BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26699_g1_i1 len=1293 path=[1271:0-1292]

Length=1293
                                                                      Score     E

emb|CDP20809.1|  unnamed protein product                                542   0.0      
emb|CDP21418.1|  unnamed protein product                                537   0.0      
emb|CDP21357.1|  unnamed protein product                                532   0.0      
ref|XP_009765438.1|  PREDICTED: probable receptor-like protein ki...    529   1e-179   
ref|XP_009780293.1|  PREDICTED: probable receptor-like protein ki...    526   1e-178   
ref|XP_009592347.1|  PREDICTED: probable receptor-like protein ki...    521   6e-177   
ref|XP_009596789.1|  PREDICTED: probable receptor-like protein ki...    523   9e-177   
ref|XP_006350567.1|  PREDICTED: probable receptor-like protein ki...    521   9e-177   
ref|XP_009596790.1|  PREDICTED: probable receptor-like protein ki...    522   1e-176   
ref|XP_009760919.1|  PREDICTED: probable receptor-like protein ki...    520   2e-176   
ref|XP_009760918.1|  PREDICTED: probable receptor-like protein ki...    520   2e-176   
ref|XP_009786425.1|  PREDICTED: probable receptor-like protein ki...    519   5e-176   
ref|XP_008232085.1|  PREDICTED: probable receptor-like protein ki...    509   6e-176   
ref|XP_008245765.1|  PREDICTED: probable receptor-like protein ki...    507   1e-174   
ref|XP_009592348.1|  PREDICTED: probable receptor-like protein ki...    516   2e-174   
ref|XP_007022130.1|  PR5-like receptor kinase                           506   3e-173   
ref|XP_011084499.1|  PREDICTED: probable receptor-like protein ki...    511   5e-173   
emb|CDP17838.1|  unnamed protein product                                500   1e-172   
ref|XP_004234168.1|  PREDICTED: probable receptor-like protein ki...    511   1e-172   
ref|XP_007219143.1|  hypothetical protein PRUPE_ppa016018mg             510   2e-172   
ref|XP_008234877.1|  PREDICTED: probable receptor-like protein ki...    498   2e-171   
ref|XP_010662458.1|  PREDICTED: probable receptor-like protein ki...    504   1e-170   
ref|XP_008245712.1|  PREDICTED: probable receptor-like protein ki...    506   2e-170   
ref|XP_011016149.1|  PREDICTED: probable receptor-like protein ki...    498   3e-170   
ref|XP_007022127.1|  PR5-like receptor kinase                           497   3e-170   
ref|XP_010662385.1|  PREDICTED: glycerophosphodiester phosphodies...    502   7e-170   
ref|XP_007206753.1|  hypothetical protein PRUPE_ppa025186mg             502   9e-170   
ref|XP_009343242.1|  PREDICTED: probable receptor-like protein ki...    493   1e-169   
ref|XP_010645763.1|  PREDICTED: probable receptor-like protein ki...    494   3e-169   
ref|XP_002268775.1|  PREDICTED: probable receptor-like protein ki...    500   4e-169   Vitis vinifera
ref|XP_007021958.1|  PR5-like receptor kinase                           493   7e-169   
ref|XP_007029389.1|  Receptor-like protein kinase                       499   1e-168   
ref|XP_009343235.1|  PREDICTED: probable receptor-like protein ki...    489   5e-168   
ref|XP_008345477.1|  PREDICTED: probable receptor-like protein ki...    491   1e-167   
ref|XP_008345483.1|  PREDICTED: probable receptor-like protein ki...    490   1e-167   
ref|XP_011037147.1|  PREDICTED: probable receptor-like protein ki...    489   3e-167   
ref|XP_002324016.2|  hypothetical protein POPTR_0017s04140g             486   9e-167   Populus trichocarpa [western balsam poplar]
ref|XP_009341644.1|  PREDICTED: probable receptor-like protein ki...    488   9e-167   
ref|XP_010645762.1|  PREDICTED: probable receptor-like protein ki...    495   9e-167   
ref|XP_004306204.1|  PREDICTED: probable receptor-like protein ki...    496   2e-166   
ref|XP_004498416.1|  PREDICTED: probable receptor-like protein ki...    497   2e-166   
ref|XP_009348963.1|  PREDICTED: probable receptor-like protein ki...    487   2e-166   
ref|XP_004498409.1|  PREDICTED: probable receptor-like protein ki...    495   3e-166   
ref|XP_004305475.1|  PREDICTED: probable receptor-like protein ki...    495   4e-166   
ref|XP_007022122.1|  PR5-like receptor kinase                           493   5e-166   
ref|XP_002267821.3|  PREDICTED: glycerophosphodiester phosphodies...    493   5e-166   Vitis vinifera
ref|XP_008245471.1|  PREDICTED: probable receptor-like protein ki...    485   5e-166   
gb|KEH40396.1|  stress-induced receptor-like kinase, putative           494   5e-166   
ref|XP_006372700.1|  hypothetical protein POPTR_0017s04100g             483   6e-166   
ref|XP_008231576.1|  PREDICTED: probable receptor-like protein ki...    484   8e-166   
ref|XP_002323918.2|  hypothetical protein POPTR_0017s04200g             493   1e-165   Populus trichocarpa [western balsam poplar]
ref|XP_008232188.1|  PREDICTED: probable receptor-like protein ki...    494   1e-165   
ref|XP_007022133.1|  PR5-like receptor kinase                           494   1e-165   
gb|KEH40395.1|  stress-induced receptor-like kinase, putative           494   1e-165   
ref|XP_011037044.1|  PREDICTED: probable receptor-like protein ki...    488   3e-165   
ref|XP_009348961.1|  PREDICTED: probable receptor-like protein ki...    489   3e-165   
ref|XP_008232172.1|  PREDICTED: probable receptor-like protein ki...    491   4e-165   
