   ESIE A+PE   E+++GRGI +G WVQQQL L HPSVGCF++HCG AS++EA
Sbjct  303   ALKPPDGFESIEEALPEGFGERVKGRGIAYGGWVQQQLILGHPSVGCFITHCGAASVTEA  362

Query  513   LVNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             LVN C +VLLP++G D I+NA+++S+ LKVGV+VEKGEEDG+F++ESVCKAV+ VM++ +
Sbjct  363   LVNKCGLVLLPRLGTDHIMNAKMLSMILKVGVQVEKGEEDGLFTKESVCKAVQTVMEDGN  422

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              +GREVR NH KLR FLL+ +L+S  +D F Q+LQD
Sbjct  423   VVGREVRENHAKLRNFLLSDNLESSCVDRFCQQLQD  458



>gb|KHN36713.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=461

 Score =   414 bits (1065),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 236/449 (53%), Positives = 316/449 (70%), Gaps = 2/449 (0%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMYPWF +GH   F  L+NKLA +GH+ISF++PK TQ+K++  N HPHLI+ VPI VP
Sbjct  10    HIAMYPWFAMGHFIPFLHLSNKLAKRGHKISFIVPKRTQTKIQHLNQHPHLITLVPITVP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP  AETT DV F    LL  AMD+ + DIE++L++LK  +VF+DF+ WLP+LAR 
Sbjct  70    HVDGLPHDAETTLDVLFSFFPLLATAMDRIEKDIELLLRELKPQIVFFDFSFWLPNLARS  129

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             +GIKSV Y  ++ +   Y  SPER   G+ L+E D  K    FPD SI LH HEA+    
Sbjct  130   LGIKSVQYFIVNAVSVAYFGSPERYHNGRDLSETDFTKPSPGFPDSSITLHEHEAQFVVR  189

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                ++FG  +  +DR       SD + +  CREIEG + DY+ETQ  KPVLL+GP LP P
Sbjct  190   MGKVEFGSGVLMYDRFDIGTRLSDAIGFKGCREIEGPYVDYLETQHGKPVLLSGPLLPEP  249

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
               +T+E KW  WL +F  GSVI+CA+GSE TL++++F ELL GLELTG PF AALKPP  
Sbjct  250   PNTTLEGKWVKWLEEFNSGSVIFCAYGSETTLQQNQFLELLLGLELTGFPFLAALKPPNG  309

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
              ESIE A+PE  +E++QGRG+V+  WVQQQL L HPSVGCF++ CG  S++EALV++CQ+
Sbjct  310   FESIEEALPEGFRERVQGRGVVYEGWVQQQLILGHPSVGCFITLCGAGSITEALVSECQL  369

Query  492   VLLPQVG-DQIINARIMSVSLkv-gvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             V LP++G D +I AR+MS  LKV     +  E+DG F++ESVCKAVK VMD+++E+GR+V
Sbjct  370   VFLPRLGSDYVITARMMSRELKVGVEVEKSEEDDGSFTKESVCKAVKIVMDDENELGRQV  429

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             R NH K+R  LL+ +L+S ++D    KL+
Sbjct  430   RENHRKVRNILLSNNLESFHVDILCDKLR  458



>gb|KHN27960.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=519

 Score =   416 bits (1070),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 231/427 (54%), Positives = 306/427 (72%), Gaps = 1/427 (0%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             M + A + H+AM+PWF +GH   F  L+NKLA +GH+ISF  P+ TQ+KL+  NLHPH I
Sbjct  1     MDAHAPSMHIAMFPWFAMGHFIPFLHLSNKLAKRGHKISFFTPRRTQTKLQHLNLHPHHI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             +FVPI VP + GLP  AETTSDVP     L+  AMD T+  IE++L++LK  +VF+DF H
Sbjct  61    TFVPINVPHVDGLPHDAETTSDVPSSLFPLIATAMDSTEKHIELLLRELKPQIVFFDFQH  120

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLP++ R +GIK + Y  ++P    Y  +  R++ G +LTE D+MK P  FPD SIKLHA
Sbjct  121   WLPNITRSLGIKCIQYWILNPSTIAYLWNGPRQIQGGELTEVDLMKPPKGFPDSSIKLHA  180

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HE R   A   ++FG  +  +DR+    S +D + +  CREI+G + DY+E  ++KPVL 
Sbjct  181   HELRFLAATRKLEFGSGVFLYDRLGLGSSLADAIGFKGCREIDGTYADYLEIVYRKPVLF  240

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             +GP LP P  ST+E+KW  WL  F  GSV++CA+GSE +L +++FQELL GLE  G PF 
Sbjct  241   SGPILPEPPNSTLEEKWVSWLEGFNPGSVVFCAYGSEGSLPENQFQELLLGLEQAGFPFL  300

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPP   ESIE A+P+   E++QGRGIV   WV QQL L H SVGCF++HCG AS++E
Sbjct  301   AALKPPNGFESIEEAMPKGFGERVQGRGIVDEGWVPQQLILGHRSVGCFITHCGAASVTE  360

Query  516   ALVNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             ALVN CQ+V LP++G D IINAR+ S  LKVGVEVEKGEEDG+F++ESVCKAVK VM+++
Sbjct  361   ALVNKCQLVFLPRLGADHIINARMFSRKLKVGVEVEKGEEDGLFTKESVCKAVKTVMEDE  420

Query  339   SEIGREV  319
             +E+GREV
Sbjct  421   TEVGREV  427



>ref|XP_007132949.1| hypothetical protein PHAVU_011G138600g [Phaseolus vulgaris]
 gb|ESW04943.1| hypothetical protein PHAVU_011G138600g [Phaseolus vulgaris]
Length=466

 Score =   414 bits (1064),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 248/456 (54%), Positives = 333/456 (73%), Gaps = 1/456 (0%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  1414
              + A   H+A++PW  +GHLT    L+NKLA +GHRISF++P+ TQ+KL   NLHPHLI+
Sbjct  3     AASAAPLHIAIFPWLAMGHLTPNLLLSNKLAERGHRISFIVPQRTQTKLHHLNLHPHLIT  62

Query  1413  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             F+PI +P + GLP  AETTSD+PF    LL  AMD+TQ DIE++L+DL   +VF+DF HW
Sbjct  63    FIPIKLPHVHGLPHHAETTSDIPFSLFPLLATAMDRTQKDIELLLRDLNPQIVFFDFQHW  122

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAH  1054
             LP+L+R +GIKSV Y  + PL   Y +   RR  G++LTE D+M+ P  FPD  IK   H
Sbjct  123   LPNLSRSLGIKSVMYLMLHPLSSAYLVEEPRRSQGRELTELDLMEPPLGFPDSCIKFQLH  182

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             E R   A   ++FG  +  +DR +     +D + +  CREI+G + +Y++T + KPVLL+
Sbjct  183   ELRFLVAIRKLEFGSGVLLYDRAYKGFRSADVIGFKGCREIDGPYAEYLQTVYGKPVLLS  242

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP LP P  +T+E+KW  WLG F  GSVI+CA+GSE  L +++ QELL GLELTG PF A
Sbjct  243   GPLLPEPPNTTLEEKWVSWLGGFNPGSVIFCAYGSENPLPQNQLQELLLGLELTGFPFLA  302

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             ALKPP E ESIE A+PE  +E+++GRGI +G WVQQQL L HPSVGCF++HCG AS++EA
Sbjct  303   ALKPPDEFESIEEALPEGFEERVKGRGIAYGGWVQQQLILGHPSVGCFITHCGAASMTEA  362

Query  513   LVNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             LVN C +VLLP++G D I+NA+++S+ LKVGV+VEKGEEDG+F++ESVCKAV+ VMD+ +
Sbjct  363   LVNKCGLVLLPRLGSDHIMNAKMLSMILKVGVQVEKGEEDGLFTKESVCKAVQTVMDDGN  422

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              + REVR NH KLR FLL+ +L+S  +D F Q+LQD
Sbjct  423   VVCREVRENHAKLRNFLLSDNLESSCVDRFCQQLQD  458



>ref|XP_010062848.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   413 bits (1062),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 215/452 (48%), Positives = 307/452 (68%), Gaps = 3/452 (1%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +HMAM+PWF VGH+T +  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+
Sbjct  7     SKFHMAMFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VPS+  LPPG ET SD+ F  +  L  AMD T+  +E+ L+ ++ D +FYD+ HW+P +
Sbjct  67    TVPSVATLPPGTETASDITFSDSPFLAAAMDLTRPQLEVSLQAMQPDFIFYDYAHWIPQV  126

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             AR +GI++V Y+ IS       L P R V  GK  TE ++ K P  +P  ++ L   EAR
Sbjct  127   ARPLGIRTVCYNVISAAAIAMVLVPVREVTQGKPCTEEELEKPPNGYPSKTVVLRGSEAR  186

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                  +++  G +ITF+ R  TA+ E D +A  TC+EIE  FC YI +Q+ KPV L GP 
Sbjct  187   PLIFISLLS-GDNITFYGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKPVFLTGPV  245

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             LP P    +++KW++WLG+FK GSV++CAFGS+  L K +FQELL G E TG+PFF AL+
Sbjct  246   LPKPDMKLLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFFIALR  305

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP    S+E A PE  +E+++GRG+VHG WVQQ L L HPSVGCFV+HCG+ S+ E+L+ 
Sbjct  306   PPIGTNSVEEAFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESLLG  365

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQIV++P + DQI+N R+++  L       + EE G FS+ES+C+A+++VMDEKSE+G 
Sbjct  366   DCQIVMVPHLADQILNTRLLANEL-KVGIEVEREESGWFSKESLCRAIESVMDEKSEVGL  424

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              V+ NH K R  L++ +  + Y+D F Q LQ+
Sbjct  425   LVKKNHAKWREVLVSPNFMTGYIDRFIQNLQE  456



>ref|XP_010260356.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=472

 Score =   414 bits (1063),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 317/458 (69%), Gaps = 12/458 (3%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H+AMYPWF +GH+T +  L+NKLA KGHR+SF +P  T+SKLE  N +PHLI F+ I +
Sbjct  10    FHVAMYPWFAIGHITPYLHLSNKLAEKGHRVSFFLPLKTKSKLEHLNRYPHLIRFITIPI  69

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
               + GLPP AETT+DV  P   LLM  +D T++ +E  L DLK D+VFYD  +WLP+LAR
Sbjct  70    ARVDGLPPTAETTADVSSPMVPLLMTTLDLTKDHVEAFLLDLKPDLVFYDLAYWLPALAR  129

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVG---KQLTEADMMKAPASFPDPS-IKLHAHEA  1048
              +GIKS+ YS +S     Y  SP R       KQLT+ ++M+ P  +P  S  ++  +E 
Sbjct  130   HLGIKSIHYSVVSSAASSYLASPARMPPSAGVKQLTQEELMQPPMGYPSSSPFQIRRYET  189

Query  1047  RGFTARTVMKFGGD-ITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla-  874
             R   A    +  GD +TF+D + T+  +SD + + TCREIEG +CDY+ TQ+ KPVLL  
Sbjct  190   R--DALLAFQDRGDGLTFYDMLTTSFGDSDAICFRTCREIEGPYCDYMATQYGKPVLLTG  247

Query  873   ----gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
                       P+   +++ WS WLG FKEGSV+YCAFGSEC L+KD+FQEL+ G ELTG+
Sbjct  248   PLILPAHHQQPNTRLLDEPWSKWLGNFKEGSVVYCAFGSECILQKDQFQELVLGFELTGL  307

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PF  ALKPP  A +IE A+P+  KE++QGRG+VHG WV Q   L HPSVGCFVSHCG+ S
Sbjct  308   PFLVALKPPHGASTIEEALPDGFKERVQGRGVVHGGWVPQTQILSHPSVGCFVSHCGYGS  367

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             + E+LV+ CQIVL+P  GDQ ++ ++++ SLKV VEVE+ EEDG FSRESVCKA++ VMD
Sbjct  368   MWESLVSSCQIVLIPNYGDQFMHTQLLTRSLKVAVEVERREEDGWFSRESVCKAIRLVMD  427

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              +++I +EV+ NH K R FLL+ ++ S Y+D+F   L+
Sbjct  428   GENQIRKEVKANHVKWRDFLLDENMQSSYIDAFIHDLR  465



>ref|XP_010245594.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=461

 Score =   413 bits (1061),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 234/457 (51%), Positives = 317/457 (69%), Gaps = 13/457 (3%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPWF +GH+  F  L+NKLA  GHR+SFL+P  TQSKL+  N +P LI F+PI +P + 
Sbjct  1     MYPWFAIGHIVPFLHLSNKLAENGHRVSFLLPPKTQSKLQHLNRYPDLIRFIPIAIPPVD  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLPP AETT+DV  P   LL++AM+ T++ +E  L+++K D VF+DF++WLP LAR++GI
Sbjct  61    GLPPTAETTADVSRPIMPLLVDAMNLTKDQVEAALRNIKPDFVFFDFSYWLPPLARQLGI  120

Query  1203  KSVFYSTISPLMHGYALSPERRVVG-KQLTEADMMKAPASFPDPS-IKLHAHEARG--FT  1036
             KS+ Y  ISP    Y L P R+  G +QLTE ++M+ P  +P  S I+L  HE+R   F 
Sbjct  121   KSILYCVISPASTSYLLVPARKPDGIEQLTEEELMQPPPGYPPDSPIRLCRHESRSLLFA  180

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
              +   +    +TF+DR  T++ E D L + T RE+EG +CDY+ +Q+ KPVLL GP LP 
Sbjct  181   FQKFSRTATGLTFYDRQTTSMRECDALCFRTYREMEGPYCDYMGSQYGKPVLLTGPILPE  240

Query  855   PSKSTM----EQKWSDW-----LGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMP  703
               KST     ++ W  W     LG FK GSV+YCAFGSEC   K+K QEL+ GLELTG+P
Sbjct  241   KEKSTTVLDDDEHWCTWSSKWRLGNFKAGSVVYCAFGSECVFTKEKVQELVLGLELTGLP  300

Query  702   FFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASL  523
             F  ALKPP  A ++E A+P+  +E+++GRG+V+G WV QQ  L H SVGCFVSHCG+ S+
Sbjct  301   FLVALKPPHGAWTVEEALPDGFRERVEGRGVVYGGWVPQQQILSHLSVGCFVSHCGYGSM  360

Query  522   SEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDE  343
              E+LV++CQ+VLLP  GDQI NA++++  +KV VEVE+ E+DG F+RESVC+AVK VMD+
Sbjct  361   WESLVSNCQMVLLPNYGDQIKNAKLLARGMKVAVEVERREDDGWFTRESVCRAVKLVMDD  420

Query  342   KSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              S IGR+V+ NH K R FLL   L   Y D+F + L+
Sbjct  421   DSHIGRQVKANHAKWRSFLLEESLQRSYTDAFIRDLK  457



>ref|XP_010062847.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   411 bits (1057),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 304/452 (67%), Gaps = 3/452 (1%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H+AM+PWF VGH+T F  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+
Sbjct  7     SKFHIAMFPWFAVGHVTPFLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VPS+  LPPG ET SD+P      L  AMD T+  +E+ L+ ++ D +FYD  HW+P +
Sbjct  67    TVPSVATLPPGTETASDIPISDAPSLAVAMDLTRRQLEVSLQAMRPDFIFYDTAHWIPQV  126

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             AR +GI++V Y+ +S       L P R V  GK LTE ++ K P  +P  ++ L  +EAR
Sbjct  127   ARPLGIRTVCYNVVSAAAIAIVLVPAREVTPGKPLTEEELGKPPVGYPSNTVVLRGNEAR  186

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                  + + FG +ITF  R  TA+ E D +A  TCREIEG  C YI  Q+ KPV L GP 
Sbjct  187   SLIFIS-LPFGDNITFHGRTTTAMRECDAIAMRTCREIEGDLCAYISNQYGKPVFLTGPV  245

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             LP P+  T+++KW++WL +F+ GSV++CAFGS+  L K +FQELL G E TG+PF  AL+
Sbjct  246   LPEPAMETLDEKWAEWLSRFEPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFLIALR  305

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP    S+E A PE  +E+++GRG+VHG WVQQ L L HPSVGCFV+HCG+ S+ E+L+ 
Sbjct  306   PPIGTNSVEEAFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESLLG  365

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQIV++P + DQI+N R+++  L       + EE G FS+ES+C+A+++VM EKSE+G 
Sbjct  366   DCQIVMVPHLADQILNTRLLANEL-KVGVEVEREESGWFSKESLCRAIESVMYEKSEVGL  424

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              V+ NH K R  L++ +  + Y++ F Q LQ+
Sbjct  425   LVKKNHAKWREVLVSPNFMTGYINRFIQNLQE  456



>ref|XP_010260530.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=471

 Score =   411 bits (1057),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 232/458 (51%), Positives = 316/458 (69%), Gaps = 12/458 (3%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H+ MYPWF +GH+T +  L+N+LA KGHR+SF +P  T+SKLE  N +PHLI F+ I +
Sbjct  9     FHVTMYPWFAIGHITPYLHLSNQLAEKGHRVSFFLPPKTKSKLEHLNRYPHLIRFITIPI  68

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
               + GLPP AETT+DV  P   LLM  +D T++ +E  L DLK D+VFYD  +WLP+LAR
Sbjct  69    ARVDGLPPTAETTADVSSPMVPLLMTTLDLTKDHVEAFLLDLKPDLVFYDLAYWLPALAR  128

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVG---KQLTEADMMKAPASFPDPS-IKLHAHEA  1048
              +GIKS+ YS +S     Y  SP R       KQLT+ ++M+ P  +P  S  ++  +E 
Sbjct  129   HLGIKSIHYSVVSSAASSYLASPARMPPSAGVKQLTQEELMQPPMGYPSSSPFQIRRYET  188

Query  1047  RGFTARTVMKFGGD-ITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla-  874
             R   A    +  GD +TF+D + T+  +SD + + TCREIEG +CDY+ TQ+ KPVLL  
Sbjct  189   RD--ALLAFQDRGDGLTFYDMLTTSFGDSDAICFRTCREIEGPYCDYMATQYGKPVLLTG  246

Query  873   ----gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
                       P+   +++ WS WLG FKEGSV+YCAFGSEC L+KD+FQEL+ G ELTG+
Sbjct  247   PLILPAHHQQPNTRLLDEPWSKWLGNFKEGSVVYCAFGSECILQKDQFQELVLGFELTGL  306

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PF  ALKPP  A +IE A+P+  KE++QGRG+VHG WV Q   L HPSVGCFVSHCG+ S
Sbjct  307   PFLVALKPPHGASTIEEALPDGFKERVQGRGVVHGGWVPQTQILSHPSVGCFVSHCGYGS  366

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             + E+LV+ CQIVL+P  GDQ ++ ++++ SLKV VEVE+ EEDG FSRESVCKA++ VMD
Sbjct  367   MWESLVSSCQIVLIPNYGDQFMHTQLLTRSLKVAVEVERREEDGWFSRESVCKAIRLVMD  426

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              +++I +EV+ NH K R FLL+ ++ S Y+D+F   L+
Sbjct  427   GENQIRKEVKANHVKWRDFLLDENMQSSYIDAFIHDLR  464



>gb|EYU28028.1| hypothetical protein MIMGU_mgv1a006231mg [Erythranthe guttata]
Length=451

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 238/451 (53%), Positives = 312/451 (69%), Gaps = 11/451 (2%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T+ + MYPW  +GHLT F  ++NKLA +GHRI  ++P NTQSKL+ FNLHP+LI+F PI 
Sbjct  5     TFRIVMYPWLAIGHLTSFLHISNKLAERGHRIFLILPLNTQSKLQQFNLHPNLITFNPIT  64

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP +  LP G ETTSDVPFP    L  AMD T+  I  +L++L+ D V +DF HWLP++A
Sbjct  65    VPQVENLPNGTETTSDVPFPLYKNLRHAMDLTKPAITHLLQELEPDFVLFDFAHWLPAVA  124

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEAD-MMKAPASFPDPSI-KLHAHEAR  1045
             R +GIKS++Y TISP   GY +  E        + AD  ++ P  FP   I KL+ HEAR
Sbjct  125   RSLGIKSIYYCTISPAAVGYLVREE--------SSADAFVEPPPGFPSRGIFKLYRHEAR  176

Query  1044  GFT-ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
                     M+F   I F  R+  A  E D + + +CRE+EG +C+++E +F+KP++LAGP
Sbjct  177   AIERINNEMEFENSINFVQRMLIAAGECDAIGFKSCREMEGTYCEFLEKKFKKPIILAGP  236

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              L     ST+++KW+ WL +F+  SVIYCAFGSE  L K +FQELL GLELTG+PFFAAL
Sbjct  237   VLHKAPISTLDEKWASWLSRFEARSVIYCAFGSEARLEKGQFQELLLGLELTGLPFFAAL  296

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   E++E A+P    ++  GRG+VHG WVQQQL L HPSVGCFV+HCG  SLSEA+V
Sbjct  297   KPPRGVETVEEALPRGFADRTLGRGVVHGGWVQQQLMLSHPSVGCFVTHCGSGSLSEAMV  356

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             N+C++VL+P  GDQIINAR+M+  LKVGVEVE+G+EDG+FS+E V KAVK VM+   E+G
Sbjct  357   NECRLVLIPHAGDQIINARLMAGDLKVGVEVERGDEDGLFSKEGVMKAVKLVMEGDCEVG  416

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             +E+  NH K R FLL   L+  Y+D F   L
Sbjct  417   KEIGENHAKWRDFLLGEGLEDSYIDGFIDNL  447



>ref|XP_009767952.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nicotiana sylvestris]
Length=469

 Score =   410 bits (1053),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 235/463 (51%), Positives = 317/463 (68%), Gaps = 23/463 (5%)
 Frame = -3

Query  1566  AMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSI  1387
              MYPW+ +GHLT F  L+NKLA +GH I F+ P NT SKLE FNL+P LI+F+ I VP +
Sbjct  9     VMYPWYAMGHLTSFLHLSNKLADRGHTIFFIHPTNTLSKLEKFNLYPQLINFISITVPHV  68

Query  1386  PGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIG  1207
              GLP GAETTSD+P    +LL +A+D TQ  IE ++++LK   + YDF +W+P +ARK G
Sbjct  69    EGLPIGAETTSDIPIFKQNLLWQALDLTQQKIESLIQELKPHFILYDFAYWVPLVARKYG  128

Query  1206  IKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFP-DPSIKLHAHEARGFTA-  1033
             +KS+ Y +I+P   GY +  E     K   E +MM+ P  FP + SIKLH +EAR   A 
Sbjct  129   VKSIHYCSITPSSVGYLMRGE-----KPTPEDEMMEPPLGFPPNSSIKLHKYEARLIAAL  183

Query  1032  ---------------RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQ  898
                                   G ++F  R+  A  + D +A+ T +EIEG +C+++E +
Sbjct  184   HSIGKESSGSGSGLGSGSGSGSGSVSFTRRLLLAFQDGDVIAFKTTKEIEGPYCEFVENK  243

Query  897   FQKpvlla-gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGL  721
             F+KPV+LA          S +E+  S WL KF+E +VI+CAFGSEC L+K++FQEL+ GL
Sbjct  244   FKKPVILAGPILPEPIDTSNLEENLSKWLEKFQEKTVIFCAFGSECKLKKEQFQELVLGL  303

Query  720   ELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSH  541
             ELTG+PFFAALKPPFEAE+IE A+PE  KE+I+G+GIVH  W +QQL L HPSVGCFV+H
Sbjct  304   ELTGLPFFAALKPPFEAETIEDALPEGFKERIEGKGIVHSGWAEQQLILSHPSVGCFVTH  363

Query  540   CGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAV  361
             CG  SLSEA++ + Q+VL+P  GDQ +NAR+    L+VGVEVE+ EE+G+F+RESVCKA+
Sbjct  364   CGGNSLSEAMITEGQLVLVPNFGDQFVNARLFGGDLRVGVEVERDEENGLFTRESVCKAI  423

Query  360   KAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             K VM+++SE GRE+R N  K R FLL+  L+  Y+D+F QKLQ
Sbjct  424   KMVMNDESEEGREIRANRAKWREFLLSKGLEDSYIDAFVQKLQ  466



>emb|CDP05961.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   409 bits (1050),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 216/446 (48%), Positives = 300/446 (67%), Gaps = 2/446 (0%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             M+PWF  GH+T F  L+NKLA KGHRISFL+P   + +LE  NLHP LI+F  + VP + 
Sbjct  1     MFPWFATGHMTPFLHLSNKLAEKGHRISFLLPNKAKHQLEHLNLHPSLITFYTLTVPHVE  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLPPG ET SDVP   T LL  AMD  ++ +  +L+ LK  +VFYD  HW+P LA +IG 
Sbjct  61    GLPPGTETASDVPIFLTSLLATAMDNMRDRVRDLLQKLKPSIVFYDMAHWIPELASEIGF  120

Query  1203  KSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARGFTART  1027
             K+V Y+ +S      AL P R+ V  + +T A++M+ P  +P  ++ L  HEA+G +   
Sbjct  121   KTVNYNVVSAASIAIALVPSRKPVEDRTITGAELMEPPPGYPSSTVLLRRHEAQGLSF-I  179

Query  1026  VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSK  847
              ++FG DITF+DRI  A+  S  ++  TCRE+EG  CDYI  ++ KPV L GP LP   K
Sbjct  180   FLEFGKDITFYDRITIAMKRSHAISIRTCRELEGSLCDYIAREYHKPVFLTGPVLPESEK  239

Query  846   STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeae  667
               +++KW++WL  F+ G+V++CAFGS+  L K +FQEL+ G ELTG+PF  ALKPPF   
Sbjct  240   EDLQEKWANWLKGFEPGTVVFCAFGSQVVLEKQQFQELVLGFELTGLPFLIALKPPFGTT  299

Query  666   sieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVL  487
             S+E A+PE  + +I+GRGIV+G WVQQ   L HPSVGCFV+HCG+ S+ E+L++DCQIVL
Sbjct  300   SVEEALPEGFEGRIRGRGIVYGGWVQQPAILSHPSVGCFVNHCGFGSMWESLMSDCQIVL  359

Query  486   LPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNH  307
             +P + DQI+N R+++  LKV VEVE+  +   FSRES+C+A+K+ MD  SE+G  +R NH
Sbjct  360   VPHLADQILNTRLLAEELKVAVEVERDNKSTWFSRESLCRAIKSAMDRDSEVGGLIRENH  419

Query  306   DKLRGFLLNADLDSKYMDSFNQKLQD  229
              K +  L +       ++ F Q LQ+
Sbjct  420   AKWKEVLASPTFMGDCIEKFIQDLQE  445



>ref|XP_010041982.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   409 bits (1050),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 210/452 (46%), Positives = 302/452 (67%), Gaps = 3/452 (1%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +HMAM+PWF VGH+T +  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+
Sbjct  7     SKFHMAMFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VPS+  LPPG ET SD+PF  +  L  AMD T+  +E+ L+ ++ D +FYD  HW+P +
Sbjct  67    TVPSVATLPPGTETASDIPFSDSPFLAAAMDLTRPQLEVSLQAMRPDFIFYDLAHWIPQV  126

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             AR +GI++V Y+ +S       L P R V  GK  TE ++ K P  +P  ++ L   EAR
Sbjct  127   ARPLGIRTVCYNVVSAAAIAIVLVPAREVTQGKPCTEEELEKPPRGYPSKTVVLRGSEAR  186

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                  + +  G +ITF  R  TA+ E D +A  TC+EIE  FC YI +Q+ K V L GP 
Sbjct  187   SLIFIS-LPSGDNITFHGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKAVFLTGPV  245

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             LP P    +++KW++WLG+FK GSV++CAFGS+  L K +FQELL G E TG+PF  AL+
Sbjct  246   LPEPDMKMLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLLGFETTGLPFLVALR  305

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP    S+E A P+  +E+++GRG+VHG WVQQ L L HPSVGCFV+HCG+ S+ E+L+ 
Sbjct  306   PPIGTNSVEEAFPKGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESLLG  365

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQIV++P + DQI++ R+++  L       + EE G FS+ES C+A+++VMDE+SE+G 
Sbjct  366   DCQIVMVPHLPDQILHTRLLADEL-KVGVEVEREESGWFSKESFCRAIESVMDEESEVGL  424

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              V+ NH K R  L++ +  + Y+D F Q LQ+
Sbjct  425   LVKKNHAKWRKVLVSPNFMTDYIDRFIQNLQE  456



>ref|XP_010666234.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=459

 Score =   408 bits (1049),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 237/452 (52%), Positives = 307/452 (68%), Gaps = 11/452 (2%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AMY WF  GHLT F +LANKLA +GH+ISF +P  TQ KL   N HPHLI+F+PI VP
Sbjct  10    HIAMYSWFAFGHLTSFLQLANKLAQRGHKISFFLPTKTQQKLTPHNHHPHLITFIPIAVP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
             ++ GLP GAETT+DVP+ +  L+M AMD TQ+ IE +L  LK D+VF+DFT WLP++ARK
Sbjct  70    AVEGLPSGAETTADVPYEARSLIMAAMDLTQDTIESLLSQLKPDLVFFDFTEWLPNVARK  129

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPS---IKLHAHEARG  1042
              G+KSV+Y+T+  +   Y L   R     QL   D+ + P  FP PS   I L  HEAR 
Sbjct  130   HGVKSVYYATLLAVSGAYFLPRAR----AQLGGRDLTRPPPGFP-PSKSMITLRDHEARA  184

Query  1041  FT-ARTVMKFGG-DITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
                A T M+FGG       R   A+   D  A  +CRE+EG +CD++   ++KP+LLAGP
Sbjct  185   VGYAVTQMEFGGPGKMMLQRHAVALEACDAFAAKSCREMEGDYCDFVYNVYRKPLLLAGP  244

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              +P P  + ++ K + WL  F + SVIYCA GSEC L KD+FQELL GLELTGMPF AAL
Sbjct  245   VVPEPPAARLDDKLNAWLSSFAKDSVIYCALGSECFLSKDRFQELLLGLELTGMPFLAAL  304

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             K P   E++E A+PE  +E+ +GRGIVHG+WVQQQL LQHPSVGCFV+HCG  SLSEA+V
Sbjct  305   KLPIGYETMEHALPEGFEERTKGRGIVHGDWVQQQLILQHPSVGCFVTHCGAGSLSEAMV  364

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             ++CQ+VL PQV DQ INAR +S+ L       +  EDG+ +++ +CK +K +MD KSE+G
Sbjct  365   SNCQLVLFPQVTDQFINARFLSLDL-KVGVEVEIGEDGILTKDGICKTIKVIMDPKSEVG  423

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             RE R N  K R FLL   L++ Y+  F Q L+
Sbjct  424   REARINRVKWRDFLLAKGLEASYISGFIQNLR  455



>ref|XP_009610402.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nicotiana tomentosiformis]
Length=461

 Score =   407 bits (1047),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 314/454 (69%), Gaps = 15/454 (3%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPW+ +GHLT F  L+NKLA +GH I F+ P NT SKLE FNL+P LI+F+ I VP + 
Sbjct  10    MYPWYAMGHLTSFLHLSNKLADRGHTIFFIHPTNTLSKLEKFNLYPQLINFISIKVPHVE  69

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLP GAETTSD+     +LL +A+D TQ  IE ++++LK   + YDF +W+P +ARK G+
Sbjct  70    GLPLGAETTSDISIFKQNLLWQALDLTQQKIESLIQELKPHFILYDFAYWVPLVARKYGV  129

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFP-DPSIKLHAHEARGFTA--  1033
             KS+ Y +I+P   GY +  E     K   E ++M+ P  FP + SIKLH +EAR   A  
Sbjct  130   KSIHYCSITPSSVGYLMRGE-----KPTPEDEVMEPPLGFPPNSSIKLHKYEARLIAALH  184

Query  1032  ------RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla-  874
                          G ++F  R+  A  + D +A+ T +EIEG +C+++E +F+KPV+LA 
Sbjct  185   SIGKESSGSGSGSGSVSFTRRLLLAFQDGDIIAFKTTKEIEGPYCEFVENKFKKPVVLAG  244

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
                      S +E+  S WL KF+E +VI+CAFGSEC L+K++FQEL+ GLELTG+PFFA
Sbjct  245   PILPEPIDTSNLEENLSKWLEKFQEKTVIFCAFGSECKLKKEQFQELVLGLELTGLPFFA  304

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             ALKPPFEAE+IE A+PE  KE+I+G+GIVH  W +QQL L HPSVGCFV+HCG  SLSEA
Sbjct  305   ALKPPFEAETIEDALPERFKERIEGKGIVHSGWAEQQLILSHPSVGCFVTHCGGNSLSEA  364

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             ++ +CQ+VL+P  GDQ INAR+    L+VGVEVE+ EE+G+F+RE VCKA+K VM+  SE
Sbjct  365   MITECQLVLVPNFGDQFINARLFGGDLRVGVEVERDEENGLFTREGVCKAIKMVMNGDSE  424

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              GRE+R N  K R FLL+  L+  Y+D+F QKLQ
Sbjct  425   EGREIRANRAKWREFLLSKGLEDSYIDAFVQKLQ  458



>gb|KCW69984.1| hypothetical protein EUGRSUZ_F03295 [Eucalyptus grandis]
Length=449

 Score =   405 bits (1041),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 212/446 (48%), Positives = 302/446 (68%), Gaps = 3/446 (1%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             M+PWF VGH+T +  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+ VPS+ 
Sbjct  1     MFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPLTVPSVA  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
              LPPG ET SD+ F  +  L  AMD T+  +E+ L+ ++ D +FYD+ HW+P +AR +GI
Sbjct  61    TLPPGTETASDITFSDSPFLAAAMDLTRPQLEVSLQAMQPDFIFYDYAHWIPQVARPLGI  120

Query  1203  KSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARGFTART  1027
             ++V Y+ IS       L P R V  GK  TE ++ K P  +P  ++ L   EAR     +
Sbjct  121   RTVCYNVISAAAIAMVLVPVREVTQGKPCTEEELEKPPNGYPSKTVVLRGSEARPLIFIS  180

Query  1026  VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSK  847
             ++  G +ITF+ R  TA+ E D +A  TC+EIE  FC YI +Q+ KPV L GP LP P  
Sbjct  181   LLS-GDNITFYGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKPVFLTGPVLPKPDM  239

Query  846   STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeae  667
               +++KW++WLG+FK GSV++CAFGS+  L K +FQELL G E TG+PFF AL+PP    
Sbjct  240   KLLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFFIALRPPIGTN  299

Query  666   sieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVL  487
             S+E A PE  +E+++GRG+VHG WVQQ L L HPSVGCFV+HCG+ S+ E+L+ DCQIV+
Sbjct  300   SVEEAFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESLLGDCQIVM  359

Query  486   LPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNH  307
             +P + DQI+N R+++  L       + EE G FS+ES+C+A+++VMDEKSE+G  V+ NH
Sbjct  360   VPHLADQILNTRLLANEL-KVGIEVEREESGWFSKESLCRAIESVMDEKSEVGLLVKKNH  418

Query  306   DKLRGFLLNADLDSKYMDSFNQKLQD  229
              K R  L++ +  + Y+D F Q LQ+
Sbjct  419   AKWREVLVSPNFMTGYIDRFIQNLQE  444



>ref|XP_004293911.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=451

 Score =   405 bits (1040),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 238/451 (53%), Positives = 321/451 (71%), Gaps = 10/451 (2%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T H+AMYPWF +GHLT F  ++NKLA +G++ISF +P  T+SKL+ +NLHP LI+F+P+ 
Sbjct  5     TLHIAMYPWFAMGHLTAFLHISNKLAERGNKISFFLPLKTRSKLQHYNLHPRLITFIPLS  64

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GLP G ETT+D+      LL  AMD T+  IE  L +LK D VF+D ++WLP++ 
Sbjct  65    VPHVDGLPLGTETTADIDLSLGSLLATAMDLTRPQIEQSLIELKPDFVFFDLSYWLPAML  124

Query  1218  RKIG--IKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             R +   IKS++YS I+P    + L   R +V  +  + D  +A  SF   SIKL  HE R
Sbjct  125   RGLATNIKSIYYSVINPATIWFGL---RNLVLPRKNQLD--EAYRSF---SIKLQTHEVR  176

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
              + A   MK+G ++TF  R+ T+ S+ D + + +CRE+   F +YIE +  KPV+LAGP 
Sbjct  177   AYDAMMNMKYGSEVTFSKRLMTSRSDCDAICFQSCRELAEPFSNYIEIRMNKPVILAGPV  236

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             +P P  S +E+KW+ WLG F+  +VI+CA GSE  L K + Q+LL G ELTG PFFAALK
Sbjct  237   MPDPPSSQLEEKWARWLGGFEPRTVIFCALGSEYILTKQQLQQLLLGFELTGFPFFAALK  296

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP   ESIE+A+PE  +E+++G+G+V+G WVQQ L L+HPSVGCFV+HCG  SL+EAL+N
Sbjct  297   PPTGVESIESALPEGFEERVKGKGVVYGSWVQQPLILKHPSVGCFVTHCGSGSLNEALLN  356

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             +CQ+V LP + DQIINAR+MS  LKVGVEVEKG+EDG+F++E VCKAVKAVMDE SE+G+
Sbjct  357   ECQLVFLPNILDQIINARMMSGELKVGVEVEKGDEDGLFTKEGVCKAVKAVMDENSEVGK  416

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             EV+ NH K R FL +  L+S Y+D F QKL 
Sbjct  417   EVKINHAKWREFLSSKGLESSYIDDFVQKLH  447



>ref|XP_007021598.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13123.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=458

 Score =   405 bits (1040),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 309/455 (68%), Gaps = 4/455 (1%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             + ++ +H+ M+ WF +GH+T F  LANKLA KGHRI+F++P+   ++LE  NL+P  ISF
Sbjct  4     ANSSDFHVLMFSWFAIGHMTPFLHLANKLAEKGHRITFVLPRKAVNQLEHLNLYPDFISF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P+ VPS+ GLPPGAET SD+P   +H L  AMD+T++ +E ++  +K ++V YD  HW+
Sbjct  64    HPVTVPSVTGLPPGAETASDIPIFLSHFLSIAMDRTRDQVESVISSVKPNLVLYDTAHWI  123

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAPASFPDPSIKLHAH  1054
             P +A+ +GIK++ Y+ +        L P R    ++ +TEA++   P  +P  S+ L +H
Sbjct  124   PEIAKPLGIKTICYNVVCAAAIAIVLVPARNAARERPITEAELAVPPLGYPSSSVVLRSH  183

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             E +     T   FG  +TF++RI TA+   D ++  TC EIEG+ CDYI +Q++KPVLL 
Sbjct  184   EGQSLLFVT-NPFGEGLTFYERITTAMKNCDAISIRTCHEIEGKLCDYIGSQYEKPVLLT  242

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP LP  SKS ++++W  WL  F+ GSV+YCAFGS+    K +FQELL G ELTG+PFF 
Sbjct  243   GPVLPEESKSVLDERWGSWLAGFEPGSVVYCAFGSQFIFEKPQFQELLLGFELTGLPFFV  302

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             ALKPP EA +IE A+PE  +E+++GRG+V G WVQQ L L HPSVGCFVSHCG+ S+ E+
Sbjct  303   ALKPPLEAATIEEALPEGFEERVKGRGVVWGGWVQQPLVLAHPSVGCFVSHCGFGSMWES  362

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             L++DCQIVL PQ+GDQI+N R+M+  L       K EE G  S+E++ +A+K+VM + SE
Sbjct  363   LMSDCQIVLFPQLGDQILNTRLMADEL-KVAVEVKREESGWLSKENLSEAIKSVMHKDSE  421

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +G+  + NH K R   ++ +L + Y+D F Q + +
Sbjct  422   VGKLAKENHKKWRD-TISPELTNDYIDKFIQSMHE  455



>gb|KCW69983.1| hypothetical protein EUGRSUZ_F03293, partial [Eucalyptus grandis]
Length=448

 Score =   404 bits (1037),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/444 (47%), Positives = 299/444 (67%), Gaps = 3/444 (1%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H+AM+PWF VGH+T F  L+N+LA +GH+ISF +P+     LE+ NLHP+LI+F P+
Sbjct  7     SKFHIAMFPWFAVGHVTPFLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VPS+  LPPG ET SD+P      L  AMD T+  +E+ L+ ++ D +FYD  HW+P +
Sbjct  67    TVPSVATLPPGTETASDIPISDAPSLAVAMDLTRRQLEVSLQAMRPDFIFYDTAHWIPQV  126

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             AR +GI++V Y+ +S       L P R V  GK LTE ++ K P  +P  ++ L  +EAR
Sbjct  127   ARPLGIRTVCYNVVSAAAIAIVLVPAREVTPGKPLTEEELGKPPVGYPSNTVVLRGNEAR  186

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                  + + FG +ITF  R  TA+ E D +A  TCREIEG  C YI  Q+ KPV L GP 
Sbjct  187   SLIFIS-LPFGDNITFHGRTTTAMRECDAIAMRTCREIEGDLCAYISNQYGKPVFLTGPV  245

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             LP P+  T+++KW++WL +F+ GSV++CAFGS+  L K +FQELL G E TG+PF  AL+
Sbjct  246   LPEPAMETLDEKWAEWLSRFEPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFLIALR  305

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP    S+E A PE  +E+++GRG+VHG WVQQ L L HPSVGCFV+HCG+ S+ E+L+ 
Sbjct  306   PPIGTNSVEEAFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESLLG  365

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQIV++P + DQI+N R+++  L       + EE G FS+ES+C+A+++VM EKSE+G 
Sbjct  366   DCQIVMVPHLADQILNTRLLANEL-KVGVEVEREESGWFSKESLCRAIESVMYEKSEVGL  424

Query  324   EVRGNHDKLRGFLLNADLDSKYMD  253
              V+ NH K R  L++ +  + Y++
Sbjct  425   LVKKNHAKWREVLVSPNFMTGYIN  448



>ref|XP_002523261.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF39100.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score =   403 bits (1036),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 208/454 (46%), Positives = 304/454 (67%), Gaps = 3/454 (1%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             +++ +H+ M+PWF VGH+T F  LAN++A +G   +FL+P   + +LE FN HP LI+F 
Sbjct  5     KSSNFHIVMFPWFAVGHMTPFLHLANRVAERGCSTTFLLPNKAKLQLEHFNTHPDLITFH  64

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
              I VP + GLP G ET SD+P   TH L  A+D+T+  +E ++ D +  +V +D  HW+P
Sbjct  65    SITVPHVEGLPLGTETASDIPIHLTHFLAIALDRTRRQVEKVIVDTRPKLVIFDVAHWIP  124

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHE  1051
              + + +GIK++ Y+ +       AL P R V   + +TEA++++ PA +P  ++ L  HE
Sbjct  125   KITKDLGIKAINYNVVCAASIAIALVPARNVTKDRPVTEAELLQPPAGYPSSNVVLRGHE  184

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
              R     + + FG  ITF++RI+TA+  SD +A  TC EIEG+ CDYI +Q++KPV L G
Sbjct  185   VRSLLFVS-LPFGEGITFYERIYTAIKGSDAIAIRTCHEIEGKLCDYIASQYEKPVFLTG  243

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P LP PSK+ +E +W+ WLG F++ SVI+CAFGS+  L K++FQEL+ GLE TG+PF AA
Sbjct  244   PVLPEPSKAPLEDQWTKWLGGFEKDSVIFCAFGSQIKLEKNQFQELVLGLESTGLPFLAA  303

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP  A ++E A+PE  +E++ GRG++ G WVQQ L L HPSVGCF++HCG+ S+ E+L
Sbjct  304   LKPPNGASTVEEALPEGFEERVNGRGVIWGGWVQQLLILDHPSVGCFLNHCGFGSMWESL  363

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             ++DCQIVL+P +GDQI+N RIM+  L         +E G FS+ES+ KA+ +VMD+ SE+
Sbjct  364   MSDCQIVLVPHLGDQILNTRIMAEEL-KVGVEVVRDESGWFSKESLRKAITSVMDKNSEV  422

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             G  V+ NH K    L      + Y+D F Q +QD
Sbjct  423   GSMVKENHRKWTEILGGEGFMTSYIDKFVQNMQD  456