ref|XP_007161182.1|  hypothetical protein PHAVU_001G0490001g            481   5e-165   
ref|XP_009335119.1|  PREDICTED: probable receptor-like protein ki...    490   1e-164   
ref|XP_011037045.1|  PREDICTED: probable receptor-like protein ki...    491   1e-164   
ref|XP_009348966.1|  PREDICTED: probable receptor-like protein ki...    487   2e-164   
ref|XP_004306407.1|  PREDICTED: probable receptor-like protein ki...    480   2e-164   
ref|XP_007022126.1|  PR5-like receptor kinase                           487   4e-164   
ref|XP_008232079.1|  PREDICTED: probable receptor-like protein ki...    488   1e-163   
ref|XP_011015080.1|  PREDICTED: probable L-type lectin-domain con...    489   1e-163   
ref|XP_008232075.1|  PREDICTED: probable receptor-like protein ki...    482   1e-163   
ref|NP_001238112.1|  stress-induced receptor-like kinase precursor      488   5e-163   
ref|XP_002513561.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    477   6e-163   Ricinus communis
emb|CAN71175.1|  hypothetical protein VITISV_037666                     484   8e-163   Vitis vinifera
ref|XP_004498297.1|  PREDICTED: probable receptor-like protein ki...    485   9e-163   
ref|XP_004498441.1|  PREDICTED: probable receptor-like protein ki...    477   2e-162   
ref|XP_004498296.1|  PREDICTED: probable receptor-like protein ki...    484   3e-162   
ref|XP_009367880.1|  PREDICTED: probable receptor-like protein ki...    476   3e-162   
ref|XP_007036623.1|  PR5-like receptor kinase                           475   5e-162   
ref|XP_008355114.1|  PREDICTED: probable receptor-like protein ki...    475   5e-162   
ref|XP_011047639.1|  PREDICTED: L-type lectin-domain containing r...    486   6e-162   
ref|XP_011047638.1|  PREDICTED: probable LRR receptor-like serine...    486   7e-162   
ref|XP_009340420.1|  PREDICTED: probable receptor-like protein ki...    484   9e-162   
ref|XP_011047634.1|  PREDICTED: L-type lectin-domain containing r...    485   1e-161   
ref|XP_011047635.1|  PREDICTED: L-type lectin-domain containing r...    485   2e-161   
ref|XP_008378068.1|  PREDICTED: probable receptor-like protein ki...    472   2e-161   
ref|XP_009335039.1|  PREDICTED: probable receptor-like protein ki...    485   2e-161   
ref|XP_009335117.1|  PREDICTED: probable receptor-like protein ki...    472   3e-161   
ref|XP_008344514.1|  PREDICTED: probable receptor-like protein ki...    472   4e-161   
ref|XP_007021970.1|  PR5-like receptor kinase                           480   5e-161   
ref|XP_008370381.1|  PREDICTED: probable receptor-like protein ki...    473   5e-161   
ref|XP_004308818.1|  PREDICTED: probable receptor-like protein ki...    481   5e-161   
ref|XP_008385065.1|  PREDICTED: probable receptor-like protein ki...    473   6e-161   
ref|XP_008245839.1|  PREDICTED: probable receptor-like protein ki...    481   7e-161   
ref|XP_008345516.1|  PREDICTED: probable receptor-like protein ki...    479   8e-161   
ref|XP_008376288.1|  PREDICTED: probable receptor-like protein ki...    472   9e-161   
ref|XP_008232089.1|  PREDICTED: probable receptor-like protein ki...    471   1e-160   
ref|XP_009370623.1|  PREDICTED: probable receptor-like protein ki...    481   1e-160   
ref|XP_008345497.1|  PREDICTED: probable receptor-like protein ki...    473   2e-160   
ref|XP_003634140.2|  PREDICTED: glycerophosphodiester phosphodies...    470   2e-160   
ref|XP_007161172.1|  hypothetical protein PHAVU_001G048500g             473   2e-160   
ref|XP_010247812.1|  PREDICTED: glycerophosphodiester phosphodies...    469   4e-160   
ref|XP_009348964.1|  PREDICTED: probable receptor-like protein ki...    471   5e-160   
ref|XP_006601168.1|  PREDICTED: probable receptor-like protein ki...    478   6e-160   
ref|XP_010099998.1|  putative receptor-like protein kinase              477   6e-160   
ref|XP_008232094.1|  PREDICTED: probable receptor-like protein ki...    467   8e-160   
ref|XP_009335041.1|  PREDICTED: probable receptor-like protein ki...    474   1e-159   
ref|XP_009336987.1|  PREDICTED: probable receptor-like protein ki...    469   1e-159   
ref|XP_003619232.1|  Kinase-like protein                                469   1e-159   
ref|XP_002513565.1|  kinase, putative                                   477   3e-159   Ricinus communis
ref|XP_007161178.1|  hypothetical protein PHAVU_001G048800g             475   5e-159   
ref|XP_008354817.1|  PREDICTED: probable receptor-like protein ki...    473   5e-159   
ref|XP_009335109.1|  PREDICTED: probable receptor-like protein ki...    476   6e-159   
ref|XP_009335107.1|  PREDICTED: probable receptor-like protein ki...    476   7e-159   
ref|XP_011047738.1|  PREDICTED: probable receptor-like protein ki...    466   7e-159   
ref|XP_008381955.1|  PREDICTED: probable receptor-like protein ki...    465   8e-159   
ref|XP_008232095.1|  PREDICTED: probable receptor-like protein ki...    476   8e-159   
ref|XP_006372927.1|  hypothetical protein POPTR_0017s06310g             478   8e-159   
ref|XP_004307212.1|  PREDICTED: probable receptor-like protein ki...    476   9e-159   
ref|XP_010662972.1|  PREDICTED: glycerophosphodiester phosphodies...    476   9e-159   
ref|XP_006372706.1|  hypothetical protein POPTR_0017s04180g             466   1e-158   
ref|XP_011001827.1|  PREDICTED: probable receptor-like protein ki...    468   1e-158   
gb|KDP46881.1|  hypothetical protein JCGZ_24090                         476   1e-158   
ref|XP_010662971.1|  PREDICTED: glycerophosphodiester phosphodies...    476   1e-158   
gb|KEH40341.1|  stress-induced receptor-like kinase                     467   1e-158   
ref|XP_007036613.1|  PR5-like receptor kinase                           474   1e-158   
ref|XP_004498418.1|  PREDICTED: G-type lectin S-receptor-like ser...    478   2e-158   
ref|XP_004307211.1|  PREDICTED: probable receptor-like protein ki...    474   2e-158   
ref|XP_002323916.2|  hypothetical protein POPTR_0017s04230g             463   2e-158   Populus trichocarpa [western balsam poplar]
ref|XP_011014554.1|  PREDICTED: probable receptor-like protein ki...    472   3e-158   
ref|XP_003635630.2|  PREDICTED: probable receptor-like protein ki...    464   3e-158   
gb|KHN05172.1|  Putative receptor-like protein kinase                   474   5e-158   
ref|XP_004308549.1|  PREDICTED: probable receptor-like protein ki...    473   5e-158   
ref|XP_008346612.1|  PREDICTED: probable receptor-like protein ki...    474   7e-158   
ref|XP_007039001.1|  Kinase, putative                                   473   8e-158   
ref|XP_010247816.1|  PREDICTED: glycerophosphodiester phosphodies...    470   8e-158   
ref|XP_004298577.1|  PREDICTED: probable receptor-like protein ki...    473   9e-158   
ref|XP_007161166.1|  hypothetical protein PHAVU_001G047900g             473   9e-158   
ref|XP_010275348.1|  PREDICTED: probable receptor-like protein ki...    462   1e-157   
ref|XP_011003873.1|  PREDICTED: probable receptor-like protein ki...    473   1e-157   
ref|XP_007022132.1|  PR5-like receptor kinase                           476   2e-157   
ref|XP_006593811.1|  PREDICTED: probable receptor-like protein ki...    474   2e-157   
ref|XP_006593810.1|  PREDICTED: probable receptor-like protein ki...    474   3e-157   
ref|XP_007220160.1|  hypothetical protein PRUPE_ppa017667mg             469   5e-157   
gb|KDP42843.1|  hypothetical protein JCGZ_23785                         462   7e-157   
ref|XP_007022121.1|  PR5-like receptor kinase                           470   7e-157   
ref|XP_010662819.1|  PREDICTED: probable receptor-like protein ki...    461   7e-157   
emb|CAN72345.1|  hypothetical protein VITISV_041721                     465   7e-157   Vitis vinifera
ref|XP_007161186.1|  hypothetical protein PHAVU_001G049200g             458   1e-156   
ref|XP_002263061.2|  PREDICTED: glycerophosphodiester phosphodies...    461   1e-156   Vitis vinifera
ref|XP_002321441.2|  hypothetical protein POPTR_0015s02040g             468   2e-156   Populus trichocarpa [western balsam poplar]
ref|XP_007021960.1|  PR5-like receptor kinase                           467   2e-156   
ref|XP_009370622.1|  PREDICTED: probable receptor-like protein ki...    470   3e-156   
gb|KEH40331.1|  stress-induced receptor-like kinase                     460   3e-156   
ref|XP_004498488.1|  PREDICTED: G-type lectin S-receptor-like ser...    471   4e-156   
gb|KDP42826.1|  hypothetical protein JCGZ_23768                         469   6e-156   
ref|XP_011001826.1|  PREDICTED: probable receptor-like protein ki...    466   6e-156   
ref|XP_004498487.1|  PREDICTED: G-type lectin S-receptor-like ser...    471   7e-156   
emb|CBI23149.3|  unnamed protein product                                461   8e-156   
ref|XP_004308548.1|  PREDICTED: probable receptor-like protein ki...    468   8e-156   
ref|XP_007036624.1|  PR5-like receptor kinase                           467   1e-155   
ref|XP_003634115.2|  PREDICTED: glycerophosphodiester phosphodies...    459   1e-155   
gb|KHG10630.1|  hypothetical protein F383_14633                         467   1e-155   
gb|KHG10629.1|  hypothetical protein F383_14633                         467   2e-155   
ref|XP_003589650.1|  serine/threonine protein kinase                    467   2e-155   
ref|XP_010662996.1|  PREDICTED: probable receptor-like protein ki...    467   2e-155   
ref|XP_011014404.1|  PREDICTED: probable receptor-like protein ki...    467   3e-155   
gb|KCW59546.1|  hypothetical protein EUGRSUZ_H02301                     457   3e-155   
ref|XP_007161169.1|  hypothetical protein PHAVU_001G048200g             464   3e-155   
ref|XP_008232092.1|  PREDICTED: probable receptor-like protein ki...    456   4e-155   
ref|XP_007161165.1|  hypothetical protein PHAVU_001G047800g             454   5e-155   
ref|XP_006593817.1|  PREDICTED: G-type lectin S-receptor-like ser...    458   5e-155   
ref|XP_008365840.1|  PREDICTED: probable receptor-like protein ki...    458   5e-155   
ref|XP_008231870.1|  PREDICTED: probable receptor-like protein ki...    466   6e-155   
ref|XP_008373817.1|  PREDICTED: probable receptor-like protein ki...    456   6e-155   
ref|XP_006372704.1|  hypothetical protein POPTR_0017s04160g             455   7e-155   
gb|KEH40363.1|  stress-induced receptor-like kinase                     455   7e-155   
ref|XP_003589647.1|  Kinase R-like protein                              466   7e-155   
ref|XP_006601166.1|  PREDICTED: probable receptor-like protein ki...    461   8e-155   
ref|XP_008376310.1|  PREDICTED: probable receptor-like protein ki...    457   9e-155   
ref|XP_007161443.1|  hypothetical protein PHAVU_001G069200g             455   1e-154   
ref|XP_007161185.1|  hypothetical protein PHAVU_001G049100g             464   1e-154   