>ref|NP_200217.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase [Arabidopsis 
thaliana]
 sp|Q9LVW3.1|AXYLT_ARATH RecName: Full=Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase; 
Short=A3G2''XylT [Arabidopsis thaliana]
 dbj|BAA97127.1| flavonol 3-O-glucosyltransferase-like [Arabidopsis thaliana]
 gb|ACE82596.1| At5g54060 [Arabidopsis thaliana]
 gb|AED96443.1| UDP-glucose:flavonoid 3-o-glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38579.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=468

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 219/466 (47%), Positives = 306/466 (66%), Gaps = 13/466 (3%)
 Frame = -3

Query  1605  IGSMGS-QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  1429
             +G  GS ++++  + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+
Sbjct  1     MGVFGSNESSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLY  60

Query  1428  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  1249
             P+LI+F  I +P + GLPPGAET SDVPF  THLL  AMD+T+ ++E I + +K D+VFY
Sbjct  61    PNLITFHTISIPQVKGLPPGAETNSDVPFFLTHLLAVAMDQTRPEVETIFRTIKPDLVFY  120

Query  1248  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAPASFPD  1078
             D  HW+P +A+ IG K+V ++ +S      +L P  ER V+ GK+++  ++ K P  +P 
Sbjct  121   DSAHWIPEIAKPIGAKTVCFNIVSAASIALSLVPSAEREVIDGKEMSGEELAKTPLGYPS  180

Query  1077  PSIKLHAHEAR--GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIE  904
               + L  HEA+   F  R     G   +FFD   TA+   D +A  TCRE EG+FCDYI 
Sbjct  181   SKVVLRPHEAKSLSFVWRKHEAIG---SFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIS  237

Query  903   TQFQKpvlla--gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQEL  733
              Q+ KPV L         P++ +++ +W++WL KF  GSV++CAFGS+  + K D+FQEL
Sbjct  238   RQYSKPVYLTGPVLPGSQPNQPSLDPQWAEWLAKFNHGSVVFCAFGSQPVVNKIDQFQEL  297

Query  732   LWGLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGC  553
               GLE TG PF  A+KPP    ++E A+PE  KE++QGRG+V G W+QQ L L HPSVGC
Sbjct  298   CLGLESTGFPFLVAIKPPSGVSTVEEALPEGFKERVQGRGVVFGGWIQQPLVLNHPSVGC  357

Query  552   FVSHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESV  373
             FVSHCG+ S+ E+L++DCQIVL+PQ G+QI+NAR+M+          + E+ G FSR+S+
Sbjct  358   FVSHCGFGSMWESLMSDCQIVLVPQHGEQILNARLMTEE-MEVAVEVEREKKGWFSRQSL  416

Query  372   CKAVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
               AVK+VM+E SEIG +VR NHDK R  L ++     Y+D F Q L
Sbjct  417   ENAVKSVMEEGSEIGEKVRKNHDKWRCVLTDSGFSDGYIDKFEQNL  462



>ref|XP_002866015.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42274.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
Length=468

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 218/462 (47%), Positives = 307/462 (66%), Gaps = 10/462 (2%)
 Frame = -3

Query  1602  GSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPH  1423
             GS GS + T  + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+P+
Sbjct  5     GSNGSSSMT--IVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLYPN  62

Query  1422  LISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  1243
             LI+F  I +P + GLPPGAET SDVPF  THLL  AMD+T+ ++E I + +K D+VFYD 
Sbjct  63    LITFRTISIPQVKGLPPGAETNSDVPFFLTHLLAIAMDQTRPEVETIFRTIKPDLVFYDS  122

Query  1242  THWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAPASFPDPS  1072
              HW+P +A+ +G K+V ++ +S      +L P  ER V+ GK+++  ++ K P  +P   
Sbjct  123   AHWIPEIAKPVGAKTVCFNIVSAASIALSLVPAAEREVIDGKEMSGEELAKTPLGYPSSK  182

Query  1071  IKLHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQ  892
             + L AHEA+  T     K  G  +FFD   TA+  SD +A  TCRE EG+FCDYI +Q+ 
Sbjct  183   VVLRAHEAKALTF-VWRKHEGIASFFDGKVTAMRNSDAIAIRTCRETEGKFCDYISSQYS  241

Query  891   Kpvlla--gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQELLWGL  721
             KPV L         P++ ++E +W++WL KF  GSV++CAFGS+  + K D+FQEL  GL
Sbjct  242   KPVYLTGPVLPGSQPNQPSLEPQWAEWLAKFNPGSVVFCAFGSQPVVDKIDQFQELCLGL  301

Query  720   ELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSH  541
             E TG PF  A+KPP    ++E A+PE  KE++QGRG+V+G W+QQ L L HPSVGCFVSH
Sbjct  302   ESTGFPFLVAIKPPSGVSTVEEALPEGFKERVQGRGVVYGGWIQQPLVLNHPSVGCFVSH  361

Query  540   CGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAV  361
             CG+ S+ E+L+++CQIVL+PQ G+QI+NAR+M+          + EE+G FS+ S+  AV
Sbjct  362   CGFGSMWESLMSNCQIVLVPQHGEQILNARLMTEE-MEVAVEVEREENGWFSQRSLENAV  420

Query  360   KAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             K+VM+E SE+  +VR NH+K R  L ++     Y+D F + L
Sbjct  421   KSVMEEGSEVSDKVRKNHEKWRCVLTDSGFADGYIDKFEKNL  462



>ref|XP_006593292.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=414

 Score =   398 bits (1023),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 228/457 (50%), Positives = 296/457 (65%), Gaps = 46/457 (10%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             M + A + H+AM+PWF +GH   F  L+NKLA +GH+ISF  P+ TQ+KL+  NLHPH I
Sbjct  1     MDAHAPSMHIAMFPWFAMGHFIPFLHLSNKLAKRGHKISFFTPRRTQTKLQHLNLHPHHI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
             +FVPI VP + GLP  AETTSDVP     L+  AMD T+  IE++L++LK  +VF+DF H
Sbjct  61    TFVPINVPHVDGLPHDAETTSDVPSSLFPLIATAMDSTEKHIELLLRELKPQIVFFDFQH  120

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             WLP++ R +GIK + Y  ++P    Y  +  R++ G +LTE D+MK P  FPD SIKLHA
Sbjct  121   WLPNITRSLGIKCIQYWILNPSTIAYLWNGPRQIQGGELTEVDLMKPPKGFPDSSIKLHA  180

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HE R   A   ++FG      +                                      
Sbjct  181   HELRFLAATRKLEFGSGPILPE--------------------------------------  202

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
                    P  ST+E+KW  WL  F  GSV++CA+GSE +L +++FQELL GLE  G PF 
Sbjct  203   -------PPNSTLEEKWVSWLEGFNPGSVVFCAYGSEGSLPENQFQELLLGLEQAGFPFL  255

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             AALKPP   ESIE A+P+   E++QGRGIV   WV QQL L H SVGCF++HCG AS++E
Sbjct  256   AALKPPNGFESIEEAMPKGFGERVQGRGIVDEGWVPQQLILGHRSVGCFITHCGAASVTE  315

Query  516   ALVNDCQIVLLPQVG-DQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             ALVN CQ+V LP++G D IINAR+ S  LKVGVEVEKGEEDG+F++ESVCKAVK VM+++
Sbjct  316   ALVNKCQLVFLPRLGADHIINARMFSRKLKVGVEVEKGEEDGLFTKESVCKAVKTVMEDE  375

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +E+GREVR NH KLR FLL  +L+S  +D F Q+LQD
Sbjct  376   TEVGREVRENHAKLRNFLLRDNLESTCVDGFCQQLQD  412



>ref|XP_010695817.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=452

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 225/453 (50%), Positives = 299/453 (66%), Gaps = 13/453 (3%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             ++    +A YPWF +GHLT F RLANKLA +GH++S+ +PKNTQ KL S N  P  ++F+
Sbjct  6     ESQVLKVAFYPWFALGHLTSFLRLANKLAERGHQVSYFLPKNTQLKLASQNHFPDHLTFI  65

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
             PI VPS+ GLPPGAETT+DV     HL+M AMD T++ I+  L  LK D VFYDF +W+P
Sbjct  66    PITVPSVDGLPPGAETTNDVSLSGAHLIMAAMDMTRDTIDAHLALLKPDFVFYDFAYWMP  125

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA  1048
              LARK GIKSV Y  I+ L+  Y L+  R + G           P     P  ++ AHE 
Sbjct  126   QLARKHGIKSVHY--ITGLIARYTLAISR-ITGAY---------PPDLSSPIFQMRAHEM  173

Query  1047  RGFTARTVMKFG-GDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
             +     +   F  G +T  +    +  E D +   TC+E+EG +C++ E    KPVLLAG
Sbjct  174   KVMEHISEKPFAPGGVTLPEMFRISFEECDAVGVKTCKEMEGIYCEFAEKTLDKPVLLAG  233

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P +P    S ++     WL  F  G+VI+CA GSEC L +++FQ++L GLELTG PF AA
Sbjct  234   PVVPKLPSSKLDDYVDAWLSTFGSGTVIFCALGSECILEQNQFQDILLGLELTGKPFLAA  293

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP   +S+E+ +PE   E+++GRG++HG WVQQQL LQHPSVGCF++HCG  SLSEA+
Sbjct  294   LKPPKNCKSLESGLPEGFSERVRGRGMIHGGWVQQQLILQHPSVGCFITHCGVGSLSEAM  353

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             V+ CQ+VL+PQ  DQ +NAR MS+ LK+GVEVE  E DG F+RE++CKAV  VMDE+SE+
Sbjct  354   VSQCQVVLMPQAVDQFMNARQMSLELKIGVEVESTETDGFFTREALCKAVSLVMDEQSEV  413

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              REV+ NH K R F+L   L+  Y+ SF Q LQ
Sbjct  414   AREVKANHAKWRDFILTEGLEDSYISSFIQSLQ  446



>ref|XP_006281777.1| hypothetical protein CARUB_v10027945mg [Capsella rubella]
 gb|EOA14675.1| hypothetical protein CARUB_v10027945mg [Capsella rubella]
Length=469

 Score =   399 bits (1024),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 217/468 (46%), Positives = 307/468 (66%), Gaps = 13/468 (3%)
 Frame = -3

Query  1605  IGSMGSQ-ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  1429
             +G  GS  +++  + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+
Sbjct  1     MGDFGSNGSSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLY  60

Query  1428  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  1249
             P LI+F  I +P + GLPPGAET SDVPF  THLL  AMD+T+ ++E I + +K D+VFY
Sbjct  61    PKLITFHTISIPQVKGLPPGAETNSDVPFFLTHLLAVAMDQTRPEVETIFRTIKPDLVFY  120

Query  1248  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAPASFPD  1078
             D  HW+P +A+ +G K+V +  +S      +L P  ER V+ GK+++  ++ K P  +P 
Sbjct  121   DSAHWIPEIAKPMGAKTVCFHIVSAASIALSLVPAAEREVIDGKEMSGEELAKTPLGYPS  180

Query  1077  PSIKLHAHEAR--GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIE  904
               + L AHEA+   F  R   K  G  +FFD    A+   D +A  TCRE EG+FCDYI 
Sbjct  181   SKVVLRAHEAKLLSFVWR---KHEGIASFFDVQVAAMRNCDAIAIRTCRETEGKFCDYIS  237

Query  903   TQFQKpvlla--gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQEL  733
             +Q+ KPV L         P++ ++E +W++WL KFK  SV++CAFGS+  + K D+FQEL
Sbjct  238   SQYNKPVNLTGPVLPGSQPNQPSLEPQWAEWLAKFKPNSVVFCAFGSQPVVDKIDQFQEL  297

Query  732   LWGLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGC  553
               GLE TG+PF  A+KPP    ++E A+PE  KE++QGRG+V+G W+QQ L L HPSVGC
Sbjct  298   CLGLESTGLPFLVAIKPPSGVSTVEEALPEGFKERVQGRGVVYGGWIQQPLVLDHPSVGC  357

Query  552   FVSHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESV  373
             FVSHCG+ S+ E+L++DCQIVL+P  G+QI+NAR+M+          +  E+G FSR S+
Sbjct  358   FVSHCGFGSMWESLMSDCQIVLVPHHGEQILNARLMTEE-MEVAVEVERGENGWFSRRSL  416

Query  372   CKAVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
               AVK+VM+E SE+G +VR NHDK R  L ++     Y+++F Q L +
Sbjct  417   EDAVKSVMEEGSEVGVKVRKNHDKWRCVLSDSGFADGYINTFEQSLTE  464



>ref|XP_007021621.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13146.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=581

 Score =   399 bits (1026),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 305/454 (67%), Gaps = 7/454 (2%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
              ++  H+AM+PWF  GH   +  L+NKLA KGH +SFL+PK  Q KLE  N +P+LI F 
Sbjct  131   NSSKLHLAMFPWFSFGHFIPYLHLSNKLAEKGHEVSFLLPKGAQPKLEQLNQYPNLIQFF  190

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
             P+VV  + G+ PGA+TTSDVP P   L   A D+T++ +E IL+ +K D+VF+D  +W+P
Sbjct  191   PLVVSHVDGILPGAQTTSDVPLPLHSLFAIAFDQTRDQVEAILRAIKPDIVFHDLGYWIP  250

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA  1048
             +LA +IGIKS++Y  ++   H  AL P ++V  +++T  ++M+ P  +P   +KL A E 
Sbjct  251   ALAHQIGIKSIYYPPVTAAAH--ALLPTKKVT-REMTVEELMEVPPGYPSSKVKLRAEEV  307

Query  1047  RGFTARTVMK-FGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
                T  T +K FG  ++F DRI T++++SD +A+   REIEG +CDY+   F KP +L G
Sbjct  308   SDLT--TALKIFGIGLSFRDRIITSMNDSDVIAFRAHREIEGPYCDYVAQHFGKPAMLTG  365

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
               LP  + + +E KW++WL  F+  SV++CAFGS+ TL+K++FQEL+ GLEL+G PF  A
Sbjct  366   TCLPETNATQLEDKWANWLSNFEPSSVVFCAFGSQITLQKEEFQELVLGLELSGQPFLVA  425

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             L PP     IE A+PE  +E+IQGRG++HG W  Q+L L HPS+GCFV+HCG  ++ E+L
Sbjct  426   LTPPDGCTRIEEALPEGFQERIQGRGLLHGGWFPQELLLSHPSIGCFVNHCGPGTMWESL  485

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             ++DCQIV +P++GDQI+N R+M V         +  E+   S+E++ KA+K VMD+ +EI
Sbjct  486   LSDCQIVFIPRLGDQILNTRLM-VEELKVAVEAEKGENSKISKENLSKAIKLVMDKDNEI  544

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
                ++ NH KL+  L N DL  +Y+++F + LQD
Sbjct  545   SVLLKRNHAKLKKILSNRDLQEEYINNFIKGLQD  578


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -3

Query  519  EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
            E L+NDCQIVL+P++GDQI+N R+M           +  E+G  S+E++ KA+K  MD+ 
Sbjct  3    EPLLNDCQIVLIPRLGDQILNTRLMVEE-LEVAVEVEKGENGEISKENLSKAIKLEMDKD  61

Query  339  SEIGREVRGNHDKLRGFLLNA  277
            +EI   ++      R F L  
Sbjct  62   NEIASLLKRTMPSSRTFFLTG  82



>ref|XP_006401632.1| hypothetical protein EUTSA_v10013471mg [Eutrema salsugineum]
 gb|ESQ43085.1| hypothetical protein EUTSA_v10013471mg [Eutrema salsugineum]
Length=463

 Score =   395 bits (1015),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 216/464 (47%), Positives = 311/464 (67%), Gaps = 14/464 (3%)
 Frame = -3

Query  1605  IGSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHP  1426
             +G  GS +    + MYPW   GH+T F  L+NKLA KGH+I FL+PK   S+LE FNL+P
Sbjct  1     MGDSGSMS----IVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALSQLEPFNLYP  56

Query  1425  HLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYD  1246
             +LI+F  I +P + GLP GAET SDVPF  THLL  AM++TQ +++ IL+ +K ++VFYD
Sbjct  57    NLITFHTISIPQVKGLPLGAETNSDVPFFLTHLLAVAMNQTQPEVDTILRTIKPNLVFYD  116

Query  1245  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAPASFPDP  1075
               +W+P +A+ +G K+V Y+ +S      +L P  ER +  GK+++  ++ ++P  +P  
Sbjct  117   SAYWIPEIAKPVGAKTVCYNIVSAASIALSLVPAAERELTDGKEISLEELARSPLGYPSS  176

Query  1074  SIKLHAHEARGFTARTVMKFGGDI-TFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQ  898
              + L AHEA+    R V K   +I +FFD   TA+   D +A  TCRE EG+FCDYI +Q
Sbjct  177   KVILLAHEAKNL--RFVWKRHEEIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIASQ  234

Query  897   FQKpvlla--gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQELLW  727
             + KPV L          +++++E +W+DWL KF  GSV++CAFGS+  + K D+FQEL  
Sbjct  235   YSKPVYLTGPVLPGSKLNQASLEPRWADWLAKFNPGSVVFCAFGSQPVVDKIDQFQELCL  294

Query  726   GLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFV  547
             GLE TG+PF  A+KPP   +++E A+PE  +E+++GRGIV+G W+QQ L L HPSVGCFV
Sbjct  295   GLESTGLPFLVAIKPPSGVQTVEEALPEGFEERVKGRGIVYGGWIQQPLVLNHPSVGCFV  354

Query  546   SHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCK  367
             SHCG+ S+ E+L++DCQ+VL+PQ G+QI+NAR+M+          + EE+G FSR S+  
Sbjct  355   SHCGFGSMWESLMSDCQVVLVPQHGEQILNARLMT-KEMEVAVEVEREENGWFSRRSLEV  413

Query  366   AVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             AVK+VM+E SE+G +VR NH+K R  L ++     Y+D F Q L
Sbjct  414   AVKSVMEEGSEVGEKVRKNHEKWRCVLSDSGFADGYIDKFEQNL  457



>ref|XP_010093983.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB54970.1| UDP-glycosyltransferase [Morus notabilis]
Length=453

 Score =   394 bits (1012),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 225/474 (47%), Positives = 308/474 (65%), Gaps = 43/474 (9%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             M +  ++ H+AMYPWF  GH+T F  L+NKLA +GH+ISF +P  TQSK+E FN  PHLI
Sbjct  1     MEADDSSLHIAMYPWFAFGHITPFLHLSNKLAKRGHKISFFVPTRTQSKIEHFNHFPHLI  60

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTH-LLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
             +F PI VP I GLP GAETT DVP P    L++ AM+KT+  IE++L++LK D++F+DF 
Sbjct  61    TFAPITVPHIDGLPLGAETTYDVPNPLLFPLIIMAMEKTKLQIELLLRNLKPDIIFFDFA  120

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPER-RVVGKQLTEADMMKAPASFPD-PSIK  1066
             HW+P+LAR +GIKSVFYS ISP+  GY ++ E  +    +++E   +  P  FPD  S+ 
Sbjct  121   HWIPNLARPLGIKSVFYSIISPVSIGYGVARENVQKKEAEISEQTFLHPPPDFPDSSSMN  180

Query  1065  LHAHEARGFTART---VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQF  895
             LH HE + F A +       G   + F RI+T++ ESD LA+                  
Sbjct  181   LHLHETKFFAANSKPPQFDGGTRTSLFRRIYTSMMESDALAFKA----------------  224

Query  894   QKpvllagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLEL  715
                          P  +++E+KW+++LG FK GS IYCA GSE TL K++FQELL G EL
Sbjct  225   --------FMPEPPVSTSLEEKWANFLGGFKAGSGIYCALGSEWTLTKEQFQELLLGFEL  276

Query  714   TGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCG  535
             +G+PF AALKPP+ AE IE A+PE   E+I+GRG+VHG W+QQ+L L+HP VGCFV+HCG
Sbjct  277   SGLPFLAALKPPYGAEKIEEALPEGFGERIRGRGVVHGGWIQQRLILEHPCVGCFVTHCG  336

Query  534   WASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKA  355
               SL E L++  Q+V++P VGD    AR++    K GVEVE+ EEDG F++ESVCKA+K 
Sbjct  337   SGSLMEGLLSKSQLVMIPHVGDHCFRARLIGNIFKAGVEVERAEEDGFFTKESVCKAIKT  396

Query  354   VMDEKS-------------EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             VM+E++             ++ RE+R NH +LR  L   DL+S Y+D F++KLQ
Sbjct  397   VMEEENYYCDKDQSHLQPCQVAREIRANHAQLRELLSLKDLESSYIDDFSKKLQ  450



>ref|XP_007021619.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13144.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=505

 Score =   395 bits (1015),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/455 (46%), Positives = 308/455 (68%), Gaps = 6/455 (1%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  1414
              S +++ H+AM+PWF  GH   +  L+NKLA KGH++SFL+PK  Q KLE  N +P+L+ 
Sbjct  54    NSNSSSLHVAMFPWFAFGHFIPYLHLSNKLAEKGHKVSFLLPKGAQPKLEQLNQYPNLLQ  113

Query  1413  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             F P+VV  + G+PPGAET SDVP P   LL  A D+T++ +E IL+ +K DVVF+D  HW
Sbjct  114   FFPLVVSHVDGMPPGAETASDVPQPLHSLLAIAFDQTRDQVEAILRAIKADVVFHDMGHW  173

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAH  1054
             +P+LA +IGIKS++Y+ +S   + + L+ E   V K++T  ++++ P  +P   ++  A 
Sbjct  174   IPALAHQIGIKSIYYAAVSAAANAH-LAKE---VSKEMTVEELIEVPPGYPSSKVRFKAE  229

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             EA   T    + FG  ++F DRI TA+ +SD +A+ T REIEG FCDYI   F KPV+L 
Sbjct  230   EAAIVTILPEI-FGIGLSFQDRIITAMKDSDVIAFRTYREIEGPFCDYIAQHFGKPVMLT  288

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP+LP  + + +E KW++WL  F+  SV++C+FGS+  L+K +FQEL+ G EL+G PF  
Sbjct  289   GPSLPETNATQLEDKWANWLSNFEPSSVVFCSFGSQIALQKGEFQELVLGFELSGQPFLV  348

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             AL PP    +IE A+PE   E+IQGRG+V+G WV Q+L L H SVGCFV+HCG+ ++ E+
Sbjct  349   ALTPPDGCITIEEALPEGFHERIQGRGLVYGGWVPQELLLSHSSVGCFVNHCGYGTMWES  408

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             L++DCQIVL+P++GDQI+N R+M           +  E+   S+E++ KA+K VMD+ +E
Sbjct  409   LLSDCQIVLIPRLGDQILNTRLMVEE-LEVAVEVQKGENREISKENLSKAIKMVMDKDNE  467

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             I   ++ NH KL+  L N DL  +Y+++F + LQD
Sbjct  468   IAGLLKRNHAKLKNILSNRDLQEEYINNFIEGLQD  502



>gb|KDO77744.1| hypothetical protein CISIN_1g017557mg [Citrus sinensis]
Length=369

 Score =   390 bits (1002),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 211/364 (58%), Positives = 282/364 (77%), Gaps = 1/364 (0%)
 Frame = -3

Query  1323  MEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGIKSVFYSTISPLMHGYALSPE  1144
             M AMD T+  IE I++D+K ++VF+DFT+WLPSLARK+GIKS+ + T+SP   GY LSPE
Sbjct  1     MTAMDLTEPAIEAIVRDIKPNIVFFDFTYWLPSLARKLGIKSIAFVTVSPATVGYLLSPE  60

Query  1143  RRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTARTVMKFGGDITFFDRIFTAVSES  964
             R++  K LTEAD+++ P  FP   IKL AHEARG  A TV  FGG ++F +R+   ++E 
Sbjct  61    RKLRDKFLTEADLLQPPQGFPPSKIKLRAHEARGLAAATVKDFGG-LSFMERLLLCLTEC  119

Query  963   DGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSKSTMEQKWSDWLGKFKEGSVIY  784
             D + + TCREIEG +CD +E+QF+K V+LAGP LP P  S +E+++      FK  S+I+
Sbjct  120   DAIGFKTCREIEGAYCDCVESQFEKRVILAGPVLPEPPASVLEEEFEMLFSSFKAKSLIF  179

Query  783   CAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVH  604
             CA GSEC L+KD+FQEL+ G ELTG+PFFAALKPP   ++IE+A+PE  +E+++GRG VH
Sbjct  180   CALGSECVLKKDQFQELILGFELTGLPFFAALKPPTGHDTIESALPEGFEERVKGRGFVH  239

Query  603   GEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvg  424
             G WVQQQL L+HPSVGCFV+HCG  SLSEA+VN+CQ+VLLP VGDQIIN+R+M   LKVG
Sbjct  240   GGWVQQQLILKHPSVGCFVTHCGSGSLSEAMVNECQLVLLPNVGDQIINSRLMGEDLKVG  299

Query  423   vevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFN  244
             VEVE+G+EDG+F+R+ VCKAVKAVMD+ SE+G++ R NH +LR FL++  L++ Y+D F 
Sbjct  300   VEVERGDEDGLFTRDGVCKAVKAVMDDDSEVGKDARQNHAELREFLISPGLENSYVDGFV  359

Query  243   QKLQ  232
             Q+L 
Sbjct  360   QELH  363



>gb|AEM37037.1| UDP-glucose:flavonoid 3-O-glucosyltransferase 2 [Brassica rapa 
subsp. oleifera]
Length=468

 Score =   394 bits (1011),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 217/466 (47%), Positives = 306/466 (66%), Gaps = 14/466 (3%)
 Frame = -3

Query  1602  GSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPH  1423
             GS GS + +  + MYPW   GH+T F  L+NKLA KGH I FL+PK    +++  NL+P+
Sbjct  5     GSDGSSSMS--IVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLYPN  62

Query  1422  LISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  1243
             LI+F  I +P + GLPPGAET SDVPF  THLL  AM++T+ ++E IL+  K D+VFYD 
Sbjct  63    LITFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFYDS  122

Query  1242  THWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAPASFPDPS  1072
               W+P +AR +G K+V Y+T+S       L P  ER ++ GK+++  ++ K P  +P   
Sbjct  123   ADWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSAEELAKPPLGYPSSK  182

Query  1071  IKLHAHEAR--GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQ  898
             + L A EA+   F  R   +  G  +FFD   TA+   D +A  TCRE EG+FCDYIE+Q
Sbjct  183   VVLLAREAKTLSFVWR---RHEGIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIESQ  239

Query  897   FQKpvlla--gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQELLW  727
             + +PV L      +  P+K+++E +W+DWL KFK GSV++CAFGS+  + K D+FQEL  
Sbjct  240   YNRPVYLTGPVLPVDEPNKTSLEPRWADWLAKFKPGSVVFCAFGSQPVVEKIDQFQELCL  299

Query  726   GLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFV  547
             GLE TG+PF  A+KPP    ++E A+PE  +E+++GRG+V+G WVQQ + L HPSVGCFV
Sbjct  300   GLEATGLPFLVAIKPPSGVSTVEEALPEGFQERVRGRGVVYGGWVQQPMILDHPSVGCFV  359

Query  546   SHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCK  367
             SHCG+ S+ E+L++DCQ+VL+PQ G+QI+NAR +           + EE+G FSR S+  
Sbjct  360   SHCGFGSMWESLMSDCQMVLVPQHGEQILNAR-LMAEEMEVAVEVEREENGWFSRRSLED  418

Query  366   AVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             AVK+VM E SE+G +VR NHDK R  L ++     Y+  F Q L +
Sbjct  419   AVKSVMGEGSEVGEKVRKNHDKWRCVLSDSGFADGYISKFEQNLTE  464



>gb|AEM37036.1| UDP-glucose:flavonoid 3-O-glucosyltransferase 1 [Brassica rapa 
subsp. oleifera]
Length=468

 Score =   393 bits (1009),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 217/466 (47%), Positives = 306/466 (66%), Gaps = 14/466 (3%)
 Frame = -3

Query  1602  GSMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPH  1423
             GS GS + +  + MYPW   GH+T F  L+NKLA KGH I FL+PK    +++  NL+P+
Sbjct  5     GSDGSSSMS--IVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLYPN  62

Query  1422  LISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  1243
             LI+F  I +P + GLPPGAET SDVPF  THLL  AM++T+ ++E IL+  K D+VFYD 
Sbjct  63    LITFHTISIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETILRTNKPDLVFYDS  122

Query  1242  THWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAPASFPDPS  1072
               W+P +AR +G K+V Y+T+S       L P  ER ++ GK+++  ++ K P  +P   
Sbjct  123   ADWIPEIARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSGEELAKPPLGYPSSK  182

Query  1071  IKLHAHEAR--GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQ  898
             + L A EA+   F  R   +  G  +FFD   TA+   D +A  TCRE EG+FCDYIE+Q
Sbjct  183   VVLLAREAKTLSFVWR---RHEGIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIESQ  239

Query  897   FQKpvlla--gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQELLW  727
             + +PV L      +  P+K+++E +W+DWL KFK GSV++CAFGS+  + K D+FQEL  
Sbjct  240   YNRPVYLTGPVLPVDEPNKTSLEPRWADWLAKFKPGSVVFCAFGSQPVVEKIDQFQELCL  299

Query  726   GLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFV  547
             GLE TG+PF  A+KPP    ++E A+PE  +E+++GRG+V+G WVQQ + L HPSVGCFV
Sbjct  300   GLEATGLPFLVAIKPPSGVSTVEEALPEGFQERVRGRGVVYGGWVQQPMILDHPSVGCFV  359

Query  546   SHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCK  367
             SHCG+ S+ E+L++DCQ+VL+PQ G+QI+NAR +           + EE+G FSR S+  
Sbjct  360   SHCGFGSMWESLMSDCQMVLVPQHGEQILNAR-LMAEEMEVAVEVEREENGWFSRRSLED  418

Query  366   AVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             AVK+VM E SE+G +VR NHDK R  L ++     Y+  F Q L +
Sbjct  419   AVKSVMGEGSEVGEKVRKNHDKWRCVLSDSGFADGYISKFEQNLTE  464



>ref|XP_006361070.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Solanum tuberosum]
Length=460

 Score =   392 bits (1008),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 228/453 (50%), Positives = 305/453 (67%), Gaps = 14/453 (3%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPW+ +GHLT F  L+NKLA +GH+I F+ P NT SKLE FN +P LI+F  + VP + 
Sbjct  10    MYPWYAMGHLTSFLHLSNKLAHRGHKIFFVHPTNTLSKLEKFNRYPELINFKSVTVPHVD  69

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLP GAETTSDVP  + +LL +A+D T   IE +++++K   +FYDF +W+PS+ARK  +
Sbjct  70    GLPLGAETTSDVPIFNQNLLCQALDLTLPKIESLIQEIKPHFIFYDFAYWVPSIARKYKV  129

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFP-DPSIKLHAHEARGFTART  1027
             KSV Y +I+P   GY +  E        +EA+MM+ P  FP D SIKLH HEAR   A  
Sbjct  130   KSVHYCSITPSSVGYLMRGENPS-----SEAEMMEPPPGFPVDSSIKLHKHEARLIVALH  184

Query  1026  VM------KFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla-gp  868
              M         G ++F  R+  A  + D +A+ T REIEG + +++E +F+KPV+LA   
Sbjct  185   SMGKNSSNSGSGSVSFTQRLLLAFQDGDAIAFKTTREIEGPYYEFVEHKFKKPVVLAGPV  244

Query  867   alpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQEL-LWGLELTGMPFFAA  691
                    S  E+ WS WL KF+E +VI CAFGSEC L+KD+FQEL  W L L  + FFAA
Sbjct  245   LPEPIESSNTEENWSKWLEKFQEKTVILCAFGSECNLKKDQFQELGFWDLNLLVIRFFAA  304

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP EAE+IE A+PE  KE+ QG+GIVH  W +QQL L HPSVGCFV+HCG  SLSE +
Sbjct  305   LKPPIEAETIEEALPEGFKERTQGKGIVHSGWAEQQLMLSHPSVGCFVTHCGGNSLSEVM  364

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             +N+CQ+VL+P  GDQ IN+R+    LK GVEVE+ EE+G F+++ VCKA+K VM+++SE 
Sbjct  365   INECQLVLVPNFGDQFINSRLFGGDLKAGVEVERNEENGSFTKDGVCKAIKMVMNDESEE  424

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             G ++R N  K R FLL+  L+  Y+D+   KLQ
Sbjct  425   GCKIRANRAKWREFLLSKGLEDSYIDALVHKLQ  457



>ref|XP_010520927.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
[Tarenaya hassleriana]
Length=468

 Score =   391 bits (1004),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 211/462 (46%), Positives = 301/462 (65%), Gaps = 13/462 (3%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  1414
             G++ ++  + MYPW  +GH+T F  L+NKLA KGHRI FL+PK  ++ LE  NLHP+LI+
Sbjct  5     GTEGSSMSIVMYPWLALGHMTAFLHLSNKLAEKGHRIVFLLPKKARAHLEPINLHPNLIT  64

Query  1413  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             F  I +P + GLP GAET SDVP   THLL  AMD+T+ ++E +++ +K D+VFYDF  W
Sbjct  65    FRTISIPHVHGLPLGAETNSDVPIFLTHLLAVAMDRTRPEVETVVRTVKPDLVFYDFADW  124

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSP---ERRVVGKQLTEADMMKAPASFPDPSIKL  1063
             +P ++  +G K+V + T S       L P        G  L+  ++ + P  +P   + L
Sbjct  125   VPGISAPVGAKTVCFDTASAASIALTLVPAAAREMADGAMLSGDELSRPPPGYPSSKVVL  184

Query  1062  HAHEAR--GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQK  889
              AHEAR  GF  +   +F G ++FF++  + +   D +A  TCREIEG+FC++I +Q+ +
Sbjct  185   RAHEARTLGFLWK---RFEGLVSFFEKKVSTLRNCDAIAIRTCREIEGKFCEFISSQYNR  241

Query  888   pvllagpa---lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQELLWGL  721
             PV L GP         ++ +E +W+DWL KF+ GSV+YCAFGS+  L K ++FQE+  GL
Sbjct  242   PVYLTGPVLPDTKPSDQAALEPRWADWLSKFEPGSVVYCAFGSQPVLDKLEQFQEVCLGL  301

Query  720   ELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSH  541
             ELTG+PF  ALKPP    ++E A+PE  +E+++GRG+V+G WVQQ L L HPSVGCFVSH
Sbjct  302   ELTGLPFLIALKPPSGFSTVEEALPEGFEERVKGRGVVYGGWVQQPLILDHPSVGCFVSH  361

Query  540   CGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAV  361
             CG+ S+ E+L+ DCQIVL+P +G+QI+NA++MS  +       K EE+G FSR S+  AV
Sbjct  362   CGFGSMWESLLRDCQIVLVPHLGEQILNAKLMSEEM-EVAVEVKREENGWFSRHSLKDAV  420

Query  360   KAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             K+VMD+ SEIG  VR NH K +  L  +     Y+  F Q L
Sbjct  421   KSVMDKDSEIGEIVRKNHKKWKDVLGESGFSESYISKFEQSL  462



>ref|XP_010474328.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
[Camelina sativa]
Length=454

 Score =   388 bits (996),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 213/451 (47%), Positives = 296/451 (66%), Gaps = 12/451 (3%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+P+LI+F  I +P + 
Sbjct  1     MYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLYPNLITFHTISIPQVK  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLPPGAET SDVP+  T+LL  AM++T+ ++E I   +K D+VF+D   W+P +A+ +G 
Sbjct  61    GLPPGAETNSDVPYFLTYLLRVAMNQTRPEVETIFHTIKPDLVFFDTADWIPEVAKSVGA  120

Query  1203  KSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARG--F  1039
             K+V ++ +S      +L P  ER V+ GK+L+  ++ K P  +P   + L AHEA+   F
Sbjct  121   KTVCFNIVSAAAIALSLVPAAEREVIDGKELSGEELAKTPLGYPSSKVVLRAHEAKALNF  180

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla--gpa  865
               R   K  G   FFD   T +   D +A  TCRE EG+FCDYI +Q+ KPV L      
Sbjct  181   MWR---KREGTACFFDVKVTTMRNCDAIAIRTCRETEGKFCDYISSQYSKPVYLTGPVLP  237

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQELLWGLELTGMPFFAAL  688
                P++ ++E +W++WL KFK GSV++CAFGS+  + K D+FQEL  GLE TG+PF  A+
Sbjct  238   GSKPNQPSLESRWAEWLAKFKPGSVVFCAFGSQPVVDKVDQFQELCLGLESTGLPFLVAI  297

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP    ++E A+PE  +E++QGRGIV G W+QQ L L HPSVGCFVSHCG+  + E+L+
Sbjct  298   KPPSGVSTVEEALPEGFEERVQGRGIVFGGWIQQPLVLDHPSVGCFVSHCGFGLMWESLM  357

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             +DCQIVL+PQ G+QI+NAR+M+          + EE+G FSR S+  AVK+VM+E SE+G
Sbjct  358   SDCQIVLVPQHGEQILNARLMTEE-MEMAVEVEREENGWFSRGSLENAVKSVMEEGSEVG  416

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
              +VR NHDK R  L  +     Y+D F Q L
Sbjct  417   EKVRKNHDKWRCVLAESGFADGYIDKFEQSL  447



>emb|CAN63557.1| hypothetical protein VITISV_034121 [Vitis vinifera]
Length=447

 Score =   387 bits (995),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 211/453 (47%), Positives = 292/453 (64%), Gaps = 17/453 (4%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             ++  +H+AM+PWF  GH+T F  L+NKLA +GH+I+F++PK  QS+L++ N HP LISF 
Sbjct  5     KSPKFHVAMFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQTLNFHPTLISFH  64

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
             P+ +P + GLPPGAET SD+P   THLL  AMD+  + +E  L+    D +FYD +H  P
Sbjct  65    PLSIPHVDGLPPGAETASDIPIFLTHLLATAMDRATDQLEAALRASNPDFLFYDCSHLAP  124

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHE  1051
              LA ++GIK++ Y+ +       AL P R V   + +TEA++   P+ +P  +     HE
Sbjct  125   VLASRLGIKAICYNVVCAASIAIALVPARGVSKDRPVTEAELAVPPSGYPSSTAVFRRHE  184

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
              R     +   FG  I+F++R  TA+ ESD ++  TCREIEG  CDYI TQ+ KP+ L G
Sbjct  185   GRALQFISA-PFGDGISFYERTTTAMKESDAISIRTCREIEGNLCDYIGTQYGKPIFLTG  243

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P LP PS + +E +W+ WL ++               L KD+FQEL+ GLELTG+PF  A
Sbjct  244   PVLPEPSPTPLEDRWAQWLSQY--------------ILEKDQFQELVLGLELTGLPFLVA  289

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP  A +IE A+PE  KE++ GR  VHG WVQQ   L HPSVGCFVSHCG+ S+ E+L
Sbjct  290   LKPPTGAATIEEALPEGFKERVGGRAAVHGGWVQQPSILSHPSVGCFVSHCGFGSMWESL  349

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             +NDCQIVL+P +GDQI+N R+++  L       + EE+G FS+ES+CKA+K+VMDE+SE+
Sbjct  350   MNDCQIVLVPHLGDQILNTRVLAGEL-QVAVEVEREENGWFSKESLCKAIKSVMDEESEV  408

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             G  VR NH K +         S Y+D F  +LQ
Sbjct  409   GGLVRKNHAKWKETFARPGFMSNYVDKFVGQLQ  441



>ref|XP_009339314.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Pyrus x bretschneideri]
Length=464

 Score =   387 bits (995),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 210/456 (46%), Positives = 295/456 (65%), Gaps = 6/456 (1%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             ++++H+AM+PW  +GH+T +  L+N+LA +GHR++ L+PK    +LE  N HP+LI+F P
Sbjct  8     SSSFHLAMFPWLAMGHITPYVHLSNELAARGHRVTLLVPKKAILQLEHLNHHPNLITFSP  67

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             + VP   GLP G E  S++P  + H L  AMD T++ IE  L   K D V YD  HW+P 
Sbjct  68    VTVPHFDGLPEGTEIASEIPIHNIHFLAAAMDLTRDQIEHFLSANKPDFVLYDAAHWVPE  127

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEA  1048
             +ARK GIKSV Y+ +       AL P R+V   + +T  ++   PA +P  ++ L  HEA
Sbjct  128   IARKNGIKSVCYNVVCAAALAIALVPARQVPKARPITAKELGVPPAGYPSTTVVLQGHEA  187

Query  1047  RGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
             R  T  T   FG  I F+DR    + E D L+  TCRE+EG  CDY+E Q+++PVLL GP
Sbjct  188   RSLTFIT-EPFGDGIRFYDRTIICMKECDALSIRTCRELEGDMCDYMEDQYKRPVLLTGP  246

Query  867   alpvPSKSTMEQ---KWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
              L + S +  EQ   +W+ W   F+ GS+++CAFGS+  L K +FQEL+ G ELTG+PFF
Sbjct  247   VLGLGSDNNTEQLEDRWAKWFAGFEAGSMVFCAFGSQWVLEKSQFQELVLGFELTGLPFF  306

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              ALKPP   E+IE A+PE  +E+++GRG+V G WVQQ L L HP+VGCFV+HCG+ S+ E
Sbjct  307   VALKPPLGCETIEEALPEGFEERVKGRGVVVGSWVQQTLILNHPAVGCFVNHCGFGSMWE  366

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             +L++D QIVL+P +GDQI+N +++ V           EE G FS+ES+ KAVK+VMDE+S
Sbjct  367   SLMSDKQIVLVPHLGDQILNTKLL-VKKLEVAVEVGREESGWFSKESLSKAVKSVMDEES  425

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             E+G  V+ NH K    L      S Y+D F QKL++
Sbjct  426   EVGVMVKKNHAKWMEALTTPGFMSGYIDRFVQKLKE  461



>ref|XP_010098447.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB75038.1| UDP-glycosyltransferase [Morus notabilis]
Length=459

 Score =   387 bits (994),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 216/453 (48%), Positives = 295/453 (65%), Gaps = 3/453 (1%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
               + +AM+PWF  GH+  F  +AN+LA +GHRIS L+PK  Q  L+  NLHP+LI+F  I
Sbjct  2     ANFDVAMFPWFATGHIAPFIHVANELAVRGHRISILLPKKAQILLQHLNLHPNLITFHTI  61

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLPPG ET SD+    THLL  AMD T+  +   L   K  +VFYDF HW+P +
Sbjct  62    TVPHVDGLPPGVETASDIHLSKTHLLAAAMDLTRPQVHDFLSAAKPQIVFYDFAHWVPDI  121

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
                IG  SV YS +S      AL P R V   + +T  D+   P  +P  ++ L   E R
Sbjct  122   TAHIGAISVCYSVVSASSLAIALVPARNVPCDRTVTVEDIKDPPPGYPSSTVVLRGPEVR  181

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                  + + FG  ITF++R  TA+  +D L+  TCRE+EG+ CDYI +Q++KP+LL GP 
Sbjct  182   SLLFIS-LPFGDGITFYERTTTAMRNADVLSIRTCREVEGELCDYIASQYKKPLLLTGPV  240

Query  864   lpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
             L  P+ +T +E +W++WL +FK GSV++CAFGS+  L+KD+FQELL G E T  PF  AL
Sbjct  241   LSEPTDTTPLEVRWTEWLNRFKPGSVVFCAFGSQHILKKDQFQELLLGFESTDFPFLIAL  300

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP   E++E A P    E+++GRGIV+G WVQQ L L HPSVGCFV+HCG+ S+ EAL+
Sbjct  301   KPPVGCETVEEAFPVGFAERVKGRGIVYGGWVQQPLILNHPSVGCFVNHCGFGSMWEALL  360

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             +  QIVL+P +GDQI+N ++++  +KV VEVEK  E G FS+ES+ KA+K+V+DE SE+G
Sbjct  361   SKNQIVLVPHLGDQILNTKLLAKEIKVAVEVEKELESGWFSKESLRKAIKSVVDEDSEVG  420

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
               VR NH K R  L      S Y+D F + L++
Sbjct  421   IMVRKNHAKWRDLLGKPGFISGYIDEFVKNLEE  453



>gb|KDP36254.1| hypothetical protein JCGZ_09819 [Jatropha curcas]
Length=442

 Score =   385 bits (989),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/436 (45%), Positives = 297/436 (68%), Gaps = 3/436 (1%)
 Frame = -3

Query  1599  SMGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHL  1420
             S   + + +H+ M+PWF VGH+T F  L+N+LA KG   +FL+P     +L+ FNL+P L
Sbjct  2     SNPKKNSIFHIVMFPWFAVGHMTPFLHLSNRLAEKGLSTTFLLPNKAIQQLKHFNLYPDL  61

Query  1419  ISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
             I+F  +++P + GLP G ET SD+P   TH L  AMD+T++ +E ++ + K  +V YD  
Sbjct  62    IAFHSLIIPPVDGLPAGTETASDIPIHLTHFLTIAMDRTRDQVEKVIHEKKPKLVIYDVA  121

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAPASFPDPSIKL  1063
             HW+P + + +GIK++ Y+ +S       L+P R+V + K +TEA++   P+ +P  ++ L
Sbjct  122   HWIPEITKSVGIKAINYTVVSAASLAIVLNPARKVTLEKPITEAELAVPPSGYPSSTVVL  181

Query  1062  HAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpv  883
               HE R     +   FG  ITF++RI  A+ ESD LA  TC E EG+FCDYI +Q++KPV
Sbjct  182   RRHEVRSLLFVS-YPFGEGITFYERITNAMKESDALAIRTCHETEGKFCDYIGSQYKKPV  240

Query  882   llagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMP  703
              L GP +P P K+ +E++W+ WL  F++ SVI+CAFGS+  L K++FQEL+ G EL G+P
Sbjct  241   FLTGPVIPEPGKAPLEERWNKWLNGFEKDSVIFCAFGSQIVLEKEQFQELVLGFELAGLP  300

Query  702   FFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASL  523
             F  A+KPP    ++E A+PE  +++++GRGI+ GEWVQQ   L HPSVGCFV+HCG+ S+
Sbjct  301   FLVAIKPPAGISTVEEALPEGFEKRVKGRGIICGEWVQQLKILDHPSVGCFVNHCGFGSM  360

Query  522   SEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDE  343
              EAL+++CQ+VL+P +GDQI+N R M+  L       + +E+G FS+E++ +A+K+VMD+
Sbjct  361   WEALMSNCQVVLVPHLGDQILNTRFMAEEL-KVAVEVERDENGWFSKENLSQAIKSVMDK  419

Query  342   KSEIGREVRGNHDKLR  295
             +SE+G  V+ NH+K R
Sbjct  420   ESEVGLMVKKNHNKWR  435



>ref|XP_010482811.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Camelina sativa]
Length=468

 Score =   386 bits (991),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 214/466 (46%), Positives = 303/466 (65%), Gaps = 9/466 (2%)
 Frame = -3

Query  1605  IGSMGSQ-ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLH  1429
             +G+ GS  +++  + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL+
Sbjct  1     MGAFGSNGSSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLY  60

Query  1428  PHLISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFY  1249
             P+LI+F  I +P + GLPPGAET SDVP+  T+LL  AM++T+ ++E I   +K D+VF+
Sbjct  61    PNLITFHTISIPQVKGLPPGAETNSDVPYFLTYLLRVAMNQTRPEVETIFHTIKPDLVFF  120

Query  1248  DFTHWLPSLARKIGIKSVFYSTISPLMHGYALSP--ERRVV-GKQLTEADMMKAPASFPD  1078
             D   W+P +A+ +G K+V ++ +S      +L P  ER+V+ G +++  ++ K P  +P 
Sbjct  121   DTADWIPEVAKPVGAKTVCFNIVSAAAIALSLVPAAERKVIDGNEMSGEELAKTPLGYPS  180

Query  1077  PSIKLHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQ  898
               + L AHEA+        K  G   FFD   T +   D +A  TCRE EG+FCDYI +Q
Sbjct  181   SKVVLRAHEAKTLNFMW-KKREGTACFFDVKVTTMRNCDAIAIRTCRETEGKFCDYISSQ  239

Query  897   FQKpvllagpalpvPSKS--TMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQELLW  727
             + KPV L GP LP    +   +E +W +WL KF  GSV++CAFGS+  + K D+FQEL  
Sbjct  240   YNKPVYLTGPVLPGTKPNHHLLESRWVEWLAKFNPGSVVFCAFGSQPVVDKIDQFQELFL  299

Query  726   GLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFV  547
             GLE TG+PF  A+KPP    ++E A+PE  +E++QGRGIV G W+QQ L L HPSVGCFV
Sbjct  300   GLESTGLPFLIAIKPPTGVSTVEEALPEGFEERVQGRGIVFGGWIQQPLVLDHPSVGCFV  359

Query  546   SHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCK  367
             SHCG+  + E+L++DCQIVL+PQ G+QI+NAR+M+          + EE+G FSR S+  
Sbjct  360   SHCGFGPMWESLMSDCQIVLVPQHGEQILNARLMTEE-MEVAVEVEREENGWFSRRSLEN  418

Query  366   AVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             AVK+VM+E SE+G +VR NHDK +  L  +     Y+D F Q L D
Sbjct  419   AVKSVMEEGSEVGEKVRKNHDKWKCVLAESGFADGYIDKFEQSLID  464



>ref|XP_008355387.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Malus domestica]
Length=460

 Score =   385 bits (989),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 208/458 (45%), Positives = 295/458 (64%), Gaps = 6/458 (1%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             ++ +++H+AM+PW  +GH+T +  L+N+LA +GHR++ L+PK    +LE  N HP+LI+F
Sbjct  2     AEPSSFHLAMFPWLAMGHITPYVHLSNELAARGHRVTLLVPKKAILQLEHLNHHPNLITF  61

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P+ VP   GLP G E  S++P  + H L  AMD T++ IE  L   K D V YD  HW+
Sbjct  62    SPVTVPHFNGLPEGTEIASEIPIHNIHFLAAAMDLTRDQIEHFLSANKPDFVLYDAAHWV  121

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAH  1054
             P +ARK GIKSV Y+ +       AL P R+V   + +T  ++   PA +P  ++ L  H
Sbjct  122   PEIARKNGIKSVCYNVVCAAALAIALVPARQVPKDRPITAKELGVPPAGYPSTTVVLQGH  181

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             EAR  T  T   FG  I F+DR    + E D L+  TCRE+EG  CDY+E Q+++PVLL 
Sbjct  182   EARSLTFIT-EPFGDGIRFYDRTIICMKECDALSIRTCRELEGDMCDYMEDQYKRPVLLT  240

Query  873   gpalpvPSKSTMEQ---KWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMP  703
             GP L + S +  EQ   +W+ W   F+ GSV++CAFGS+  L K +FQEL+ G ELTG+P
Sbjct  241   GPVLGLGSDNNTEQLEDRWAKWFAGFEAGSVVFCAFGSQWVLEKSQFQELVLGFELTGLP  300

Query  702   FFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASL  523
             FF ALKPP   E+IE A+PE  +E+++GRG+V G WVQQ L L HP+VGCFV+HCG+ S+
Sbjct  301   FFVALKPPLGCETIEEALPEGFEERVKGRGVVVGSWVQQTLILNHPAVGCFVNHCGFGSM  360

Query  522   SEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDE  343
              E+L++D QIVL+P +GDQI+N +++ V           EE G FS+ES+ KA+ +VMD+
Sbjct  361   WESLMSDKQIVLVPHLGDQILNTKLL-VKKLEVAVEVGREESGWFSKESLSKAIXSVMDK  419

Query  342   KSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +SE+G  V+ NH K    L      S Y+D F QKL++
Sbjct  420   ESEVGVMVKKNHAKWMETLXTPGFMSGYIDRFVQKLKE  457



>dbj|BAF75891.1| glucosyltransferase [Dianthus caryophyllus]
Length=461

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 218/459 (47%), Positives = 300/459 (65%), Gaps = 9/459 (2%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             +  T  H+AMYPW  +GH+T F R+ NKLA +GHRISF +P  TQ +  S N +P LI+F
Sbjct  4     NNGTPLHIAMYPWLAMGHITSFLRIGNKLAERGHRISFFLPPKTQLRFTSQNHYPELITF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
             + I +P + G P  AETT+D+   +  LLM AMD T++ IE  L DL+ + VF+DFT W+
Sbjct  64    ISITLPPVDGFPAEAETTNDISAHARPLLMTAMDLTKDTIEAHLVDLRPNFVFFDFTCWM  123

Query  1230  PSLARKIGIKSVFYST-----ISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIK  1066
             P LA K GIK ++Y +      + ++H   ++P+    G+ + EA +M      P P + 
Sbjct  124   PELAHKHGIKPIYYMSALLVRAAYILHLSVITPK----GQPIKEAHLMSPLPLLPSPHMT  179

Query  1065  LHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKp  886
               AHEAR       + FGG +T  DR+  +  E D +   TCRE+E  + +++E ++ KP
Sbjct  180   HRAHEARSLIEAFHLDFGGGLTLLDRVGKSSRECDAIGIKTCREMEEIYYEFVEKKYGKP  239

Query  885   vllagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
             VL AGP LP P  + ++++++ WL  F    VIYCAFGSECT+    FQEL+ GLELTG 
Sbjct  240   VLTAGPVLPDPISTKLDERFNKWLASFGFDQVIYCAFGSECTINLVAFQELVLGLELTGS  299

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PF AALK P   + IE+A+PE   E+ + RGIV+G WVQQQL L+HPSVGCFV+HCG  S
Sbjct  300   PFLAALKAPTGHDIIESALPEGFLERTKDRGIVYGGWVQQQLILRHPSVGCFVTHCGAGS  359

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             LSEA+VN CQ+V++P   DQ INA++MS+ L+VGVEVE+ +EDG FSRE V KAV++VMD
Sbjct  360   LSEAMVNKCQLVMIPHAVDQFINAKMMSLELRVGVEVERRDEDGFFSREDVRKAVESVMD  419

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             E S +G+EV  NH K R F+L   ++  Y+  F  KL D
Sbjct  420   ENSVLGKEVMANHAKWREFILKDGIEESYISGFIDKLYD  458



>ref|XP_003527222.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Glycine max]
Length=462

 Score =   380 bits (977),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 204/450 (45%), Positives = 293/450 (65%), Gaps = 4/450 (1%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF  GH+T F  L+N+LA +GH+I+FL+PK  + +L+  N HPHLI+F  + +P
Sbjct  10    HIAMFPWFATGHMTPFLHLSNELAKRGHKITFLLPKKAKLQLQHLNNHPHLITFHTLTIP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP G ET S++P    HLL+ AMDKT++ +E  L     D V YD  +W+P +A+K
Sbjct  70    HVKGLPHGTETASEIPISLNHLLVIAMDKTRDQVEHTLSATNPDFVLYDNAYWVPQIAKK  129

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +GIK++ Y+ +        L P R V   + +T  ++ + P  +P   + L   EA    
Sbjct  130   LGIKTICYNVVCAASLAIVLVPARNVPKDRPITVEELSQPPEGYPSSKVVLTGLEAESLM  189

Query  1035  ARTVMKFGGD-ITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
               +V  FG D ITF+DRI +A+ ESD +A  T REIEG FCDYI +QF K VLL GP LP
Sbjct  190   FISV-PFGEDNITFYDRITSALRESDAIAIRTSREIEGNFCDYIASQFGKKVLLTGPVLP  248

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
               ++  +E+ W++WL  F   S++YCAFGS+  L KD+FQELL G EL+G+PF  ALK P
Sbjct  249   EEAEGKLEENWANWLDAFANESIVYCAFGSQINLEKDQFQELLLGFELSGLPFLVALKTP  308

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
                ES+E A+PE  +E+++GRG+V   WVQQ L L+HPSVGCFV+HCG+ S+ E+L++D 
Sbjct  309   RGCESVEEALPEGFEERVKGRGVVSRGWVQQLLILKHPSVGCFVNHCGFGSMWESLMSDK  368

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVL+PQ+GDQ++N +++ V         +   +G  S+ES+ KA+K VMD  SE+G  V
Sbjct  369   QIVLVPQLGDQVLNTKLL-VEELGVAVEVERGGNGWVSKESLSKAIKLVMDGDSEVGARV  427

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             + NH + +    + +L + YMD F Q LQD
Sbjct  428   KKNHMEWKKTGGSPNLMNGYMDRFVQNLQD  457



>ref|XP_006281795.1| hypothetical protein CARUB_v10027966mg [Capsella rubella]
 gb|EOA14693.1| hypothetical protein CARUB_v10027966mg [Capsella rubella]
Length=447

 Score =   380 bits (975),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 212/456 (46%), Positives = 289/456 (63%), Gaps = 13/456 (3%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  M+PWFG GH+T F  LANKLA  GHRI+FL+PK    +LE  NL P  I
Sbjct  1     MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEGGHRITFLLPKKALKQLEPLNLFPDFI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + +PS+ GLP GAETTSD+P  S   L  AMD+T+N +E  +   K D++F+DF H
Sbjct  58    IFQTLTIPSVDGLPAGAETTSDIPISSGSFLASAMDRTRNQVEEAVSIGKPDLIFFDFAH  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +AR+ G KSV Y TIS      +  P         +   M   P  +P   + L  
Sbjct  118   WIPEIAREYGAKSVNYITISAACVAISFVPGH-------SPDAMAVPPPGYPSSKVLLRG  170

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
              E   F A     FG   TF++RI   +   D ++  TC+E+EG+FCD+IE+QFQ+ VLL
Sbjct  171   QETNCF-AFLSYPFGDGTTFYERIMIGLKNCDIISIRTCQEMEGKFCDFIESQFQRKVLL  229

Query  876   agpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPF  700
              GP LP P  S  +E +W  WL +++ GSVIYCA GS+  L KD+FQEL  G+ELTG+PF
Sbjct  230   TGPMLPEPDNSKPLEDQWRKWLNQYEPGSVIYCALGSQIILEKDQFQELCLGMELTGLPF  289

Query  699   FAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLS  520
               A+KPP    +I+ A+P   +E+++GRG+V G WVQQ L L HPS+GCFVSHCG+ S+ 
Sbjct  290   LVAVKPPKGFSTIQEALPNGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMW  349

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             EALVNDCQIV +P +G+QI+N R+MS  L       K EE G FS+ES+  ++K+VMD+ 
Sbjct  350   EALVNDCQIVFIPHLGEQILNTRLMSEEL-EVSVEVKREETGWFSKESLSDSIKSVMDKD  408

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             SE+G  VR NH K +  L++  L ++ ++ F + LQ
Sbjct  409   SELGNLVRRNHAKWKESLVSTGLMNRDVNKFIEALQ  444



>ref|XP_002866013.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42272.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   380 bits (975),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 208/455 (46%), Positives = 293/455 (64%), Gaps = 12/455 (3%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL PH I
Sbjct  1     MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPHCI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + +PS+ GLP GAETTSD+P      L  AMD+T+N +E  +   + D++F+DF H
Sbjct  58    VFHTLTIPSVDGLPAGAETTSDIPISLGSFLASAMDRTRNQVEEAVSIRQPDMIFFDFAH  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +AR+ G KSV + TIS      +  P         ++ D+   P  +P   + L  
Sbjct  118   WIPEIAREYGAKSVNFITISAACVAISFVP-------GCSQDDLGIPPPGYPSSKVLLRG  170

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
              E    +  +   FG   TF++RI   +   D ++  TC+EIEG+FCD+IE QFQ+ VLL
Sbjct  171   QETNSLSFLS-YPFGDGTTFYERIMIGLKNCDVISIRTCQEIEGKFCDFIERQFQREVLL  229

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
              GP LP P    +E +W  WL +F+  SVIYCA GS+  L KD+FQEL  G+ELTG+PF 
Sbjct  230   TGPMLPDPDSKPLEDQWRLWLSQFEPESVIYCALGSQIILEKDQFQELCLGMELTGLPFL  289

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              A+KPP  A++I+ A+P+  +E+++GRG+V G WV+Q L L HPS+GCFVSHCG+ S+ E
Sbjct  290   VAVKPPKGAKTIQEALPKGFEERVKGRGVVWGGWVKQPLILAHPSIGCFVSHCGFGSMWE  349

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             A+VNDCQIV +P +G+QI+N R+MS  L       K E+ G FS+ES+  AV++VMD+ S
Sbjct  350   AIVNDCQIVFIPHLGEQILNTRLMSEEL-EVSVEVKREKAGWFSKESLSGAVRSVMDKDS  408

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             E+G  VR NH K +  L++  L + Y++ F ++LQ
Sbjct  409   ELGNLVRRNHAKWKESLVSTGLMNGYVNKFIEELQ  443



>ref|NP_200212.1| UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 sp|Q9FN26.1|U79B6_ARATH RecName: Full=UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 dbj|BAB10731.1| flavonol 3-O-glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAV84494.1| At5g54010 [Arabidopsis thaliana]
 gb|AAW30019.1| At5g54010 [Arabidopsis thaliana]
 gb|AED96438.1| UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 gb|AHL38580.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=453

 Score =   379 bits (974),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 210/456 (46%), Positives = 290/456 (64%), Gaps = 13/456 (3%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  M+PWFG GH+T F  LANKLA K H+I+FL+PK  + +LES NL P  I
Sbjct  1     MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKDHKITFLLPKKARKQLESLNLFPDCI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + +PS+ GLP GAETTSD+P      L  AMD+T+  ++  +   K D++F+DF H
Sbjct  58    VFQTLTIPSVDGLPDGAETTSDIPISLGSFLASAMDRTRIQVKEAVSVGKPDLIFFDFAH  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +AR+ G+KSV + TIS      +  P R       ++ D+   P  +P   + L  
Sbjct  118   WIPEIAREYGVKSVNFITISAACVAISFVPGR-------SQDDLGSTPPGYPSSKVLLRG  170

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HE    +  +   FG   +F++RI   +   D ++  TC+E+EG+FCD+IE QFQ+ VLL
Sbjct  171   HETNSLSFLS-YPFGDGTSFYERIMIGLKNCDVISIRTCQEMEGKFCDFIENQFQRKVLL  229

Query  876   agpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPF  700
              GP LP P  S  +E +W  WL KF  GSVIYCA GS+  L KD+FQEL  G+ELTG+PF
Sbjct  230   TGPMLPEPDNSKPLEDQWRQWLSKFDPGSVIYCALGSQIILEKDQFQELCLGMELTGLPF  289

Query  699   FAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLS  520
               A+KPP  + +I+ A+P+  +E+++ RG+V G WVQQ L L HPS+GCFVSHCG+ S+ 
Sbjct  290   LVAVKPPKGSSTIQEALPKGFEERVKARGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMW  349

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             EALVNDCQIV +P +G+QI+N R+MS  L       K EE G FS+ES+  AV++VMD  
Sbjct  350   EALVNDCQIVFIPHLGEQILNTRLMSEEL-KVSVEVKREETGWFSKESLSGAVRSVMDRD  408

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             SE+G   R NH K +  LL   L S Y++ F + L+
Sbjct  409   SELGNWARRNHVKWKESLLRHGLMSGYLNKFVEALE  444



>gb|KFK27016.1| hypothetical protein AALP_AA8G323600 [Arabis alpina]
Length=447

 Score =   379 bits (973),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 202/452 (45%), Positives = 289/452 (64%), Gaps = 10/452 (2%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P+ I F  +
Sbjct  3     SQFHAFMFPWFGFGHMTAFLHLANKLAEKGHKINFLLPKKALKQLEPLNLFPNSIVFHIL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +P + GLP GAETT+D+P      L  AMD+T+N ++ ++ + K D++F+DF HW+P +
Sbjct  63    TIPPVDGLPAGAETTADIPISLGSFLASAMDRTRNQVKEMVSNDKPDLIFFDFAHWIPEI  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A++ G K+V Y TIS      +  P R       +  D+   P  +P   + L   E + 
Sbjct  123   AKEYGAKTVNYVTISAACVAISFVPGR-------SPDDLAVPPPGYPSSKVLLRGQETKS  175

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
              +  +   FG   TF++RI T ++  D ++  TC+E+EG+FCD+IE Q Q+ VLL GP L
Sbjct  176   LSFLS-YPFGDGTTFYERIITGLTNCDVISIRTCQEMEGKFCDFIERQCQRKVLLTGPML  234

Query  861   pvPSKSTM-EQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
                  S + E++WS WL +FK GSVIYCA GS+  L K++FQEL  G+ELTG+PF  A+K
Sbjct  235   SEQDNSKLLEEQWSQWLSRFKPGSVIYCALGSQIILEKNQFQELCLGMELTGLPFLVAVK  294

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP    +I+ A+PE  +E+++GRG+V G WVQQ L L HPS+GCFVSHCG+ S+ EALVN
Sbjct  295   PPKGVSTIQVALPEGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWEALVN  354

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQIV +P + +Q+ N R+MS  L       K EE G FS+E +  A+++VMDE SE+G 
Sbjct  355   DCQIVFIPHLAEQVFNTRLMSDEL-EVSVEVKREEIGWFSKERLSGAIRSVMDEDSELGN  413

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              VR NH K +  L+   L + Y++ F + LQ+
Sbjct  414   LVRRNHAKWKESLVKTGLMNDYVNKFIEALQE  445



>ref|XP_010442979.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Camelina sativa]
Length=447

 Score =   379 bits (972),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 207/450 (46%), Positives = 287/450 (64%), Gaps = 16/450 (4%)
 Frame = -3

Query  1569  MAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPS  1390
             + MYPW   GH+T F  L+NKLA KGH+I FL+PK   ++LE  NL P+LI+F  I +P 
Sbjct  3     IVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLFPNLITFHTIAIPQ  62

Query  1389  IPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI  1210
             + GLPPGAET SDVP+  T+LL  AM++T+ ++E I   +K D+VF+D  HW+P +A+ +
Sbjct  63    VKGLPPGAETNSDVPYLLTYLLRVAMNQTRPEVETIFHKIKPDLVFFDTAHWIPEVAKPV  122

Query  1209  GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR--GFT  1036
             G K+V ++ +S      +L P            ++ K P  +P   + L AHEA+   F 
Sbjct  123   GAKTVCFNIVSAAAIALSLVPAAE-------REELAKTPLGYPSSKVVLRAHEAKTLNFM  175

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla--gpal  862
              R   K  G   FFD   T +   D +A  TCRE EG+FCDYI +Q+ KPV L       
Sbjct  176   WR---KREGTACFFDVKVTTMRNCDAIAIRTCRETEGKFCDYISSQYNKPVYLTGPVLPG  232

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRK-DKFQELLWGLELTGMPFFAALK  685
               P++ ++E +W++WL KF   SV++CAFGS+  + K D+FQEL  GLE TG+PF  A+K
Sbjct  233   SKPNQPSLESRWAEWLTKFNPSSVVFCAFGSQPVVDKIDQFQELCLGLESTGLPFLIAIK  292

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP    ++E A+PE  +E++QGRGIV G W+QQ L L HPSVGCFVSHCG+ S+ E+L++
Sbjct  293   PPTGVSTVEEALPEGFEERVQGRGIVFGGWIQQPLVLDHPSVGCFVSHCGFGSMWESLMS  352

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQIVL+PQ G+QI+NAR+M+          + EE+G FSR S+  AVK+VM+E SE+G 
Sbjct  353   DCQIVLVPQHGEQILNARLMTEE-MEVAVEVEREENGWFSRRSLENAVKSVMEEGSEVGE  411

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             +VR NHDK R  L  +     Y+D F Q L
Sbjct  412   KVRKNHDKWRCVLAESGFADGYIDKFEQSL  441



>gb|KDO58530.1| hypothetical protein CISIN_1g012080mg [Citrus sinensis]
Length=471

 Score =   379 bits (972),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 210/450 (47%), Positives = 302/450 (67%), Gaps = 3/450 (1%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
              + + M PWF VGH+T F  L+NKLA KGH+I+ L+P+  Q++L+ FNLHP LI+  P+ 
Sbjct  14    AFPIVMLPWFAVGHMTPFLHLSNKLAEKGHKITILLPRKAQTQLQHFNLHPDLITLHPLT  73

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GLP GAET SDVP  S +LL+ AMD+ +  +E ++K  K  ++FYD  +W+ +++
Sbjct  74    VPHVDGLPAGAETASDVPMSSINLLVIAMDRCRGQVEAVIKAAKPRLLFYDIAYWMATIS  133

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             + + IK + Y+ +       AL P R V   + +TEA++   PA +P  +I L  HEAR 
Sbjct  134   KSLSIKCIKYNVVCAASIATALVPARNVPKDRPVTEAELAMPPAGYPSDTIVLRRHEARE  193

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
              T  +   FG  ++F++RI T++ ESD ++  TC EIEG  C+YI  Q+ KPV L GP L
Sbjct  194   LTFIS-FPFGEGMSFYERITTSLKESDAISIRTCHEIEGDLCEYIARQYNKPVFLTGPVL  252

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
               P+K+  E++W  WLG F+  SV+YCAFGS+  L K +FQELL GLELTG+ F  ALKP
Sbjct  253   HEPAKTPSEERWDKWLGGFERSSVVYCAFGSQIILEKKQFQELLLGLELTGLCFLIALKP  312

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  A ++E A P+   E+ +GRG+V GEWV+Q   L+H SVGCFVSHCG+ S+ E+L++D
Sbjct  313   PTGASTVEEAFPDGFAERTKGRGVVCGEWVEQMPILEHSSVGCFVSHCGFGSMWESLMSD  372

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQIVL+P +GDQI+N R+++  L       + EE+G FS+ES+CKA+K VMD++SE+G  
Sbjct  373   CQIVLVPHLGDQILNTRLLAEEL-KVAVEVEREENGWFSKESLCKAIKCVMDKESEVGNV  431

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             VR NH K +G L++    S Y+D F Q ++
Sbjct  432   VRRNHAKWKGTLVSPGFVSGYIDKFVQNMR  461



>ref|XP_010442976.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X1 [Camelina 
sativa]
Length=447

 Score =   378 bits (970),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 204/451 (45%), Positives = 290/451 (64%), Gaps = 10/451 (2%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +L+  N+ P  I F  +
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLKPLNIFPDCIVFHTL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +PS+ GLP GAETTSD+P  S   L  AMD+T+N +E  +   K D++F+DF HW+P +
Sbjct  63    TIPSVDGLPAGAETTSDIPISSGSFLASAMDQTRNQVEEAVSIGKPDLIFFDFAHWIPEI  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             AR+ G KSV + TIS      +  P R       +  D+   P  +P   + L   E   
Sbjct  123   ARECGAKSVNFITISAACVAISFVPGR-------SPDDLAVPPPGYPSSKVLLRRQETNC  175

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
             F+  +   FG + TF++RI   +   D ++  TCRE+EG+FCD+I++QFQ+ VLL GP L
Sbjct  176   FSFLS-HPFGDNTTFYERIMIGLKNCDVISIRTCREMEGKFCDFIQSQFQREVLLTGPML  234

Query  861   pvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             P P  S  +E +W  WL +F+ GSV+YCA GS+  L KD+FQEL  G+ELTG+PF  A+K
Sbjct  235   PEPYNSKPLEDQWRQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFLVAVK  294

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP  + +I+ A+P   +E+++GRG+V G WVQQ L L HPS+GCFVSHCG+ S+ EALVN
Sbjct  295   PPKGSSTIQEALPNGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWEALVN  354

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQ V +P +G+QI N R+MS  L       K E+ G FS+ES+  ++++VMD+ SE+G 
Sbjct  355   DCQTVFIPHLGEQIFNTRLMSEEL-EVSVEVKREDSGWFSKESLSGSIRSVMDKDSELGY  413

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              VR NH K +  L++  L + Y++ F + LQ
Sbjct  414   LVRRNHAKWKESLVSTGLMNGYVNKFIEALQ  444



>ref|XP_006451768.1| hypothetical protein CICLE_v10008184mg [Citrus clementina]
 ref|XP_006464820.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Citrus sinensis]
 gb|ESR65008.1| hypothetical protein CICLE_v10008184mg [Citrus clementina]
Length=471

 Score =   378 bits (971),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 210/450 (47%), Positives = 302/450 (67%), Gaps = 3/450 (1%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
              + + M PWF VGH+T F  L+NKLA KGH+I+ L+P+  Q++L+ FNLHP LI+  P+ 
Sbjct  14    AFPIVMLPWFAVGHMTPFLHLSNKLAEKGHKITILLPRKAQTQLQHFNLHPDLITLHPLT  73

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             VP + GLP GAET SDVP  S +LL+ AMD+ +  +E ++K  K  ++FYD  +W+ +++
Sbjct  74    VPYVDGLPAGAETASDVPMSSINLLVIAMDRCRGQVEAVIKAAKPRLLFYDIAYWMATIS  133

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             + + IK + Y+ +       AL P R V   + +TEA++   PA +P  +I L  HEAR 
Sbjct  134   KSLSIKCIKYNVVCAASIATALVPARNVPKDRPVTEAELAMPPAGYPSDTIVLRRHEARE  193

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
              T  +   FG  ++F++RI T++ ESD ++  TC EIEG  C+YI  Q+ KPV L GP L
Sbjct  194   LTFIS-FPFGEGMSFYERITTSLKESDAISIRTCHEIEGDLCEYIARQYNKPVFLTGPVL  252

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
               P+K+  E++W  WLG F+  SV+YCAFGS+  L K +FQELL GLELTG+ F  ALKP
Sbjct  253   HEPAKTPSEERWDKWLGGFERSSVVYCAFGSQIILEKKQFQELLLGLELTGLCFLIALKP  312

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  A ++E A P+   E+ +GRG+V GEWV+Q   L+H SVGCFVSHCG+ S+ E+L++D
Sbjct  313   PTGASTVEEAFPDGFAERTKGRGVVCGEWVEQMPILEHSSVGCFVSHCGFGSMWESLMSD  372

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQIVL+P +GDQI+N R+++  L       + EE+G FS+ES+CKA+K VMD++SE+G  
Sbjct  373   CQIVLVPHLGDQILNTRLLAEEL-KVAVEVEREENGWFSKESLCKAIKCVMDKESEVGNV  431

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             VR NH K +G L++    S Y+D F Q ++
Sbjct  432   VRRNHAKWKGTLVSPGFVSGYIDKFVQNMR  461



>ref|XP_006401633.1| hypothetical protein EUTSA_v10013535mg [Eutrema salsugineum]
 gb|ESQ43086.1| hypothetical protein EUTSA_v10013535mg [Eutrema salsugineum]
Length=447

 Score =   376 bits (965),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 209/456 (46%), Positives = 298/456 (65%), Gaps = 13/456 (3%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P+ I
Sbjct  1     MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPNRI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  I VPS+ GLP GAETTSD+P      L  AMD+T+N ++  +   K D++F+DF H
Sbjct  58    VFDTITVPSVEGLPAGAETTSDIPISLGSFLASAMDRTRNQVKERVSMSKPDLIFFDFAH  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +AR+ G KSV + TIS      + SP R       +  D+   P  +P   + L  
Sbjct  118   WIPEIAREYGAKSVNFVTISAACVAISFSPGR-------SPDDLAVPPPGYPSSKVLLRG  170

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
              E    +  +   FG   TF++RI T ++  D ++  TC+E+EG+FCD+IE+QFQ+ VLL
Sbjct  171   QETNSLSFLS-YPFGDGTTFYERIMTGLTHCDVISIRTCQEMEGKFCDFIESQFQRKVLL  229

Query  876   agpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPF  700
              GP LP P  S  ++++ S WL +F+  SV+YCA GS+  L KD+FQEL  G+ELTG+PF
Sbjct  230   TGPMLPDPDNSKPLDEQRSHWLRQFEPESVVYCALGSQIILEKDQFQELCLGMELTGLPF  289

Query  699   FAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLS  520
               A+KPP  A +I+ A+P+  +E+++GRG+V G WVQQ L L HPS+GCFVSHCG+ S+ 
Sbjct  290   LVAVKPPKGASTIQEALPKGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMW  349

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             E+LVNDCQIV +P +G+QI N R+MS  L       K EE G FS+ES+  A+++VMD+ 
Sbjct  350   ESLVNDCQIVFIPHLGEQIFNTRLMSEEL-EVSVEVKREETGWFSKESLSGAIRSVMDKD  408

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             SE+G  VR NH K +  ++++ L + Y+++F + L+
Sbjct  409   SELGNLVRRNHAKWKESIVSSGLMNGYVNNFIEALE  444



>ref|XP_008226432.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=489

 Score =   377 bits (968),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 209/469 (45%), Positives = 290/469 (62%), Gaps = 17/469 (4%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             + ++ +H+AM+PWF +GH   F  L+N+LA +GHRISFL+PK  Q  L+  NLHPHLI+F
Sbjct  20    TSSSNFHIAMFPWFAMGHSIPFLHLSNELAARGHRISFLLPKKAQIHLQHLNLHPHLIAF  79

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIIL-----KDLKVDVVFYD  1246
               + VP I GLP G ET SD+P   T LL  AMD+T+  I+  L      D KVD++FYD
Sbjct  80    CSVTVPHIEGLPEGTETASDIPISLTPLLAAAMDRTRQQIQGFLVSCGVNDRKVDMIFYD  139

Query  1245  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSI  1069
             F HW+P + R +GIK V Y      +   A+ P R V   + +TE D+   P  +P  ++
Sbjct  140   FAHWVPEITRGLGIKCVNYGVACAAITAMAIVPARNVPKDRPVTEEDLRDPPPGYPSSTV  199

Query  1068  -KLHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQ  892
               L  HE +     T M +G  ITF++R+ TA    D +   TCRE+EG FCDY+E Q++
Sbjct  200   VMLPGHEVQSLMFIT-MPYGDGITFYERLMTAKKGCDAICIRTCREVEGVFCDYLEAQYK  258

Query  891   KpvllagpalpvPSKSTMEQK--------WSDWLGKFKEGSVIYCAFGSECTLRKDKFQE  736
             KPVLL GP L     +   +K        W++W   F+  SV++C FGS+  L KD+FQE
Sbjct  259   KPVLLTGPVLGAMDSNNKNKKKSEQLEDIWANWFSGFETESVVFCGFGSQWVLEKDQFQE  318

Query  735   LLWGLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVG  556
             L+ G ELTG+PFF ALKPP    +IE A+P+  +E+++GRG+V G WVQQ L L HPSVG
Sbjct  319   LVLGFELTGLPFFVALKPPVGCATIEEALPQGFEERVKGRGVVFGGWVQQTLILSHPSVG  378

Query  555   CFVSHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRES  376
             CFVSHCG+ +L E+LV++ QIVL+P   D I+N +I+   L       + EE+G FS+ES
Sbjct  379   CFVSHCGFGALWESLVSNNQIVLVPHGADHILNTKILVKDL-KVAVEVEREENGWFSKES  437

Query  375   VCKAVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             + KA+  VM + +E+G  V+ NH K R  L        Y+D F QKL++
Sbjct  438   LSKAITTVMAKDNEVGVMVKKNHAKWRETLSTPGFMDGYIDRFVQKLKE  486



>gb|AFJ52975.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=468

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 216/459 (47%), Positives = 290/459 (63%), Gaps = 12/459 (3%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             T  H+AM+PWF  GH+T +  LAN LA +GHR+SFLIPK TQSK    N HPHLI+F PI
Sbjct  10    TKPHVAMFPWFAFGHITPYLHLANHLASRGHRVSFLIPKRTQSKFTKLNRHPHLITFHPI  69

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLPPGAET+ D PFP    L  A D+TQ  +  IL +L   +V YD  HW+PSL
Sbjct  70    TVPHVDGLPPGAETSYDAPFPLVMFLFTAFDRTQPQVREILTELNPSLVLYDLAHWIPSL  129

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSI--KLHAHEA  1048
               ++G K V Y T S +     + P  ++V K +T+A++M+ P  +P   +  +L   + 
Sbjct  130   GLELGFKKVAYVTASAVSSALRILPSVKMV-KGMTDAELMRPPPGYPSSVVVPRLDEVDQ  188

Query  1047  RGFTARTVMKFGGD-ITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
               F A     FGG  + F++R+  + S  D +A+ TCRE+EGQFCDY+  Q+ KP+LL G
Sbjct  189   ARFLAE---DFGGSAVPFYERLTASNSGGDAIAFRTCRELEGQFCDYLGQQYGKPILLTG  245

Query  870   palpvPSKSTM---EQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPF  700
             P LP   K+ M   ++K   WLG F  GSV+YCAFGSE  L KD+FQELL G EL G+PF
Sbjct  246   PILPDEDKTPMTAEDEKLFSWLGNFDGGSVVYCAFGSEIALGKDQFQELLNGFELCGLPF  305

Query  699   FAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLS  520
              AALKPP    ++E A PE  ++K++GRG V G WV QQ  L H SVGCFVSHCG+ S+ 
Sbjct  306   LAALKPPAGCSTVEEAFPEGFEDKVRGRGWVTGGWVPQQRILDHASVGCFVSHCGFGSMW  365

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVF--SRESVCKAVKAVMD  346
             E L++ CQ+V+ P +GDQI+   +M   LKV VEVEK +    +  ++E + +A++AVMD
Sbjct  366   EGLLSKCQLVMAPTLGDQIMGTMLMVNELKVAVEVEKIKSGDRWWIAKEKLSEAIRAVMD  425

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
                E+G EVR NH K R  L    +  KY+D F  ++ D
Sbjct  426   GDGEVGGEVRRNHLKFREVLGEKKVHDKYVDDFVVQIHD  464



>ref|XP_002316802.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE97414.1| glycosyltransferase family protein [Populus trichocarpa]
Length=463

 Score =   375 bits (964),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 198/455 (44%), Positives = 291/455 (64%), Gaps = 3/455 (1%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             S+ +++ + M+PWF VGHLT F  L+NKLA KG  ISFL+P      L+ FNL+P  I+F
Sbjct  6     SKRSSFRILMFPWFAVGHLTPFLHLSNKLAEKGCTISFLLPNKAIKLLQHFNLYPDHITF  65

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P+ VP + GLP G ET SD+P   TH L  AMD+T++ +E I++D K D V YD  +W+
Sbjct  66    HPVKVPHVEGLPLGTETASDIPIHLTHFLCVAMDRTRDQVEKIIRDQKPDFVMYDMAYWI  125

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAH  1054
             P +AR +GIK++ YS +S       L P R VV GK +T A++   P  +P  S+ L  H
Sbjct  126   PEVARPLGIKTIKYSVVSAAAIAIVLVPARNVVEGKAITAAELSVPPTGYPSTSVVLRGH  185

Query  1053  EARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             E R     +   +G   TF++R  T +   D +A  +C E+E + CDYI  Q+ KPV L 
Sbjct  186   EVRSLLFVS-QPYGEGTTFYERACTGMKGCDAIAIRSCYEMEEKLCDYIGRQYGKPVFLT  244

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP LP  +++ +E +W+ WL +F+ GSV++C+FGS+  L K++ QEL+ G E TG+PF  
Sbjct  245   GPVLPESARTPLEDRWAQWLNRFEAGSVVFCSFGSQLILEKEQLQELVLGFESTGLPFLV  304

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
              LKPP  + +IE A+PE  +E+++GRG+V G WVQQ   L HPS+GCFV+ CG+ S+ E+
Sbjct  305   VLKPPVGSSTIEEALPEGFEERVKGRGVVWGGWVQQLEILDHPSIGCFVNTCGFGSMWES  364

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             L++DCQIVL+P +GDQI+N R+M+  L       + +E G F++E++  A+K VMD+ SE
Sbjct  365   LMSDCQIVLVPHLGDQILNTRLMAEEL-KVAVEVERDEKGWFTKENLSNAIKCVMDKDSE  423

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +G  ++ NH + R  L +    S Y D F Q +Q+
Sbjct  424   VGSMIKKNHTEWRKLLRSEGFMSSYFDKFFQNMQE  458



>ref|XP_011008292.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Populus euphratica]
Length=463

 Score =   375 bits (962),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 291/454 (64%), Gaps = 3/454 (1%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             + + + + M+PWF VGHLT F  L+NKLA KG  ISFL+P      L+ FNL+P  I+F 
Sbjct  7     KRSNFRILMFPWFAVGHLTPFLHLSNKLAEKGCTISFLLPNKAIKLLQHFNLYPDHITFH  66

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
             P+ VP + GLP G ET SD+P   TH L  AMD+T++ +E I++D K D V YD  +W+P
Sbjct  67    PVQVPHVEGLPLGTETASDIPIYLTHFLCVAMDRTRDQVEKIIRDQKPDFVMYDMAYWIP  126

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHE  1051
              +AR +GIK++ YS +S       L P R VV GK +T A++   P  +P  S+ L  HE
Sbjct  127   EVARPLGIKTIKYSVVSAAAIAIVLVPARNVVEGKPITAAELSVPPTGYPSTSVVLRGHE  186

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
              R     +   +G  ITF++R  T +   D +A  TC E+E + CDYI  Q++KPV L G
Sbjct  187   VRSLLFVS-QPYGERITFYERACTGMKGCDAIAIRTCHEMEEKLCDYIGRQYEKPVFLTG  245

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P LP  +++ +E +W+ WL  F+ GSV++C+FGS+  L K++ QEL+ G E TG+PF   
Sbjct  246   PVLPESARTPLEDRWAQWLNGFEAGSVVFCSFGSQFILEKEQLQELVLGFESTGLPFIVV  305

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP  + +IE A+PE  +E+++GRG+V G WVQQ   L HPS+GCFV+ CG+ S+ E+L
Sbjct  306   LKPPVGSSTIEEALPEGFEERVKGRGVVWGGWVQQLEILDHPSIGCFVNTCGFGSMWESL  365

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             ++DCQIVL+P +GDQI+N R+M+  L       + +E G F++E++  A+K VMD+ S++
Sbjct  366   MSDCQIVLVPHLGDQILNTRLMAEEL-KVAVEVERDEKGWFTKENLSNAIKCVMDKDSKV  424

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             G  ++ NH + R  L +    S Y+D F Q +Q+
Sbjct  425   GSMIKKNHTEWRKLLRSEGFMSSYIDKFFQNMQE  458



>ref|XP_003596676.1| Anthocyanidin 3-O-glucosyltransferase, partial [Medicago truncatula]
Length=389

 Score =   372 bits (954),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 201/384 (52%), Positives = 272/384 (71%), Gaps = 1/384 (0%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AM+PWF +GHLT +  L+NKLA +GH+ISF IP  TQ+KLE FNL+P+LI+F P+
Sbjct  5     SSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPTKTQTKLEQFNLYPNLITFYPL  64

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP I GLP GAETTSDV F    L+M AMD+TQ  +E++L  L   +VF+DF  W+P +
Sbjct  65    NVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLAQLNPKMVFFDFAFWIPKI  124

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A+ +GIKS  Y  +SP    Y LSP R      LTE D+MK P  +P+ S  L++HEA+ 
Sbjct  125   AQSLGIKSFQYWIVSPATISYTLSPSRMCESINLTEFDLMKPPKGYPNSSFTLYSHEAKY  184

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                +   +FG  + F+DR+F  +S SD + +  CR+IEG + DY+E +F KPVLL+GP L
Sbjct  185   LALKRNFEFGSGVLFYDRLFNGLSLSDAIGFKGCRQIEGPYVDYLEQEFGKPVLLSGPVL  244

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
             P P K+ +++KW  WLG FK+GS++YCA GSEC L  ++FQELL GLELTG PF A LKP
Sbjct  245   PEPPKTVLDEKWGSWLGGFKDGSLVYCALGSECKLTLEQFQELLLGLELTGYPFLAILKP  304

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P   E++E A PEE +E+++ +GIVH  W+QQQL L+H SVGCFV+HCG  SL+E L N+
Sbjct  305   PVGFETVEDAFPEEFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGSLTEGLTNN  364

Query  501   CQIVLLPQV-GDQIINARIMSVSL  433
             CQ+VL+P +  D IINA+IM + L
Sbjct  365   CQMVLIPHLDADHIINAKIMGMKL  388



>ref|XP_010537036.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Tarenaya hassleriana]
Length=461

 Score =   374 bits (961),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 202/452 (45%), Positives = 299/452 (66%), Gaps = 8/452 (2%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+ M+PWF  GH+T F  LANKLA KGH++++L+PK  Q +LE+ NLHP  ISF  + VP
Sbjct  7     HVLMFPWFAFGHMTPFLHLANKLAEKGHKVTYLLPKKAQEQLENLNLHPESISFNLVSVP  66