ref|XP_006372702.1|  hypothetical protein POPTR_0017s04120g             454   1e-154   
gb|KHN05168.1|  Putative receptor-like protein kinase                   466   1e-154   
gb|KEH40336.1|  stress-induced receptor-like kinase                     454   2e-154   
gb|KEH33223.1|  stress-induced receptor-like kinase                     456   2e-154   
ref|XP_011001825.1|  PREDICTED: probable receptor-like protein ki...    466   2e-154   
ref|XP_008347200.1|  PREDICTED: probable receptor-like protein ki...    456   2e-154   
ref|XP_011001823.1|  PREDICTED: probable receptor-like protein ki...    466   3e-154   
ref|XP_008232077.1|  PREDICTED: probable receptor-like protein ki...    464   3e-154   
ref|XP_010662816.1|  PREDICTED: cysteine-rich receptor-like prote...    466   4e-154   
ref|XP_003589626.1|  Kinase-like protein                                464   4e-154   
ref|XP_002263251.3|  PREDICTED: probable receptor-like protein ki...    455   4e-154   Vitis vinifera
ref|XP_010662566.1|  PREDICTED: cysteine-rich receptor-like prote...    466   4e-154   
ref|XP_011047642.1|  PREDICTED: probable receptor-like protein ki...    464   1e-153   
ref|XP_003589645.1|  Kinase-like protein                                462   1e-153   
ref|XP_008347207.1|  PREDICTED: probable receptor-like protein ki...    454   1e-153   
ref|XP_011047641.1|  PREDICTED: probable receptor-like protein ki...    464   1e-153   
gb|KDP42824.1|  hypothetical protein JCGZ_23766                         460   2e-153   
ref|XP_011047640.1|  PREDICTED: probable receptor-like protein ki...    464   2e-153   
ref|XP_011015079.1|  PREDICTED: probable receptor-like protein ki...    464   2e-153   
gb|AES59896.2|  stress-induced receptor-like kinase                     461   2e-153   
ref|XP_011015081.1|  PREDICTED: L-type lectin-domain containing r...    463   2e-153   
ref|XP_002513567.1|  kinase, putative                                   460   3e-153   Ricinus communis
ref|XP_006593814.1|  PREDICTED: probable receptor-like protein ki...    462   3e-153   
ref|XP_006593812.1|  PREDICTED: probable receptor-like protein ki...    463   3e-153   
ref|XP_002309734.2|  hypothetical protein POPTR_0007s00780g             451   3e-153   Populus trichocarpa [western balsam poplar]
ref|XP_010646996.1|  PREDICTED: glycerophosphodiester phosphodies...    461   3e-153   
ref|XP_010646999.1|  PREDICTED: probable receptor-like protein ki...    462   4e-153   
ref|XP_007163974.1|  hypothetical protein PHAVU_L000900g                452   4e-153   
ref|XP_006601165.1|  PREDICTED: probable receptor-like protein ki...    460   4e-153   
gb|KCW64256.1|  hypothetical protein EUGRSUZ_G01897                     451   4e-153   
ref|XP_010662989.1|  PREDICTED: probable receptor-like protein ki...    461   4e-153   
ref|XP_006601164.1|  PREDICTED: probable receptor-like protein ki...    460   4e-153   
ref|XP_002309858.2|  hypothetical protein POPTR_0007s00820g             450   5e-153   Populus trichocarpa [western balsam poplar]
ref|XP_006601163.1|  PREDICTED: probable receptor-like protein ki...    461   5e-153   
ref|XP_010111693.1|  putative receptor-like protein kinase              451   5e-153   
ref|XP_006388285.1|  hypothetical protein POPTR_0247s00220g             451   5e-153   
emb|CDP12540.1|  unnamed protein product                                459   6e-153   
gb|KHN02025.1|  Putative receptor-like protein kinase                   449   7e-153   
gb|KHN05177.1|  Putative receptor-like protein kinase                   460   1e-152   
ref|NP_001237957.1|  stress-induced receptor-like kinase precursor      458   1e-152   
ref|XP_008373799.1|  PREDICTED: probable receptor-like protein ki...    449   2e-152   
ref|XP_007161439.1|  hypothetical protein PHAVU_001G068800g             451   2e-152   
emb|CAN66613.1|  hypothetical protein VITISV_023171                     452   2e-152   Vitis vinifera
gb|KEH40387.1|  stress-induced receptor-like kinase                     451   2e-152   
ref|XP_010040879.1|  PREDICTED: probable receptor-like protein ki...    453   2e-152   
ref|XP_011001829.1|  PREDICTED: probable receptor-like protein ki...    460   2e-152   
ref|XP_007161453.1|  hypothetical protein PHAVU_001G070200g             451   3e-152   
ref|XP_002265870.3|  PREDICTED: lectin-domain containing receptor...    461   4e-152   Vitis vinifera
ref|XP_010035321.1|  PREDICTED: probable receptor-like protein ki...    450   4e-152   
ref|XP_010646612.1|  PREDICTED: probable receptor-like protein ki...    458   4e-152   
gb|KEH40381.1|  stress-induced receptor-like kinase                     449   5e-152   
emb|CBI23151.3|  unnamed protein product                                455   5e-152   
ref|XP_010942308.1|  PREDICTED: probable receptor-like protein ki...    460   5e-152   
ref|XP_011001830.1|  PREDICTED: probable receptor-like protein ki...    459   6e-152   
gb|KCW58971.1|  hypothetical protein EUGRSUZ_H01601                     447   6e-152   
gb|KEH40357.1|  stress-induced receptor-like kinase                     447   7e-152   
ref|XP_010662999.1|  PREDICTED: probable receptor-like protein ki...    458   9e-152   
gb|KEH40313.1|  stress-induced receptor-like kinase                     461   1e-151   
gb|KCW58952.1|  hypothetical protein EUGRSUZ_H01578                     450   1e-151   