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
             S+  LP GAET SD+P   +  L  AMD T++ +E  +  LK D++FYDF HW+P +A++
Sbjct  67    SVNDLPAGAETASDIPISLSSSLASAMDLTRDQVEARVHALKPDLIFYDFAHWIPEIAQR  126

Query  1212  IGIKSVFYSTISPLMHGYALSP---ERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             IG+K+V Y T+S      +L P     R   K  TE +++  P  +P   +  + HEAR 
Sbjct  127   IGVKTVCYVTVSAATVAISLVPGLISSRDGPK--TEDELVIPPPGYPSSKVVFYRHEART  184

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                 + + FG   TF++R+  A+++ D +   T +E+E +FC+YIE+Q+QK VLL GP L
Sbjct  185   LLFLS-LPFGDGTTFYERVIMALTKCDAICLRTYKELERKFCEYIESQYQKKVLLTGPML  243

Query  861   pvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             P P K+  +E +WS+WL  F+ GSV++CA GS+  L KD+FQEL  GLELTG+PF A LK
Sbjct  244   PDPDKTKPLEDRWSNWLSVFEPGSVVFCALGSQIILEKDQFQELCLGLELTGLPFLAVLK  303

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP    +I+ A P+  +E+++ RG+++G W+QQ L L HPSVGCFVSHCG+ S+ E+L++
Sbjct  304   PPNGTSAIQEAFPKGFEERVKDRGVIYGGWIQQPLILSHPSVGCFVSHCGFGSMWESLMS  363

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             D QIVL+P +GDQI+N R+M+  L         ++ G FS+ES+  A+ +V+D+ SE G 
Sbjct  364   DSQIVLIPHLGDQILNTRLMAEEL-KVAVEVHRDKTGWFSKESLSHAIASVVDKDSETGT  422

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              +R N   L+  L++  L S Y+D+F ++LQ+
Sbjct  423   FLRKNRQMLKETLVSPGLTSCYVDNFVEELQN  454



>ref|XP_008226430.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=489

 Score =   375 bits (962),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 208/469 (44%), Positives = 290/469 (62%), Gaps = 17/469 (4%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             + ++ +H+AM+PWF +GH   F  L+N+LA +GHRISFL+PK  Q +L+  NLHPHLI+F
Sbjct  20    TSSSNFHIAMFPWFAMGHSIPFLHLSNELASRGHRISFLLPKKAQIQLQHLNLHPHLIAF  79

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIIL-----KDLKVDVVFYD  1246
               + VP I GLP G ET SD+P   T LL  AMD+T+  I+  L      D KVD++FYD
Sbjct  80    CSVTVPHIEGLPEGTETASDIPISLTPLLAAAMDRTRQQIQGFLVSCGVNDRKVDMIFYD  139

Query  1245  FTHWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSI  1069
             F HW+P + R +GIK V Y      +   A+ P R V   + +TE D+   P  +P  ++
Sbjct  140   FAHWVPEITRGLGIKCVNYGVACAAITAMAIVPARNVPKDRPVTEEDLRDPPPGYPSSTV  199

Query  1068  -KLHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQ  892
               L   E +     T M +G  ITF++R+ TA    D +   TCRE+EG FCDY+E Q++
Sbjct  200   VMLPGREVQSLMFIT-MPYGDGITFYERLMTAKKGCDAICIRTCREVEGVFCDYLEAQYK  258

Query  891   KpvllagpalpvPSKSTMEQK--------WSDWLGKFKEGSVIYCAFGSECTLRKDKFQE  736
             KPVLL GP L     +   +K        W++W   F+  SV++C FGS+  L KD+FQE
Sbjct  259   KPVLLTGPVLGAMDSNNKNKKKSEQLEDIWANWFSGFETESVVFCGFGSQWVLEKDQFQE  318

Query  735   LLWGLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVG  556
             L+ G ELTG+PFF ALKPP    +IE A+P+  +E+++GRG+V G WVQQ L L HPSVG
Sbjct  319   LVLGFELTGLPFFVALKPPVGCATIEEALPQGFEERVKGRGVVFGGWVQQTLILSHPSVG  378

Query  555   CFVSHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRES  376
             CFVSHCG+ +L E+LV++ QIVL+P   D I+N +I+   L       + EE+G FS+ES
Sbjct  379   CFVSHCGFGALWESLVSNNQIVLVPHGADHILNTKILVKDL-KVAVEVEREENGWFSKES  437

Query  375   VCKAVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             + KA+  VM + +E+G  V+ NH K R  L        Y+D F QKL++
Sbjct  438   LSKAITTVMAKDNEVGVMVKKNHAKWRETLSTPGFMDGYIDRFVQKLKE  486



>gb|AFJ52978.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=462

 Score =   374 bits (959),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 202/461 (44%), Positives = 289/461 (63%), Gaps = 7/461 (2%)
 Frame = -3

Query  1596  MGSQATT--YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPH  1423
             M S   T  +H+ M+PW   GH+T F  L+N LA KG  I+F++PK    +   FN HP+
Sbjct  1     MASSCETKKFHIVMFPWLATGHITPFLHLSNTLASKGFTITFILPKKAIQQFSRFNQHPN  60

Query  1422  LISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDF  1243
             LI F PI +P + GLP G ET S+VP   TH L  AMD+T++ +E I++     VV YD 
Sbjct  61    LIDFHPITLPPVDGLPAGVETASEVPIEVTHFLCIAMDRTRDQVEKIIRGTNPKVVVYDM  120

Query  1242  THWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIK  1066
              HW+  +   +GIKSV Y+ +S     +A  P R +V GK+LT  ++   P  +P  +I 
Sbjct  121   AHWVSDITASLGIKSVNYTVLSAAAVAFADVPVRGIVKGKELTVDELAVPPPGYPSSTIV  180

Query  1065  LHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKp  886
             L  HE +   +     +G   TF++RI T +   D LA  TC EIEG+ C+Y+  Q++K 
Sbjct  181   LRPHEGK-LLSFIFFPYGEATTFWERISTGMRMCDALAIRTCDEIEGKLCEYLGEQYKKR  239

Query  885   vllagpalpvPSKS--TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELT  712
             V L GP L  P+    ++E +W DWLGKF+ GSV++CAFGS+  L K +FQEL+ G EL+
Sbjct  240   VFLTGPVLTEPANDVVSLENQWIDWLGKFEPGSVVFCAFGSQIMLEKSQFQELVLGFELS  299

Query  711   GMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGW  532
             G PF  ALKPP  + +I+ A+PE  +E+++GRGI+ GEWVQQ L L HPSVGCFV+HCG+
Sbjct  300   GHPFLVALKPPAGSSTIKEALPEGFEERVKGRGIIWGEWVQQVLILNHPSVGCFVNHCGF  359

Query  531   ASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAV  352
              S+ E+L++D QIVL+P +GDQ++N R+++  L       + +E G  S+E +  A+K V
Sbjct  360   GSMWESLMSDSQIVLVPHLGDQVLNTRLLADEL-KVGLEVERDEQGWVSKEKLSDAIKCV  418

Query  351   MDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             MD+ +E+G  +R NH K RG + + D  S Y+D F Q L D
Sbjct  419   MDQGNELGCSLRKNHSKWRGVVSDPDFMSSYIDKFVQNLHD  459



>ref|XP_010674067.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Beta vulgaris subsp. 
vulgaris]
Length=458

 Score =   372 bits (956),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 210/459 (46%), Positives = 294/459 (64%), Gaps = 9/459 (2%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MG Q    H+ M+PWF +GH+T F  L+NKLA  GH+I+FLIPK  + +LE   L+P LI
Sbjct  1     MGKQ---LHIVMFPWFAIGHMTPFLHLSNKLAEYGHKITFLIPKKAKHQLEHLLLYPSLI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIE--IILKDLKVDVVFYDF  1243
             +  PI +P +  LPPG ET S++P    + L  A+D T+ ++E  II    K  V+FYD 
Sbjct  58    TLHPITIPHVHPLPPGIETASEIPLHLNNHLATALDLTRPEVESFIITLQPKPHVLFYDM  117

Query  1242  THWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAPASFPDPSIK  1066
              +W+P +A K+ IKSV Y+ +       AL P   V   Q  TE D+ K P  +P  ++ 
Sbjct  118   AYWVPEIASKLQIKSVCYNVVCAASLAIALVPALNVGRYQPFTEEDVAKPPPGYPSSNVV  177

Query  1065  LHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKp  886
              H  EAR       ++FG  +TF+DR+ TA+   D +A  TCREIE  FC+YI +Q+ KP
Sbjct  178   FHGPEARSLLFLG-LEFGSGLTFYDRMSTALKSCDAIAIRTCREIEDNFCNYISSQYNKP  236

Query  885   vllagpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             VLL GP LP  + +  +E +W++WL +F+  SV++CAFGS+  L KD+FQELL G E+T 
Sbjct  237   VLLTGPVLPETNNNNPLEARWAEWLSRFEPNSVVFCAFGSQFILEKDQFQELLLGFEMTM  296

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  ALKPP    S+E A+PE  KE++  RG+VHG WVQQ L L HPSVGCFV+HCG+ 
Sbjct  297   VPFLVALKPPQGCGSVEEALPEGFKERVGERGVVHGGWVQQPLILAHPSVGCFVNHCGFG  356

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+L+ + QIV++PQ+GDQI+N R+MS  L V     +  E+G  S+ES+CKA+K+VM
Sbjct  357   SMWESLMAESQIVMVPQLGDQILNTRLMSGEL-VVGVEVERTENGWVSKESLCKAIKSVM  415

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              E SE+G  VR NH   R  +++      Y+DSF + L+
Sbjct  416   GEDSEVGCLVRNNHANWRQIMVSQGFMRGYIDSFVKDLE  454



>ref|XP_009132454.1| PREDICTED: UDP-glycosyltransferase 79B6 [Brassica rapa]
Length=447

 Score =   372 bits (954),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 199/456 (44%), Positives = 288/456 (63%), Gaps = 13/456 (3%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P  I
Sbjct  1     MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKGLKQLEPLNLFPKSI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + +PS+ GLP GAETTSD+P      L  AMD+T+  +E  ++  K D++F+DF H
Sbjct  58    VFHILTIPSVDGLPDGAETTSDIPITLGSFLASAMDRTRGQVEETVRLGKPDLIFFDFAH  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +AR+ G KSV + TIS      +  P R       +  ++   P  +P   + LH 
Sbjct  118   WIPDIAREYGAKSVNFVTISAACVAISFVPGR-------SPDELAIPPPGYPSSKVLLHG  170

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQ-Kpvl  880
              E    +  +   FG  +TF++RI T +   D ++  TC+E+EG+FCD+IE +FQ K +L
Sbjct  171   QETSSLSFLS-YPFGDGVTFYERIMTGLVNCDVISIRTCQEMEGKFCDFIEREFQRKVLL  229

Query  879   lagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPF  700
                      +   +E +WS WL +FK GSV+YC+ GS+  L K++FQEL  G+ELTG+PF
Sbjct  230   TGPMLPEPDNIKPLEDQWSHWLNRFKPGSVVYCSLGSQIILEKEQFQELCLGMELTGLPF  289

Query  699   FAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLS  520
               A+KPP  A +I+ A+P+  +E+ + RG+V GEWV Q L L HPS+GCFVSHCG+ S+ 
Sbjct  290   LVAVKPPKGASTIQEALPKGFEERFKERGVVWGEWVHQPLILAHPSIGCFVSHCGFGSMW  349

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             E+L+NDCQIV +P +G+QI N R+MS  L       K EE G FS+ES+  AV++VMD+ 
Sbjct  350   ESLLNDCQIVFIPHLGEQIFNTRLMSEEL-EVSVEVKREETGWFSKESLSGAVRSVMDKD  408

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +E+G  VR NH K +  LL++ + S Y++ + + L+
Sbjct  409   TELGNLVRRNHAKWKESLLSSGIISGYVNKYVEALE  444



>gb|KHN13063.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=480

 Score =   372 bits (956),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 203/467 (43%), Positives = 293/467 (63%), Gaps = 20/467 (4%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF  GH+T F  L+N+LA +GH+I+FL+PK  + +L+  N HPHLI+F  + +P
Sbjct  10    HIAMFPWFATGHMTPFLHLSNELAKRGHKITFLLPKKAKLQLQHLNNHPHLITFHTLTIP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP G ET S++P    HLL+ AMDKT++ +E  L     D V YD  +W+P +A+K
Sbjct  70    HVKGLPHGTETASEIPISLNHLLVIAMDKTRDQVEHTLSATNPDFVLYDNAYWVPQIAKK  129

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +GIK++ Y+ +        L P R V   + +T  ++ + P  +P   + L   EA    
Sbjct  130   LGIKTICYNVVCAASLAIVLVPARNVPKDRPITVEELSQPPEGYPSSKVVLTGLEAESLM  189

Query  1035  ARTVMKFGGD-ITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
               +V  FG D ITF+DRI +A+ ESD +A  T REIEG FCDYI +QF K VLL GP LP
Sbjct  190   FISV-PFGEDNITFYDRITSALRESDAIAIRTSREIEGNFCDYIASQFGKKVLLTGPVLP  248

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
               ++  +E+ W++WL  F   S++YCAFGS+  L KD+FQELL G EL+G+PF  ALK P
Sbjct  249   EEAEGKLEENWANWLDAFANESIVYCAFGSQINLEKDQFQELLLGFELSGLPFLVALKTP  308

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
                ES+E A+PE  +E+++GRG+V   WVQQ L L+HPSVGCFV+HCG+ S+ E+L++D 
Sbjct  309   RGCESVEEALPEGFEERVKGRGVVSRGWVQQLLILKHPSVGCFVNHCGFGSMWESLMSDK  368

Query  498   QIVLLPQVGDQIINARIM-----------------SVSLkvgvevekgeedgVFSRESVC  370
             QIVL+PQ+GDQ++N +++                   +        +   +G  S+ES+ 
Sbjct  369   QIVLVPQLGDQVLNTKLLVEELGVAGGGGGGGGGGGAASLGVAVEVERGGNGWVSKESLS  428

Query  369   KAVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             KA+K VMD  SE+G  V+ NH + +    + +L + YMD F Q LQD
Sbjct  429   KAIKLVMDGDSEVGARVKKNHMEWKKTGGSPNLMNGYMDRFVQNLQD  475



>ref|XP_002282717.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=459

 Score =   371 bits (953),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 214/456 (47%), Positives = 304/456 (67%), Gaps = 9/456 (2%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             +++   H+AM+PWF  GH+  +  L+N+LAG+GH+I+F++P+  QSKL+  N HP LI+F
Sbjct  4     AKSPKLHIAMFPWFAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALITF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P++VP + GLPPG ET SD+P   T+LL  A+D+T++ +E  L+ L  D++FYDF +W 
Sbjct  64    HPLIVPHVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTLNPDLLFYDFAYWA  123

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVG--KQLTEADMMKAPASFPDPSIKLHA  1057
             P+LA ++GIKS++Y  +      +   P ++     +QLT+      P  +P  ++ L  
Sbjct  124   PALASQLGIKSIYYCVVCAAAVAHTPIPAQQGSKDCRQLTDV----PPPGYPSSTVVLRP  179

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEAR         +G  ITF  R  TA +  D ++  TC+E EG  CDYI +Q+ KPV L
Sbjct  180   HEAR-LMDFMFAPYGEGITFQQRHITARTSCDAISIRTCQETEGPICDYIGSQYGKPVFL  238

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
              GP LP PS   +E +W+ WLG FK GSVI+CAFGS+    KD+FQELL GLELTG+PFF
Sbjct  239   TGPVLPNPSVEPLEDRWAQWLGGFKPGSVIFCAFGSQNVHEKDQFQELLLGLELTGLPFF  298

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGE-WVQQQLFLQHPSVGCFVSHCGWASLS  520
             AALKPP  A +IE A+PE  +E++ GRG+VHG  WVQQ   L HPSVGCFVSHCG+ S+ 
Sbjct  299   AALKPPTGAATIEEALPEGFQERVGGRGLVHGGWWVQQPSVLSHPSVGCFVSHCGYGSMW  358

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             E+L +D QIVL+P++ DQI+N+R+++  L       + EE+G+FS+ES+C A+K VMDE 
Sbjct  359   ESLTSDPQIVLVPELPDQILNSRLLAEEL-KVAVEVEREENGLFSKESLCDAIKTVMDEN  417

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             SE+G  V+ NH K +  L +    S Y+D+F  +LQ
Sbjct  418   SEVGGLVKKNHAKWKEALTSQSFLSNYVDNFVGQLQ  453



>ref|XP_010446338.1| PREDICTED: UDP-glycosyltransferase 79B6-like isoform X1 [Camelina 
sativa]
Length=447

 Score =   371 bits (952),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 200/451 (44%), Positives = 288/451 (64%), Gaps = 10/451 (2%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P  I F  +
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPDYIFFHTL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +PS+ GLP GAETTSD+   S   L  AMD+T+N ++  +   K D++F+DF HW+P +
Sbjct  63    TIPSVDGLPAGAETTSDIQISSGSFLASAMDRTRNQVQEAVSIGKPDLIFFDFAHWIPEI  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A + G +SV + TIS      +  P R       +  D+   P  +P   + L   E   
Sbjct  123   AGEYGARSVNFITISAACVAISFVPGR-------SPDDLAVPPPGYPSSKVLLRGQETNC  175

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
             F+  +   FG + TF++RI   ++  D ++  TC+E+EG+FCD+IE+QFQ+ VLL GP L
Sbjct  176   FSFLS-HPFGDNTTFYERIMIGLTNCDVISIRTCQEMEGKFCDFIESQFQREVLLTGPML  234

Query  861   pvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             P P  S  +E +W  WL +F+ GSV+YCA GS+  L KD+FQEL  G+ELTG+PF  A+K
Sbjct  235   PEPDNSKPLEDQWMQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFLVAVK  294

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP  + +I+ A+P   +E+++GRG+V G WVQQ L L HPS+GCFVSHCG+ S+ E LVN
Sbjct  295   PPKGSSTIQEALPNGFEERVKGRGVVWGRWVQQPLILAHPSIGCFVSHCGFGSMWEGLVN  354

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQIV +P +G+QI N R+MS          + E+ G FS+ES+  ++++VMD+ SE+G 
Sbjct  355   DCQIVFIPHLGEQIFNTRLMSEE-LEVSVEVEREDTGWFSKESLSGSIRSVMDKDSELGN  413

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              VR NH K +  L++  L + Y++ F + LQ
Sbjct  414   LVRRNHAKWKDSLVSTGLMNGYVNKFIEALQ  444



>ref|XP_008386210.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Malus domestica]
Length=468

 Score =   372 bits (954),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 299/469 (64%), Gaps = 21/469 (4%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             ++++H+AM+PWF +GH+T F  L+N+LA +GH+I+FL+PK  Q  L+  NLHPHL++F P
Sbjct  2     SSSFHIAMFPWFALGHMTPFLHLSNELAARGHKITFLLPKKAQILLQHLNLHPHLVTFHP  61

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLKVDVVFYDFTH  1237
             + VP I GLP   E  S++P   +H L  A+D+T++ I+  LK    + KVD++F+D  H
Sbjct  62    VTVPHIEGLPDKTEFVSEIPLSLSHFLTLAIDRTRDQIQDFLKTSVANCKVDMIFFDSAH  121

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-------LTEADMMKAPASFPD  1078
             W+P +AR +GIKS+FY  I    +  +L P    V K        +TE    K P  +P 
Sbjct  122   WIPEIARGLGIKSIFYGVICAAAYALSLVPICNYVTKDACMAPMTMTEEQQHKPPPGYPS  181

Query  1077  PSIKL-HAHEARGF-TARTVMKFGGDITFFDRI---FTAVSESDGLAYSTCREIEGQFCD  913
              ++ L  +HE R   T+R+    G  I    R+   F A+ E D     TCRE EG FCD
Sbjct  182   STVVLTRSHEVRSLMTSRSC---GVGIRVNQRLITGFRAIKECDAFCLRTCREFEGDFCD  238

Query  912   YIETQFQKpvllagpalpvPSKSTM-EQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQE  736
             Y+E QFQKPVLL GP L +    T+ E +W+DW   F+ G+V++CAFGS+    KD+FQE
Sbjct  239   YLEAQFQKPVLLTGPVLSLEKGPTLLENRWADWFAGFEAGTVVFCAFGSQWAFEKDQFQE  298

Query  735   LLWGLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVG  556
             L+ G ELTG+PF  A+KPP    +IE A+PE  +E+++GRG+V G WVQQ L L HP+VG
Sbjct  299   LVLGFELTGLPFLVAVKPPLGCVTIEEALPEGFEERVRGRGVVFGGWVQQPLILSHPAVG  358

Query  555   CFVSHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRES  376
             CFV HCG+ ++ E+L+++ QIVL+PQ+ DQI+ A++++  L       + EEDG FSRES
Sbjct  359   CFVHHCGYGTMWESLMSENQIVLVPQLVDQILGAKLLAKEL-KVAVEVEREEDGWFSRES  417

Query  375   VCKAVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             + KAVK+VMD+ S++G  V+ NH K R  +      S Y+D F   L++
Sbjct  418   LSKAVKSVMDKGSDVGVMVKKNHAKCREIISEPGFMSGYVDKFVDNLKE  466



>ref|XP_003634640.2| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=457

 Score =   370 bits (950),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 210/456 (46%), Positives = 304/456 (67%), Gaps = 9/456 (2%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             +++   H+AM+PWF  GH+  +  L+N+LAG+GH+I+F++P+  QSKL+  N HP LI+F
Sbjct  2     AKSPKLHIAMFPWFAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALITF  61

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P++VP + GLPPG ET SD+P   T+LL  A+D+T++ +E  L+ L   ++FYDF +W 
Sbjct  62    HPLIVPHVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTLNPHLLFYDFAYWA  121

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVG--KQLTEADMMKAPASFPDPSIKLHA  1057
             P+LA ++GIKS++YS +      +   P ++     +QLT+      P  +P  ++ L  
Sbjct  122   PALASQLGIKSIYYSAVCAAAVAHIPIPAQQGSKDCRQLTDV----PPPGYPSSTVVLRP  177

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEAR         +G  ITF  R+ TA +  D ++  TC+E +G  CDYI +Q+ KPV L
Sbjct  178   HEAR-LMDFMFAPYGEGITFQQRVTTARARGDAISIRTCQETDGPICDYIGSQYGKPVFL  236

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
              GP LP PS   +E +W+ WLG FK GSVI+CAFGS+    KD+FQELL GLELTG+PFF
Sbjct  237   TGPVLPKPSVEPLEDRWAQWLGGFKPGSVIFCAFGSQNVHEKDQFQELLLGLELTGLPFF  296

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGE-WVQQQLFLQHPSVGCFVSHCGWASLS  520
             AA+KP     +IE A+PE  +E++ GRG+VHG  WVQQ   L HPSVGCFVSHCG+ S+ 
Sbjct  297   AAVKPRTGVATIEEALPEGFQERVGGRGLVHGGWWVQQPSVLSHPSVGCFVSHCGYGSMW  356

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             E+L +D QIVL+P++ DQI+N+R+++  L       + EE+G+FS+ES+C A+K+VMDE 
Sbjct  357   ESLTSDPQIVLVPELADQILNSRLLAEEL-KVAVEVEREENGLFSKESLCDAIKSVMDEN  415

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             SE+G  V+ NH K +  L +    S Y+D+F  +LQ
Sbjct  416   SEVGGLVKKNHAKWKEALTSQSFLSNYVDNFVGQLQ  451



>ref|XP_010675464.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Beta vulgaris subsp. 
vulgaris]
Length=458

 Score =   368 bits (945),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 206/459 (45%), Positives = 291/459 (63%), Gaps = 9/459 (2%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MG Q    H+ M+PWF +GH+T F  L+NKLA  GH+I+FL+PK  + +L+   L+P LI
Sbjct  1     MGKQ---LHIVMFPWFAIGHMTPFLHLSNKLAEYGHKITFLLPKKAKHQLQHLLLYPSLI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIE--IILKDLKVDVVFYDF  1243
             +  PI +P +  LPPG ET S++P    + L  A+D T+ ++E  II    K  ++FYD 
Sbjct  58    TLHPITIPHVHPLPPGTETASEIPLHLNNHLATALDLTRLEVEYFIITLQPKPHLLFYDI  117

Query  1242  THWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQ-LTEADMMKAPASFPDPSIK  1066
               W+P +A K+ IKS+ Y+ +       AL P   V   Q +TE D+ K P  +P  ++ 
Sbjct  118   AFWVPEIASKLQIKSICYNVVCAASLAIALVPALNVGRDQPVTEEDVAKPPPGYPSSNVV  177

Query  1065  LHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKp  886
              H  EAR       ++FG  +TF+DRI TA+   D +A  TCREIE  FCDYI  Q+ KP
Sbjct  178   FHGPEARSLLF-IGLEFGSGLTFYDRIVTAMKSCDAIAIRTCREIEDNFCDYISAQYNKP  236

Query  885   vllagpalpvPSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             VLL GP LP  + +  +E +W +WL +F+  SV++CAFGS+  L KD+FQELL G E+T 
Sbjct  237   VLLTGPVLPETNNNHPLEAQWVEWLSRFEPNSVVFCAFGSQYILEKDQFQELLLGFEMTM  296

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  ALKPP     +E A+PE  KE++  RG+VHG WVQQ L L HPSVGCFV+HCG+ 
Sbjct  297   LPFLVALKPPQGCGFVEEALPEGFKERVGERGVVHGGWVQQPLILAHPSVGCFVNHCGFG  356

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+L+ + QIV++PQ+GDQI+N R+MS  L V     +  E G  S+ES+CKA+++VM
Sbjct  357   SMWESLMAESQIVMVPQLGDQILNTRLMSGEL-VVGVEVERAESGWVSKESLCKAIQSVM  415

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              E SE+G  VR NH K R  +++      Y+D+F + L+
Sbjct  416   GEDSEVGCLVRNNHAKWRQIMVSQGFMRGYIDNFVKDLE  454



>ref|XP_007213912.1| hypothetical protein PRUPE_ppa005654mg [Prunus persica]
 gb|EMJ15111.1| hypothetical protein PRUPE_ppa005654mg [Prunus persica]
Length=449

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 290/449 (65%), Gaps = 6/449 (1%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             M+PWF +GH+T +  LAN+LA +GHRI+ L+P   + +L+   LH  LI F P+ VP + 
Sbjct  1     MFPWFAIGHITPYIHLANELASRGHRITLLVPNKARLQLQHLVLHADLIVFSPVAVPHVH  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLP G E  S++P   THLL  AMD+T+ +IE  L   K+D V YD   W+P +AR+ GI
Sbjct  61    GLPEGTEIASEIPIHMTHLLATAMDRTRGEIEQFLTVSKLDFVLYDTAQWVPGIARRNGI  120

Query  1203  KSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAPASFPDPSIKLHAHEARGFTART  1027
             K+V Y+ +       AL P R V   + +TE ++ +APA +P  ++ L   EA+  T  +
Sbjct  121   KTVCYNVVCAAALAIALVPARNVPKDRPITEEELREAPAGYPSKNVVLCGAEAKALTFIS  180

Query  1026  VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPS-  850
              + +G  ITF++R  TA+ E D L+  TCRE+EG  CDY+E Q++KPV+L GP L + S 
Sbjct  181   -LPYGEGITFYERTTTAMKECDVLSIRTCRELEGDLCDYMEAQYKKPVILTGPVLGLGSD  239

Query  849   --KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppf  676
                  +E++W  W   F+ GSV++CAFG++  L K++FQEL+ G ELTG+PFF ALKPP 
Sbjct  240   KKSEKLEERWEKWFSGFEAGSVVFCAFGTQWILEKEQFQELVLGFELTGLPFFVALKPPS  299

Query  675   eaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQ  496
                +IE A+P   +E+++GRG+V G WVQQ   L H SVGCFV+HCG+ S+ E+L+ D Q
Sbjct  300   GCATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESLMTDNQ  359

Query  495   IVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             IVL+P +GDQI+N +++   L       + EE+G  S++S+ KA+K+VMD+ SE+G  V+
Sbjct  360   IVLVPHLGDQILNTKLLVKEL-KVAVEVEREENGWLSKDSLRKAIKSVMDKDSEVGVMVK  418

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH K    L +    S Y+D F QKL++
Sbjct  419   KNHAKWVETLSSPGFMSGYIDRFVQKLKE  447



>ref|XP_002866011.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42270.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=447

 Score =   367 bits (942),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 206/450 (46%), Positives = 283/450 (63%), Gaps = 16/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+T +  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5     FHAFMFPWFAYGHMTPYLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFYPLTI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SD+P      L  AMD T++ +E  ++ LK D++F+DF +W+P +AR
Sbjct  65    PHVDGLPDGAETASDIPISLGKFLTAAMDLTRDQVEAAVRALKPDLIFFDFAYWVPEMAR  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +  +KSV Y  +S     + L P            ++   P  +P   +    H+A    
Sbjct  125   EHNVKSVLYFVVSANSIAHELVP----------GGELGVPPPGYPSTKVLYRGHDAHALL  174

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
               T   F   + +  RI T +   D ++  TC+E+EG+FCDYIE Q+Q+ VLL GP LP 
Sbjct  175   --TFAIFYERLHY--RITTGLKNCDFISIRTCKEVEGKFCDYIEKQYQRKVLLTGPMLPE  230

Query  855   PSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P  S  +E +W  WL  F+ GSVIYCA GS+ TL KD+FQEL  G+ELTG+PF  A+KPP
Sbjct  231   PDNSRPLEDRWDHWLNHFEPGSVIYCALGSQITLEKDQFQELCLGMELTGLPFLVAVKPP  290

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               A++I+ A+PE   E+++  G+V GEWVQQ L L HPSVGCFV+HCG+ S+ E+LV+DC
Sbjct  291   KGAKTIQEALPEGFAERVKNHGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVSDC  350

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+MS  L       K EE G FS+ES+C A+  VMD+ SE+G  V
Sbjct  351   QIVLLPYLCDQVLNTRLMSEEL-EVSVEVKREETGWFSKESLCVAITLVMDKDSELGNLV  409

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH KL+  L++  L + Y D F + LQD
Sbjct  410   RTNHAKLKEVLVSHGLLTDYTDKFVETLQD  439



>ref|XP_009340538.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Pyrus x bretschneideri]
Length=467

 Score =   367 bits (942),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 204/467 (44%), Positives = 294/467 (63%), Gaps = 20/467 (4%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             ++++H+AM+PWF +GH+T F  L+N+LA +GH+I+FL+PK  Q +L+  NLHPHLI+F P
Sbjct  2     SSSFHIAMFPWFAMGHMTPFLHLSNELAARGHKITFLLPKKAQIQLQRLNLHPHLITFHP  61

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLKVDVVFYDFTH  1237
             + VP I GLP   E  S++P   +H L  A+D+T++ I+  LK    D KVD++F+D  H
Sbjct  62    VTVPHIEGLPDKTEFVSEIPLSLSHFLTLAIDRTRDQIQDFLKTSVADCKVDMIFFDSAH  121

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADM------MKAPASFPDP  1075
             W+P +AR +GIKS+FY  IS   +  +L P    V K    A M      +  P  +P  
Sbjct  122   WIPEIARGLGIKSIFYGVISAAAYALSLVPICNYVTKDACMAPMIMTEEQLNPPPGYPSS  181

Query  1074  SIKL-HAHEARGF-TARTVMKFGGDITFFDRI---FTAVSESDGLAYSTCREIEGQFCDY  910
             ++ L  +HE R   T+R+    G  I    R+   F A+ E D     TCRE EG FCDY
Sbjct  182   TVILTRSHEVRSLMTSRSC---GVGIRVNQRLITGFRAIKECDAFCLRTCREFEGDFCDY  238

Query  909   IETQFQKpvllag-palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQEL  733
             +E QFQKPVLL G           +E++W+DW    + GS+++CAFGS+    KD+FQEL
Sbjct  239   LEAQFQKPVLLTGPVLSLEKGPKLLEERWADWFAGLEAGSMVFCAFGSQWAFGKDQFQEL  298

Query  732   LWGLELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGC  553
             + G ELTG PF  A+KPP    +IE A+PE  +E+++GRG+V G WVQQ L L HP+VGC
Sbjct  299   VLGFELTGSPFLVAVKPPLGCVTIEEALPEGFEERVRGRGVVFGGWVQQPLILSHPAVGC  358

Query  552   FVSHCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESV  373
             FV HCG+ ++ E+L+++ QIVL+PQ+ DQI+ A++++  L       + EEDG FS+ES+
Sbjct  359   FVHHCGYGTMWESLMSENQIVLVPQLVDQILGAKLLAKEL-KVAVEVEREEDGWFSKESL  417

Query  372   CKAVKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              KAVK VMD++S++G  V+ NH K R  +      S Y+D F   L+
Sbjct  418   SKAVKGVMDKESDVGVMVKKNHAKFREIISEPGFMSGYVDRFVDNLK  464



>ref|NP_194487.1| UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 sp|Q9T081.1|U79B3_ARATH RecName: Full=UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 emb|CAB38269.1| UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB81407.1| UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 dbj|BAC43080.1| putative UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AAO63434.1| At4g27570 [Arabidopsis thaliana]
 gb|AEE85358.1| UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 gb|AHL38673.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=453

 Score =   367 bits (941),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 201/453 (44%), Positives = 286/453 (63%), Gaps = 17/453 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H+ MYPWF  GH+T F  LANKLA KGH ++FL+PK +  +LE FNL PH I F  + V
Sbjct  6     FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLLPKKSLKQLEHFNLFPHNIVFRSVTV  65

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP G ET S++P  ST LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR
Sbjct  66    PHVDGLPVGTETASEIPVTSTDLLMSAMDLTRDQVEAVVRAVEPDLIFFDFAHWIPEVAR  125

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA---R  1045
               G+K+V Y  +S       L P            ++   P  +P   + L   +A   +
Sbjct  126   DFGLKTVKYVVVSASTIASMLVPG----------GELGVPPPGYPSSKVLLRKQDAYTMK  175

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                    +  G ++   +R+ T++  SD +A  T REIEG FCDYIE   +K VLL GP 
Sbjct  176   KLEPTNTIDVGPNL--LERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPV  233

Query  864   lpvPSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              P P K+  +E++W  WL  ++  SV++CA GS+  L KD+FQEL  G+ELTG PF  A+
Sbjct  234   FPEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAV  293

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP  + +I+ A+PE  +E+++GRG+V G WVQQ L L HPSVGCFVSHCG+ S+ E+L+
Sbjct  294   KPPRGSSTIQEALPEGFEERVKGRGLVWGGWVQQPLILSHPSVGCFVSHCGFGSMWESLL  353

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             +DCQIVL+PQ+GDQ++N R++S  L         EE G FS+ES+C AV +VM   SE+G
Sbjct  354   SDCQIVLVPQLGDQVLNTRLLSDEL-KVSVEVAREETGWFSKESLCDAVNSVMKRDSELG  412

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
               VR NH K R  + +  L + Y+D+F + LQD
Sbjct  413   NLVRKNHTKWRETVASPGLMTGYVDAFVESLQD  445



>gb|KFK30258.1| hypothetical protein AALP_AA7G237800 [Arabis alpina]
Length=452

 Score =   365 bits (938),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 199/454 (44%), Positives = 289/454 (64%), Gaps = 14/454 (3%)
 Frame = -3

Query  1584  ATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVP  1405
             A+ +H  MYPWF  GH+T F  LANKL  KGHR++FL+PK    + E  NL+PH I F  
Sbjct  2     ASKFHALMYPWFATGHITPFMHLANKLGEKGHRVTFLLPKKALKQFEHLNLYPHHIVFRT  61

Query  1404  IVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPS  1225
             + VP + GLP G ET+S++P  ST+LL  AMD T++ +E +++ LK DV+F+DF HW+P 
Sbjct  62    VTVPHVDGLPLGVETSSEIPISSTNLLASAMDLTRSQVEDVVRALKPDVIFFDFAHWIPE  121

Query  1224  LARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEAR  1045
             +AR+ G KSV Y     L+   A++    ++     E D+   P  +P   + LH  +A 
Sbjct  122   VAREFGAKSVDYL----LLCAAAVA---NLIVHAGGEFDV--PPPGYPSSKVLLHKKDA-  171

Query  1044  GFTARTVMKFGGDITFF-DRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagp  868
              ++ + +     D+  F +R   + ++ D +    C+E EG+FC Y+E++  K +L  GP
Sbjct  172   -YSMKPLANSTEDLDAFKERFIASFTKCDVIMIKACKEFEGKFCTYVESKMDKKILFTGP  230

Query  867   alpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
              L     +  +E++WS+WL +F+ GSV++CAFGSE  + +D+FQEL  G+ELTG+PF  A
Sbjct  231   MLHHADATIPLEEEWSNWLSRFELGSVVFCAFGSETIMERDQFQELCLGMELTGLPFLVA  290

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             +KPP    +I+ A+PE  +E+++GRG+V G WVQQ L L HPSVGCFVSHCG  S+ E+L
Sbjct  291   VKPPRGTTTIQEALPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVSHCGLGSMWESL  350

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             V+DCQIVL+PQ+ +QIINAR+MS  L         EE G FS+ES+   +K+VMD  SE+
Sbjct  351   VSDCQIVLVPQIAEQIINARLMSQEL-EVSVEVAREETGWFSKESLRDNIKSVMDRDSEL  409

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             G  VR NH K R  L +  L + Y+D   + L+D
Sbjct  410   GNRVRNNHTKWRKTLTSPGLVNGYVDDLIESLKD  443



>ref|XP_002867497.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43756.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   364 bits (935),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 202/451 (45%), Positives = 283/451 (63%), Gaps = 15/451 (3%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H+ MYPWF  GH+T F  LANKLA KGH ++FL+PK    +LE  NL PH I F  + +
Sbjct  6     FHVLMYPWFATGHMTPFLYLANKLAEKGHMVTFLLPKKALKQLEHLNLFPHNIVFRSVTI  65

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP G ET S++P  S  LLM AMD T++ +E++L+ ++ D++F+DF HW+P +AR
Sbjct  66    PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEVVLRAVEPDLIFFDFAHWIPQVAR  125

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
              +GIK+V Y  +S       L P            ++   P  +P   + L   +A  +T
Sbjct  126   DLGIKTVKYVVVSASTIASMLVPG----------GELGVPPPGYPSSKVLLRKQDA--YT  173

Query  1035  ARTVM-KFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
              + +           +R+ T++  SD +A  T REIEG FCDYIE   +K VLL GP  P
Sbjct  174   MKNLEPTIDAGPNLLERVTTSLMNSDVIAIRTVREIEGNFCDYIEKHCRKKVLLTGPMFP  233

Query  858   vPSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
              P K+  +E++W  WL  ++  SV++CA G++  L KD+FQEL  G+ELTG PF  A+KP
Sbjct  234   EPDKTRELEERWVKWLSGYEPDSVVFCALGTQVILEKDQFQELCLGMELTGSPFLVAVKP  293

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  + +IE A+PE  KE+++GRG+V G WVQQ L L HPSVGCFVSHCG+ S+ E+L++D
Sbjct  294   PRGSSTIEEALPEGFKERVKGRGVVWGGWVQQPLILSHPSVGCFVSHCGFGSMWESLLSD  353

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQIVL+PQ+GDQ++N R+MS  L         EE G FS+ES+  A+ +VM   SEIG  
Sbjct  354   CQIVLVPQLGDQVLNTRLMSDEL-KVSVEVVREETGWFSKESLRDAINSVMKRDSEIGNL  412

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             V+ NH K R  L +  L S Y+D+F + LQD
Sbjct  413   VKKNHTKWRETLASPGLLSGYVDNFIESLQD  443



>ref|NP_194486.1| UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 sp|Q9T080.1|U79B2_ARATH RecName: Full=UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 emb|CAB38268.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB81406.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 gb|AAL49923.1| putative UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AAN13158.1| putative UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AEE85357.1| UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 gb|AHL38674.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=455

 Score =   364 bits (934),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 285/453 (63%), Gaps = 17/453 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H+ MYPWF  GH+T F  LANKLA KGH ++FLIPK    +LE+ NL PH I F  + V
Sbjct  6     FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTV  65

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP G ET S++P  S  LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR
Sbjct  66    PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVEPDLIFFDFAHWIPEVAR  125

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA---R  1045
               G+K+V Y  +S       L P            ++   P  +P   + L   +A   +
Sbjct  126   DFGLKTVKYVVVSASTIASMLVPG----------GELGVPPPGYPSSKVLLRKQDAYTMK  175

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                +   +  G ++   +R+ T++  SD +A  T REIEG FCDYIE   +K VLL GP 
Sbjct  176   NLESTNTINVGPNL--LERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPV  233

Query  864   lpvPSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              P P K+  +E++W  WL  ++  SV++CA GS+  L KD+FQEL  G+ELTG PF  A+
Sbjct  234   FPEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAV  293

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP  + +I+ A+PE  +E+++GRG+V GEWVQQ L L HPSVGCFVSHCG+ S+ E+L+
Sbjct  294   KPPRGSSTIQEALPEGFEERVKGRGVVWGEWVQQPLLLSHPSVGCFVSHCGFGSMWESLL  353

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             +DCQIVL+PQ+GDQ++N R++S  L         EE G FS+ES+  A+ +VM   SEIG
Sbjct  354   SDCQIVLVPQLGDQVLNTRLLSDEL-KVSVEVAREETGWFSKESLFDAINSVMKRDSEIG  412

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
               V+ NH K R  L +  L + Y+D+F + LQD
Sbjct  413   NLVKKNHTKWRETLTSPGLVTGYVDNFIESLQD  445



>ref|XP_008350006.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Malus domestica]
Length=471

 Score =   363 bits (933),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 289/460 (63%), Gaps = 12/460 (3%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H+AM+PWF +GHLT F  L N+LA +GHRI+FL+PK  Q+KL+  N HPHLI+F  I
Sbjct  11    SNFHIAMFPWFAMGHLTPFLHLPNELAARGHRITFLLPKKAQTKLQHLNHHPHLITFHSI  70

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLK--VDVVFYDFT  1240
              VP + GLP GAET S++P  S H L  AMD+T++ I   LK    D K  +D++ +D  
Sbjct  71    TVPHVEGLPKGAETASEIPLSSIHFLTIAMDRTRDQIHDFLKASAADPKHIIDMIVFDLA  130

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMK-APASFPDPSI  1069
             HW+P +AR +GIKS++Y  I   ++  AL  +PE   V   +TE    +  P  +P  ++
Sbjct  131   HWIPDIARGLGIKSIYYGVICAAVYAAALVPTPECNSVPMTVTEERQRRNPPPPYPSSTV  190

Query  1068  KLHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQK  889
                 +E R   A      G  +TF+ R+ T+  E D     TCRE+EG FCDY+E ++QK
Sbjct  191   VTRDYEVRSLIA-IREPCGEGVTFYQRVITSTKECDAFCLRTCRELEGDFCDYLEAKYQK  249

Query  888   pvllagpalpvPS-KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELT  712
             PVLL GP L +      +E +W++W   F+ GSV++CA GS+    KD+FQE L G ELT
Sbjct  250   PVLLTGPVLGLNKIPQQLEDRWAEWFAGFEAGSVVFCAVGSQWIFEKDQFQEXLLGFELT  309

Query  711   GMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGW  532
             G+PF  ALKP    E+IE A+P+  +E+++GRG+V   WVQQ L L HP+VGCFV HCG+
Sbjct  310   GLPFLVALKPLLGCETIEEALPDGFEERVRGRGVVFXGWVQQPLILSHPAVGCFVHHCGF  369

Query  531   ASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAV  352
              S+ E+L++  QIVL+PQ  DQI+  ++M+  L       + EE G  S+ S+ +A+K+V
Sbjct  370   GSMWESLLSKKQIVLVPQWPDQILGTKLMAKEL-KVAVEVEREESGWISKGSLKEAIKSV  428

Query  351   MDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             MD +SE+G  V+ NH+K R  +  A   S Y+D F Q L+
Sbjct  429   MDTESEVGVMVKRNHEKWREIVSEAGFMSGYVDRFVQNLK  468



>ref|XP_004146274.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=471

 Score =   363 bits (932),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 296/466 (64%), Gaps = 13/466 (3%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  1414
             G +    H+ M+PWF  GH+T F  ++N LA K HRI+FL+P N  S   S NL+P LIS
Sbjct  4     GKETQNLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSSLFSSLNLYPDLIS  63

Query  1413  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             F  + +PS+PGLPP A + SD+P   T LL  A+D T+  ++ I+  L+ D VF+DF HW
Sbjct  64    FHFLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFAHW  123

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAPASFPDPSIKLH-  1060
             +P +   + I+S+ ++ +S       + P RRV +   LT+ D  + P  +P  ++  H 
Sbjct  124   IPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPSSTVVFHG  183

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
             + E+R     + M FG  ITF +R  T+  +SD +A  TC+EIEG FCD++  QFQK +L
Sbjct  184   SRESRSLLFLS-MPFGQGITFHERFMTSYKKSDAIAMRTCQEIEGDFCDFLSNQFQKKIL  242

Query  879   lagpalpvPSK----STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELT  712
             L GP +  PS     +T++++W  WLG+F++ +VI+CAFGS+  L K + +EL+ G+E T
Sbjct  243   LTGPLMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAFGSQVILEKQQLEELVLGIEQT  302

Query  711   GMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGW  532
             G+PF  ALKPP   +S+E A+P+  +E+++ RGIV+G WVQQ L L H S+GCFVSHCG+
Sbjct  303   GLPFLVALKPPMGYDSMEEALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGF  362

Query  531   ASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAV  352
              S+ E+L++D QIVL+P +GDQI+N R+++  L       K EEDG F+R+SV +A++ V
Sbjct  363   GSMWESLMSDAQIVLIPTLGDQILNTRLLAQEL-KVGVEVKREEDGSFTRQSVRQAIELV  421

Query  351   M-----DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             M     + +S +G  V+ NH K +  L        Y+D+F +KLQ+
Sbjct  422   MVDDKNNNRSGVGEIVKKNHAKWKDLLTKPGFLETYIDNFVKKLQE  467



>ref|XP_008226434.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=450

 Score =   362 bits (929),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 200/449 (45%), Positives = 286/449 (64%), Gaps = 6/449 (1%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             M+PWF +GH+  +  LAN+LA +GHRI+FL+P   + +L+   LH +LI F P+ VP + 
Sbjct  1     MFPWFAMGHINPYLHLANELASRGHRITFLVPNKARLQLQHLVLHSNLIVFSPVAVPHVH  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             G P G E  S++P   THLL  AMD+T+ +IE  L   K D V YD   W+P +AR+ G 
Sbjct  61    GFPDGTEIASEIPIHMTHLLATAMDRTRGEIEQFLTVSKPDFVLYDTAQWVPEIARRNGT  120

Query  1203  KSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARGFTART  1027
             K+V Y+ +        L P R V   + +TE ++ + PA +P  ++ L   EA+  T  T
Sbjct  121   KTVCYNFVCAAALAITLVPARNVPKDRPITEEELREPPAGYPSKNVVLRGAEAKALTFIT  180

Query  1026  VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPS-  850
              + +G  ITF++R  TA+ E D L+  TCRE+EG  CDYIE Q++KPVLL GP L + S 
Sbjct  181   -LPYGEGITFYERTKTAMKECDVLSIRTCRELEGDLCDYIEAQYKKPVLLTGPVLGLGSD  239

Query  849   --KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppf  676
                  +E++W  W   F+ GSV++CAFGS+  L KD+FQEL+ G ELT +PFF ALKPP 
Sbjct  240   KKSEKLEERWEKWFSGFEAGSVVFCAFGSQWILEKDQFQELVLGFELTRLPFFVALKPPL  299

Query  675   eaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQ  496
                +IE A+P   +E+++GRG+V G WVQQ   L H SVGCFV+HCG+ S+ E+L+   Q
Sbjct  300   GCATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESLMTHNQ  359

Query  495   IVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             IVL+PQ+GDQI+N +++   L       + EE+G FS+ES+ KA+K+VMD+ SE+G  ++
Sbjct  360   IVLVPQLGDQILNTKLLVKEL-KVAVEVEREENGWFSKESLRKAIKSVMDKDSEVGVMIK  418

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH K    L +    S Y+D F QKL++
Sbjct  419   ENHAKWVETLSSPGFMSGYIDRFVQKLKE  447



>ref|XP_009127123.1| PREDICTED: UDP-glycosyltransferase 79B10-like [Brassica rapa]
Length=451

 Score =   362 bits (929),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 200/450 (44%), Positives = 288/450 (64%), Gaps = 16/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+T +  LANKLA KGHR++FL+PK  + +LE  NL P  I F PI +
Sbjct  9     FHAFMFPWFAFGHMTPYVHLANKLAEKGHRVTFLLPKKAKKQLEHLNLFPDSIVFHPITI  68

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SD+P      L  AMD T++ +E  ++ L+ D++ +D  +W+  +A+
Sbjct  69    PHVDGLPAGAETPSDIPVTLWRFLSTAMDLTRDQVEAAVRALRPDIILFDLAYWITEVAK  128

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             + GIKS+ Y+ IS     + L P            ++   P  +P  ++    H+A    
Sbjct  129   EHGIKSMLYNVISATSIAHDLVP----------GGELGVPPPGYPSSTLLFRRHDAHALL  178

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
             +  V        F+ R+ T +++ D ++  TC EIEG+FCDYI  Q+QK VLL GP LP 
Sbjct  179   SFAVYY----KRFYYRVTTGLTDCDFISIRTCEEIEGKFCDYIGRQYQKKVLLTGPMLPE  234

Query  855   PSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P KS  +E KW++WL  F+ GSV+YCA GS+ TL KD+FQEL  GLELTG+PFF A+ PP
Sbjct  235   PDKSKPLEDKWNNWLSGFEPGSVVYCALGSQITLEKDQFQELCLGLELTGLPFFVAVTPP  294

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               A++I+ A+PE  +E+++GRG+V GEWVQQ L L HPSVGCFVSHCG+ S+ E+L++DC
Sbjct  295   KGAKTIQEALPEGFEERVKGRGVVWGEWVQQPLILAHPSVGCFVSHCGFGSMWESLMSDC  354

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+++  L         E+ G FS+E++  AV +VMD+ SEIG  V
Sbjct  355   QIVLLPYLADQVLNTRLLTDEL-EVSVEVPREKTGWFSKENLSVAVTSVMDKDSEIGNLV  413

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH KL+  +++  L + Y D+F   L++
Sbjct  414   RRNHSKLKEVVVSPGLLTGYTDNFVVTLEN  443



>ref|XP_010644165.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=454

 Score =   362 bits (929),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 219/451 (49%), Positives = 301/451 (67%), Gaps = 9/451 (2%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H+ MYPW   GH+  +  L+N+LA +GH I+F++PK  QS+L+  NLHP LISF  + +
Sbjct  9     FHIVMYPWSAFGHMIPYLHLSNELAERGHSITFILPKKVQSQLQHLNLHPTLISFHSLTI  68

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLPPGAET SDVP    HLL  AMD+T + +E  L+ LK D +FYD  +W P LA 
Sbjct  69    PYVDGLPPGAETASDVPISLHHLLATAMDRTTDQVEAALRALKSDFLFYDTAYWAPPLAS  128

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKA--PASFPDPSIKLHAHEARG  1042
             K+G+KS+FYS +S     Y L     V+ +Q++++  +    P  +P  ++ L  HEAR 
Sbjct  129   KLGMKSIFYSAVSASAFSYCL-----VLDQQISKSRPIPTGPPPGYPSSTVVLRPHEAR-  182

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                  +  FG DITF +R+  A+   D ++  TC+EIEG FCDYIE +F KPV + GP L
Sbjct  183   LLQFLLFPFGEDITFHERLTAAIKLCDVVSIRTCQEIEGPFCDYIERRFGKPVFVTGPVL  242

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
               PS    E +W+ WL  FK GSVI+CAFGS+    KD+FQELL G ELTG+PF AALKP
Sbjct  243   VEPSPLAPEDRWAQWLSGFKPGSVIFCAFGSQNFPGKDQFQELLLGFELTGLPFLAALKP  302

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  A +IE A+PE  +E++ GRG+V+G WV Q   L HPSVGCFVSHCG+ S+ E+L++D
Sbjct  303   PLGAATIEEALPEGFQERVGGRGVVYGGWVPQPSILSHPSVGCFVSHCGFGSMWESLMSD  362

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
              QIVL+P++ DQ  NAR+++  LKV VEVEK E   V S+E +CKA+K+VMDE+ E+G  
Sbjct  363   PQIVLVPELFDQTFNARLLAEELKVAVEVEKEENGWV-SKEGLCKAIKSVMDEEGEVGCL  421

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             V+ NH K +  L++    S Y+D+F ++L D
Sbjct  422   VKKNHAKWKETLMSQGFMSNYIDNFVRQLLD  452



>ref|XP_009132456.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Brassica rapa]
Length=447

 Score =   361 bits (927),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 194/456 (43%), Positives = 285/456 (63%), Gaps = 13/456 (3%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P  I
Sbjct  1     MGSK---FHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPECI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + +PS+ GLP GA+TT+D+P      L  AMD+T+  +E  ++  K D++F+DF H
Sbjct  58    VFHTLTIPSVDGLPDGAQTTADIPITLGGFLASAMDRTRGQVEEAVRLGKPDLIFFDFAH  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +A++ G K V + TIS      +  P R       +  ++   P  +P   + L  
Sbjct  118   WIPEVAKEYGAKCVNFLTISAACVAISFVPGR-------SPDELTVPPPGYPSSKVVLRG  170

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQ-Kpvl  880
              E   F +     FG  +TF++RI T + + D ++  TC+EIEG FCD+IE +FQ K +L
Sbjct  171   QETN-FLSFLSYPFGDGVTFYERIMTGLVKCDVISIRTCQEIEGIFCDFIEREFQRKVLL  229

Query  879   lagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPF  700
                      +   +E +W  WL +F+ GSV+YC+ GS+  L K++FQEL  G+ELTG+PF
Sbjct  230   TGPMLPEPDNIKPLEDRWHQWLNRFEPGSVVYCSLGSQIILEKEEFQELCLGMELTGLPF  289

Query  699   FAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLS  520
               A+KPP  A +I+ A+PE  +++++ RG+V GE VQQ L L HPS+GCFVSHCG+ S+ 
Sbjct  290   LVAVKPPKGASTIQEALPEGFEDRVKERGVVWGEGVQQPLILAHPSIGCFVSHCGFGSMW  349

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             E+L+NDCQIV +P +G+QI N R+MS  L       K EE G FS+E++  AV++VMD  
Sbjct  350   ESLLNDCQIVFIPHLGEQIFNTRLMSEEL-EVSVEVKREETGWFSKENISGAVRSVMDND  408

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +E+G  VR NH KL+  LL++ + S Y + + + L+
Sbjct  409   TELGNLVRRNHAKLKESLLSSGIISGYANKYVEALE  444



>ref|NP_189604.1| UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
 sp|Q9LJA6.1|U79B4_ARATH RecName: Full=UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
 dbj|BAB01199.1| UDP-glycose: flavonoid glucosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE77593.1| UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
Length=448

 Score =   361 bits (927),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 288/460 (63%), Gaps = 22/460 (5%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  +YPWFG GH+  +  LANKLA KGHR++FL PK  Q +LE  NL P+ I
Sbjct  1     MGSK---FHAFLYPWFGFGHMIPYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + +P + GLP GAETT+D+P  S  +L +AMD  +  IE+ ++ LK D++F+DF  
Sbjct  58    HFENVTLPHVDGLPVGAETTADLPNSSKRVLADAMDLLREQIEVKIRSLKPDLIFFDFVD  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +A+++GIKSV Y  IS        +P           A++   P  FP   + L  
Sbjct  118   WIPQMAKELGIKSVSYQIISAAFIAMFFAP----------RAELGSPPPGFPSSKVALRG  167

Query  1056  HEARGFTA-RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
             H+A  ++      KF      FDR+ T +   D +A  TC EIEG  CD+IE Q Q+ VL
Sbjct  168   HDANIYSLFANTRKF-----LFDRVTTGLKNCDVIAIRTCAEIEGNLCDFIERQCQRKVL  222

Query  879   lagpa---lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             L GP        S   +E +W++WL  F+  SV+YCAFG+      D+FQEL  G+ELTG
Sbjct  223   LTGPMFLDPQGKSGKPLEDRWNNWLNGFEPSSVVYCAFGTHFFFEIDQFQELCLGMELTG  282

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  A+ PP  + +I+ A+PE  +E+I+GRGIV G WV+Q L L HPS+GCFV+HCG+ 
Sbjct  283   LPFLVAVMPPRGSSTIQEALPEGFEERIKGRGIVWGGWVEQPLILSHPSIGCFVNHCGFG  342

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+LV+DCQIV +PQ+ DQ++  R+++  L+V V+V++ E  G FS+ES+   VK+VM
Sbjct  343   SMWESLVSDCQIVFIPQLVDQVLTTRLLTEELEVSVKVKRDEITGWFSKESLRDTVKSVM  402

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             D+ SEIG  VR NH KL+  L++  L S Y D F  +L++
Sbjct  403   DKNSEIGNLVRRNHKKLKETLVSPGLLSSYADKFVDELEN  442



>ref|XP_008386212.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Malus domestica]
Length=472

 Score =   362 bits (929),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 201/464 (43%), Positives = 292/464 (63%), Gaps = 19/464 (4%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H+AM+PWF +GHLT F  L N+LA +GHRI+FL+PK  Q+KL+  N HPHLI+F  I
Sbjct  11    SNFHIAMFPWFAMGHLTPFLHLXNELAARGHRITFLLPKKAQTKLQHLNHHPHLITFHSI  70

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLK--VDVVFYDFT  1240
              VP + GLP GAET S++P  S H L  AMD+T++ I   LK    D K  +D++ +D  
Sbjct  71    TVPHVEGLPKGAETASEIPLSSIHFLTIAMDRTRDQIHDFLKASAADPKHIIDMIVFDLA  130

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMK-APASFPDPSI  1069
             HW+P +AR +GIKS++Y  I   ++  AL  +PE   V   +TE    +  P  +P  ++
Sbjct  131   HWIPDIARGLGIKSIYYGVICAAVYAAALVPTPECNSVPMTVTEERQRRNPPPPYPSSTV  190

Query  1068  KLHAHEARGFTARTVMKF----GGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIET  901
              +     R +  R+++      G  +TF+ R+ T+  E D     TCRE+EG FCDY+E 
Sbjct  191   VM----TRDYEVRSLIAIREPCGEGVTFYQRVITSTKECDAFCLRTCRELEGDFCDYLEA  246

Query  900   QFQKpvllagpalpvPS-KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWG  724
             ++QKPVLL GP L +      +E +W++W   F+ GSV++CA GS+    KD+FQE L G
Sbjct  247   KYQKPVLLTGPVLGLNKIPQQLEDRWAEWFAGFEAGSVVFCAVGSQWIFEKDQFQEXLLG  306

Query  723   LELTGMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVS  544
              ELTG+PF  ALKP    E+IE A+P+  +E+++GRG+V   WVQQ L L HP+VGCFV 
Sbjct  307   FELTGLPFLVALKPLLGCETIEEALPDGFEERVRGRGVVFXGWVQQPLILSHPAVGCFVH  366

Query  543   HCGWASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKA  364
             HCG+ S+ E+L++  QIVL+PQ  DQI+  ++M+  L       + EE G  S+ S+ +A
Sbjct  367   HCGFGSMWESLLSKKQIVLVPQWPDQILGTKLMAKEL-KVAVEVEREESGWISKGSLKEA  425

Query  363   VKAVMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             +K+VMD +SE+G  V+ NH+K R  +  A   S Y+D F Q L+
Sbjct  426   IKSVMDTESEVGVMVKRNHEKWREIVSEAGFMSGYVDRFVQNLK  469



>ref|XP_004166346.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B6-like 
[Cucumis sativus]
Length=471

 Score =   362 bits (928),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 295/466 (63%), Gaps = 13/466 (3%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  1414
             G +    H+ M+PWF  GH+T F  ++N LA K HRI+FL+P N  S   S NL+P LIS
Sbjct  4     GKETQNLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSSLFSSLNLYPDLIS  63

Query  1413  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             F  + +PS+PGLPP A + SD+P   T LL  A+D T+  ++ I+  L+ D VF+DF HW
Sbjct  64    FHFLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFAHW  123

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAPASFPDPSIKLH-  1060
             +P +   + I+S+ ++ +S       + P RRV +   LT+ D  + P  +P  ++  H 
Sbjct  124   IPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPSSTVVFHG  183

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
             + E+R     + M FG  ITF +R  T+  +SD +A  TC+EIEG FCD++  QFQK +L
Sbjct  184   SRESRSLLFLS-MPFGQGITFHERFMTSYKKSDAIAMRTCQEIEGDFCDFLSNQFQKKIL  242

Query  879   lagpalpvPSK----STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELT  712
             L GP +  PS     +T++++W  WLG+F++ +VI+CAFGS+  L K + +EL+ G+E T
Sbjct  243   LTGPLMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAFGSQVILEKQQLEELVLGIEQT  302

Query  711   GMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGW  532
             G+PF  ALKPP   +S+E A+P+  +E+++ RGIV+G WVQQ L L H S+GCFVSHCG+
Sbjct  303   GLPFLVALKPPMGYDSMEEALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGF  362

Query  531   ASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAV  352
              S+ E+L++D QIVL+P +GDQI+N R+++  L       K EEDG F+R+SV +A++ V
Sbjct  363   GSMWESLMSDAQIVLIPTLGDQILNTRLLAQEL-KVGVEVKREEDGSFTRQSVRQAIELV  421

Query  351   M-----DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             M     + +S +G  V  NH K +  L        Y+D+F +KLQ+
Sbjct  422   MVDDKNNNRSGVGEIVXENHAKWKDLLTKPGFLETYIDNFVKKLQE  467



>gb|KGN57635.1| hypothetical protein Csa_3G236030 [Cucumis sativus]
Length=521

 Score =   363 bits (932),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 296/466 (64%), Gaps = 13/466 (3%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  1414
             G +    H+ M+PWF  GH+T F  ++N LA K HRI+FL+P N  S   S NL+P LIS
Sbjct  54    GKETQNLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSSLFSSLNLYPDLIS  113

Query  1413  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             F  + +PS+PGLPP A + SD+P   T LL  A+D T+  ++ I+  L+ D VF+DF HW
Sbjct  114   FHFLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSLRPDFVFFDFAHW  173

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAPASFPDPSIKLH-  1060
             +P +   + I+S+ ++ +S       + P RRV +   LT+ D  + P  +P  ++  H 
Sbjct  174   IPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPSSTVVFHG  233

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
             + E+R     + M FG  ITF +R  T+  +SD +A  TC+EIEG FCD++  QFQK +L
Sbjct  234   SRESRSLLFLS-MPFGQGITFHERFMTSYKKSDAIAMRTCQEIEGDFCDFLSNQFQKKIL  292

Query  879   lagpalpvPSK----STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELT  712
             L GP +  PS     +T++++W  WLG+F++ +VI+CAFGS+  L K + +EL+ G+E T
Sbjct  293   LTGPLMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAFGSQVILEKQQLEELVLGIEQT  352

Query  711   GMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGW  532
             G+PF  ALKPP   +S+E A+P+  +E+++ RGIV+G WVQQ L L H S+GCFVSHCG+
Sbjct  353   GLPFLVALKPPMGYDSMEEALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGF  412

Query  531   ASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAV  352
              S+ E+L++D QIVL+P +GDQI+N R+++  L       K EEDG F+R+SV +A++ V
Sbjct  413   GSMWESLMSDAQIVLIPTLGDQILNTRLLAQEL-KVGVEVKREEDGSFTRQSVRQAIELV  471

Query  351   M-----DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             M     + +S +G  V+ NH K +  L        Y+D+F +KLQ+
Sbjct  472   MVDDKNNNRSGVGEIVKKNHAKWKDLLTKPGFLETYIDNFVKKLQE  517



>gb|AAM65481.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
Length=446

 Score =   360 bits (924),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 282/449 (63%), Gaps = 17/449 (4%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYPWF  GH+T F  LANKLA KGH ++FLIPK    +LE+ NL PH I F  + VP + 
Sbjct  1     MYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTVPHVD  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLP G ET S++P  S  LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR  G+
Sbjct  61    GLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVEPDLIFFDFAHWIPEVARDFGL  120

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA---RGFTA  1033
             K+V Y  +S       L P            ++   P  +P   + L   +A   +   +
Sbjct  121   KTVKYVVVSASTIASMLVPG----------GELGVPPPGYPSSKVLLRKQDAYTMKNLES  170

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                +  G ++   +R+ T++  SD +A  T REIEG FCDYIE   +K VLL GP  P P
Sbjct  171   TNTINVGPNL--LERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPVFPEP  228

Query  852   SKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppf  676
              K+  +E++W  WL  ++  SV++CA GS+  L KD+FQEL  G+ELTG PF  A+KPP 
Sbjct  229   DKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAVKPPR  288

Query  675   eaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQ  496
              + +I+ A+PE  +E+++GRG+V GEWVQQ L L HPSVGCFVSHCG+ S+ E+L++DCQ
Sbjct  289   GSSTIQEALPEGFEERVKGRGVVWGEWVQQPLLLSHPSVGCFVSHCGFGSMWESLLSDCQ  348

Query  495   IVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             IVL+PQ+GDQ++N R++S  L         EE G FS+ES+  A+ +VM   SEIG  V+
Sbjct  349   IVLVPQLGDQVLNTRLLSDEL-KVSVEVAREETGWFSKESLFDAINSVMKRDSEIGNLVK  407

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              NH K R  L +  L + Y+D+F + LQD
Sbjct  408   KNHTKWRETLTSPGLVTGYVDNFIESLQD  436



>emb|CDY65923.1| BnaCnng49110D [Brassica napus]
Length=448

 Score =   360 bits (923),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 195/450 (43%), Positives = 289/450 (64%), Gaps = 15/450 (3%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+  +  LANKLA KGHR++FL+PK  Q +LE  +L P  I F P+ +
Sbjct  5     FHAFMFPWFAFGHMIPYLHLANKLAEKGHRVTFLLPKKAQKQLEYHSLFPDNILFHPLTI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SD+     + L  AMD T++ +   +  L+ D++ +DF +W+P +A+
Sbjct  65    PPVDGLPAGAETASDISISWGNFLFAAMDLTRDQVTATVHALRPDLILFDFAYWVPEMAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +  +KSV Y+ +S             +   Q+  +++   P  +P   +   AH+A   +
Sbjct  125   EHRVKSVVYNVVS----------ATTIAHNQVPGSELGVPPPGYPSAKVVYRAHDAHALS  174

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
             + ++     +  F+ R+ T ++  D ++  TC EIEG+FCDYI  Q+QK VLL GP LP 
Sbjct  175   SLSIYY---ERLFYYRVTTGLTNCDFISIRTCEEIEGKFCDYIGRQYQKKVLLTGPMLPE  231

Query  855   PSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P KS  +E KW++WL +F+ GSV+YCA GS+ TL KD+FQEL  GLELTG+PFF A+ PP
Sbjct  232   PDKSKPLEDKWNNWLSRFEPGSVVYCALGSQITLEKDQFQELCLGLELTGLPFFVAVTPP  291

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               A++I+ A+PE  +E ++GRG+V GEWVQQ L L HPSVGCFVSHCG+ S+ E+L++DC
Sbjct  292   KGAKTIQEALPEGFEEGVKGRGVVWGEWVQQPLILAHPSVGCFVSHCGFGSMWESLMSDC  351

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+++  L         E+ G FS+E++  AV +VMD+ SEIG  V
Sbjct  352   QIVLLPYLADQVLNTRLLTDEL-EVSVEVPREKTGWFSKENLSAAVTSVMDKDSEIGNLV  410

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH KL+  +++  L + Y D+F   L++
Sbjct  411   RRNHSKLKEVVVSPGLLTGYTDNFVVTLEN  440



>emb|CDY28802.1| BnaA02g09940D [Brassica napus]
Length=451

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 199/450 (44%), Positives = 287/450 (64%), Gaps = 16/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+T +  LANKLA KGHR++FL+PK    +LE  NL P  I F PI +
Sbjct  9     FHAFMFPWFAFGHMTPYVHLANKLAEKGHRVTFLLPKKANKQLEHLNLFPDSIVFHPITI  68

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SD+P      L  AMD T++ +E  ++ L+ D++ +D  +W+  +A+
Sbjct  69    PHVDGLPAGAETPSDIPVTLWRFLSTAMDLTRDQVEAAVRALRPDIILFDLAYWITEVAK  128

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             + GIKS+ Y+ IS     + L P            ++   P  +P  ++    H+A    
Sbjct  129   EHGIKSMLYNVISATSIAHDLVP----------GGELGVPPPGYPSSTLLFRRHDAHALL  178

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
             +  V        F+ R+ T +++ D ++  TC EIEG+FCDYI  Q+QK VLL GP LP 
Sbjct  179   SFAVYY----KRFYYRVTTGLTDCDFISIRTCEEIEGKFCDYIGRQYQKKVLLTGPMLPE  234

Query  855   PSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P KS  +E KW++WL  F+ GSV+YCA GS+ TL K++FQEL  GLELTG+PFF A+ PP
Sbjct  235   PDKSKPLEDKWNNWLSGFEPGSVVYCALGSQITLEKNQFQELCLGLELTGLPFFVAVTPP  294

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               A++I+ A+PE  +E+++GRG+V GEWVQQ L L HPSVGCFVSHCG+ S+ E+L++DC
Sbjct  295   KGAKTIQEALPEGFEERVKGRGVVWGEWVQQPLILAHPSVGCFVSHCGFGSMWESLMSDC  354

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+++  L         E+ G FS+E++  AV +VMD+ SEIG  V
Sbjct  355   QIVLLPYLADQVLNTRLLTDEL-EVSVEVPREKTGWFSKENLSVAVTSVMDKDSEIGNLV  413

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH KL+  +++  L + Y D+F   L++
Sbjct  414   RRNHSKLKEVVVSPGLLTGYTDNFVVTLEN  443



>ref|XP_011082711.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X1 [Sesamum indicum]
 ref|XP_011082712.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X2 [Sesamum indicum]
Length=457

 Score =   360 bits (923),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 198/453 (44%), Positives = 286/453 (63%), Gaps = 6/453 (1%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             + +  H+AM+PW  +GH+T F  LAN+LA +GH IS LIP     +L   +L+P LI F 
Sbjct  5     EKSKLHIAMFPWVAIGHITPFIHLANELAKRGHSISILIPNKPLLQLGHHSLYPDLIKFH  64

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
              + +P + GLPPGAET SD+   + + L  A D T   +E IL  LK D+VFYDF  W+P
Sbjct  65    VVTIPQVEGLPPGAETASDIDITAKNPLAIAFDATAEQVETILSGLKPDIVFYDFADWIP  124

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHE  1051
              +A ++G K+V Y+ I        + P R +   ++LTE ++ + P  +P  ++ L   E
Sbjct  125   KMAARVGFKTVCYNVICASCMAIGIVPARHIPKDRRLTEEELGQPPKGYPSSTVVLRGQE  184

Query  1050  ARGFTARTVMKFGGDITFFD-RIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             A   +    M +G   T FD RI  A+   D +   TCRE+EG  CDY+  Q+ KPV L+
Sbjct  185   ALTLSF-IAMDYGA--TKFDVRITAAMQGCDAIGIRTCRELEGPMCDYLSEQYNKPVFLS  241

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP LP   K  +E+KW  WL KFK  SV+YCAFGS+  L+K +FQE++ G E+TG+PFF 
Sbjct  242   GPVLPENPKGALEEKWDKWLSKFKPKSVVYCAFGSQLMLQKKQFQEMVLGFEMTGLPFFV  301

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             A+  P  A+SIE A+PE   E++  RG+VHG WVQQ   L HPSVGCFVSHCG+ S+ E+
Sbjct  302   AVSKPHGADSIEEALPEGFLERVGDRGVVHGGWVQQTQGLNHPSVGCFVSHCGFGSMWES  361

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             L+++ QIVL+P++ DQI+N R+++  L       +  E G FS+E + KA+K+VMDE+SE
Sbjct  362   LLSESQIVLVPRLADQILNTRLLAEEL-KVAVEVERGEMGWFSKEDLSKAIKSVMDEESE  420

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             +G+ V+ NH K R  L++ +    Y+D+F ++L
Sbjct  421   VGKLVKENHGKWRETLMSPEFMDNYVDNFIRQL  453



>dbj|BAE99810.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
Length=448

 Score =   359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 287/460 (62%), Gaps = 22/460 (5%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  +YPWFG GH+  +  LANKLA KGHR++FL PK  Q +LE  NL P+ I
Sbjct  1     MGSK---FHAFLYPWFGFGHMIPYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + +P + GLP GAETT+D+P  S  +L +AMD  +  IE+ ++ LK D++F+DF  
Sbjct  58    HFENVTLPHVDGLPVGAETTADLPNSSKRVLADAMDLLREQIEVKIRSLKPDLIFFDFVD  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +A+++GIKSV Y  IS        +P           A++   P  FP   + L  
Sbjct  118   WIPQMAKELGIKSVSYQIISAAFIAMFFAP----------RAELGSPPPGFPSSKVALRG  167

Query  1056  HEARGFTA-RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
             H+A  ++      KF      FDR+ T +   D +A  TC EIEG  CD+IE Q Q+ VL
Sbjct  168   HDANIYSLFANTRKF-----LFDRVTTGLKNCDVIAIRTCAEIEGNLCDFIERQCQRKVL  222

Query  879   lagpa---lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             L GP        S   +E +W++WL  F+  SV+YCAFG+      D+FQEL  G+ELTG
Sbjct  223   LTGPMFLDPQGKSGKPLEDRWNNWLNGFEPSSVVYCAFGTHFFFEIDQFQELCLGMELTG  282

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  A+ PP  + +I+ A+PE  +E+I+GRGIV G WV+Q L L HPS+GCFV+HCG+ 
Sbjct  283   LPFLVAVMPPRGSSTIQEALPEGFEERIKGRGIVWGGWVEQPLILSHPSIGCFVNHCGFG  342

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+LV+DCQIV +PQ+ DQ++  R+++  L+V V+V++ E  G FS+ES+   VK+VM
Sbjct  343   SMWESLVSDCQIVFIPQLVDQVLTTRLLTEELEVSVKVKRDEITGWFSKESLRDTVKSVM  402

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             D+ SEIG  VR NH KL+  L++  L   Y D F  +L++
Sbjct  403   DKNSEIGNLVRRNHKKLKETLVSPGLLGSYADKFVDELEN  442



>ref|XP_009340549.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Pyrus x bretschneideri]
Length=456

 Score =   360 bits (923),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 200/458 (44%), Positives = 292/458 (64%), Gaps = 19/458 (4%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             M+PWF +GHLT F  L+N+LA +GHRI+FL+PK  Q+KL+  N HPHLI+F  I VP + 
Sbjct  1     MFPWFAMGHLTPFLHLSNELAARGHRITFLLPKKAQTKLQHLNHHPHLITFHSITVPHVE  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILK----DLK--VDVVFYDFTHWLPSL  1222
             GLP  AET S++P  S H L  AMD+T++ I   LK    D K  +D++ +D  HW+P +
Sbjct  61    GLPKSAETASEIPLSSIHFLTIAMDRTRDQIHAFLKASAADPKHIIDMIVFDLAHWIPDI  120

Query  1221  ARKIGIKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMKAPAS-FPDPSIKLHAHE  1051
             AR +GIKS++Y  I   ++  AL  +PE   V   +TE    + P S +P  ++ +    
Sbjct  121   ARGLGIKSIYYGVICAAVYAAALVPAPECNSVPMTVTEERQRRNPPSTYPSSTVVM----  176

Query  1050  ARGFTARTVMKF----GGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpv  883
              R +  R+++      G  +TF+ R+ T+  E D     TCRE+EG FCDY+E ++QKPV
Sbjct  177   TRDYEVRSLIAIREPCGEGVTFYQRVITSTKECDAFCLRTCRELEGDFCDYLEAKYQKPV  236

Query  882   llagpalpvPS-KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
             LL GP L +      +E +W++W   F+ GS+++CA GS+    KD+FQE+L G ELTG+
Sbjct  237   LLTGPVLGLNKIPQQLEDRWAEWFAGFEAGSLVFCAVGSQWIFEKDQFQEVLLGFELTGL  296

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PF  ALKPP   E+IE A+P+  +E+++GRG+V G WVQQ L L HP+VGCFV HCG+ S
Sbjct  297   PFLVALKPPLGCETIEEALPDGFEERVRGRGVVFGGWVQQPLILSHPAVGCFVHHCGFGS  356

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             + E+L++  QIVL+PQ  DQI+  ++M+  L       + EE G  S+E++ +A+K+VMD
Sbjct  357   MWESLLSKKQIVLVPQWPDQILGTKLMAKEL-KVAVEVEREESGWISKENLKEAIKSVMD  415

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              +SE+G  V+ NH+K R  +  A   S Y+D F Q L+
Sbjct  416   TESEVGVVVKRNHEKWREIVSEAGFMSGYVDRFVQNLK  453



>ref|NP_200210.1| UDP-glycosyltransferase 79B9 [Arabidopsis thaliana]
 sp|Q9FN28.1|U79B9_ARATH RecName: Full=UDP-glycosyltransferase 79B9 [Arabidopsis thaliana]
 dbj|BAB10729.1| flavonol 3-O-glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL38880.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AAM20183.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AED96436.1| UDP-glycosyltransferase 79B9 [Arabidopsis thaliana]
 gb|AHL38581.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=447

 Score =   358 bits (920),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 203/451 (45%), Positives = 285/451 (63%), Gaps = 16/451 (4%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
              +H  M+PWF  GH+T +  LANKLA KGHR++FL+PK  Q +LE  NL P  I F  + 
Sbjct  4     NFHAFMFPWFAFGHMTPYLHLANKLAAKGHRVTFLLPKKAQKQLEHHNLFPDRIIFHSLT  63

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             +P + GLP GAET SD+P      L  AMD T++ +E  ++ L+ D++F+D  +W+P +A
Sbjct  64    IPHVDGLPAGAETASDIPISLGKFLTAAMDLTRDQVEAAVRALRPDLIFFDTAYWVPEMA  123

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGF  1039
             ++  +KSV Y  IS     + L P            ++   P  +P   +    H+A   
Sbjct  124   KEHRVKSVIYFVISANSIAHELVPG----------GELGVPPPGYPSSKVLYRGHDAHAL  173

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
                ++  F   + +  RI T +   D ++  TC+EIEG+FCDYIE Q+Q+ VLL GP LP
Sbjct  174   LTFSI--FYERLHY--RITTGLKNCDFISIRTCKEIEGKFCDYIERQYQRKVLLTGPMLP  229

Query  858   vPSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
              P  S  +E +W+ WL +FK GSVIYCA GS+ TL KD+FQEL  G+ELTG+PF  A+KP
Sbjct  230   EPDNSRPLEDRWNHWLNQFKPGSVIYCALGSQITLEKDQFQELCLGMELTGLPFLVAVKP  289

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  A++I+ A+PE  +E+++  G+V GEWVQQ L L HPSVGCFV+HCG+ S+ E+LV+D
Sbjct  290   PKGAKTIQEALPEGFEERVKNHGVVWGEWVQQPLILAHPSVGCFVTHCGFGSMWESLVSD  349

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQIVLLP + DQI+N R+MS  L       K EE G FS+ES+  A+ +VMD+ SE+G  
Sbjct  350   CQIVLLPYLCDQILNTRLMSEEL-EVSVEVKREETGWFSKESLSVAITSVMDKDSELGNL  408

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             VR NH KL+  L++  L + Y D F + LQ+
Sbjct  409   VRRNHAKLKEVLVSPGLLTGYTDEFVETLQN  439



>ref|XP_006361401.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Solanum tuberosum]
Length=463

 Score =   359 bits (921),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 209/453 (46%), Positives = 294/453 (65%), Gaps = 8/453 (2%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
              + M+PW   GHL  F  L+N+LA KGHRISFL+PKN + KL++FNL+P+LI+F  + +P
Sbjct  10    QIVMFPWLAFGHLIPFLSLSNELAKKGHRISFLLPKNAEIKLQNFNLYPNLITFHTLKIP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              I GLP GAETT+DVP     LL  AMD+  ++I+  L++LK   VF+DF HW+P +A +
Sbjct  70    HIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLRNLKPHFVFFDFAHWVPEIATE  129

Query  1212  I-GIKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             I GIK++ Y  + P    Y+L  SP++ V     T A+ ++ P  +P  ++ LH HEA+ 
Sbjct  130   IGGIKTLCYKIVCPATSAYSLVRSPKKSVFIAS-TAAEKVRPPPGYPSTTVVLHEHEAK-  187

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                    ++G  +T ++R+   V+  D +A  TCREIEG F DYI TQF+KPVL  GP L
Sbjct  188   LLEFLFQEYGKGVTIYERLSKGVTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGPVL  247

Query  861   pvPSKSTMEQK-WSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             P   K  +E+   S+WL KF+ GSV++CAFGS+  L K +FQEL+ GLELTG+PF   +K
Sbjct  248   PDSEKGPLEEHGLSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLLVVK  307

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL-V  508
             PP   +S+E A+PE  KE++Q +G++   WV Q   L H SVGCFVSHCG+ S+ E+L +
Sbjct  308   PPEGTKSVEEALPEGFKERVQEKGLILDCWVPQLKILTHKSVGCFVSHCGYGSMWESLAL  367

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
              DCQ+VLLP   DQ ++AR+M   L       K +E+G FS+ES+CKAVK VMD+ S+ G
Sbjct  368   CDCQLVLLPSANDQTLSARLMEQDL-KVGVEVKKDENGWFSKESLCKAVKCVMDKDSQFG  426

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
               V+ NH K +  L +    + Y+DSF Q L +
Sbjct  427   CLVKENHRKWKEVLSSPGFMNNYIDSFIQNLHE  459



>ref|XP_010446327.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Camelina sativa]
Length=447

 Score =   358 bits (919),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/450 (43%), Positives = 284/450 (63%), Gaps = 16/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+  F  LANKLA  GH+++FL+PK  Q +LE  NL P  I F  + +
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAQNGHKVTFLLPKKAQKQLEHHNLFPDSIVFHTLTI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SDVP      L  A++ T++  E  ++ L+ D++F+DF+HW+P +A+
Sbjct  65    PHVDGLPAGAETASDVPLSLEKFLTAAINLTRDQAEAAVRALRPDLIFFDFSHWVPEMAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             + G+KSV Y     +   ++L P            +    P  +P   +     +A    
Sbjct  125   EHGVKSVMYFVAGAVSMAHSLVPG----------GEFGVPPPGYPSSKVLFREQDAHALL  174

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
             + ++       + + R+ T +   D ++  TC+E+EG+FCDYIE+Q+Q+ VLL GP  P 
Sbjct  175   SFSIYY----ESLYHRLTTGLMNCDFISLRTCKEVEGKFCDYIESQYQRKVLLTGPMHPE  230

Query  855   PSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P  S T+E +WS WL +F+ GSVIYCA GS+ +L KD+FQEL  G+ELTG+PF  A++PP
Sbjct  231   PDNSKTLEARWSHWLSRFEPGSVIYCALGSQISLEKDQFQELCLGMELTGLPFLVAVRPP  290

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               A++I+ A+PE  +E+++ RG+V GEWVQQ L L HPS+GCFVSHCG  S+ EALV+DC
Sbjct  291   KGAKTIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSIGCFVSHCGLGSMWEALVSDC  350

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+MS  L       + E+ G FS+ES+  A+ +VMD+ SE+G  V
Sbjct  351   QIVLLPYLSDQVLNTRLMSEEL-EVSVEVQREKTGWFSKESLSVAITSVMDKDSEVGNRV  409

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH +++  L++  L   Y+D F + LQ+
Sbjct  410   RRNHARIKEILVSPGLLIGYIDEFIETLQN  439



>ref|XP_008226433.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=439

 Score =   357 bits (917),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 195/448 (44%), Positives = 283/448 (63%), Gaps = 15/448 (3%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             M+PWF +GH+T +  LAN+LA +GHR + L+P   + +L+   LH  LI F P+ +P + 
Sbjct  1     MFPWFAIGHITPYLHLANELASRGHRTTLLVPNKARLQLQHLVLHADLIVFSPVAIPHVH  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLP G E  S++P   THLL  AMD+T+ +IE  L   K D V YD   W+P +AR+ GI
Sbjct  61    GLPEGTEIASEIPIHMTHLLATAMDRTRGEIEQFLTISKPDFVLYDTAQWVPGIARRNGI  120

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTARTV  1024
             K+V Y+ +       AL P R          ++ + PA +P  ++ L   EA+  T  + 
Sbjct  121   KTVCYNVVCAAALAIALVPAR----------NLREPPAGYPSKNVVLCGAEAKALTFIS-  169

Query  1023  MKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPS--  850
             + +G  ITF++R  TA+ E D L+  TCRE+EG  CDY+E Q++KPV+L GP L + S  
Sbjct  170   LPYGEGITFYERTTTAMKECDVLSIRTCRELEGDLCDYMEAQYKKPVILTGPVLGLGSDK  229

Query  849   -KSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
                 ++++W  W   F+ GSV++CAFG++  L KD+FQEL+ G ELTG+PFF ALKPP  
Sbjct  230   KSEKLDERWEKWFSGFEAGSVVFCAFGTQWILEKDQFQELVLGFELTGLPFFVALKPPSG  289

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
               +IE A+P   +E+++GRG+V G WVQQ   L H SVGCFV+HCG+ S+ E+L+ D QI
Sbjct  290   CATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESLMTDNQI  349

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VL+P +GDQI+N +++   L       + EE+G FS+ES+ KA+K+VMD+ SE+G  V+ 
Sbjct  350   VLVPHLGDQILNTKLLVKEL-KVAVEVEREENGWFSKESLRKAIKSVMDKDSEVGVMVKK  408

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             NH K    L +    S Y+D F QKL++
Sbjct  409   NHAKWVETLSSPGFMSGYIDRFVQKLKE  436



>emb|CAN63797.1| hypothetical protein VITISV_026414 [Vitis vinifera]
Length=443

 Score =   357 bits (916),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 202/435 (46%), Positives = 292/435 (67%), Gaps = 9/435 (2%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             +++   H+AM+PW   GH+  +  L+N+LAG+GH+I+F++P+  QSKL+  N HP LI+F
Sbjct  2     AKSPKLHIAMFPWXAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALITF  61

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P++VP + GLPPG ET SD+P   T+LL  A+D+T++ +E  L+ L   ++FYDF +W 
Sbjct  62    HPLIVPHVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTLNPHLLFYDFAYWA  121

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVG--KQLTEADMMKAPASFPDPSIKLHA  1057
             P+LA ++GIKS++YS +      +   P ++     +QLT+      P  +P  ++ L  
Sbjct  122   PALASQLGIKSIYYSAVCAAAVAHIPIPAQQGSKDCRQLTDV----PPPGYPSSTVVLRP  177

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEAR         +G  ITF  R+ TA +  D ++  TC+E +G  CDYI +Q+ KPV L
Sbjct  178   HEAR-LMDFMFAPYGEGITFQQRVTTARARGDAISIRTCQETDGPICDYIGSQYGKPVFL  236

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
              GP LP PS   +E +W+ WLG FK GSVI+CAFGS+    KD+FQELL GLELTG+PFF
Sbjct  237   TGPVLPKPSVEPLEDRWAQWLGGFKPGSVIFCAFGSQNVHEKDQFQELLLGLELTGLPFF  296

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGE-WVQQQLFLQHPSVGCFVSHCGWASLS  520
             AA+KP     +IE A+PE  +E++ GRG+VHG  WVQQ   L HPSVGCFVSHCG+ S+ 
Sbjct  297   AAVKPRTGVATIEEALPEGFQERVGGRGLVHGGWWVQQPSVLSHPSVGCFVSHCGYGSMW  356

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             E+L +D QIVL+P++ DQI+N+R+++  L       + EE+G+FS+ES+C A+K+VMDE 
Sbjct  357   ESLTSDPQIVLVPELADQILNSRLLAEEL-KVAVEVEREENGLFSKESLCDAIKSVMDEN  415