ref|XP_010662822.1|  PREDICTED: G-type lectin S-receptor-like ser...    459   1e-151   
ref|XP_007141195.1|  hypothetical protein PHAVU_008G175100g             458   1e-151   
ref|XP_008346578.1|  PREDICTED: probable receptor-like protein ki...    446   1e-151   
ref|XP_010035323.1|  PREDICTED: probable receptor-like protein ki...    448   2e-151   
gb|KDP42830.1|  hypothetical protein JCGZ_23772                         457   2e-151   
emb|CAN65252.1|  hypothetical protein VITISV_011046                     459   2e-151   Vitis vinifera
ref|XP_011001828.1|  PREDICTED: probable receptor-like protein ki...    458   2e-151   
emb|CAN73610.1|  hypothetical protein VITISV_032836                     456   2e-151   Vitis vinifera
ref|XP_010026257.1|  PREDICTED: probable receptor-like protein ki...    447   2e-151   
ref|XP_006596681.1|  PREDICTED: probable receptor-like protein ki...    456   2e-151   
gb|KEH40315.1|  stress-induced receptor-like kinase                     459   2e-151   
ref|XP_006593816.1|  PREDICTED: G-type lectin S-receptor-like ser...    457   3e-151   
ref|XP_010026272.1|  PREDICTED: probable receptor-like protein ki...    447   3e-151   
ref|XP_007038999.1|  Kinase, putative isoform 2                         453   4e-151   
ref|XP_010646767.1|  PREDICTED: probable receptor-like protein ki...    458   4e-151   
ref|XP_010662815.1|  PREDICTED: cysteine-rich receptor-like prote...    457   4e-151   
gb|KCW58968.1|  hypothetical protein EUGRSUZ_H01596                     446   4e-151   
emb|CAN80054.1|  hypothetical protein VITISV_034697                     455   4e-151   Vitis vinifera
gb|KEH40374.1|  stress-induced receptor-like kinase                     458   4e-151   
ref|XP_010646766.1|  PREDICTED: probable receptor-like protein ki...    458   4e-151   
gb|KCW44830.1|  hypothetical protein EUGRSUZ_L01599                     452   5e-151   
ref|XP_006593813.1|  PREDICTED: probable receptor-like protein ki...    457   5e-151   
ref|XP_010026263.1|  PREDICTED: probable receptor-like protein ki...    450   5e-151   
gb|AES59897.2|  stress-induced receptor-like kinase                     455   5e-151   
ref|XP_003589646.1|  Kinase R-like protein                              455   6e-151   
ref|XP_008777484.1|  PREDICTED: probable receptor-like protein ki...    445   6e-151   
gb|KEH40376.1|  receptor-like kinase                                    456   6e-151   
ref|XP_006380299.1|  hypothetical protein POPTR_0007s02210g             452   7e-151   
ref|XP_010026531.1|  PREDICTED: uncharacterized protein LOC104416895    459   8e-151   
ref|XP_010042026.1|  PREDICTED: probable receptor-like protein ki...    446   8e-151   
ref|XP_010662841.1|  PREDICTED: probable receptor-like protein ki...    456   9e-151   
ref|XP_008347206.1|  PREDICTED: probable receptor-like protein ki...    446   9e-151   
ref|XP_010662814.1|  PREDICTED: glycerophosphodiester phosphodies...    455   1e-150   
ref|XP_010662781.1|  PREDICTED: probable receptor-like protein ki...    456   2e-150   
ref|XP_010942305.1|  PREDICTED: probable receptor-like protein ki...    454   2e-150   
gb|KCW46535.1|  hypothetical protein EUGRSUZ_K00368                     444   2e-150   
ref|XP_010109241.1|  hypothetical protein L484_011863                   452   3e-150   
ref|XP_010034904.1|  PREDICTED: probable receptor-like protein ki...    451   3e-150   
ref|XP_010034906.1|  PREDICTED: probable receptor-like protein ki...    446   3e-150   
ref|XP_002309736.2|  hypothetical protein POPTR_0007s00840g             442   3e-150   Populus trichocarpa [western balsam poplar]
gb|KCW47320.1|  hypothetical protein EUGRSUZ_K01107                     451   3e-150   
ref|XP_010038687.1|  PREDICTED: probable receptor-like protein ki...    451   3e-150   
ref|XP_002323919.2|  hypothetical protein POPTR_0017s04190g             449   4e-150   Populus trichocarpa [western balsam poplar]
ref|XP_010038695.1|  PREDICTED: probable receptor-like protein ki...    446   5e-150   
gb|KCW58957.1|  hypothetical protein EUGRSUZ_H01583                     447   5e-150   
ref|XP_010034907.1|  PREDICTED: probable receptor-like protein ki...    443   6e-150   
ref|XP_006604039.1|  PREDICTED: probable receptor-like protein ki...    454   6e-150   
gb|KCW47330.1|  hypothetical protein EUGRSUZ_K01120                     447   6e-150   
gb|KCW44473.1|  hypothetical protein EUGRSUZ_L02016                     442   7e-150   
emb|CDP12537.1|  unnamed protein product                                447   7e-150   
ref|XP_007038998.1|  Receptor-like protein kinase, putative isofo...    453   8e-150   
ref|XP_010034903.1|  PREDICTED: probable receptor-like protein ki...    451   8e-150   
ref|XP_010942304.1|  PREDICTED: putative cysteine-rich receptor-l...    454   9e-150   
ref|XP_010646614.1|  PREDICTED: probable receptor-like protein ki...    446   9e-150   
ref|XP_010662994.1|  PREDICTED: probable receptor-like protein ki...    453   1e-149   
ref|XP_007219662.1|  hypothetical protein PRUPE_ppa023930mg             452   1e-149   
gb|KCW46629.1|  hypothetical protein EUGRSUZ_K00441                     441   1e-149   
ref|XP_010026268.1|  PREDICTED: probable receptor-like protein ki...    449   1e-149   
gb|KDP42828.1|  hypothetical protein JCGZ_23770                         451   1e-149   
ref|XP_006596264.1|  PREDICTED: probable receptor-like protein ki...    444   1e-149   