Query  339   SEIGREVRGNHDKLR  295
             SE+G  V+ NH K +
Sbjct  416   SEVGGLVKKNHAKWK  430



>ref|XP_011082713.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X3 [Sesamum indicum]
Length=458

 Score =   357 bits (916),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 200/454 (44%), Positives = 288/454 (63%), Gaps = 7/454 (2%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFV  1408
             + +  H+AM+PW  +GH+T F  LAN+LA +GH IS LIP     +L   +L+P LI F 
Sbjct  5     EKSKLHIAMFPWVAIGHITPFIHLANELAKRGHSISILIPNKPLLQLGHHSLYPDLIKFH  64

Query  1407  PIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLP  1228
              + +P + GLPPGAET SD+   + + L  A D T   +E IL  LK D+VFYDF  W+P
Sbjct  65    VVTIPQVEGLPPGAETASDIDITAKNPLAIAFDATAEQVETILSGLKPDIVFYDFADWIP  124

Query  1227  SLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHE  1051
              +A ++G K+V Y+ I        + P R +   ++LTE ++ + P  +P  ++ L   E
Sbjct  125   KMAARVGFKTVCYNVICASCMAIGIVPARHIPKDRRLTEEELGQPPKGYPSSTVVLRGQE  184

Query  1050  ARGFTARTVMKFGGDITFFD-RIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
             A   +    M +G   T FD RI  A+   D +   TCRE+EG  CDY+  Q+ KPV L+
Sbjct  185   ALTLSF-IAMDYGA--TKFDVRITAAMQGCDAIGIRTCRELEGPMCDYLSEQYNKPVFLS  241

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             GP LP   K  +E+KW  WL KFK  SV+YCAFGS+  L+K +FQE++ G E+TG+PFF 
Sbjct  242   GPVLPENPKGALEEKWDKWLSKFKPKSVVYCAFGSQLMLQKKQFQEMVLGFEMTGLPFFV  301

Query  693   AL-KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
             A+ KPP  A+SIE A+PE   E++  RG+VHG WVQQ   L HPSVGCFVSHCG+ S+ E
Sbjct  302   AVSKPPHGADSIEEALPEGFLERVGDRGVVHGGWVQQTQGLNHPSVGCFVSHCGFGSMWE  361

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             +L+++ QIVL+P++ DQI+N R+++  L       +  E G FS+E + KA+K+VMDE+S
Sbjct  362   SLLSESQIVLVPRLADQILNTRLLAEEL-KVAVEVERGEMGWFSKEDLSKAIKSVMDEES  420

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
             E+G+ V+ NH K R  L++ +    Y+D+F ++L
Sbjct  421   EVGKLVKENHGKWRETLMSPEFMDNYVDNFIRQL  454



>ref|XP_008456016.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B6-like 
[Cucumis melo]
Length=472

 Score =   357 bits (915),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 194/466 (42%), Positives = 291/466 (62%), Gaps = 13/466 (3%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLIS  1414
             G +  + H+ M+PWF  GH+T F  ++N LA K HRI+FL+P N      S NL+P+LIS
Sbjct  5     GGETQSLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSPXFHSLNLYPNLIS  64

Query  1413  FVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHW  1234
             F  + +PS+PGLPP A + SD+P   T LL  A D T+  +  I+  L+ D VF+DF HW
Sbjct  65    FHFLSLPSVPGLPPAAHSASDIPLSLTPLLASAFDLTRPQVHRIIHSLRPDFVFFDFAHW  124

Query  1233  LPSLARKIGIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAPASFPDPSIKLH-  1060
             +P +   + I+S+ ++ +S       + P RRV +   LT+ D  + P  +P  ++  H 
Sbjct  125   IPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPSSTVVFHD  184

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
             + E+R     + M FG  ITF +R+ T+  +SD +A  TC+EIEG FCD++  Q QK +L
Sbjct  185   SRESRSLLFLS-MPFGQGITFHERLMTSYKKSDAIAMRTCQEIEGDFCDFLSNQLQKKIL  243

Query  879   lagpalpvPSK----STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELT  712
             L GP +  PS     +T++++W  WLG+F+  +VI+CAFGS+  L K + +EL+ G+E T
Sbjct  244   LTGPLMAAPSSRIKATTLDKEWEKWLGQFQPKTVIFCAFGSQVILEKQQLEELVLGIEQT  303

Query  711   GMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGW  532
             G+PF  ALKPP   +S++ A+P+  +E+++ RGIV+G WVQQ L L H S+GCFVSHCG+
Sbjct  304   GLPFLVALKPPMGYDSMKEALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGF  363

Query  531   ASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAV  352
              S+ E+L++D QIVL+P +GDQI+N R+++  L       K EEDG F+R+SV +A++ V
Sbjct  364   GSMWESLMSDAQIVLIPTLGDQILNTRLLAQEL-KVGVEVKREEDGSFTRQSVRQAIELV  422

Query  351   M-----DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             M     +  S IG  V+ NH K +  L        Y+D+F   LQ+
Sbjct  423   MVDDNNNNGSGIGEMVKKNHAKWKHLLTKPSFLETYIDNFVMNLQE  468



>ref|XP_010442973.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Camelina sativa]
Length=447

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 275/450 (61%), Gaps = 16/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+T +  LANKLA  GHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHQNLFPESIVFHPLTI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SD+P      L  AMD T++ +E  ++DL+ D++F+DF +W+   A+
Sbjct  65    PHVGGLPAGAETASDIPISLGKFLTAAMDLTRDQVEAAVRDLRPDLIFFDFAYWVAETAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +  +KSV Y  IS     + L P     G +L        P  +P   +    H+A    
Sbjct  125   EHRVKSVMYFVISANSIAHELVP-----GGKLG-----VPPPGYPSSKVLYREHDAHALL  174

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQ-Kpvllagpalp  859
               ++         + RI T +   D ++  TC+E+EG+FCDYIE+Q+Q K +L       
Sbjct  175   TFSIFY----ERLYHRITTGLMNCDFISIRTCKEVEGKFCDYIESQYQRKVLLTGPMLPD  230

Query  858   vPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
               +   +E +WS WL +F+ GSVIYCA GS+  L K +FQEL  G+ELT +PF  A+KPP
Sbjct  231   PDNNKALEDRWSHWLNRFEPGSVIYCALGSQINLEKHQFQELCLGMELTSLPFLVAVKPP  290

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               A  I+ A+PE  +E+++ RG+V GEWVQQ L L HPSVGCFV+HCG+ S+ E+LV+DC
Sbjct  291   KGAVKIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVSDC  350

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+M+  L       + EE G FS+ES+  A+ +VMD+ SE+G  V
Sbjct  351   QIVLLPYLCDQVLNTRLMTEEL-EVSVEVQREETGWFSKESLSVAITSVMDKDSEVGNRV  409

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH K++  L++  L + Y D F + LQ+
Sbjct  410   RRNHAKMKEILVSPGLLTGYTDEFVETLQN  439



>ref|XP_010446317.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Camelina sativa]
Length=447

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 282/450 (63%), Gaps = 16/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+T +  LANKLA  GHR++FL+PK  Q +LE  N+ P  I F P+ +
Sbjct  5     FHAVMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHQNMFPDSIVFHPLTI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SD+P      L  AMD T++ +E  ++DL+ D++F+D+ +W+  +A+
Sbjct  65    PHVDGLPAGAETASDIPISLGKFLTAAMDLTRDQVEAAVRDLRPDLIFFDYAYWVAEMAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +  +KSV Y  IS             +  + +    +   P  +P   +    H+A    
Sbjct  125   EHRVKSVMYFVIS----------ANSIAHEHVPGGKLGVPPPGYPSSKVLYREHDAHALL  174

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
             + ++         + RI T +   D ++  TC+E+EG+FCDYIE+Q+Q+ V L GP LP 
Sbjct  175   SYSIYY----ERMYHRITTGLMNCDFISIRTCKEVEGKFCDYIESQYQRKVFLTGPMLPD  230

Query  855   PSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P  S  +E +WS WL +F+ GSVIYCA GS+  L K++FQEL  G+ELTG+PF  A+KPP
Sbjct  231   PDNSKELEDRWSHWLSRFETGSVIYCALGSQIYLEKNQFQELCLGMELTGLPFLVAVKPP  290

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
                E+I+ A+PE  +E+++ RG+V GEWVQQ L L HPSVGCFV+HCG+ S+ E+LV+DC
Sbjct  291   KGVETIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVSDC  350

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+M+  L       + EE G F++ES+  A+ +VMD+ SE+G  V
Sbjct  351   QIVLLPYLCDQVLNTRLMTEEL-EVSVEVQREETGWFAKESLSVAITSVMDKDSEVGNRV  409

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH K +  L++  L + Y D F + LQ+
Sbjct  410   RRNHAKKKEILVSPGLLTGYTDKFVETLQN  439



>gb|AAL09791.1| AT4g27560/T29A15_50 [Arabidopsis thaliana]
Length=461

 Score =   355 bits (911),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 195/449 (43%), Positives = 281/449 (63%), Gaps = 17/449 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H+ MYPWF  GH+T F  LANKLA KGH ++FLIPK    +LE+ NL PH I+F  + V
Sbjct  6     FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIAFRSVTV  65

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP G ET S++P  S  LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR
Sbjct  66    PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVEPDLIFFDFAHWIPEVAR  125

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA---R  1045
               G+K+V Y  +S       L P            ++   P  +P   + L   +A   +
Sbjct  126   DFGLKTVKYVVVSASTIASMLVPG----------GELGVPPPGYPSSKVLLRKQDAYTMK  175

Query  1044  GFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
                +   +  G ++   +R+ T++  SD +A  T REIEG FCDYIE   +K VLL GP 
Sbjct  176   NLESTNTINVGPNL--LERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPV  233

Query  864   lpvPSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              P P K+  +E++W  WL  ++  SV++CA GS+  L KD+FQEL  G+ELTG PF  A+
Sbjct  234   FPEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAV  293

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP  + +I+ A+PE  +E+++GRG+V GEWVQQ L L HPSVGCFVSHCG+ S+ E+L+
Sbjct  294   KPPRGSSTIQEALPEGFEERVKGRGVVWGEWVQQPLLLSHPSVGCFVSHCGFGSMWESLL  353

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
             +DCQIVL+PQ+GDQ++N R++S  L         EE G FS+ES+  A+ +VM   SEIG
Sbjct  354   SDCQIVLVPQLGDQVLNTRLLSDEL-KVSVEVAREETGWFSKESLFDAINSVMKRDSEIG  412

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQ  241
               V+ NH K R  L +  L + Y++   +
Sbjct  413   NLVKKNHTKWRETLTSPGLVTGYVEGVRE  441



>emb|CDY03578.1| BnaC03g68370D [Brassica napus]
Length=451

 Score =   354 bits (909),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 198/459 (43%), Positives = 287/459 (63%), Gaps = 21/459 (5%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  MYP F  GH+  +  LANKLA KGH I+FL+PK  Q +LES NLHP  I
Sbjct  1     MGSK---FHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
              F P+ +P + GLP G ETT+D+P  +T  L+ +AMD  +++IE  ++ LK D++F+D  
Sbjct  58    CFHPLTLPPVEGLPVGVETTADLPPNTTGKLISDAMDLLRDEIEAKVRVLKPDLIFFDLV  117

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLH  1060
              W+P +A++ G+KSV Y  +S      AL+P     G +L        P+ +P   + L 
Sbjct  118   PWVPEMAKEFGVKSVSYQIVSAACVAVALAP-----GVELG----FSQPSGYPSSKVALR  168

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
              H+A  ++  T         FF RI T +  SD ++  TC EIEG++C +IE + Q+ VL
Sbjct  169   GHDANLYSVFT----NSHKRFFSRIITGLKNSDVVSIRTCAEIEGKYCSFIERECQRKVL  224

Query  879   lagpa---lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             L  P        S   +E +W++WL  F+ GSV++CA GS+  L KD+FQEL  G+ELTG
Sbjct  225   LTAPMFPEPQEKSVKPLEDQWNNWLNVFEPGSVVFCALGSQTILEKDQFQELCLGMELTG  284

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  A+K P  + +++ A+PE  KE+++GRGIV G WV+Q L L H SVGCFV+HCG  
Sbjct  285   LPFLVAVKLPRGSSTVQEALPEGFKERVKGRGIVWGGWVEQPLILSHQSVGCFVNHCGSG  344

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+LV+DCQIV +PQ+GDQ++  +++S  L         E+ G FS+ES+  AVK++M
Sbjct  345   SMWESLVSDCQIVFIPQLGDQVLTTKLLSEEL-EVSVKVHREDSGWFSKESLRDAVKSMM  403

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             D+ SEIG  V+ NH KLR  L++  L S Y D+F + L+
Sbjct  404   DKDSEIGNLVKRNHMKLRETLVSPGLLSGYADNFVEALE  442



>ref|XP_010482808.1| PREDICTED: UDP-glycosyltransferase 79B9 [Camelina sativa]
Length=447

 Score =   353 bits (907),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 197/450 (44%), Positives = 281/450 (62%), Gaps = 16/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+T +  LANKLA  GHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHHNLFPESIVFHPLTI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SD+       L  AMD T++ +E  ++DL+ D++F+DF +W+   A+
Sbjct  65    PHVDGLPAGAETASDISISLGKFLTAAMDLTRDQVEAAVRDLRPDLIFFDFAYWVAETAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +  +KSV Y  IS     + L P     G +L        P  +P   +    H+A    
Sbjct  125   EHRVKSVMYFVISANSIAHELVP-----GGKLG-----VPPPGYPSSKVLYCEHDAHALL  174

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
               ++         + RI T +   D ++  TC+E+EG+FCDYIE+Q+Q+ VLL GP LP 
Sbjct  175   TFSIFY----ERLYHRITTGLMNCDFISIRTCKEVEGKFCDYIESQYQRKVLLTGPMLPD  230

Query  855   PSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P  S  +E +W  WL +++ GSVIYCA GS+  L KD+FQEL  G+ELTG+PF  A+KPP
Sbjct  231   PDNSKALEDRWCHWLNRYEPGSVIYCALGSQINLEKDQFQELCLGMELTGLPFIVAVKPP  290

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               A +I+ A+PE  +E+++ RG+V GEWVQQ L L HPSVGCFV+HCG+ S+ E+LV+DC
Sbjct  291   KGAVTIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVSDC  350

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+M+  L       + EE G FS+ES+  A+  VMD+ SE+G  V
Sbjct  351   QIVLLPYLCDQVLNTRLMTEEL-EVSVEVQREETGWFSKESLSVAITLVMDKDSEVGNRV  409

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH K++  L++  L + Y D F + LQ+
Sbjct  410   RRNHAKMKEILVSPGLLTGYTDEFVETLQN  439



>ref|XP_006397072.1| hypothetical protein EUTSA_v10028656mg [Eutrema salsugineum]
 gb|ESQ38525.1| hypothetical protein EUTSA_v10028656mg [Eutrema salsugineum]
Length=443

 Score =   353 bits (906),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 195/452 (43%), Positives = 283/452 (63%), Gaps = 16/452 (4%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  MYPWF  GH+T F  LANKLA KGHR++FL+PK T  + E  NL P  I F  +
Sbjct  3     SKFHALMYPWFATGHMTPFLHLANKLADKGHRVTFLLPKKTLKQYEHLNLFPDKIVFHSV  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLP G ET S++P  ST+LL  AMD T+  IE  +  +K D++F+DF HW+P +
Sbjct  63    TVPHVDGLPIGTETASEIPVSSTNLLASAMDLTRAQIEDQVLAVKPDLIFFDFAHWIPEM  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A+  G+K+V Y  +S             +    +   ++   P  +P   + L   +   
Sbjct  123   AKDFGVKTVMYVVVS----------ASTIASMLVQGGELGVPPPGYPSSKVLLRKQDL--  170

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
             ++ +++   G    F +RI T++   D +A  T REIEG FCDYIE   +K VLL GP  
Sbjct  171   YSMKSINNDG--TKFMERITTSLMNCDVIAIRTVREIEGSFCDYIEKHCKKRVLLTGPMF  228

Query  861   pvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             P P ++  +E+KWS+WL  F+  SV++CA G++  L+KD+FQEL   +ELTG+PF  A+K
Sbjct  229   PEPDETKQLEEKWSNWLSGFEPDSVVFCALGTQVVLQKDQFQELCLAMELTGLPFLLAVK  288

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP    +I+ A+P+  +E+++GRG+V G WVQQ+L L HPSVGCFVSHCG+ S+ E+L+N
Sbjct  289   PPRGISTIQEALPDGFEERVKGRGVVWGGWVQQELILSHPSVGCFVSHCGFGSMWESLMN  348

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             DCQIVL+PQ+GDQI+N R++S  L         EE G FS+ES+  A+ +VM+ +SE G+
Sbjct  349   DCQIVLIPQLGDQILNTRLLSEEL-EVSVEVAREETGWFSKESLRDAITSVMERESETGK  407

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              VR NH+K R  L +  +   Y+++    LQD
Sbjct  408   LVRMNHNKWRETLFSPGVMIGYVNNSVNSLQD  439



>ref|XP_004236775.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
isoform X3 [Solanum lycopersicum]
Length=463

 Score =   353 bits (905),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 209/453 (46%), Positives = 291/453 (64%), Gaps = 8/453 (2%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
              + M+PW  +GH+  F  L+N+LA KGH+ISFL+PKN Q KL++ NL+P+LI+F  + +P
Sbjct  10    QIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQNLNLYPNLITFHTLKIP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              I GLP GAETT+DVP     LL  AMD+  ++I+  L++LK   VF+DF HW+  +A +
Sbjct  70    HIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLQNLKPHFVFFDFAHWVTEIALE  129

Query  1212  IG-IKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             IG I ++ Y   SP     +L  SPE+ V     T A+ ++ P  +P  ++ LH HEA+ 
Sbjct  130   IGDINTICYKLTSPATSAISLIRSPEKSVFMAS-TAAEKVRPPPGYPSTTVVLHEHEAK-  187

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                    ++G  +T ++R+   ++  D +A  TCREIEG F DYI TQF+KPVL  GP L
Sbjct  188   LLEFLFQEYGKGVTIYERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGPVL  247

Query  861   pvPSKSTM-EQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             P P K  + E   S+WL KF+ GSV++CAFGS+  L K +FQEL+ GLELTG+PF   LK
Sbjct  248   PDPEKGPLAEHGLSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLVVLK  307

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL-V  508
             PP    S+E A+PE  KE++Q +G+V   WV Q   L H SVGCFVSHCG+ S+ E+L +
Sbjct  308   PPEGTNSVEEALPEGFKERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGYGSMWESLAL  367

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
              DCQ+VLLP   DQ ++AR+M   L       K +E+G FS+ES+CKAVK VMD+ S++G
Sbjct  368   CDCQLVLLPSANDQTLSARMMEQDL-KVGVEVKKDENGWFSKESLCKAVKCVMDKDSQVG  426

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
               V+ NH K +  L +    S Y+DSF Q L +
Sbjct  427   CLVKENHRKWKEVLSSPGFMSNYIDSFIQILYE  459



>ref|XP_010442978.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X2 [Camelina 
sativa]
Length=422

 Score =   350 bits (899),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 187/450 (42%), Positives = 269/450 (60%), Gaps = 33/450 (7%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +L+  N+ P  I F  +
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLKPLNIFPDCIVFHTL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +PS+ GLP GAETTSD+P  S   L  AMD+T+N +E  +   K D++F+DF HW+P +
Sbjct  63    TIPSVDGLPAGAETTSDIPISSGSFLASAMDQTRNQVEEAVSIGKPDLIFFDFAHWIPEI  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             AR+ G KSV + TIS      +  P R       +  D+   P  +P   + L   E   
Sbjct  123   ARECGAKSVNFITISAACVAISFVPGR-------SPDDLAVPPPGYPSSKVLLRRQETNC  175

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
             F+  +   FG + TF++RI   +   D ++  TCRE+E                      
Sbjct  176   FSFLS-HPFGDNTTFYERIMIGLKNCDVISIRTCREMED---------------------  213

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
                +   +E +W  WL +F+ GSV+YCA GS+  L KD+FQEL  G+ELTG+PF  A+KP
Sbjct  214   ---NSKPLEDQWRQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFLVAVKP  270

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  + +I+ A+P   +E+++GRG+V G WVQQ L L HPS+GCFVSHCG+ S+ EALVND
Sbjct  271   PKGSSTIQEALPNGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWEALVND  330

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQ V +P +G+QI N R+MS  L       K E+ G FS+ES+  ++++VMD+ SE+G  
Sbjct  331   CQTVFIPHLGEQIFNTRLMSEEL-EVSVEVKREDSGWFSKESLSGSIRSVMDKDSELGYL  389

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             VR NH K +  L++  L + Y++ F + LQ
Sbjct  390   VRRNHAKWKESLVSTGLMNGYVNKFIEALQ  419



>ref|XP_010433351.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Camelina sativa]
Length=453

 Score =   350 bits (899),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 195/454 (43%), Positives = 286/454 (63%), Gaps = 19/454 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  MYPWF  GH+T F   ANKLA +GH ++FL+PK    +LE  NL PH I F  + V
Sbjct  6     FHALMYPWFATGHMTPFLYPANKLAERGHMVTFLLPKKALKQLEHLNLFPHNIVFRSVTV  65

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP G ET S++P  +T LLM AMD T++ +E++++ ++ D++F+DF HW+P +AR
Sbjct  66    PHVDGLPLGTETASEIPVSTTDLLMSAMDLTRDQVEVVVRAVEPDLIFFDFAHWIPEVAR  125

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
               G+K+V Y  +S       + P            ++   P  +P   + L   +A  +T
Sbjct  126   DFGLKTVKYVVVSASTIANMVVPG----------GELGVPPPGYPSTKVLLRKQDA--YT  173

Query  1035  ART---VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpa  865
              +     +  G +  FF+R+ T++   D +A  T REIEG FCDYIE   +K VLL G  
Sbjct  174   MKKPDHTIDVGPN--FFERVTTSLLNCDVVAIRTAREIEGNFCDYIEKHCRKKVLLTGTL  231

Query  864   lpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAAL  688
              P P K+  +E++W  WL  F+  SV++CA GS+  L KD+FQEL  G+ELTG PF  A+
Sbjct  232   FPEPDKTIQLEERWVKWLSGFEPESVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAV  291

Query  687   KppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV  508
             KPP  + +++ A+PE  +E+++GRG+V G WVQQ L L HPSVGCFVSHCG+ S+ E+L+
Sbjct  292   KPPRGSSTVQEALPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVSHCGFGSMWESLL  351

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgV-FSRESVCKAVKAVMDEKSEI  331
             +DCQIVL+PQ+ DQ++N R++S  LKV VEV +   +   FS+ES+  A+ +VM++ SEI
Sbjct  352   SDCQIVLVPQLVDQVLNTRLLSDELKVSVEVVRENTETGWFSKESLRDAINSVMNKDSEI  411

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             G  V+ NH K R  L +    + Y+D F + L+D
Sbjct  412   GNLVKKNHTKWRETLASPGFMTDYVDKFIESLKD  445



>ref|XP_009628388.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Nicotiana tomentosiformis]
Length=458

 Score =   349 bits (896),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 190/451 (42%), Positives = 286/451 (63%), Gaps = 8/451 (2%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+PWF  GH T F  LAN+LA +GH+ISFL+PK  Q +L++ NLHP+LI+F  + +P
Sbjct  10    HIAMFPWFAFGHFTPFLHLANELAKRGHQISFLLPKKAQFQLQNINLHPNLITFHSLTIP  69

Query  1392  SIPGLPPGAETTSDVP-FPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
              + GLP G  T SDVP F + HL M  +D+ ++ I+ +L  LK  +VFYDF +W+P  A 
Sbjct  70    QVEGLPLGTXTASDVPIFLTCHLAM-XLDQMRDQIKSLLAKLKPHIVFYDFAYWIPDYAP  128

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVV--GKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             +I  K++ Y+ +        L P R+    G   T  +MMK P  +P  ++ L  HE+R 
Sbjct  129   EISYKTICYNVVCAASIAIMLVPVRKSCPSGAPPTVEEMMKPPKGYPSSAVVLREHESRA  188

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla-gpa  865
              +     ++G  +TF+DR+ TA+ + D ++  TC E  G  CDY+ +Q+ KPV L     
Sbjct  189   LSF-MFHEYGRGVTFYDRVTTALKKCDAISIRTC-ENXGPLCDYLSSQYNKPVFLTGPIL  246

Query  864   lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
                 SK  +E KW+ WL +FK GS+++CAFGS+  L K +FQEL+ G+ELT  PF  ALK
Sbjct  247   PEPTSKELLEGKWATWLKQFKPGSILFCAFGSQMVLEKSQFQELVLGIELTDFPFLIALK  306

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP   ++IE A+PE  +E+ +GRGIV+G+ V +   L H S+GCFVSHCG+ S+ E+L++
Sbjct  307   PPLGVKTIEEALPEGFEERTKGRGIVYGDLVPKLXILSHSSIGCFVSHCGFGSMWESLMS  366

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             +CQIVL+P +GDQI+N R+++  L       + +E+G F++E++CK +++VM+E SE+G 
Sbjct  367   ECQIVLIPHLGDQILNTRLLADEL-NVAVEVERDENGWFTKENLCKVIRSVMNEGSELGY  425

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              V+ NH K +  L      S Y++ F   L 
Sbjct  426   LVKKNHAKWKETLTRPGFMSGYIEEFMHNLH  456



>ref|NP_176672.1| UDP-glycosyltransferase 79B11 [Arabidopsis thaliana]
 sp|Q9XIQ4.1|U7B11_ARATH RecName: Full=UDP-glycosyltransferase 79B11 [Arabidopsis thaliana]
 gb|AAD38266.1|AC006193_22 Similar to Flavonol 3-O-Glucosyltransferase [Arabidopsis thaliana]
 gb|AEE34305.1| UDP-glycosyltransferase 79B11 [Arabidopsis thaliana]
 gb|AHL38892.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=452

 Score =   349 bits (895),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 281/454 (62%), Gaps = 22/454 (5%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H  M+PWF  GH+T +  L NKLA KGHR++FL+PK  Q +LE  NL PH I F P+V+P
Sbjct  6     HAFMFPWFAFGHMTPYLHLGNKLAEKGHRVTFLLPKKAQKQLEHQNLFPHGIVFHPLVIP  65

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP GAET SD+P      L  AMD T++ IE  +  L+ D++ +D  HW+P +A+ 
Sbjct  66    HVDGLPAGAETASDIPISLVKFLSIAMDLTRDQIEAAIGALRPDLILFDLAHWVPEMAKA  125

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             + +KS+ Y+ +S     + L P            ++  AP  +P        H+A     
Sbjct  126   LKVKSMLYNVMSATSIAHDLVP----------GGELGVAPPGYPSSKALYREHDAHA---  172

Query  1032  RTVMKFGGDIT-FFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
               ++ F G    F+ R  T +   D ++  TC EIEG+FCDYIE+Q++K VLL GP LP 
Sbjct  173   --LLTFSGFYKRFYHRFTTGLMNCDFISIRTCEEIEGKFCDYIESQYKKKVLLTGPMLPE  230

Query  855   PSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P KS  +E +WS WL  F +GSV++CA GS+  L K++FQEL  G+ELTG+PF  A+KPP
Sbjct  231   PDKSKPLEDQWSHWLSGFGQGSVVFCALGSQTILEKNQFQELCLGIELTGLPFLVAVKPP  290

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQ----QQLFLQHPSVGCFVSHCGWASLSEAL  511
               A +I  A+PE  +E+++GRGIV GEWVQ    Q L L HPSVGCFVSHCG+ S+ E+L
Sbjct  291   KGANTIHEALPEGFEERVKGRGIVWGEWVQQPSWQPLILAHPSVGCFVSHCGFGSMWESL  350

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             ++DCQIV +P + DQ++  R+M+  L       + EE G FS+E++  A+ ++MD+ SEI
Sbjct  351   MSDCQIVFIPVLNDQVLTTRVMTEEL-EVSVEVQREETGWFSKENLSGAIMSLMDQDSEI  409

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             G +VR NH KL+  L +  L + Y D F   L++
Sbjct  410   GNQVRRNHSKLKETLASPGLLTGYTDKFVDTLEN  443



>ref|NP_176671.1| UDP-glycosyltransferase 79B10 [Arabidopsis thaliana]
 sp|Q9XIQ5.1|U7B10_ARATH RecName: Full=UDP-glycosyltransferase 79B10 [Arabidopsis thaliana]
 gb|AAD38265.1|AC006193_21 Similar to Flavonol 3-O-Glucosyltransferase [Arabidopsis thaliana]
 gb|AEE34304.1| UDP-glycosyltransferase 79B10 [Arabidopsis thaliana]
 gb|AHL38893.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=447

 Score =   348 bits (892),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 193/451 (43%), Positives = 281/451 (62%), Gaps = 16/451 (4%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T+H  M+PWF  GH+T +  LANKLA +GHRI+FLIPK  Q +LE  NL P  I F  + 
Sbjct  4     TFHAFMFPWFAFGHMTPYLHLANKLAERGHRITFLIPKKAQKQLEHLNLFPDSIVFHSLT  63

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             +P + GLP GAET SD+P P    L  A+D T++ +E  +  L  D++ +D   W+P +A
Sbjct  64    IPHVDGLPAGAETFSDIPMPLWKFLPPAIDLTRDQVEAAVSALSPDLILFDIASWVPEVA  123

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGF  1039
             ++  +KS+ Y+ IS     +   P            ++   P  +P   +    H+A   
Sbjct  124   KEYRVKSMLYNIISATSIAHDFVP----------GGELGVPPPGYPSSKLLYRKHDAHAL  173

Query  1038  TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
              + +V        F  R+ T +   D ++  TC+EIEG+FC+Y+E Q+ K V L GP LP
Sbjct  174   LSFSVYY----KRFSHRLITGLMNCDFISIRTCKEIEGKFCEYLERQYHKKVFLTGPMLP  229

Query  858   vPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
              P+K   +E +WS WL  F++GSV++CA GS+ TL KD+FQEL  G+ELTG+PFF A+ P
Sbjct  230   EPNKGKPLEDRWSHWLNGFEQGSVVFCALGSQVTLEKDQFQELCLGIELTGLPFFVAVTP  289

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  A++I+ A+PE  +E+++ RG+V GEWVQQ L L HPSVGCF+SHCG+ S+ E++++D
Sbjct  290   PKGAKTIQDALPEGFEERVKDRGVVLGEWVQQPLLLAHPSVGCFLSHCGFGSMWESIMSD  349

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQIVLLP + DQ++N R+M+  L       + EE G FS+ES+  A+ +VMD+ SEIG  
Sbjct  350   CQIVLLPFLADQVLNTRLMTEEL-KVSVEVQREETGWFSKESLSVAITSVMDQASEIGNL  408

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             VR NH KL+  L++  L + Y D F   L++
Sbjct  409   VRRNHSKLKEVLVSDGLLTGYTDKFVDTLEN  439



>ref|XP_002285228.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=458

 Score =   347 bits (891),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 218/453 (48%), Positives = 304/453 (67%), Gaps = 4/453 (1%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             ++ T + +AMYPWF  GHLT +  L+N+LA +GH+I+F++P+ TQS+L+  NLHP LI+F
Sbjct  4     ARNTKFQIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPEKTQSQLQHLNLHPTLITF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P+ +P + GLPPGAET SDVPF S HLL  AMD+T + +E  L+ LK D  F+DF +W 
Sbjct  64    HPLTIPHVDGLPPGAETASDVPFFSHHLLATAMDRTSDQVEAALRALKPDFFFFDFPYWA  123

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             P+LA K+GIKS++YS +      +   P R+V        D+   P  +P P++ L +HE
Sbjct  124   PALASKLGIKSIYYSAVCASAVAHHPPPGRQVSKDSTLTTDV--PPPGYPSPTVVLRSHE  181

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
             A          FG  +  + R+ T +   D ++  TC+EIEG FCDY+ +Q+ KPVLL G
Sbjct  182   AW-MVQFLFAPFGEGVNLYQRLTTGMKGCDAISIRTCQEIEGPFCDYLASQYGKPVLLTG  240

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P LP P  + +E +W+ WLG FK GSVI+CAFGS+    KD+FQELL GLELTG+PF  A
Sbjct  241   PVLPKPLPTPLEDRWAQWLGGFKPGSVIFCAFGSQNFPGKDQFQELLLGLELTGLPFLVA  300

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP  A +IE A+PE  +E++ GRG+VHG WV Q   L HPSVGCFVSHCG+ S+ E+L
Sbjct  301   LKPPTGAATIEEALPEGFQERVGGRGVVHGGWVPQPSILSHPSVGCFVSHCGFGSMWESL  360

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
              +D QIVL+P++ DQI+N R+++  L         E++G FS+ES+C+A+++VMDE+SE+
Sbjct  361   TSDPQIVLVPELPDQILNTRLLAEVL-KVAVEIDKEQNGWFSKESLCRAIRSVMDEESEV  419

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             G  VR NH K +  L      S Y+D+F Q+LQ
Sbjct  420   GGLVRKNHAKWKKTLTGQGFMSNYIDNFVQQLQ  452



>ref|XP_009107252.1| PREDICTED: UDP-glycosyltransferase 79B5-like [Brassica rapa]
Length=451

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 197/459 (43%), Positives = 283/459 (62%), Gaps = 21/459 (5%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  MYP F  GH+  +  LANKLA KGH I+FL+PK  Q +LES NLHP  I
Sbjct  1     MGSK---FHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
              F P+ +P + GLP GAETT+D+P  +T  L+ +AMD  ++ IE  ++ LK D++F+D  
Sbjct  58    CFHPLTLPPVEGLPVGAETTADLPPNTTGKLISDAMDLLRDQIEAKVRVLKPDLIFFDLV  117

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLH  1060
              W+P +A++ G+KSV Y  +S      AL+P          E    + P  +P   +   
Sbjct  118   PWVPEMAKEFGVKSVSYQIVSAACVAVALAPG--------VELGFPQQPG-YPSSKVAFR  168

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
              H+A  ++  T         FF RI T +  SD  +  TC EIEG++C +IE + Q+ VL
Sbjct  169   GHDANLYSIFT----NSHKRFFSRIITGLKNSDVASIRTCAEIEGKYCSFIERECQRKVL  224

Query  879   lagpa---lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             L GP        S   +E +W+ WL +F+ GSV++CA GS+  L KD+FQEL  G+ELTG
Sbjct  225   LTGPMFPEPQEKSVKPLEDQWNQWLNRFEPGSVVFCALGSQTILEKDQFQELCLGMELTG  284

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  A+K P  + +++ A+PE  +E+++GRGIV G WV+Q L L H SVGCFV+HCG  
Sbjct  285   LPFLVAVKLPRGSSTVQEALPEGFEERVKGRGIVWGGWVEQPLILSHQSVGCFVNHCGSG  344

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+LV+DCQIV +PQ+GDQ++  +++S  L         E+ G FS+ES+  AVK+VM
Sbjct  345   SMWESLVSDCQIVFIPQLGDQVLTTKLLSEEL-EVSVKVHREDSGWFSKESLRDAVKSVM  403

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             D+ SEIG  V+ NH KL+  L++  L S Y D F + L+
Sbjct  404   DKDSEIGNLVKRNHMKLKETLVSPGLLSGYADKFVEALE  442



>emb|CAN63555.1| hypothetical protein VITISV_034119 [Vitis vinifera]
Length=458

 Score =   347 bits (890),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 218/453 (48%), Positives = 304/453 (67%), Gaps = 4/453 (1%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             ++ T + +AMYPWF  GHLT +  L+N+LA +GH+I+F++P+ TQS+L+  NLHP LI+F
Sbjct  4     ARNTKFXIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPEKTQSQLQHLNLHPTLITF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P+ +P + GLPPGAET SDVPF S HLL  AMD+T + +E  L+ LK D  F+DF +W 
Sbjct  64    HPLTIPHVDGLPPGAETASDVPFFSHHLLATAMDRTXDQVEAALRALKPDFFFFDFPYWA  123

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             P+LA K+GIKS++YS +      +   P R+V        D+   P  +P P++ L +HE
Sbjct  124   PALASKLGIKSIYYSAVCASAVAHHPPPGRQVSKDSTLTTDV--PPPGYPSPTVVLRSHE  181

Query  1050  ARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
             A          FG  +  + R+ T +   D ++  TC+EIEG FCDY+ +Q+ KPVLL G
Sbjct  182   AW-MVQFLFAPFGEGVNLYQRLTTGMKGCDAISIRTCQEIEGPFCDYLASQYGKPVLLTG  240

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
             P LP P  + +E +W+ WLG FK GSVI+CAFGS+    KD+FQELL GLELTG+PF  A
Sbjct  241   PVLPKPLPTPLEDRWAQWLGGFKPGSVIFCAFGSQNFPGKDQFQELLLGLELTGLPFLVA  300

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             LKPP  A +IE A+PE  +E++ GRG+VHG WV Q   L HPSVGCFVSHCG+ S+ E+L
Sbjct  301   LKPPTGAATIEEALPEGFQERVGGRGVVHGGWVPQPSILSHPSVGCFVSHCGFGSMWESL  360

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
              +D QIVL+P++ DQI+N R+++  L         E++G FS+ES+C+A+++VMDE+SE+
Sbjct  361   TSDPQIVLVPELPDQILNTRLLAEVL-KVAVEIDKEQNGWFSKESLCRAIRSVMDEESEV  419

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             G  VR NH K +  L      S Y+D+F Q+LQ
Sbjct  420   GGLVRKNHAKWKKTLTGQGFMSNYIDNFVQQLQ  452



>ref|XP_006401636.1| hypothetical protein EUTSA_v10013536mg [Eutrema salsugineum]
 gb|ESQ43089.1| hypothetical protein EUTSA_v10013536mg [Eutrema salsugineum]
Length=447

 Score =   346 bits (887),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 193/450 (43%), Positives = 284/450 (63%), Gaps = 18/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+T F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5     FHAFMFPWFAFGHMTPFLHLANKLAEKGHRVTFLLPKKAQKQLEHLNLFPDSIVFHPLTI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
               + GLP GAET SD+P      L  AMD +++ +E  ++ L+ D++ +D  HW+P +A+
Sbjct  65    FPVDGLPAGAETASDIPVSLVRFLSIAMDLSRDQVEAAVRALRPDLILFDIAHWVPDMAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             + G+K++ Y+ IS     + L P            ++   P  +P   +     +A   +
Sbjct  125   EHGVKTMMYNVISANCTAHDLVP----------GGELGVPPPGYPSSKVLYREQDAHALS  174

Query  1035  A-RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalp  859
             +  T  K      F++R+ T +   D ++  TC+EIEG+FCDYIE Q+QK VLL GP LP
Sbjct  175   SFSTYYK-----RFYNRVTTGLMNCDFISIRTCQEIEGKFCDYIERQYQKKVLLTGPMLP  229

Query  858   vPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
              P KS  +E +WS WL  F +GSV++CA GS+ TL KD+FQEL  G+ELTG+PF  A+ P
Sbjct  230   EPEKSKPLEDQWSHWLSGFGQGSVVFCALGSQITLEKDQFQELCLGMELTGLPFLVAVTP  289

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  A++I+ A+PE  +++++ RG+V GEWVQQ L L H SVGCFVSHCG+ S+ E+L++D
Sbjct  290   PKGAKTIQEALPEGFEDRVKSRGVVWGEWVQQPLILAHSSVGCFVSHCGFGSMWESLMSD  349

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQIVLLP + DQ++N R+M+  L       K EE G FS+E++  A+ +VM++ SE+G  
Sbjct  350   CQIVLLPYLNDQVLNTRLMTEEL-EVSVEVKREETGWFSKENLSCAIMSVMEKDSEVGNR  408

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             VR +H  L+  +++A L + Y D F   L+
Sbjct  409   VRRSHANLKEVVVSAGLLTGYTDKFVDTLE  438



>ref|XP_010421894.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=447

 Score =   346 bits (887),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 192/456 (42%), Positives = 283/456 (62%), Gaps = 24/456 (5%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3     SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLPPGAETTSD+     +LL EA+D T+  +E  ++ L+ D++F+DF HW+P L
Sbjct  63    TVPHVNGLPPGAETTSDISISEDNLLSEALDLTRGQVEAAVRALRPDLIFFDFAHWIPEL  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A++  IKSV Y  +S  +      P           A +   P  +P   +    ++A  
Sbjct  123   AKEHMIKSVSYMIVSATVIARLHDP----------GAPVEVPPPGYPSSKVLFRGNDAHA  172

Query  1041  FTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
                R++        F++R++    T     D +A  TC EIEG+FCD+I  Q+QK VLL 
Sbjct  173   LVIRSI--------FYERLYHQLATGFKSCDVIALRTCNEIEGKFCDFISRQYQKKVLLT  224

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP P  S  +E+ WS +L  F  GSV++CA GS+  L KD+FQEL  G+ELTG+PF 
Sbjct  225   GPMLPEPDTSKPLEEHWSHFLSGFPPGSVVFCALGSQIVLEKDQFQELCLGMELTGLPFL  284

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              A+KPP  + +I+ ++PE  +E+++GRG+V G WVQQ L L HPSVGCFV+HCG  ++ E
Sbjct  285   VAVKPPRGSSTIQESLPEGFEERVKGRGVVSGGWVQQPLILSHPSVGCFVNHCGPGAIWE  344

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              L+ DCQ+VL+P + DQ++  R+++            E+ G FS+ES+  A+K+VMD++S
Sbjct  345   CLMTDCQMVLIPFLSDQVLFTRLLTEEF-EVSVEVFREKTGWFSKESLRDAIKSVMDKES  403

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             ++G+ VR NH KL+  L++  L + Y+D+F + L D
Sbjct  404   DLGKLVRSNHAKLKEILVSPGLFAGYVDNFVEGLTD  439



>emb|CDY59372.1| BnaA08g29640D [Brassica napus]
Length=451

 Score =   345 bits (885),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 196/459 (43%), Positives = 282/459 (61%), Gaps = 21/459 (5%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  MYP F  GH+  +  LANKLA KGH I+FL+PK  Q +LES NLHP  I
Sbjct  1     MGSK---FHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
              F P+ +P + GLP GAETT+D+P  +T  L+ +AMD  ++ IE  ++ LK D++F+D  
Sbjct  58    CFHPLTLPPVEGLPVGAETTADLPPNTTGKLISDAMDLLRDQIEAKVRVLKPDLIFFDLV  117

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLH  1060
              W+P +A++ G+KSV Y  +S      AL+P          E    + P  +P   +   
Sbjct  118   PWVPEMAKEFGVKSVSYQIVSAACVAVALAPG--------VELGFPQQPG-YPSSKVAFR  168

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
              H+A  ++            FF RI T +  SD  +  TC EIEG++C +IE + Q+ VL
Sbjct  169   GHDANLYSIFA----NSHKRFFSRIITGLKNSDVASIRTCAEIEGKYCSFIERECQRKVL  224

Query  879   lagpa---lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             L GP        S   +E +W+ WL +F+ GSV++CA GS+  L KD+FQEL  G+ELTG
Sbjct  225   LTGPMFPEPQEKSVKPLEDQWNQWLNRFEPGSVVFCALGSQTILEKDQFQELCLGMELTG  284

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  A+K P  + +++ A+PE  +E+++GRGIV G WV+Q L L H SVGCFV+HCG  
Sbjct  285   LPFLVAVKLPRGSSTVQEALPEGFEERVKGRGIVWGGWVEQPLILSHQSVGCFVNHCGSG  344

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+LV+DCQIV +PQ+GDQ++  +++S  L         E+ G FS+ES+  AVK+VM
Sbjct  345   SMWESLVSDCQIVFIPQLGDQVLTTKLLSEEL-EVSVKVHREDSGWFSKESLRDAVKSVM  403

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             D+ SEIG  V+ NH KL+  L++  L S Y D F + L+
Sbjct  404   DKDSEIGNLVKRNHMKLKETLVSPGLLSGYADKFVEALE  442



>ref|XP_002888294.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64553.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=447

 Score =   345 bits (884),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 192/450 (43%), Positives = 277/450 (62%), Gaps = 16/450 (4%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+T +  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAEKGHRVTFLLPKKAQKQLEHLNLFPDSIVFHPLTM  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAET SD+P P    L  A+D T++ +E  +  L+ D++ +D   W+P +A+
Sbjct  65    PHVDGLPAGAETFSDIPMPLWKFLPPAIDLTRDQVEAAVHALRPDLILFDLASWVPEMAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +  +KS+ Y+ IS     +   P            ++   P  +P   +    H+A    
Sbjct  125   EYRVKSMLYNIISATSIAHDFVP----------GGELGVPPPGYPSSKLLYRRHDAHALL  174