ref|XP_010034905.1|  PREDICTED: probable receptor-like protein ki...    447   1e-149   
ref|XP_010034901.1|  PREDICTED: probable receptor-like protein ki...    451   1e-149   
ref|XP_010038381.1|  PREDICTED: probable receptor-like protein ki...    444   2e-149   
gb|EYU19634.1|  hypothetical protein MIMGU_mgv1a003233mg                450   2e-149   
gb|KDP22159.1|  hypothetical protein JCGZ_25990                         451   2e-149   
ref|XP_007133663.1|  hypothetical protein PHAVU_011G198500g             455   2e-149   
gb|KEH40316.1|  stress-induced receptor-like kinase                     454   4e-149   
ref|XP_008232047.1|  PREDICTED: G-type lectin S-receptor-like ser...    449   4e-149   
ref|XP_011026378.1|  PREDICTED: probable receptor-like protein ki...    451   5e-149   
ref|XP_002267570.2|  PREDICTED: probable receptor-like protein ki...    451   5e-149   
ref|XP_010035239.1|  PREDICTED: probable receptor-like protein ki...    451   6e-149   
ref|XP_010034900.1|  PREDICTED: probable receptor-like protein ki...    451   6e-149   
gb|KCW46515.1|  hypothetical protein EUGRSUZ_K00342                     443   7e-149   
ref|XP_008232046.1|  PREDICTED: G-type lectin S-receptor-like ser...    449   7e-149   
gb|AES59898.2|  receptor-like kinase                                    439   8e-149   
ref|XP_010662316.1|  PREDICTED: glycerophosphodiester phosphodies...    440   1e-148   
ref|XP_010068631.1|  PREDICTED: probable receptor-like protein ki...    449   1e-148   
ref|XP_008347218.1|  PREDICTED: probable receptor-like protein ki...    440   1e-148   
gb|KCW88167.1|  hypothetical protein EUGRSUZ_A00554                     439   1e-148   
ref|XP_010662306.1|  PREDICTED: glycerophosphodiester phosphodies...    439   2e-148   
gb|KCW58965.1|  hypothetical protein EUGRSUZ_H01592                     439   2e-148   
ref|XP_007163971.1|  hypothetical protein PHAVU_L0007001g               441   2e-148   
gb|KCW58944.1|  hypothetical protein EUGRSUZ_H01566                     438   2e-148   
gb|KCW46525.1|  hypothetical protein EUGRSUZ_K00355                     439   3e-148   
gb|KEH40352.1|  stress-induced receptor-like kinase                     451   3e-148   
ref|XP_003589621.1|  LRR receptor-like serine/threonine-protein k...    444   3e-148   
ref|XP_010038694.1|  PREDICTED: probable receptor-like protein ki...    449   3e-148   
gb|KCW47328.1|  hypothetical protein EUGRSUZ_K01118                     449   3e-148   
ref|XP_010662663.1|  PREDICTED: glycerophosphodiester phosphodies...    449   5e-148   
gb|KCW52337.1|  hypothetical protein EUGRSUZ_J01754                     436   5e-148   
ref|XP_010026276.1|  PREDICTED: uncharacterized protein LOC104416604    451   5e-148   
ref|XP_010041889.1|  PREDICTED: probable receptor-like protein ki...    439   6e-148   
ref|XP_010038474.1|  PREDICTED: probable receptor-like protein ki...    447   6e-148   
ref|XP_007161181.1|  hypothetical protein PHAVU_001G0490001g            435   7e-148   
ref|XP_010662825.1|  PREDICTED: probable receptor-like protein ki...    437   7e-148   
ref|XP_010038459.1|  PREDICTED: probable receptor-like protein ki...    440   8e-148   
gb|KCW64246.1|  hypothetical protein EUGRSUZ_G01891                     437   9e-148   
ref|XP_007133653.1|  hypothetical protein PHAVU_011G197700g             448   9e-148   
gb|KCW58942.1|  hypothetical protein EUGRSUZ_H01564                     438   9e-148   
emb|CDP12527.1|  unnamed protein product                                443   1e-147   
ref|XP_004498411.1|  PREDICTED: probable receptor-like protein ki...    448   1e-147   
ref|XP_010034532.1|  PREDICTED: probable receptor-like protein ki...    446   1e-147   
gb|KCW62867.1|  hypothetical protein EUGRSUZ_G00463                     437   2e-147   
ref|XP_007161180.1|  hypothetical protein PHAVU_001G048900g             446   2e-147   
ref|XP_007219382.1|  hypothetical protein PRUPE_ppa020110mg             445   3e-147   
ref|XP_010662313.1|  PREDICTED: glycerophosphodiester phosphodies...    436   3e-147   
ref|XP_002529764.1|  kinase, putative                                   446   4e-147   
ref|XP_010100007.1|  putative receptor-like protein kinase              448   6e-147   
ref|XP_010662830.1|  PREDICTED: probable receptor-like protein ki...    446   6e-147   
ref|XP_010026687.1|  PREDICTED: probable receptor-like protein ki...    439   7e-147   
ref|XP_010663014.1|  PREDICTED: probable receptor-like protein ki...    434   1e-146   
ref|XP_002272131.3|  PREDICTED: glycerophosphodiester phosphodies...    445   1e-146   
gb|KEH40334.1|  stress-induced receptor-like kinase                     442   1e-146   
ref|XP_007161167.1|  hypothetical protein PHAVU_001G048000g             432   1e-146   
gb|KEH40318.1|  stress-induced receptor-like kinase                     432   1e-146   
ref|XP_007133651.1|  hypothetical protein PHAVU_011G197500g             444   1e-146   
ref|XP_004498415.1|  PREDICTED: probable receptor-like protein ki...    446   2e-146   
ref|XP_007161513.1|  hypothetical protein PHAVU_001G075600g             445   2e-146   
ref|XP_010662829.1|  PREDICTED: probable receptor-like protein ki...    446   2e-146   
ref|XP_008388744.1|  PREDICTED: probable receptor-like protein ki...    437   2e-146   
gb|KCW46704.1|  hypothetical protein EUGRSUZ_K00523                     437   2e-146   