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
             + +V        F  R+ T +   D ++  TC+EIEG+FC+YIE Q+ K V L GP LPV
Sbjct  175   SFSVYY----KRFSQRLITGLMNCDFISIRTCKEIEGKFCEYIERQYHKKVFLTGPMLPV  230

Query  855   PSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
               KS  +E +WS WL  F +G V++CA GS+ +L KD+FQEL  G+ELTG+PF  A+ PP
Sbjct  231   LEKSKPLEDRWSHWLNGFGQGYVVFCALGSQISLEKDQFQELCLGIELTGLPFLVAVTPP  290

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDC  499
               A++I+ A+PE  +E+++ RG+V GEWVQQ L L HPSVGCFVSHCG+ S+ E+L+ DC
Sbjct  291   KGAKTIQEALPEGFEERVKDRGVVWGEWVQQPLILAHPSVGCFVSHCGFGSMWESLMGDC  350

Query  498   QIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREV  319
             QIVLLP + DQ++N R+M+  L       + EE G FS+ES+  A+ +VMD+ SEIG  V
Sbjct  351   QIVLLPFLADQVLNTRLMTEEL-EVSVEVQREETGWFSKESLSVAITSVMDQGSEIGNLV  409

Query  318   RGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             R NH KL+   ++  L + Y D F   L++
Sbjct  410   RRNHSKLKEVFVSDGLLTGYTDKFVDTLEN  439



>ref|XP_010448113.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X1 [Camelina 
sativa]
 ref|XP_010448114.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X1 [Camelina 
sativa]
 ref|XP_010448115.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X2 [Camelina 
sativa]
 ref|XP_010448116.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X3 [Camelina 
sativa]
Length=453

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 198/462 (43%), Positives = 284/462 (61%), Gaps = 23/462 (5%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS  + +H  MYPWF  GH+T F  LANKLA KGH ++FL+PK    +LE  NL PH I
Sbjct  1     MGS--SRFHALMYPWFAAGHITPFLYLANKLAEKGHMVTFLLPKKALKQLEHLNLFPHNI  58

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + VP + GLP G ET S++P  + +LLM AMD T++ +E +++ ++ D++F+DF H
Sbjct  59    VFRFVTVPHVDGLPIGTETASEIPVSTNNLLMSAMDLTRDQVEAVVRAVEPDLIFFDFAH  118

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +AR  G+K+V Y  +S       L P            ++   P  +P   + L  
Sbjct  119   WIPEVARDFGLKTVKYVVVSASTVASILVP----------GGELGVPPPGYPSSKVLLRK  168

Query  1056  HEARGFTART---VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKp  886
              +  G+T +     +  G +  F++R+ T++   D +A  T REIEG  CDYIE   +K 
Sbjct  169   QD--GYTMKNPNPTIDVGPN--FYERVTTSLMNCDAIAIRTVREIEGDLCDYIEKHSRKK  224

Query  885   vllagpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             VL+ GP  P P K+  +E++W  WL  F+  SV++CA GS+  L KD+FQEL  G+ELTG
Sbjct  225   VLVTGPVFPEPDKTIQLEERWVKWLSGFEPDSVVFCALGSQIILEKDQFQELCLGMELTG  284

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
              PF   +KPP  + +++ A+PE  +E+I+GRG+V   WVQQ L L HPSVGCFVSHCG+ 
Sbjct  285   SPFLVVVKPPRGSSTVQEALPEGFEERIKGRGVVWEGWVQQPLILSHPSVGCFVSHCGFG  344

Query  528   SLSEALVNDCQIVLLP--QVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKA  355
             S+ E+L++DCQIVL+P  Q+GD I NAR+M+  L         EE G FS+ES+  A+ +
Sbjct  345   SMWESLLSDCQIVLVPQAQLGDHIRNARLMTDEL-KVSVEVVREETGWFSKESLRDAINS  403

Query  354   VMDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             VM   SEIG  V+ NH K R  L +  L + Y+D+F + L+D
Sbjct  404   VMKSDSEIGNLVKKNHTKWREPLASPGLMTGYVDNFIESLKD  445



>ref|XP_006282036.1| hypothetical protein CARUB_v10028277mg [Capsella rubella]
 gb|EOA14934.1| hypothetical protein CARUB_v10028277mg [Capsella rubella]
Length=430

 Score =   343 bits (880),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/461 (41%), Positives = 280/461 (61%), Gaps = 43/461 (9%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MG Q   +H  M+PWF  GH+T +  LANKLA  GHR++FL+PK  Q +LE  NL P  I
Sbjct  1     MGKQ---FHAFMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHHNLFPDNI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F P+ +P + GLP GAET SD+P      L  AMD T++ +E  +  L+ D++F+DF +
Sbjct  58    VFHPLTIPHVDGLPTGAETASDIPISLGKFLTAAMDLTRDQVEAAVCALRPDLIFFDFAY  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +A++  +KSV Y  +S     + L P           +++  +P  +P   +    
Sbjct  118   WVPEVAKEHRVKSVLYFVVSANSIAHELVPG----------SELGVSPPGYPSSKVVYRE  167

Query  1056  HEARGFTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQK  889
              +A    + ++        FF+R++    T +   + ++  TC+E+EG+FCDYIE+Q+Q+
Sbjct  168   QDAHALFSFSM--------FFERLYHRITTGLMNCNFISVRTCKEVEGKFCDYIESQYQR  219

Query  888   pvllagpalpvPSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELT  712
              VLL GP LP    S  +E +WS WL +F+ GSVIYCA GS+  L KD+FQEL  G ELT
Sbjct  220   KVLLTGPMLPEQDNSKALEDRWSHWLNQFEPGSVIYCALGSQIKLEKDQFQELCLGTELT  279

Query  711   GMPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGW  532
             G+PF  A+KPP  +E+I+ A+PE  +E+++ RG+V GEWVQQ L L HPSVGCFV+HCG+
Sbjct  280   GLPFLVAVKPPKGSETIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHCGF  339

Query  531   ASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAV  352
              S+ E+LV+DCQIVLLP + DQ++N R+M+  L                 E   +   +V
Sbjct  340   GSMWESLVSDCQIVLLPYLCDQVLNTRLMTEEL-----------------EDGSRRRASV  382

Query  351   MDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             MD+ SE+G  VR NH +++  L++  L + Y D F + LQ+
Sbjct  383   MDKDSEVGGRVRRNHTRMKEILVSPGLLTGYTDKFVETLQN  423



>ref|XP_004238162.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Solanum lycopersicum]
Length=457

 Score =   343 bits (880),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 190/453 (42%), Positives = 288/453 (64%), Gaps = 8/453 (2%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
              + M+PW   GHL  F  L+N+LA +GH+ISFL+PK  +++L+    +P LI+F  + +P
Sbjct  2     EIVMFPWLAYGHLIPFMNLSNELAKRGHKISFLLPKTAETRLQKLIFYPSLINFHKLTIP  61

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP GAETT+DVP P   LL  A D+  ++I+  L++LK   VF+DF +W+P LA +
Sbjct  62    HVDGLPYGAETTADVPGPLESLLATAFDELYDEIKCFLQNLKPHFVFFDFAYWIPDLALE  121

Query  1212  I-GIKSVFYSTISPLMHGYAL--SPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             I GIK++FY  + P +   ++  SP++ +     T A+++K P  +P  ++ L   EA+ 
Sbjct  122   IGGIKTLFYRVVCPAVSSVSVIRSPDKAIFMAS-TAAELVKPPPGYPSTTVVLRESEAK-  179

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
               +    ++G  +TF++RI   ++  D +A  TCREIEG FC YI TQF+KPVL  GP +
Sbjct  180   LLSFVFHEYGNGVTFYERIKKGMTRCDAIAMKTCREIEGNFCTYISTQFEKPVLYTGPVI  239

Query  861   pvPSKSTMEQK-WSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
               P    +E+   ++WL KF+ GSV++CAFGS+  L K +FQEL+ G ELT +PF   +K
Sbjct  240   SEPKNEPLEEHGLTNWLEKFEPGSVVFCAFGSQMILEKTQFQELVLGFELTELPFLLVVK  299

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL-V  508
              P    S+E A+PE  KE++Q +G++   WV Q   L+H SVGCFV+HCG+ S+ E+L +
Sbjct  300   TPEGTNSVEEALPEGFKERVQEKGLILDCWVPQLEILRHKSVGCFVTHCGYGSMWESLAL  359

Query  507   NDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIG  328
              DCQ+VLLP+  D I NAR+M   L       + +E+ +F++E++CKAVK VMD+ S+IG
Sbjct  360   CDCQLVLLPRPIDHIFNARLMEKQL-KVGIEVEKDENDMFTKENLCKAVKCVMDKDSQIG  418

Query  327   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
               V+ NH K +  L +    S Y+D+F Q L +
Sbjct  419   CVVKENHKKWKELLSSPGFMSNYIDNFIQDLNE  451



>ref|XP_010446347.1| PREDICTED: UDP-glycosyltransferase 79B6-like isoform X2 [Camelina 
sativa]
Length=422

 Score =   341 bits (875),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/450 (40%), Positives = 267/450 (59%), Gaps = 33/450 (7%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWFG GH+T F  LANKLA KGH+I+FL+PK    +LE  NL P  I F  +
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPDYIFFHTL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +PS+ GLP GAETTSD+   S   L  AMD+T+N ++  +   K D++F+DF HW+P +
Sbjct  63    TIPSVDGLPAGAETTSDIQISSGSFLASAMDRTRNQVQEAVSIGKPDLIFFDFAHWIPEI  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A + G +SV + TIS      +  P R       +  D+   P  +P   + L   E   
Sbjct  123   AGEYGARSVNFITISAACVAISFVPGR-------SPDDLAVPPPGYPSSKVLLRGQETNC  175

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
             F+  +   FG + TF++RI   ++  D ++  TC+E+E                      
Sbjct  176   FSFLS-HPFGDNTTFYERIMIGLTNCDVISIRTCQEME----------------------  212

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
                +   +E +W  WL +F+ GSV+YCA GS+  L KD+FQEL  G+ELTG+PF  A+KP
Sbjct  213   --DNSKPLEDQWMQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFLVAVKP  270

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  + +I+ A+P   +E+++GRG+V G WVQQ L L HPS+GCFVSHCG+ S+ E LVND
Sbjct  271   PKGSSTIQEALPNGFEERVKGRGVVWGRWVQQPLILAHPSIGCFVSHCGFGSMWEGLVND  330

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQIV +P +G+QI N R+MS          + E+ G FS+ES+  ++++VMD+ SE+G  
Sbjct  331   CQIVFIPHLGEQIFNTRLMSEE-LEVSVEVEREDTGWFSKESLSGSIRSVMDKDSELGNL  389

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             VR NH K +  L++  L + Y++ F + LQ
Sbjct  390   VRRNHAKWKDSLVSTGLMNGYVNKFIEALQ  419



>ref|XP_002285222.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=457

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 217/455 (48%), Positives = 303/455 (67%), Gaps = 9/455 (2%)
 Frame = -3

Query  1590  SQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISF  1411
             +++T  H+AMYPWF  GHLT +  L+N+LA +GH+I+F++PK  QS+L+  NLHP LI+F
Sbjct  4     ARSTKLHIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPKKAQSQLQHLNLHPTLITF  63

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
              P+ +P + GLPPGAET SDVPF   HLL+ AMD+T + +E  L+ LK D + +DF +W 
Sbjct  64    HPLTIPHVDGLPPGAETASDVPFFMHHLLVTAMDRTADQVEAALRALKPDFLLFDFPYWA  123

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKA--PASFPDPSIKLHA  1057
             P+LA K+GIKS++YS +       AL+    V G Q+ +   + A  P  +P  ++ L  
Sbjct  124   PTLASKLGIKSIYYSAVC----AAALA-RHPVPGGQVGKDRPITAGPPPGYPSSTVVLRP  178

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             HEA          FG  +  + R+ T +   D ++  TC EIEG FCDY+ +Q+ KPVLL
Sbjct  179   HEA-WMVKFLYAPFGEGVNLYQRLTTGMKCCDAISIRTCHEIEGAFCDYLASQYGKPVLL  237

Query  876   agpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
              GP LP P  +  E +W+ WL  FK GSVI+CAFGS+    KD+FQELL GLELTG+PF 
Sbjct  238   TGPVLPKPLPTPSEDRWAQWLSGFKPGSVIFCAFGSQNFPEKDQFQELLLGLELTGLPFL  297

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              ALKPP  A +IE A+PE  +E++ GRG+VHG WV Q   L HPSVGCFVSHCG+ S+ E
Sbjct  298   VALKPPTGAATIEEALPEGFQERVGGRGVVHGGWVPQPSILSHPSVGCFVSHCGFGSMWE  357

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             +L +D QIVL+P++ DQI+N R ++  L       + EE+G FS++S+C+AV++VMDE+S
Sbjct  358   SLTSDPQIVLVPELPDQILNTRQLAEVL-KVAVEIEKEENGWFSKKSLCRAVRSVMDEES  416

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             E+G  VR NH K +  L +    S Y+++F Q+LQ
Sbjct  417   EVGGLVRKNHAKWKETLTSQGFMSNYIENFVQQLQ  451



>gb|EPS58858.1| glucosyltransferase, partial [Genlisea aurea]
Length=450

 Score =   341 bits (875),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 200/456 (44%), Positives = 285/456 (63%), Gaps = 13/456 (3%)
 Frame = -3

Query  1587  QATTYHMAMYPWFGVGHLTGFFRLANKLAGKG-HRISFLIPKNTQSKLESFNLHPHLISF  1411
             + +   + M+PWF +GHLT F  ++NKLA +G HRI F +P+N+ +++   N  P LI F
Sbjct  1     EESPLKIMMFPWFAMGHLTTFLHISNKLAQRGGHRIFFAVPRNSIARVRHLNRFPELIEF  60

Query  1410  VPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWL  1231
             +P+ VP + GLP GAE T+DVPFP   L++ AMD T+  IE ++ +L+ + V +DF+HWL
Sbjct  61    LPLAVPHVEGLPAGAELTADVPFPMIPLILTAMDLTRPQIEDLISELRPNFVLFDFSHWL  120

Query  1230  PSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHE  1051
             P  A K G K+VFY+TIS    G+     R +     T  D+M+ P  +P   IKL   E
Sbjct  121   PGSAAKFGAKTVFYNTISAAAVGWLF---RDLTA---TVDDIMRPPPGYPSSGIKLTTQE  174

Query  1050  ARGF--TARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             A       +T     G++ F +R+     + D + + +  E+E Q+ D++  ++ KPV  
Sbjct  175   ACAVHDMNKTGPPGAGELKFVERLEACARDCDSMVFKSYMELESQYFDFLSKKYSKPVSP  234

Query  876   agpalpvPSK-STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPF  700
             AGP LP   K    + KWS+WL KF+  SVIYCAFGSE  LR  +FQEL+ GLELTG P+
Sbjct  235   AGPVLPEAPKLDDADGKWSEWLDKFESKSVIYCAFGSEARLRTIQFQELILGLELTGKPY  294

Query  699   FAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLS  520
               A KPP  AE++E A+P   + ++ GRG+VHG WV QQL L HPS GCFV+HCGW SL 
Sbjct  295   LVAAKPPIGAETVEEAMP---EGELSGRGVVHGGWVPQQLMLSHPSTGCFVTHCGWGSLF  351

Query  519   EALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEK  340
             E ++++CQ+VL+P   DQ INAR+M   L +G+E+EKG+EDG+F +ESV KAV + +D  
Sbjct  352   EGILSECQLVLMPLFADQPINARLMGGELGIGIEMEKGDEDGMFRKESVKKAVDSALDFA  411

Query  339   SEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
               IG ++R NH K R  ++    D  Y+D    K +
Sbjct  412   GGIGAKIRANHAKWREVMMKDGFDDSYIDDLILKFR  447



>gb|KFK35925.1| hypothetical protein AALP_AA4G054400 [Arabis alpina]
Length=449

 Score =   340 bits (873),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 191/459 (42%), Positives = 282/459 (61%), Gaps = 21/459 (5%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  MYP FG GH+  +  LANKLA KGH+++FL+P   Q +L+  N  P  I
Sbjct  1     MGSK---FHAFMYPIFGFGHMIPYLHLANKLAEKGHKVTFLVPTKAQKQLQPLNRFPSSI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
              F  + +P + GLP GAETTSD+P  S  LL  AMD  ++ IE  ++ LK D++F+DF  
Sbjct  58    LFETLTLPHVDGLPDGAETTSDLPDSSKELLSNAMDLLRDQIEAKVRALKPDLIFFDFVD  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
              +P +A+K+G+K V Y  +S       L+P           A++   P  +P   + L  
Sbjct  118   SIPEMAKKLGVKCVSYQIVSAACIAMFLAP----------GAELGFPPPGYPSSKVALRG  167

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             H+A  ++  T  +       FDR+  A+   D +A  TC EIEG+ CD+IE Q Q+ VLL
Sbjct  168   HDANLYSHFTSTR----QILFDRVTKALMNCDIVAIRTCAEIEGKLCDFIERQCQRKVLL  223

Query  876   a---gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
                  P L   S   +E +W+ WL  F+ GSV++CAFG+ C L KD+FQEL  G+ELTG+
Sbjct  224   TGPMLPELQDRSSKQLEDRWNHWLNGFEPGSVVFCAFGTHCFLEKDQFQELCLGMELTGL  283

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PF  A+ PP  + +I+ A+PE  +E+++GRG+V  EWV+Q L L HPSVGCFV+HCG+ S
Sbjct  284   PFLLAVMPPRGSSTIQEALPEGFEERVKGRGVVSREWVEQPLILSHPSVGCFVNHCGFGS  343

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             + E+L++DC+IV +P + DQ++  R+++  L       + E+ G FS+ES+  AVK+VMD
Sbjct  344   MWESLLSDCRIVFVPLLADQVLTTRLLTEEL-EVSVKIQREDSGWFSKESLRDAVKSVMD  402

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             + SEIG+ V+ NH KL+  L++  L   Y D F + L++
Sbjct  403   KDSEIGKLVKRNHKKLKETLVSPGLLCGYADKFVEALEN  441



>ref|XP_010319271.1| PREDICTED: UDP-glycosyltransferase 79B8 isoform X2 [Solanum lycopersicum]
Length=507

 Score =   342 bits (878),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 211/497 (42%), Positives = 294/497 (59%), Gaps = 52/497 (10%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
              + M+PW  +GH+  F  L+N+LA KGH+ISFL+PKN Q KL++ NL+P+LI+F  + +P
Sbjct  10    QIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQNLNLYPNLITFHTLKIP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              I GLP GAETT+DVP     LL  AMD+  ++I+  L++LK   VF+DF HW+  +A +
Sbjct  70    HIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLQNLKPHFVFFDFAHWVTEIALE  129

Query  1212  IG---------------------------------------------IKSVFYSTISPLM  1168
             IG                                             IK++ Y T+ P  
Sbjct  130   IGDINTICYKLTSPATSAISLIRSPEKSVFMASTAAEKVRPPPEIGGIKTLCYKTVCPAT  189

Query  1167  HGYAL--SPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTARTVMKFGGDITFF  994
               Y+L  SPE+ V     T A+ ++ P  +P  ++ LH HEA+        ++G  +T +
Sbjct  190   SAYSLVRSPEKSVFMAS-TAAEKVRPPPGYPSTTVVLHEHEAK-LLEFLFQEYGKGVTIY  247

Query  993   DRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSKSTM-EQKWSDW  817
             +R+   ++  D +A  TCREIEG F DYI TQF+KPVL  GP LP P K  + E   S+W
Sbjct  248   ERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGPVLPDPEKGPLAEHGLSNW  307

Query  816   LGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeaesieaaipeEL  637
             L KF+ GSV++CAFGS+  L K +FQEL+ GLELTG+PF   LKPP    S+E A+PE  
Sbjct  308   LEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLVVLKPPEGTNSVEEALPEGF  367

Query  636   KEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL-VNDCQIVLLPQVGDQII  460
             KE++Q +G+V   WV Q   L H SVGCFVSHCG+ S+ E+L + DCQ+VLLP   DQ +
Sbjct  368   KERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGYGSMWESLALCDCQLVLLPSANDQTL  427

Query  459   NARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNHDKLRGFLLN  280
             +AR+M   L       K +E+G FS+ES+CKAVK VMD+ S++G  V+ NH K +  L +
Sbjct  428   SARMMEQDL-KVGVEVKKDENGWFSKESLCKAVKCVMDKDSQVGCLVKENHRKWKEVLSS  486

Query  279   ADLDSKYMDSFNQKLQD  229
                 S Y+DSF Q L +
Sbjct  487   PGFMSNYIDSFIQILYE  503



>ref|XP_006287748.1| hypothetical protein CARUB_v10000959mg [Capsella rubella]
 gb|EOA20646.1| hypothetical protein CARUB_v10000959mg [Capsella rubella]
Length=445

 Score =   340 bits (872),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 193/456 (42%), Positives = 277/456 (61%), Gaps = 24/456 (5%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+
Sbjct  3     SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLVPKKAQKQLEPHNLFPESIVFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLP GAETTSDVP    + L EA D T + +E  ++ LK D++F+DF HW+  L
Sbjct  63    TVPHVNGLPVGAETTSDVPISMDNFLSEAFDLTHDQVEAAVRALKPDLIFFDFAHWIAKL  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A++   KSV Y  +S       L P    +G           P  +P   +    ++A  
Sbjct  123   AKEHMFKSVSYMIVSATAVS-QLHPPGSSLGV---------LPPGYPSSKVVFRENDAHA  172

Query  1041  FTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
                        D  +++R++    T++   D +A  TC+E+EG+FCDYI  Q+ K VLL 
Sbjct  173   VLT--------DSIYYERLYHQLTTSLKSCDAIALKTCKEMEGKFCDYISRQYNKKVLLT  224

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP P  S  +E++WS +L KF  GSV++CA GS+  L KD+FQEL  G+E+TG+PF 
Sbjct  225   GPMLPEPDTSKPLEERWSHFLSKFPPGSVVFCALGSQIVLEKDQFQELCLGMEMTGLPFL  284

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              A+K P    +++ A+PE  +E+++ RG+V GEWVQQ L L HPSVGCFV+HCG  +L E
Sbjct  285   LAVKSPRGLSTVQEALPEGFEERVKDRGVVWGEWVQQPLILSHPSVGCFVNHCGPGTLWE  344

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              L++DCQIVLLP + DQ++  R+M+            E+ G FS+ES+  A+K+VMD+ +
Sbjct  345   GLMSDCQIVLLPFLSDQVLFTRLMTEEF-QVSVEVSREKTGWFSKESLRDAIKSVMDKDN  403

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             ++G+ VR NH KL+  L +  L   Y+D+F + L D
Sbjct  404   DLGKLVRSNHTKLKEVLGSPGLFDGYVDNFVEVLAD  439



>ref|XP_006286630.1| hypothetical protein CARUB_v10002468mg [Capsella rubella]
 gb|EOA19528.1| hypothetical protein CARUB_v10002468mg [Capsella rubella]
Length=443

 Score =   340 bits (872),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 192/456 (42%), Positives = 276/456 (61%), Gaps = 24/456 (5%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+
Sbjct  3     SKFHAFMFPWFSFGHMIPFLHLANKLAEKGHRVTFLVPKKAQKQLEPHNLFPESIVFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLP GAETTSD+     +LL EA D T++ +E  ++ LK D++F+DF HW+P L
Sbjct  63    TVPHVDGLPVGAETTSDISISMDNLLSEAFDLTRDQVEAAVRTLKPDLIFFDFAHWIPEL  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A++  IK+V Y  +S     + L P             +   P  +P   +    ++A  
Sbjct  123   AKQHMIKNVSYMIVSATAIAHTLVP----------GGALGVPPPGYPSSKVLFRENDAHT  172

Query  1041  FTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
                 ++        F++R++    T +   D +A  TC EIEG+FCDYI  Q+ K VLL 
Sbjct  173   LVTLSI--------FYERLYHQLTTGLKSCDVIALRTCNEIEGKFCDYISRQYNKKVLLT  224

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP    S  +E+ WS +L KF  GSV++CA GS+  L KD+FQEL  G+ELTG+PF 
Sbjct  225   GPLLPELDTSKPLEEHWSQFLRKFPPGSVVFCALGSQIVLEKDQFQELCLGMELTGLPFL  284

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              A+KPP  + +++ A+PE  +E+++ RG+V G WVQQ L L HPSVGCFVSHCG  ++ E
Sbjct  285   IAVKPPRGSSTVQEALPEGFEERVKERGVVWGGWVQQPLILSHPSVGCFVSHCGPGAIWE  344

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              L+ND Q+  +P +GDQ++  R+M+            E+ G FS+ES   A+K+VMD+ S
Sbjct  345   CLMNDVQMAFIPFLGDQVLFTRLMTEEF-QVSVEVLREKTGWFSKESSRDAIKSVMDKDS  403

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             E+G+ VR NH KL+  L++  L   Y+D+F + L D
Sbjct  404   ELGKLVRSNHTKLKEVLVSPGLLDGYVDNFVEALVD  439



>ref|XP_004236774.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X1 [Solanum lycopersicum]
Length=509

 Score =   342 bits (877),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 211/499 (42%), Positives = 294/499 (59%), Gaps = 54/499 (11%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
              + M+PW  +GH+  F  L+N+LA KGH+ISFL+PKN Q KL++ NL+P+LI+F  + +P
Sbjct  10    QIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQNLNLYPNLITFHTLKIP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              I GLP GAETT+DVP     LL  AMD+  ++I+  L++LK   VF+DF HW+  +A +
Sbjct  70    HIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLQNLKPHFVFFDFAHWVTEIALE  129

Query  1212  IG-----------------------------------------------IKSVFYSTISP  1174
             IG                                               IK++ Y T+ P
Sbjct  130   IGDINTICYKLTSPATSAISLIRSPEKSVFMASTAAEKVRPPPATEIGGIKTLCYKTVCP  189

Query  1173  LMHGYAL--SPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTARTVMKFGGDIT  1000
                 Y+L  SPE+ V     T A+ ++ P  +P  ++ LH HEA+        ++G  +T
Sbjct  190   ATSAYSLVRSPEKSVFMAS-TAAEKVRPPPGYPSTTVVLHEHEAK-LLEFLFQEYGKGVT  247

Query  999   FFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSKSTM-EQKWS  823
              ++R+   ++  D +A  TCREIEG F DYI TQF+KPVL  GP LP P K  + E   S
Sbjct  248   IYERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGPVLPDPEKGPLAEHGLS  307

Query  822   DWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeaesieaaipe  643
             +WL KF+ GSV++CAFGS+  L K +FQEL+ GLELTG+PF   LKPP    S+E A+PE
Sbjct  308   NWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLVVLKPPEGTNSVEEALPE  367

Query  642   ELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL-VNDCQIVLLPQVGDQ  466
               KE++Q +G+V   WV Q   L H SVGCFVSHCG+ S+ E+L + DCQ+VLLP   DQ
Sbjct  368   GFKERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGYGSMWESLALCDCQLVLLPSANDQ  427

Query  465   IINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNHDKLRGFL  286
              ++AR+M   L       K +E+G FS+ES+CKAVK VMD+ S++G  V+ NH K +  L
Sbjct  428   TLSARMMEQDL-KVGVEVKKDENGWFSKESLCKAVKCVMDKDSQVGCLVKENHRKWKEVL  486

Query  285   LNADLDSKYMDSFNQKLQD  229
              +    S Y+DSF Q L +
Sbjct  487   SSPGFMSNYIDSFIQILYE  505



>emb|CBI20246.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 206/451 (46%), Positives = 287/451 (64%), Gaps = 38/451 (8%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H+ MYPW   GH+  +  L+N+LA +GH I+F++PK  QS+L+  NLHP LISF  + +
Sbjct  9     FHIVMYPWSAFGHMIPYLHLSNELAERGHSITFILPKKVQSQLQHLNLHPTLISFHSLTI  68

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLPPGAET SDVP    HLL  AMD+T + +E  L+ LK D +FYD  +W P LA 
Sbjct  69    PYVDGLPPGAETASDVPISLHHLLATAMDRTTDQVEAALRALKSDFLFYDTAYWAPPLAS  128

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKA--PASFPDPSIKLHAHEARG  1042
             K+G+K +FY+        Y L     V+ +Q++++  +    P  +P  ++ L  HEAR 
Sbjct  129   KLGMKPIFYT------FSYCL-----VLDQQISKSRPIPTGPPPGYPSSTVVLRPHEAR-  176

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                  +  FG DITF +R+  A+   D ++  TC+EIEG FCDYI               
Sbjct  177   LLQFLLFPFGEDITFHERLTAAIKLCDVVSIRTCQEIEGPFCDYI---------------  221

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
                     E++W+ WL  FK GSVI+CAFGS+    KD+FQELL G ELTG+PF AALKP
Sbjct  222   --------ERRWAQWLSGFKPGSVIFCAFGSQNFPGKDQFQELLLGFELTGLPFLAALKP  273

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P  A +IE A+PE  +E++ GRG+V+G WV Q   L HPSVGCFVSHCG+ S+ E+L++D
Sbjct  274   PLGAATIEEALPEGFQERVGGRGVVYGGWVPQPSILSHPSVGCFVSHCGFGSMWESLMSD  333

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
              QIVL+P++ DQ  NAR+++  LKV VEVEK E   V S+E +CKA+K+VMDE+ E+G  
Sbjct  334   PQIVLVPELFDQTFNARLLAEELKVAVEVEKEENGWV-SKEGLCKAIKSVMDEEGEVGCL  392

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             V+ NH K +  L++    S Y+D+F ++L D
Sbjct  393   VKKNHAKWKETLMSQGFMSNYIDNFVRQLLD  423



>ref|XP_002872446.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48705.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   339 bits (870),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/454 (39%), Positives = 277/454 (61%), Gaps = 24/454 (5%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAETTSD+P    + L EA+D T++ +E  ++ L+ D++F+DF  W+P +A+
Sbjct  65    PPVNGLPAGAETTSDIPISMDNFLSEALDLTRDQVEAAVRALRPDMIFFDFAQWVPEMAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +  IKSV Y  +      +   P  +          +   P+S+P   +    ++A    
Sbjct  125   EHMIKSVSYIIVCATTIAHTHVPGGK----------LGVPPSSYPSSKVFFRENDAHALA  174

Query  1035  ARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQF-QKpvllag  871
               ++        F+ R++    T +   D +A  TC+EIEG+FCDYI  Q+ +K +L   
Sbjct  175   TLSI--------FYKRLYHQITTGLKNCDVIAMRTCKEIEGKFCDYISRQYHKKVLLTGP  226

Query  870   palpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAA  691
                   +   +E+ WS +L  F   SV++C+FGS+  L KD+FQEL  G+ELTG+PF  A
Sbjct  227   MFPEPDTTKPLEEHWSHFLSGFTPKSVVFCSFGSQIILEKDQFQELCLGMELTGLPFLVA  286

Query  690   LKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEAL  511
             +KPP  + +++  +P+  +E+++GRG+V G WVQQ L L HPS+GCFV+HCG  ++ E+L
Sbjct  287   VKPPRGSSTVQEGLPQGFEERVKGRGVVWGGWVQQPLILSHPSIGCFVNHCGPGTIWESL  346

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             V+DCQ+VL+P + DQ++  R+M+            E+ G FS+ES+  A+K+VMD+ S++
Sbjct  347   VSDCQMVLIPFLSDQVLFTRLMTEEF-EVSVEVYREKTGWFSKESLSNAIKSVMDKDSDL  405

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             G+ VR NH KL+  L++  L + Y+D+F + LQ+
Sbjct  406   GKLVRSNHTKLKEILVSPGLLTGYVDNFVEALQE  439



>ref|NP_179877.1| UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 sp|O81010.1|U79B8_ARATH RecName: Full=UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 gb|AAC32440.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AAO64763.1| At2g22930 [Arabidopsis thaliana]
 dbj|BAE99613.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AEC07376.1| UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 gb|AHL38844.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=442

 Score =   339 bits (870),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 191/455 (42%), Positives = 281/455 (62%), Gaps = 24/455 (5%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
             T+H  M+PWF  GH+  F  LANKLA KGH+I+FL+PK  Q +LE  NL P  I F P+ 
Sbjct  4     TFHAFMFPWFAFGHMIPFLHLANKLAEKGHQITFLLPKKAQKQLEHHNLFPDSIVFHPLT  63

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             +P + GLP GAETTSD+     +LL EA+D T++ +E  ++ L+ D++F+DF HW+P +A
Sbjct  64    IPHVNGLPAGAETTSDISISMDNLLSEALDLTRDQVEAAVRALRPDLIFFDFAHWIPEIA  123

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGF  1039
             ++  IKSV Y  +S     Y  +P   V+G           P  +P   +    ++A   
Sbjct  124   KEHMIKSVSYMIVSATTIAYTFAP-GGVLG---------VPPPGYPSSKVLYRENDAHAL  173

Query  1038  TARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
                ++        F+ R++    T     D +A  TC EIEG+FCDYI +Q+ K VLL G
Sbjct  174   ATLSI--------FYKRLYHQITTGFKSCDIIALRTCNEIEGKFCDYISSQYHKKVLLTG  225

Query  870   palpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             P LP    S  +E++ S +L +F   SV++CA GS+  L KD+FQEL  G+ELTG+PF  
Sbjct  226   PMLPEQDTSKPLEEQLSHFLSRFPPRSVVFCALGSQIVLEKDQFQELCLGMELTGLPFLI  285

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             A+KPP  + ++E  +PE  +E+++GRG+V G WVQQ L L HPS+GCFV+HCG  ++ E 
Sbjct  286   AVKPPRGSSTVEEGLPEGFQERVKGRGVVWGGWVQQPLILDHPSIGCFVNHCGPGTIWEC  345

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             L+ DCQ+VLLP +GDQ++  R+M+            E+ G FS+ES+  A+K+VMD+ S+
Sbjct  346   LMTDCQMVLLPFLGDQVLFTRLMTEEF-KVSVEVSREKTGWFSKESLSDAIKSVMDKDSD  404

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +G+ VR NH KL+  L +  L + Y+D F ++LQ+
Sbjct  405   LGKLVRSNHAKLKETLGSHGLLTGYVDKFVEELQE  439



>dbj|BAE98680.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase - 
like protein [Arabidopsis thaliana]
Length=435

 Score =   339 bits (869),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 191/437 (44%), Positives = 273/437 (62%), Gaps = 17/437 (4%)
 Frame = -3

Query  1527  FFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIPGLPPGAETTSDV  1348
             F  LANKLA KGH ++FLIPK    +LE+ NL PH I F  + VP + GLP G ET S++
Sbjct  2     FLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTVPHVDGLPVGTETVSEI  61

Query  1347  PFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGIKSVFYSTISPLM  1168
             P  S  LLM AMD T++ +E +++ ++ D++F+DF HW+P +AR  G+K+V Y  +S   
Sbjct  62    PVTSADLLMSAMDLTRDQVEGVVRAVEPDLIFFDFAHWIPEVARDFGLKTVKYVVVSAST  121

Query  1167  HGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEA---RGFTARTVMKFGGDITF  997
                 L P            ++   P  +P   + L   +A   +   +   +  G ++  
Sbjct  122   IASMLVPG----------GELGVPPPGYPSSKVLLRKQDAYTMKNLESTNTINVGPNL--  169

Query  996   FDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSKS-TMEQKWSD  820
              +R+ T++  SD +A  T REIEG FCDYIE   +K VLL GP  P P K+  +E++W  
Sbjct  170   LERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPVFPEPDKTRELEERWVK  229

Query  819   WLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeaesieaaipeE  640
             WL  ++  SV++CA GS+  L KD+FQEL  G+ELTG PF  A+KPP  + +I+ A+PE 
Sbjct  230   WLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAVKPPRGSSTIQEALPEG  289

Query  639   LKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVLLPQVGDQII  460
              +E+++GRG+V GEWVQQ L L HPSVGCFVSHCG+ S+ E+L++DCQIVL+PQ+GDQ++
Sbjct  290   FEERVKGRGVVWGEWVQQPLLLSHPSVGCFVSHCGFGSMWESLLSDCQIVLVPQLGDQVL  349

Query  459   NARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNHDKLRGFLLN  280
             N R++S  L         EE G FS+ES+  A+ +VM   SEIG  V+ NH K R  L +
Sbjct  350   NTRLLSDEL-KVSVEVAREETGWFSKESLFDAINSVMKRDSEIGNLVKKNHTKWRETLTS  408

Query  279   ADLDSKYMDSFNQKLQD  229
               L + Y+D+F + LQD
Sbjct  409   PGLVTGYVDNFIESLQD  425



>ref|XP_010496151.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=442

 Score =   338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 189/456 (41%), Positives = 282/456 (62%), Gaps = 24/456 (5%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3     SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLP GAETTSD+     +LL E +D T++ +E  ++ L+ D++F+DF HW+P +
Sbjct  63    TVPHVNGLPRGAETTSDISISEDNLLCEVLDLTRDQVEAAVRALRPDLIFFDFAHWIPEV  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A+++ IK+V Y  +S             +   Q+        P  +P   ++L  ++A  
Sbjct  123   AKELLIKTVSYIIVS----------ATTIAHDQVPGGACGVPPPGYPSSKVRLGENDAHA  172

Query  1041  FTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
                 ++        F+ R++    T     D +A  TC++IEG+FCDYI  Q+QK VLL 
Sbjct  173   IAKLSI--------FYKRLYHQITTGFKRCDIIALRTCKDIEGKFCDYIAHQYQKKVLLT  224

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP P  S  +EQ+WS +L  F   SV++CA GS+  L KD+FQEL  G+ELTG+PF 
Sbjct  225   GPMLPEPDTSKPLEQRWSHFLSGFPPRSVVFCALGSQIVLEKDQFQELCLGMELTGLPFL  284

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              A+KPP  + +++  +PE  +E+++GRG+V G WVQQ L L HPSVGCFV+HCG  ++ E
Sbjct  285   LAVKPPKGSSTVQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWE  344

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              L+ DCQ+VLLP + DQ++  R+++            E+ G FS+ES+  AVK+VMD+ S
Sbjct  345   CLMTDCQMVLLPFLHDQVLFTRLLTDEF-EVSVEVLREKTGWFSKESLRDAVKSVMDKDS  403

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             ++G+ VR NH KL+  L++  L + Y+DSF + LQ+
Sbjct  404   DLGKLVRSNHAKLKEILVSPGLLTGYVDSFVEALQE  439



>gb|AFJ52976.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=475

 Score =   339 bits (869),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 282/460 (61%), Gaps = 11/460 (2%)
 Frame = -3

Query  1593  GSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESF--NLHPHL  1420
             G      ++ M+P F +GH+T F  LAN+LA +GHRISFL+P  T  KL +   N H  L
Sbjct  9     GESNKQLNVVMFPLFAMGHITPFLHLANRLAARGHRISFLLPTRTIPKLTNLIINTHADL  68

Query  1419  ISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
             I+F PI VP + GLPPGAE  +DVP      +  AMD T++    IL+ +  D+V +D  
Sbjct  69    ITFHPITVPHVQGLPPGAELIADVPPHLAGHIFAAMDATEDQFTSILRGVSPDIVIFDAA  128

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLH  1060
              W+   AR++G   V Y T S +     + P  R+V K++T+ ++ + P  +P  ++   
Sbjct  129   PWVSRAARELGCVPVSYGTSSAVWAAMRIVPSARIV-KEMTDEELGRTPPGYPSSAVIPR  187

Query  1059  AHEARGFTART-VMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpv  883
               E  G  AR   M+FG   + ++RI + +  S+ +A  +CRE+EG++ DY+  Q  K V
Sbjct  188   PDEIAG--ARLFAMEFGPS-SLYERIVSVIQGSEAIAMRSCRELEGKYLDYLGEQHGKRV  244

Query  882   llagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMP  703
             LL GP LP      +++K   WL KF+ GSV+YCAFGSE  L KD+FQELL GLE  G P
Sbjct  245   LLTGPVLPKLDGLGLDEKLGCWLSKFEPGSVVYCAFGSEVVLHKDQFQELLRGLEQCGRP  304

Query  702   FFAALKppfeaesieaaipeELKEKI---QGRGIVHGEWVQQQLFLQHPSVGCFVSHCGW  532
             F  ALKPP   +++E A+PE  KE++   +GRG+VH  WVQQ   L HPSVGCFVSHCG+
Sbjct  305   FLTALKPPHGCKTVEEALPEGFKERVIIKEGRGMVHEGWVQQPQILGHPSVGCFVSHCGF  364

Query  531   ASLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAV  352
              S+ EAL++DCQI+L+P + +QI+   I  V           +E+G  S+E VC+AV AV
Sbjct  365   GSMWEALLSDCQILLIPNISEQIL-CTIFMVKELRLALEVDKDENGWISKEEVCRAVGAV  423

Query  351   MDEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             MDE S++G+EVR NH KLR  L + DL  KY+D F  +L+
Sbjct  424   MDEDSDVGKEVRRNHLKLREVLGDDDLLDKYVDDFVAQLR  463



>ref|XP_010438412.1| PREDICTED: UDP-glycosyltransferase 79B8 [Camelina sativa]
Length=442

 Score =   337 bits (865),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 186/455 (41%), Positives = 280/455 (62%), Gaps = 24/455 (5%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3     SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLPPGAETTSD+     +LL EA+D T+  +E  ++ L+ D++F+DF HW+P +
Sbjct  63    TVPHVNGLPPGAETTSDISISEDNLLSEALDLTRGQVEAAVRALRPDLIFFDFAHWIPEV  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A++  IKSV Y  +S             +    +    +   P  +P   ++   ++A  
Sbjct  123   AKEFMIKSVSYIIVS----------ATTIAHTHVPGGSLGVPPPGYPSSKVRFGENDAHA  172

Query  1041  FTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
                 ++        F+ R++    T     D +A  TC+EIEG+FCDYI  Q+QK VLL 
Sbjct  173   LAKLSI--------FYKRLYHQITTGFKRCDIIALRTCKEIEGKFCDYIAHQYQKKVLLT  224

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP P  S  +E++WS +L  F   SV++CA GS+  L KD+FQEL  G+ELTG+PF 
Sbjct  225   GPMLPEPDTSKPLEERWSHFLSGFPPRSVVFCALGSQIVLEKDQFQELCLGMELTGLPFL  284

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              A+KPP  + +++  +PE  +E+++GRG+V G WVQQ L L HPSVGCFV+HCG  ++ E
Sbjct  285   LAVKPPRGSSTVQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWE  344

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              ++++CQ+VLLP + DQ +  ++M+            E+ G FS+ES+  A+K+VMD+ S
Sbjct  345   CMMSNCQMVLLPFLSDQTLFTKLMTKEF-EVSVEVLREKTGWFSKESLRDAIKSVMDKDS  403

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             ++G+ VR NH KL+  L++  L + Y+D+F + LQ
Sbjct  404   DLGKVVRSNHAKLKEVLVSPGLLTVYVDNFVEALQ  438



>ref|XP_010479520.1| PREDICTED: UDP-glycosyltransferase 79B5 [Camelina sativa]
Length=448

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 191/459 (42%), Positives = 269/459 (59%), Gaps = 22/459 (5%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  MYPWFG GH+  +  LANKLA KGH I+F +PK    +LE  NL P  I
Sbjct  1     MGSK---FHAFMYPWFGFGHMIPYLHLANKLAEKGHTITFFLPKKAHKQLEPLNLFPDSI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
                P+ +P + GLP GAET SD+P  +   + +AMD  ++ IE  ++ LK D++F+DF H
Sbjct  58    VLEPLTLPHVDGLPSGAETASDLPNSTKKPIFDAMDLLRDQIEAKVRALKPDLIFFDFIH  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +A++ G KSV Y  IS       L+P                A   FP P   L  
Sbjct  118   WVPDMAKEFGFKSVNYQIISAACLAMVLAP---------------CAELGFPPPDYPLSK  162