gb|KEH40307.1|  stress-induced receptor-like kinase                     432   2e-146   
ref|XP_010026256.1|  PREDICTED: probable receptor-like protein ki...    441   2e-146   
ref|XP_007161514.1|  hypothetical protein PHAVU_001G075600g             445   2e-146   
ref|XP_010068112.1|  PREDICTED: probable receptor-like protein ki...    433   2e-146   
gb|KCW58933.1|  hypothetical protein EUGRSUZ_H01555                     434   2e-146   
gb|KCW64257.1|  hypothetical protein EUGRSUZ_G01898                     432   3e-146   
gb|KCW58941.1|  hypothetical protein EUGRSUZ_H01564                     441   3e-146   
gb|KCW58953.1|  hypothetical protein EUGRSUZ_H01579                     434   3e-146   
ref|XP_007133684.1|  hypothetical protein PHAVU_011G200400g             445   3e-146   
gb|KCW59937.1|  hypothetical protein EUGRSUZ_H02661                     443   3e-146   
ref|XP_002309731.2|  hypothetical protein POPTR_0007s03090g             433   4e-146   
gb|KCW62872.1|  hypothetical protein EUGRSUZ_G00469                     431   5e-146   
gb|KCW58925.1|  hypothetical protein EUGRSUZ_H01549                     432   1e-145   
ref|XP_003635579.2|  PREDICTED: glycerophosphodiester phosphodies...    442   1e-145   
gb|KHN09867.1|  Putative receptor-like protein kinase                   442   1e-145   
ref|XP_008357002.1|  PREDICTED: probable receptor-like protein ki...    437   1e-145   
ref|XP_010645760.1|  PREDICTED: glycerophosphodiester phosphodies...    442   2e-145   
ref|XP_010041283.1|  PREDICTED: uncharacterized protein LOC104430221    442   2e-145   
ref|XP_010026246.1|  PREDICTED: uncharacterized protein LOC104416572    444   2e-145   
ref|NP_001238646.1|  stress-induced receptor-like kinase precursor      443   2e-145   
gb|KHN05856.1|  Putative receptor-like protein kinase                   443   2e-145   
ref|XP_010035343.1|  PREDICTED: probable receptor-like protein ki...    434   2e-145   
ref|XP_010038456.1|  PREDICTED: probable receptor-like protein ki...    442   2e-145   
ref|XP_010040936.1|  PREDICTED: probable receptor-like protein ki...    439   3e-145   
ref|XP_002323924.2|  hypothetical protein POPTR_0017s04130g             440   3e-145   
ref|XP_010662826.1|  PREDICTED: probable receptor-like protein ki...    442   5e-145   
ref|XP_010035238.1|  PREDICTED: probable receptor-like protein ki...    440   7e-145   
gb|KCW46633.1|  hypothetical protein EUGRSUZ_K00445                     429   8e-145   
gb|KCW46625.1|  hypothetical protein EUGRSUZ_K00436                     428   9e-145   
ref|XP_010038692.1|  PREDICTED: probable receptor-like protein ki...    431   1e-144   
ref|XP_010035231.1|  PREDICTED: probable receptor-like protein ki...    441   1e-144   
emb|CAN62767.1|  hypothetical protein VITISV_033945                     429   1e-144   
ref|XP_010662308.1|  PREDICTED: glycerophosphodiester phosphodies...    429   2e-144   
ref|XP_010039839.1|  PREDICTED: probable receptor-like protein ki...    428   2e-144   
ref|XP_002514776.1|  receptor serine/threonine kinase, putative         439   2e-144   
ref|XP_010038470.1|  PREDICTED: probable receptor-like protein ki...    438   3e-144   
ref|XP_002309820.2|  hypothetical protein POPTR_0007s02280g             427   4e-144   
gb|KCW46536.1|  hypothetical protein EUGRSUZ_K00369                     427   4e-144   
gb|KCW46529.1|  hypothetical protein EUGRSUZ_K00360                     432   4e-144   
ref|XP_007208278.1|  hypothetical protein PRUPE_ppa014999mg             437   5e-144   
gb|KHG09273.1|  hypothetical protein F383_13058                         437   5e-144   
ref|XP_010068402.1|  PREDICTED: uncharacterized protein LOC104455285    442   5e-144   
ref|XP_007021961.1|  PR5-like receptor kinase, putative                 426   5e-144   
gb|KEH40322.1|  stress-induced receptor-like kinase                     426   5e-144   
gb|KCW46682.1|  hypothetical protein EUGRSUZ_K00490                     426   8e-144   
ref|XP_010035347.1|  PREDICTED: probable receptor-like protein ki...    437   9e-144   
gb|KCW46684.1|  hypothetical protein EUGRSUZ_K00492                     427   1e-143   
ref|XP_010070301.1|  PREDICTED: probable receptor-like protein ki...    433   1e-143   
ref|XP_010026251.1|  PREDICTED: uncharacterized protein LOC104416576    439   2e-143   
gb|KCW46512.1|  hypothetical protein EUGRSUZ_K00336                     424   2e-143   
ref|XP_010038387.1|  PREDICTED: probable receptor-like protein ki...    428   2e-143   
ref|XP_010038462.1|  PREDICTED: probable receptor-like protein ki...    436   2e-143   
gb|KCW46631.1|  hypothetical protein EUGRSUZ_K00443                     425   2e-143   
ref|XP_010038472.1|  PREDICTED: probable receptor-like protein ki...    426   3e-143   
ref|XP_010100003.1|  putative receptor-like protein kinase              435   3e-143   
ref|XP_002264027.1|  PREDICTED: probable receptor-like protein ki...    436   8e-143   
gb|KCW46110.1|  hypothetical protein EUGRSUZ_K00034                     422   1e-142   
ref|XP_010068626.1|  PREDICTED: uncharacterized protein LOC104455551    444   1e-142   
ref|XP_006367678.1|  PREDICTED: probable receptor-like protein ki...    425   1e-142   
ref|XP_007161177.1|  hypothetical protein PHAVU_001G048700g             431   2e-142   