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
                RG  A     F      F  I T +   D ++  TC E+EG+ C +IE + QK VLL
Sbjct  163   VALRGHEANVCSLFASSHELFGLITTGLKNCDVVSIRTCVELEGKLCGFIERECQKKVLL  222

Query  876   agpal---pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
              GP L      S   +E +WS WL  F+ GSV++CAFG++    KD+FQEL  G+ELTG+
Sbjct  223   TGPMLPEPQSKSGKPLEDRWSQWLNGFEPGSVVFCAFGTQFFFEKDQFQELCLGMELTGL  282

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PF   + P   + +++ A+P+  +E+++GRGIV   WV+Q L L HPSVGCFV+HCG+ S
Sbjct  283   PFLIVVMPRKGSSTVQEALPKGFEERVKGRGIVWEGWVEQPLILSHPSVGCFVNHCGFGS  342

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             + E+LV+DCQIV +PQ+ DQI+  R+++  L       + E+ G FS+ES+   VK+VMD
Sbjct  343   MWESLVSDCQIVFIPQLADQILITRLLTEEL-EVSVKVQREDSGWFSKESLMDTVKSVMD  401

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             + SEIG  V+ NH KL+  L++    S Y D F + L+D
Sbjct  402   KDSEIGNLVKRNHKKLKETLVSPGFFSGYADKFVETLED  440



>gb|EYU44977.1| hypothetical protein MIMGU_mgv1a006277mg [Erythranthe guttata]
Length=450

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 199/446 (45%), Positives = 283/446 (63%), Gaps = 4/446 (1%)
 Frame = -3

Query  1569  MAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPS  1390
             +AM+PW  +GH+T F  LAN+LA +GH IS  IP  +  +L   NL+P LI F P+ VP 
Sbjct  5     IAMFPWIAIGHITPFIHLANELAKRGHSISIFIPPKSVLQLAHHNLYPDLIEFTPVGVPH  64

Query  1389  IPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI  1210
             + GLP GAET SD+   +   L  A D    DIE +L++LK D+VFYDF  W+P+LA KI
Sbjct  65    VDGLPTGAETASDIDISAKDPLAVAFDAMSGDIETLLQNLKPDIVFYDFADWIPALAAKI  124

Query  1209  GIKSVFYSTISPLMHGYALSPERRV-VGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
             G K+V Y+ I   +    + P R +   + LT  ++M+ P+ +P  ++ L   EA   T 
Sbjct  125   GFKTVCYNVICASVMAIGIVPARSIPTDRPLTLQELMEPPSGYPSSTVVLRGQEA--MTL  182

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
               +    G   F  RI  A+   D +   TCRE+EG   DY+ +Q+ KPV L+GP LP P
Sbjct  183   SFIGMDYGATKFHVRIAAAMRGCDAIGIRTCRELEGPMVDYLSSQYNKPVFLSGPVLPEP  242

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
             +K  +E+KW  WL KF   SV+YCAFGS+  L+KD+FQE++ G E+TG+PFF A+  P  
Sbjct  243   AKEPLEEKWLTWLSKFPPKSVVYCAFGSQMILKKDQFQEMVLGFEMTGLPFFVAVSKPAG  302

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQI  493
             A+SIE A+PE   E++ GRG+VHG WVQQ  FL HPSVGCFVSHCG+ S+ E+L++DC+I
Sbjct  303   ADSIEEALPEGFLERVGGRGVVHGGWVQQIQFLNHPSVGCFVSHCGFGSMWESLLSDCRI  362

Query  492   VLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRG  313
             VL+P++ DQI+N R+++  L       +    G FS+E + KA+ + MDE+SE+G+ V+ 
Sbjct  363   VLVPRLADQILNTRLLAEEL-KVAVEVERGVMGWFSKEDLSKAIVSAMDEESELGKMVKR  421

Query  312   NHDKLRGFLLNADLDSKYMDSFNQKL  235
             NH   +  L+N      Y+D+F Q+L
Sbjct  422   NHAVWKETLVNPGYMDDYVDNFIQQL  447



>ref|XP_011096374.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Sesamum indicum]
Length=461

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 209/444 (47%), Positives = 283/444 (64%), Gaps = 9/444 (2%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             MYP F +GHLT +   ANKLA +GH++  ++P  +QSKL   NLHP LI F PI +P + 
Sbjct  22    MYPLFAMGHLTPYLLTANKLAQRGHKVFIVVPPKSQSKLRPLNLHPDLIQFKPISIPRVE  81

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLPP  ETT+D+      LL+ A+D TQ  IE +L DL+   VF+DF HWLP LAR + I
Sbjct  82    GLPPDVETTADITIMEHDLLLHALDLTQPAIESMLSDLQPHFVFFDFMHWLPGLARSLKI  141

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTARTV  1024
             KSV+YS  SP   G+  +    V        D+M  P  FP   I+L+ H A        
Sbjct  142   KSVYYSPASPAAVGFLFAEGPFV-------EDLMNGPPGFPT-RIRLYKHAALQLMWFNA  193

Query  1023  MK-FGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSK  847
              K  G  IT   R    + ESD + ++TC E EG +C ++E +F KP+LLAGP +     
Sbjct  194   AKGRGSGITLRQRFMAGMWESDAIGFATCEETEGIYCQFLENKFDKPILLAGPTVQKIQI  253

Query  846   STMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeae  667
             S++E+KW+ WLGKFK  SV++CAFGSE  L KD+F++LL GLELTG+PF AALKPP   +
Sbjct  254   SSLEEKWATWLGKFKPKSVVFCAFGSEAVLEKDQFEQLLLGLELTGLPFLAALKPPSGVD  313

Query  666   sieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVL  487
             S+E A+P   KE+   RG+V+G WV Q L L HP VGCFV+HCG+ S  E L+++CQ+VL
Sbjct  314   SVEEALPNGFKERSGERGVVYGGWVPQPLILNHPCVGCFVTHCGYGSSWEGLMSECQLVL  373

Query  486   LPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNH  307
             L Q GDQ ++A+++S  L VGVE+EKG+EDG F+RE+V  A+   M ++SE+G+ VR  H
Sbjct  374   LSQQGDQYVDAKLLSGDLGVGVEIEKGDEDGRFTREAVSGAIMGAMGDQSEVGKRVRAKH  433

Query  306   DKLRGFLLNADLDSKYMDSFNQKL  235
             D+ R  L        Y+D+F  +L
Sbjct  434   DEWRELLFGEGFQDSYLDNFVGRL  457



>emb|CDP05960.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   337 bits (865),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 200/449 (45%), Positives = 289/449 (64%), Gaps = 4/449 (1%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H+AM+P    GH+T F  LAN+LA +GH++S+L+ K  + +LE  NL+P +++F  + VP
Sbjct  10    HVAMFPGLATGHMTPFLHLANELAKRGHKVSYLLTKKAKIQLECGNLYPDVVTFHVLPVP  69

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLPPG E  S++P     L   A D   + +E  L DL  DVV YD    +   A K
Sbjct  70    HVEGLPPGTENASEIPIFLNSLFALAFDNMSDQVEAALSDLNPDVVLYDTAFRITDFAPK  129

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             IG K+V Y+ +S      AL P R++   + LTE ++M+ P  +P  S+ L  HEA+   
Sbjct  130   IGFKTVCYNVVSAASIALALVPARQMPKDRPLTEEELMEPPPGYPSSSVVLRKHEAK-VL  188

Query  1035  ARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
             A    +FG   TF+DRI TA+     +A  +C+E+EGQFCDYI  Q+QKPV L+GP LP 
Sbjct  189   AFMSSEFGAR-TFYDRIITALKGCHAIAIRSCQELEGQFCDYIGGQYQKPVFLSGPVLPE  247

Query  855   PSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppf  676
               K  ++ KW++WLGKF++ SV++CAFGS+  L K +FQEL+ G ELTG+PFF ALKPP 
Sbjct  248   QEKQPLDGKWAEWLGKFEQKSVVFCAFGSQIILEKQQFQELVLGFELTGLPFFVALKPPL  307

Query  675   eaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQ  496
                SIE ++P+  +E++ GRG+V+G WVQQ   L HPSVGCFV+HCG+ S+ E+L++DCQ
Sbjct  308   GTGSIEESLPDGFEERVGGRGVVYGGWVQQPQILSHPSVGCFVNHCGFGSMWESLMSDCQ  367

Query  495   IVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             IVL+P +GDQI+N+R++   L       + +E G FS+ES+  A+ AVM   SE+G  +R
Sbjct  368   IVLVPHLGDQILNSRLLCGDL-KVAVEVERDESGWFSKESLSSAINAVMGPDSEVGSSLR  426

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              +H K++  L +    S Y++SF Q L +
Sbjct  427   KSHLKVKEILSSPGYMSNYVESFIQNLYE  455



>ref|XP_010421892.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=448

 Score =   337 bits (864),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 189/455 (42%), Positives = 274/455 (60%), Gaps = 25/455 (5%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ V
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTV  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAETTSD+     + L EAMD T++ +E  +   + D++F+DF HW+P +A+
Sbjct  65    PHVNGLPAGAETTSDISISMDNFLSEAMDLTRDQVEAAVHASRPDLIFFDFAHWIPEVAK  124

Query  1215  KIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFT  1036
             +  IKSV Y  IS     +   P          +  +   P  +P   +    ++A  F 
Sbjct  125   EHMIKSVSYIIISATAIAHLREP----------DTPLGVPPPGYPSTKVLCRENDAHAFI  174

Query  1035  ARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla--  874
                 M F     F++R++    T   + D +A  TCRE+EG+FCDY+  Q+ K VLL   
Sbjct  175   T---MPF-----FYERLYHQITTGFKKCDVIALRTCREMEGKFCDYVSHQYHKNVLLTGP  226

Query  873   gpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
                 P  SK   EQ W+ +L  F  GSVI+CA G++  L KD+FQEL  G+ELTG+PF  
Sbjct  227   MLPEPDTSKPLEEQHWNHFLSGFPPGSVIFCALGTQIVLEKDQFQELCLGMELTGLPFLL  286

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             A+KPP  + +++  +PE  +E+++GRG+V G WVQQ L L HPSVGCFV+HCG  ++ E 
Sbjct  287   AVKPPRGSSTVQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGTIWEC  346

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             L++DCQ+VL+P  GDQ++  R+++            E+ G FS+ES+  AVK+VMD+ S+
Sbjct  347   LLSDCQMVLIPFFGDQVLFTRLLTEEF-EVSVEVSREKTGWFSKESLRDAVKSVMDKDSD  405

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +G  VR NH KL+  L++  L + Y+D+F + L D
Sbjct  406   LGELVRSNHAKLKEILISPGLFAGYVDNFVEALTD  440



>ref|XP_010437944.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=447

 Score =   337 bits (863),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 190/455 (42%), Positives = 276/455 (61%), Gaps = 24/455 (5%)
 Frame = -3

Query  1578  TYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIV  1399
              +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q +LE  N  P  I F P+ 
Sbjct  4     NFHAFMFPWFAFGHMIPFIHLANKLAEKGHRVTFLLPKKAQKQLEHLNQFPDSIVFHPLT  63

Query  1398  VPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLA  1219
             +P + GLP GAETTSD+     + L EAMD T++  E  +  L+ D++F+DF HW+P +A
Sbjct  64    IPPVNGLPAGAETTSDISISMDNFLSEAMDLTRDQAEAAVHALRPDLIFFDFAHWIPEVA  123

Query  1218  RKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGF  1039
             ++  IKSV Y  IS     +   P+            +   P  +P   +    ++A  F
Sbjct  124   KEHMIKSVSYIIISATAISHLREPD----------TPLGVPPPGYPSSKVLCRENDAHAF  173

Query  1038  TARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllag  871
                 +        F++R++    T     D +A  TCRE+EG+FCDY+  Q+ K VLL G
Sbjct  174   ITMPL--------FYERLYHQVTTGFKRCDVIALRTCREMEGKFCDYVSHQYHKNVLLTG  225

Query  870   palpvPSKS-TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFA  694
             P LP P  S  +E+ WS +L  F  GSV++CAFG++  L KD+FQEL  G+ELTG+PF  
Sbjct  226   PMLPEPDTSKPLEEHWSHFLSGFPPGSVVFCAFGTQIVLEKDQFQELCLGMELTGLPFLL  285

Query  693   ALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEA  514
             A+KPP  + +I+  +PE  +E+++GRG+V G WVQQ L L HPSVGCFV+HCG  ++ E 
Sbjct  286   AVKPPRGSSTIQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGTIWEC  345

Query  513   LVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSE  334
             L++DCQ+VL+P  GDQ++  R+++            E+ G FS+ES+  AVK+VMD+ S+
Sbjct  346   LLSDCQMVLIPFFGDQVLFTRLLTEEF-EVSVEVSREKTGWFSKESLRDAVKSVMDKDSD  404

Query  333   IGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             +G  VR NH KL+  L++  L + Y+D+F + L D
Sbjct  405   LGELVRSNHAKLKEILISPGLFAGYVDNFVEALTD  439



>gb|EYU41034.1| hypothetical protein MIMGU_mgv1a006102mg [Erythranthe guttata]
Length=457

 Score =   336 bits (862),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 191/457 (42%), Positives = 277/457 (61%), Gaps = 6/457 (1%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKL-ESFNLHPHL  1420
             M S+    H+AM+PW  +GH+T F  + N+LA +GH +S L+PK    KL  + +     
Sbjct  1     MPSETKKLHIAMFPWIAMGHVTPFLHVGNELAKRGHTVSLLLPKKALLKLGHAADPGGSP  60

Query  1419  ISFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKD-LKVDVVFYDF  1243
             ++F  + VP + GLP GAET SD+     + L  A D    ++E +L+D +K DVVFYDF
Sbjct  61    VNFHTVKVPHVAGLPAGAETCSDIDITENNFLAMAFDAMSPEVEALLRDTIKPDVVFYDF  120

Query  1242  THWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVV-GKQLTEADMMKAPASFPDPSIK  1066
              HW+P LA ++G K+V Y  +S     Y + P R +   +QLT  ++   P  +P  ++ 
Sbjct  121   AHWIPDLASRVGFKTVCYQIVSASCMAYGVVPARTIPKDRQLTAEELAAPPPGYPSSTVV  180

Query  1065  LHAHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKp  886
             L  HE  G     + +  GDI F +R+  A+S  D +   TC E+EG  CDY+  Q++KP
Sbjct  181   LRRHE--GMIMSFIGRDYGDIRFDERMAAALSGCDAIGIRTCAEMEGPMCDYLSEQYKKP  238

Query  885   vllagpalpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
             V L+GP LP   +  +E+KW  WL KF   SV+YCAFGS+  L+K++F E++ G E+TG+
Sbjct  239   VFLSGPVLPEVPEGPLEEKWDTWLNKFPPKSVVYCAFGSQVILKKEQFTEMVLGFEMTGL  298

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PFF A   P   E +E A+PE   E++ GRG+VH  WVQQ   L H SVGCFVSHCG+ S
Sbjct  299   PFFIAAAKPHGVEKVEEALPEGFMERVAGRGVVHCGWVQQTQILSHDSVGCFVSHCGFGS  358

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             + E+L++DCQIVL+P+ GDQ++NAR+++  +       +  E G FS+E +C AVK VMD
Sbjct  359   MCESLMSDCQIVLVPRFGDQVLNARLLTAEM-KVAVEVERGEMGWFSKEDLCNAVKTVMD  417

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKL  235
               SE+G  VR NH   +  L+       Y+D+F Q+L
Sbjct  418   VGSEVGDLVRRNHATWKETLVKPGFMDNYIDNFVQQL  454



>ref|XP_006393137.1| hypothetical protein EUTSA_v10012257mg [Eutrema salsugineum]
 gb|ESQ30423.1| hypothetical protein EUTSA_v10012257mg [Eutrema salsugineum]
Length=450

 Score =   335 bits (860),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 192/459 (42%), Positives = 281/459 (61%), Gaps = 20/459 (4%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  MYP F  GH   +  LANKLA KGHRI+FL+PK  + +LES NL P+ I
Sbjct  1     MGSK---FHAFMYPCFAFGHFIPYLHLANKLAEKGHRITFLLPKKAKKQLESLNLFPYSI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTH  1237
                P+ +P + GLP GAETT+D+   +  ++ +AM+  ++ IE  ++ LK D++F+DF H
Sbjct  58    VLDPLTLPPVDGLPVGAETTADLSNLNGKVITDAMNLLRDQIEAKVRALKPDLIFFDFVH  117

Query  1236  WLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHA  1057
             W+P +A++IG+KSV Y  +S      AL+P     G +L        P  +P     L  
Sbjct  118   WVPEMAKEIGVKSVSYQIVSAACVAMALAP-----GAELG----FPQPPGYPSFKTVLRG  168

Query  1056  HEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvll  877
             H+A  ++  T       +  F R  T +   D +A  T +EIEGQ+C +IE Q ++ VLL
Sbjct  169   HDANLYSLFT----NSCLRLFGRTTTGLKNCDLIAIRTSKEIEGQYCSFIERQCERKVLL  224

Query  876   agpa---lpvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGM  706
              GP        S   +E +W+ WL  FK GS+++CA GS+  + KD+FQEL  G+EL G+
Sbjct  225   TGPMFPESQEKSVKPLEDRWNHWLNGFKPGSLVFCALGSQNYIEKDQFQELCLGIELAGL  284

Query  705   PFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWAS  526
             PF  A+KP   + +I+ A+PE  +++++ RGIV G WV+Q L L H SVGCFV+HCG  S
Sbjct  285   PFLIAVKPLGGSSTIQEALPEGFEDRVKERGIVWGGWVEQPLILSHQSVGCFVNHCGSGS  344

Query  525   LSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMD  346
             + E+LV+DCQIV +PQ+GDQ++  R++S  L       + E+ G FS+ES+  AVK+VMD
Sbjct  345   MWESLVSDCQIVFIPQLGDQVLTTRLLSEEL-KVSVKVQREDSGWFSKESLRDAVKSVMD  403

Query  345   EKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
               SEIG  V+ NH+KL+  L+   L S Y D F + L++
Sbjct  404   VDSEIGNLVKRNHEKLKETLVRPGLLSGYADKFVEALKN  442



>ref|XP_003596801.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=844

 Score =   347 bits (889),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 209/451 (46%), Positives = 283/451 (63%), Gaps = 51/451 (11%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             ++ H+AM PWF +GHL  +  L+N LA KG + SF IPK TQ+KLE FNL+P+LI+F P+
Sbjct  438   SSLHIAMSPWFAMGHLIPYLHLSNILAKKGDKTSFFIPKKTQTKLEKFNLYPNLITFYPL  497

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP I GLP GAETTSDV F    L+M AMD+T+  IE  L  L  ++VF+DF  WLP +
Sbjct  498   NVPHIEGLPFGAETTSDVSFSLGPLIMTAMDQTKPQIE-PLTPLNPEMVFFDFAFWLPKI  556

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A+ +GIKS  Y  IS                  LTE D+M  P  +P  S  L++HEA+ 
Sbjct  557   AQNLGIKSFQYWIIS----------------INLTEFDLMIPPKGYPISSFNLYSHEAKF  600

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                +   +FG  + F+DR+F  +S SD + +  CREIEG + DY+E +F KPVLL+GP L
Sbjct  601   LALKRNFEFGSGVIFYDRLFIGLSLSDAIWFKGCREIEGSYVDYLEQEFGKPVLLSGPVL  660

Query  861   pvPSKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKp  682
             P P K+T+++KW                   E  L +D+F ELL GLELT  PF A LKP
Sbjct  661   PEPPKNTLDEKWG----------------SCEWKLSQDQFHELLLGLELTCYPFLAILKP  704

Query  681   pfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVND  502
             P   E++E A+PE  KE+++ +GIV   W+QQQL L+H SVGCFV+HCG  SL+E L+N+
Sbjct  705   PVGFETVEDALPEGFKERVKEKGIVDSGWIQQQLILEHSSVGCFVTHCGAGSLTEGLINN  764

Query  501   CQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGRE  322
             CQ+VL+   G ++   +                EDG+F++ESVC+AVK VMD+++EIGRE
Sbjct  765   CQMVLM--AGVEVKKGK----------------EDGLFTKESVCEAVKIVMDDENEIGRE  806

Query  321   VRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             VR NHDKLR  LL+ DL+S  +  F +KLQ+
Sbjct  807   VRNNHDKLRKLLLSHDLESSCVGVFCEKLQE  837



>ref|XP_002888295.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64554.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 190/454 (42%), Positives = 277/454 (61%), Gaps = 22/454 (5%)
 Frame = -3

Query  1572  HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  1393
             H  M+PWF  GH+T +  LAN    KGHR++FL+PK  Q +L   NL PH I F P+ +P
Sbjct  6     HAFMFPWFAFGHMTPYLHLANSTQQKGHRVTFLLPKKAQKQLGHQNLFPHGIVFHPLTIP  65

Query  1392  SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARK  1213
              + GLP GAET SD+P      L  AMD T++ +E  +  L+ D++ +D   W+P +A+ 
Sbjct  66    HVDGLPAGAETASDIPISLVKFLSIAMDLTRDQVEAAILALRPDLILFDLAQWIPEMAKA  125

Query  1212  IGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
               +KS+ Y+ +S     + L P            ++   P  +P      H H+A     
Sbjct  126   HKVKSMLYNVMSATSIAHDLVP----------GGELGVPPPGYPSSKALYHKHDAHA---  172

Query  1032  RTVMKFGGDIT-FFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpv  856
               ++ F G    F+ R+ T +   D ++  TC+EIEG+FCDYIE Q++K VLL GP LP 
Sbjct  173   --LLTFSGFYKRFYHRLTTGLMNCDFISIRTCKEIEGKFCDYIERQYEKKVLLTGPMLPE  230

Query  855   PSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKpp  679
             P KS  +E +WS WL  F++GSV++CA GS+ TL K++FQEL  G+ELTG+PF  A+KPP
Sbjct  231   PDKSKPLEDQWSHWLSGFRQGSVLFCALGSQTTLEKNQFQELCLGIELTGLPFLVAVKPP  290

Query  678   feaesieaaipeELKEKIQGRGIVHGEWVQ----QQLFLQHPSVGCFVSHCGWASLSEAL  511
                ++I+ A+PE  +E++ GRG+V GEWVQ    Q L L HPSVGCFVSHCG+ S+ E+L
Sbjct  291   KGTKTIQEALPEGFEERVTGRGMVWGEWVQQPYWQPLILAHPSVGCFVSHCGFGSMWESL  350

Query  510   VNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEI  331
             ++DCQIV +P + DQ++  R+++  L       + EE G FS+E++  A+ ++MD+ SEI
Sbjct  351   MSDCQIVFIPVLNDQVLTTRLLTEEL-EVSVEVQREETGWFSKENLSGAIMSLMDKDSEI  409

Query  330   GREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             G +VR NH KL+  L +  L + Y D F   L +
Sbjct  410   GNQVRRNHSKLKETLGSPGLLTGYTDKFVDTLAN  443



>ref|XP_010455377.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=446

 Score =   334 bits (857),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 188/456 (41%), Positives = 280/456 (61%), Gaps = 25/456 (5%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3     SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIFFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              V  + GLP GAETTSD+     +LL EA+D T++ +E  ++ L+ D +F+DF HW+P L
Sbjct  63    TVTHVNGLPLGAETTSDISISEDNLLSEALDLTRSQVEAAVRALRPDFIFFDFAHWIPEL  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A++  IKSV Y  +S             V+ +          P  +P   +    ++A  
Sbjct  123   AKEHKIKSVSYMIVS-----------ATVIARLHDPGAPGVHPPGYPSTKVLFRENDAHA  171

Query  1041  FTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
                R++        F++R++    T     D +A  TC+EIEG+FCD+I  Q+QK VLL 
Sbjct  172   LVTRSI--------FYERLYNQLTTGFKSCDVIALRTCKEIEGKFCDFISRQYQKKVLLT  223

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP P+ S  +E+ WS +L  F  GSV++CA GS+  L KD+FQ+L  G+ELTG+PF 
Sbjct  224   GPMLPEPATSKPLEEHWSHFLSGFPPGSVVFCALGSQIVLEKDQFQDLCLGMELTGLPFL  283

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              A+KPP  + +I+ ++PE  +E+++GRG+V G WVQQ L L HPSVGCFV HCG  ++ E
Sbjct  284   VAVKPPRGSSTIQESLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVHHCGPGTIWE  343

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              L+ DCQ+VL+P + DQ++  R+++            E+ G FS+ES+  A+K+VMD++S
Sbjct  344   CLMTDCQMVLIPFLSDQVLFTRLLTEEF-EVSVEVSREKIGWFSKESLRNAIKSVMDKES  402

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             ++G+ V  NH KL+  L++  L S Y+D+F + L D
Sbjct  403   DLGKLVGSNHAKLKEILVSPGLFSSYVDNFVEALAD  438



>ref|XP_009147894.1| PREDICTED: UDP-glycosyltransferase 79B5-like isoform X1 [Brassica 
rapa]
 ref|XP_009147895.1| PREDICTED: UDP-glycosyltransferase 79B5-like isoform X2 [Brassica 
rapa]
Length=445

 Score =   334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 198/460 (43%), Positives = 280/460 (61%), Gaps = 28/460 (6%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  MYP+F  GH+  +  LANKLA KGH I+FL+PK  Q  LES NL P  I
Sbjct  1     MGSK---FHAFMYPYFAFGHMIPYLHLANKLAEKGHYITFLLPKKAQKHLESLNLFPESI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
              F PI +P + GLP GAET SD+P   T  ++ +AMD  ++ IE  +  LK D++F+D T
Sbjct  58    FFHPITLPPVEGLPVGAETASDLPPNLTGKVISDAMDLLRDQIEAKVCALKPDLIFFDLT  117

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLH  1060
              W+P +A++ G+KSV Y  +S      AL+P     G +L           FP PS  L 
Sbjct  118   PWVPEMAKEFGVKSVSYQIVSAACVAIALAP-----GVEL----------GFPQPS-GLR  161

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
              H+A  ++    +        F RI T +   D ++  TC EIEG++C +IE + Q+ V 
Sbjct  162   GHDANLYS----IFMNSHKRVFSRIITGIKNCDVVSIRTCAEIEGKYCSFIERECQRKVF  217

Query  879   lagpalpvPSKST---MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             L GP      +++   +E +W+ WL  F+ GSV++CA GS+  L KD+FQEL  G+ELTG
Sbjct  218   LTGPMFLEAEENSVRPLEDQWNRWLNGFEPGSVVFCALGSQTILEKDQFQELCLGMELTG  277

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  A+KPP  A +I+ A+P+  +E+++GRGIV G WV+Q L L H SVGCFV+HCG  
Sbjct  278   LPFLVAVKPPRGASTIQEALPQGFEERVKGRGIVCGGWVEQPLILSHQSVGCFVNHCGSG  337

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+LV+DCQIV +PQ GDQ++  +++S          + E+ G FS+ES+  AVK+VM
Sbjct  338   SMWESLVSDCQIVFIPQSGDQVLTTKLLSEEF-EVSVEVQREDSGWFSKESLRDAVKSVM  396

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             D+ SEIG  V+ NH KLR  L    L S Y D F + L++
Sbjct  397   DKDSEIGNIVKRNHMKLRETLACPGLLSGYADKFVEALEN  436



>ref|XP_006289841.1| hypothetical protein CARUB_v10003451mg [Capsella rubella]
 gb|EOA22739.1| hypothetical protein CARUB_v10003451mg [Capsella rubella]
Length=447

 Score =   334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 185/452 (41%), Positives = 274/452 (61%), Gaps = 16/452 (4%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++ L+PK  Q +LE  NL P  I F P+
Sbjct  3     SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTLLLPKKAQKQLEHHNLFPDSIVFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +P + GLP GAETTSD+       L EA++ T++ +E  ++ L+ D++F+DF HW+P L
Sbjct  63    TIPPVNGLPAGAETTSDISISMGKFLSEALNLTRDQVEAAVRALRPDIIFFDFAHWIPEL  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A +  IKSV Y  +S     + L P             +   P  +P   +    ++A  
Sbjct  123   AEEHMIKSVSYMIVSATDIAHTLVPG----------GALGVPPPGYPSSKVLFRENDAHT  172

Query  1041  FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpal  862
                 ++         + RI T     D +A  TC+E+EG+FC+YI  Q+ K VLL GP L
Sbjct  173   LVTLSIFY----ERLYHRITTGFKSCDVIALRTCKEMEGKFCNYISRQYNKKVLLTGPML  228

Query  861   pvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  685
             P P  S  +E++WS +L K+  GSV++CA GS+  L KD+FQEL  G+E+TG+PF  ALK
Sbjct  229   PEPDTSKPLEERWSQFLSKYPPGSVVFCALGSQIVLEKDQFQELCLGMEMTGLPFLVALK  288

Query  684   ppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  505
             PP  + +I+  +PE  +E+++GRG+V G WVQQ L L HPSVGCFV+HCG  ++ E L++
Sbjct  289   PPRGSSTIQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWECLMS  348

Query  504   DCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGR  325
             +CQ+VL+P + DQ++  R+M+            E+ G FS+ES+  A+K+VMD+ S+IG+
Sbjct  349   NCQMVLIPFLSDQVLFTRLMTEEF-EVAVEVSREKTGWFSKESLSDAIKSVMDKDSDIGK  407

Query  324   EVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
              VR NH KL+  L++  L   Y+D+  + L D
Sbjct  408   LVRSNHAKLKEVLVSPGLLDGYVDNLVEALVD  439



>ref|XP_010496152.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=442

 Score =   333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/455 (41%), Positives = 279/455 (61%), Gaps = 24/455 (5%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3     SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              VP + GLPPGAETTSD+     +LL EA+D T+  +E  ++ L+ D++F+DF HW+P L
Sbjct  63    TVPHVSGLPPGAETTSDISISEDNLLCEALDLTRGQVEAAVRALRPDLIFFDFAHWIPEL  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A++  IK+V Y  +S             +    +    +   P  +P   ++   ++A  
Sbjct  123   AKEHMIKTVSYIIVS----------ATTIAHTHVPGGSLGVPPPGYPSSKVRFGENDAHA  172

Query  1041  FTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
                 ++        F+ R++    T     D +A  TC+EIEG+FCDYI  Q+QK VLL 
Sbjct  173   LEKLSI--------FYKRLYHQITTGFKRCDIIALRTCKEIEGKFCDYIAHQYQKKVLLT  224

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP P  S  +E++WS +L  F   SV++ A GS+  L KD+FQEL  G+ELTG+PF 
Sbjct  225   GPMLPEPDTSKPLEERWSHFLSGFPPRSVVFFALGSQIVLEKDQFQELCLGMELTGLPFL  284

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              A+KPP  + +++  +PE  +E+++GRG+V G WVQQ L L HPSVGCFV+HCG  ++ E
Sbjct  285   LAVKPPRGSSTVQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWE  344

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              L+++CQ+VLLP + DQ +  ++M+            E+ G FS+ES+  A+K+VMD+ S
Sbjct  345   CLMSNCQMVLLPFLSDQTLFTKLMTKEF-EVSVEVLREKTGWFSKESLRDAIKSVMDKDS  403

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
             ++G+ VR NH KL+  L++  L + Y+D+F + LQ
Sbjct  404   DLGKVVRSNHAKLKEVLVSPGLLTAYVDNFVEALQ  438



>ref|XP_006289802.1| hypothetical protein CARUB_v10003406mg [Capsella rubella]
 gb|EOA22700.1| hypothetical protein CARUB_v10003406mg [Capsella rubella]
Length=447

 Score =   333 bits (855),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 188/456 (41%), Positives = 276/456 (61%), Gaps = 24/456 (5%)
 Frame = -3

Query  1581  TTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPI  1402
             + +H  M+PWF  GH+  F  LANKLA KGHR++FL+PK  Q ++E  NL P  I F P+
Sbjct  3     SKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQMEHHNLFPDSIVFHPL  62

Query  1401  VVPSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSL  1222
              +P + GLP GAETTSD+     +LL EA D TQ+ +E ++  LK D++F+DF HW+P L
Sbjct  63    TIPHVDGLPAGAETTSDISLSLDNLLSEAFDLTQDQVEAVVCYLKPDIIFFDFAHWIPEL  122

Query  1221  ARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             A++  IKSV Y  +S     +                     P  +P   + L  ++A  
Sbjct  123   AKEHKIKSVSYMIVSATALAHI----------NDPGVPFGVPPPGYPSTKVLLGENDAHA  172

Query  1041  FTARTVMKFGGDITFFDRIF----TAVSESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
                 ++        F++R++    T  +  D +A  TC E+EG+FCDYI  Q+ K VLL 
Sbjct  173   LATMSI--------FYERLYHQLTTGFNNCDVIALRTCNEMEGKFCDYISRQYNKKVLLT  224

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP P  S  +E++WS +L KF  GSV++CA GS+  L KD+FQEL  G+E+TG+PF 
Sbjct  225   GPMLPEPDTSKPLEERWSHFLSKFPPGSVVFCALGSQIVLEKDQFQELCLGMEMTGLPFL  284

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
              ALKPP  + +I+  +PE  +E+++GRG+V   WVQQ L L HPSVGCFV+HCG  ++ E
Sbjct  285   VALKPPRGSSTIQEVLPEGFEERVKGRGVVWEGWVQQPLILSHPSVGCFVNHCGPGTIWE  344

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
             +L+ DCQ+VL+P + DQ++  R+M+            E+ G FS+ES+   +K+VMD++S
Sbjct  345   SLMTDCQLVLIPFLSDQMLFTRLMTKEF-EVAVEVSREKTGWFSKESLSDTIKSVMDKES  403

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             ++G+ V  NH KL+  L +  L   Y+D+F + L D
Sbjct  404   DLGKLVSSNHTKLKEVLFSPGLLDGYVDNFVEALAD  439



>emb|CDY70505.1| BnaAnng33940D [Brassica napus]
Length=445

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 197/460 (43%), Positives = 280/460 (61%), Gaps = 28/460 (6%)
 Frame = -3

Query  1596  MGSQATTYHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLI  1417
             MGS+   +H  MYP+F  GH+  +  LANKLA KGH I+FL+PK  Q  LES NL P  I
Sbjct  1     MGSK---FHAFMYPYFAFGHMIPYLHLANKLAEKGHYITFLLPKKAQKHLESLNLFPESI  57

Query  1416  SFVPIVVPSIPGLPPGAETTSDVPFPST-HLLMEAMDKTQNDIEIILKDLKVDVVFYDFT  1240
              F PI +P + GLP GAET SD+P   T  ++ +AMD  ++ IE  +  LK D++F+D T
Sbjct  58    FFHPITLPPVEGLPVGAETASDLPPNLTGKVISDAMDLLRDQIEAKVCALKPDLIFFDLT  117

Query  1239  HWLPSLARKIGIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLH  1060
              W+P +A++ G+KSV +  +S      AL+P     G +L           FP PS  L 
Sbjct  118   PWVPEMAKEFGVKSVSFQIVSAACVAIALAP-----GVEL----------GFPQPS-GLR  161

Query  1059  AHEARGFTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvl  880
              H+A  ++    +        F RI T +   D ++  TC EIEG++C +IE + Q+ V 
Sbjct  162   GHDANLYS----IFMNSHKRVFSRIITGIKNCDVVSIRTCAEIEGKYCSFIERECQRKVF  217

Query  879   lagpalpvPSKST---MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTG  709
             L GP      +++   +E +W+ WL  F+ GSV++CA GS+  L KD+FQEL  G+ELTG
Sbjct  218   LTGPMFLEAEENSVKPLEDQWNRWLNGFEPGSVVFCALGSQTILEKDQFQELCLGMELTG  277

Query  708   MPFFAALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWA  529
             +PF  A+KPP  A +I+ A+P+  +E+++GRGIV G WV+Q L L H SVGCFV+HCG  
Sbjct  278   LPFLVAVKPPRGASTIQEALPQGFEERVKGRGIVCGGWVEQPLILSHQSVGCFVNHCGSG  337

Query  528   SLSEALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVM  349
             S+ E+LV+DCQIV +PQ GDQ++  +++S          + E+ G FS+ES+  AVK+VM
Sbjct  338   SMWESLVSDCQIVFIPQSGDQVLTTKLLSEEF-EVSVEVQREDSGWFSKESLRDAVKSVM  396

Query  348   DEKSEIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             D+ SEIG  V+ NH KLR  L    L S Y D F + L++
Sbjct  397   DKDSEIGNIVKRNHMKLRETLACPGLLSGYADKFVEALEN  436



>ref|XP_004238163.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Solanum lycopersicum]
Length=455

 Score =   331 bits (849),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 190/448 (42%), Positives = 283/448 (63%), Gaps = 9/448 (2%)
 Frame = -3

Query  1569  MAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPS  1390
             + M+PW   GHL  F  L+N+LA +GH I+FL+P+N +++L+  NL+P+LI F  + +P 
Sbjct  11    IVMFPWLAFGHLIPFMNLSNELAKRGHNITFLLPQNAETRLQKLNLYPNLIKFHKLTIPH  70

Query  1389  IPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKI  1210
             + GLP GAETT+DVP P   LL  A D+  ++I+ IL++LK   VF+DF +W+P LA++I
Sbjct  71    VDGLPYGAETTADVPGPMETLLATAFDELYDEIKSILQNLKPHFVFFDFAYWIPDLAKEI  130

Query  1209  -GIKSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTA  1033
              GIK++ Y  ISP           +      T A++ K P  +P  ++ LH  EA+   +
Sbjct  131   GGIKTLIYLLISP---AALCKSTDKATFMTSTAAELAKPPPGYPSTTVVLHESEAK-LLS  186

Query  1032  RTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvP  853
                 ++G  +TF +R+  A+ + D +A  TCREIEG FC+Y+    +KPV+  GP +P P
Sbjct  187   FVYQEYGKGVTFQERLDKALRQCDVIAAKTCREIEGIFCEYLANLLEKPVIYVGPVIPEP  246

Query  852   SKSTMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfe  673
              K   + + S+WL KF+ GSV++CAFGS+  L K +FQEL+ G ELT +PF   +KPP  
Sbjct  247   KKE--QHELSNWLEKFEPGSVVFCAFGSQMILEKTQFQELVLGFELTELPFLLVVKPPQG  304

Query  672   aesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALV-NDCQ  496
               S+E A+PE  K++IQ +G++   WV Q   L+H SVGCFV+HCG+ S+ E+LV  DCQ
Sbjct  305   TNSVEEALPEGFKQRIQEKGLILDCWVPQLEILRHKSVGCFVTHCGYGSMWESLVLCDCQ  364

Query  495   IVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVR  316
             +VLLP+  D I  AR+M   L       + +E+ +F++E++CKAVK VMD+ S+IG  V+
Sbjct  365   LVLLPRPIDHIFTARLMGQHL-KVGVEVEKDENDMFTKENLCKAVKCVMDKDSQIGCVVK  423

Query  315   GNHDKLRGFLLNADLDSKYMDSFNQKLQ  232
              NH K +  L +    S Y+D+F Q L 
Sbjct  424   ENHKKWKKLLSSPGFMSNYIDNFIQDLH  451



>ref|XP_010455375.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=444

 Score =   331 bits (848),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 185/456 (41%), Positives = 281/456 (62%), Gaps = 31/456 (7%)
 Frame = -3

Query  1575  YHMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVV  1396
             +H  M+PWF   H+  F  LANKLA KGHR++FL+PK  Q +LE  NL P  I F P+ +
Sbjct  5     FHAFMFPWFAFVHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDRIVFHPLAI  64

Query  1395  PSIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLAR  1216
             P + GLP GAETTSD+     + L EA+D T++ +E  ++ L+ D++F+DF HW+P +A+
Sbjct  65    PHVNGLPAGAETTSDISISMDNFLSEALDLTRDQVEAAVRALRPDLIFFDFAHWIPEVAK  124

Query  1215  KIGIKSVFY--STISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARG  1042
             +  IKSV Y  ++ + + H +A      V+            P  +P   +    ++A  
Sbjct  125   EHMIKSVSYMIASATAVAHSHAHGSALGVI------------PPGYPSSKVFFRGNDAHT  172

Query  1041  FTARTVMKFGGDITFFDRIFTAVS----ESDGLAYSTCREIEGQFCDYIETQFQKpvlla  874
              +           TFF+R+   ++      D +A  TC+EIEG+FCDYI +Q+QK V+L 
Sbjct  173   MS-----------TFFERVCHLLTIGFKSCDVIALRTCKEIEGKFCDYISSQYQKKVILT  221

Query  873   gpalpvPSKST-MEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFF  697
             GP LP    S  +++ WS +   F  GSV++CAFG++  L KD+FQEL  GLELTG+PF 
Sbjct  222   GPMLPELDTSKPLDEHWSQFPSGFPPGSVVFCAFGNQTVLEKDQFQELCLGLELTGLPFL  281

Query  696   AALKppfeaesieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSE  517
               + PP  + +++  +PEE +E+++GRG V G WVQQ L L HPSVGCFV+HCG  ++ E
Sbjct  282   LVVNPPRGSSTVQEGLPEEFEERVKGRGEVWGGWVQQPLILSHPSVGCFVNHCGPGTIWE  341

Query  516   ALVNDCQIVLLPQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKS  337
              L+ DCQ+VL+P +GDQ++  R+++            E+ G FS+ES+  A+K+VMD++S
Sbjct  342   CLMTDCQMVLIPYIGDQVLFTRLLTEEF-EVSVEVSREKTGWFSKESLRDAIKSVMDKES  400

Query  336   EIGREVRGNHDKLRGFLLNADLDSKYMDSFNQKLQD  229
             ++G+ VR NH KL+  L++  L + Y+D+F + L D
Sbjct  401   DVGKLVRSNHAKLKEILVSPGLFAGYVDNFVEALAD  436



>emb|CBI20242.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   327 bits (839),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 186/444 (42%), Positives = 251/444 (57%), Gaps = 82/444 (18%)
 Frame = -3

Query  1563  MYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVPSIP  1384
             M+PWF  GH+T F  L+NKLA +GH+I+F++PK  QS+L++ N HP LISF P+ +P + 
Sbjct  1     MFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQTLNFHPTLISFHPLSIPHVD  60

Query  1383  GLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDLKVDVVFYDFTHWLPSLARKIGI  1204
             GLPPGAET SD+P   THLL  AMD+  + +E  L+    D +FYD +H  P LA ++GI
Sbjct  61    GLPPGAETASDIPIFLTHLLATAMDRATDQLEAALRASNPDFLFYDCSHLAPVLASRLGI  120

Query  1203  KSVFYSTISPLMHGYALSPERRVVGKQLTEADMMKAPASFPDPSIKLHAHEARGFTARTV  1024
             K++ Y+ +       AL P                               ++   + RT 
Sbjct  121   KAICYNVVCAASIAIALVPA------------------------------QSDAISIRTC  150

Query  1023  MKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKpvllagpalpvPSKS  844
              +  G++                            CDYI TQ                  
Sbjct  151   REIEGNL----------------------------CDYIGTQ------------------  164

Query  843   TMEQKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALKppfeaes  664
                  W+ WLG FK GS+I+CAFGS+  L KD+FQEL+ GLELTG+PF  ALKPP  A +
Sbjct  165   -----WAQWLGGFKPGSIIFCAFGSQYILEKDQFQELVLGLELTGLPFLVALKPPTGAAT  219

Query  663   ieaaipeELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVNDCQIVLL  484
             IE A+PE  KE++ GR  VHG WVQQ   L HPSVGCFVSHCG+ S+ E+L+NDCQIVL+
Sbjct  220   IEEALPEGFKERVGGRAAVHGGWVQQPSILSHPSVGCFVSHCGFGSMWESLMNDCQIVLV  279

Query  483   PQVGDQIINARIMSVSLkvgvevekgeedgVFSRESVCKAVKAVMDEKSEIGREVRGNHD  304
             P +GDQI+N R+++  L       + EE+G FS+ES+CKA+K+VMDE+SE+G  VR NH 
Sbjct  280   PHLGDQILNTRVLAGEL-QVAVEVEREENGWFSKESLCKAIKSVMDEESEVGGLVRKNHA  338

Query  303   KLRGFLLNADLDSKYMDSFNQKLQ  232
             K +         S Y+D F  +LQ
Sbjct  339   KWKETFARPGFMSNYVDKFVGQLQ  362



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5003565261950