ref|XP_010035382.1|  PREDICTED: probable receptor-like protein ki...    428   2e-142   
ref|XP_010026267.1|  PREDICTED: probable receptor-like protein ki...    427   2e-142   
ref|XP_007161171.1|  hypothetical protein PHAVU_001G048400g             421   3e-142   
gb|KCW63685.1|  hypothetical protein EUGRSUZ_G01334                     421   3e-142   
ref|XP_010038508.1|  PREDICTED: probable receptor-like protein ki...    425   3e-142   
ref|XP_007161519.1|  hypothetical protein PHAVU_001G076100g             434   4e-142   
gb|KHG22635.1|  hypothetical protein F383_30248                         421   4e-142   
gb|KCW58962.1|  hypothetical protein EUGRSUZ_H01587                     433   5e-142   
ref|XP_008344520.1|  PREDICTED: probable receptor-like protein ki...    422   5e-142   
ref|XP_010662307.1|  PREDICTED: G-type lectin S-receptor-like ser...    435   5e-142   
gb|KCW46521.1|  hypothetical protein EUGRSUZ_K003522                    423   5e-142   
gb|KCW88168.1|  hypothetical protein EUGRSUZ_A00556                     422   6e-142   
ref|XP_006595233.1|  PREDICTED: probable receptor-like protein ki...    419   8e-142   
gb|KEH40327.1|  stress-induced receptor-like kinase                     420   1e-141   
ref|XP_009796756.1|  PREDICTED: probable receptor-like protein ki...    427   1e-141   
gb|KCW44770.1|  hypothetical protein EUGRSUZ_L01669                     421   1e-141   
ref|XP_010038693.1|  PREDICTED: probable receptor-like protein ki...    431   1e-141   
ref|XP_010035352.1|  PREDICTED: probable receptor-like protein ki...    422   1e-141   
ref|XP_006365625.1|  PREDICTED: probable receptor-like protein ki...    422   2e-141   
ref|XP_006348220.1|  PREDICTED: probable receptor-like protein ki...    422   2e-141   
ref|XP_010038494.1|  PREDICTED: probable receptor-like protein ki...    421   3e-141   
ref|XP_008232080.1|  PREDICTED: putative receptor-like protein ki...    428   4e-141   
ref|XP_010035235.1|  PREDICTED: cysteine-rich receptor-like prote...    432   4e-141   
ref|XP_010038515.1|  PREDICTED: probable receptor-like protein ki...    420   8e-141   
ref|XP_008218363.1|  PREDICTED: probable receptor-like protein ki...    428   8e-141   
ref|XP_007161450.1|  hypothetical protein PHAVU_001G069900g             419   9e-141   
ref|XP_007161179.1|  hypothetical protein PHAVU_001G048800g             426   9e-141   
gb|KCW47326.1|  hypothetical protein EUGRSUZ_K01116                     430   2e-140   
ref|XP_002323917.2|  hypothetical protein POPTR_0017s04210g             425   2e-140   
gb|KCW46752.1|  hypothetical protein EUGRSUZ_K00565                     416   3e-140   
ref|XP_010051194.1|  PREDICTED: probable receptor-like protein ki...    428   3e-140   
ref|XP_006380305.1|  hypothetical protein POPTR_0007s02310g             416   3e-140   
ref|XP_010039836.1|  PREDICTED: probable receptor-like protein ki...    419   3e-140   
ref|XP_009796755.1|  PREDICTED: probable receptor-like protein ki...    427   4e-140   
ref|XP_010035380.1|  PREDICTED: probable receptor-like protein ki...    427   5e-140   
gb|KCW46532.1|  hypothetical protein EUGRSUZ_K00363                     415   7e-140   
ref|XP_010035234.1|  PREDICTED: probable receptor-like protein ki...    422   8e-140   
ref|XP_010042252.1|  PREDICTED: probable receptor-like protein ki...    429   9e-140   
ref|XP_009796754.1|  PREDICTED: probable receptor-like protein ki...    427   1e-139   
ref|XP_009782473.1|  PREDICTED: probable receptor-like protein ki...    426   1e-139   
gb|KCW46702.1|  hypothetical protein EUGRSUZ_K00520                     425   1e-139   
gb|KCW46695.1|  hypothetical protein EUGRSUZ_K00513                     415   1e-139   
ref|XP_002309819.2|  hypothetical protein POPTR_0007s02260g             426   1e-139   
ref|XP_009782472.1|  PREDICTED: probable receptor-like protein ki...    426   2e-139   
ref|XP_010065788.1|  PREDICTED: probable receptor-like protein ki...    436   2e-139   
ref|XP_010035317.1|  PREDICTED: probable receptor-like protein ki...    415   2e-139   
ref|XP_007052348.1|  Receptor serine/threonine kinase                   424   2e-139   
ref|XP_004302110.1|  PREDICTED: uncharacterized protein LOC101298033    428   2e-139   
ref|XP_008218362.1|  PREDICTED: cysteine-rich receptor-like prote...    427   2e-139   
gb|KCW46712.1|  hypothetical protein EUGRSUZ_K00533                     420   2e-139   
ref|XP_010038468.1|  PREDICTED: probable receptor-like protein ki...    412   3e-139   
gb|KEH40311.1|  stress-induced receptor-like kinase                     429   3e-139   
gb|KCW46707.1|  hypothetical protein EUGRSUZ_K00526                     416   3e-139   
ref|XP_003607182.1|  Kinase R-like protein                              427   3e-139   
gb|KCW45690.1|  hypothetical protein EUGRSUZ_L00522                     417   3e-139   
ref|XP_008347212.1|  PREDICTED: probable receptor-like protein ki...    414   7e-139   
gb|KCW58964.1|  hypothetical protein EUGRSUZ_H01589                     414   8e-139   
ref|XP_009609372.1|  PREDICTED: probable receptor-like protein ki...    424   9e-139   
ref|XP_007052298.1|  Receptor serine/threonine kinase                   424   9e-139   
gb|KEH40362.1|  stress-induced receptor-like kinase                     425   1e-138   
ref|XP_007221159.1|  hypothetical protein PRUPE_ppa020329mg             419   1e-138   
ref|XP_010662837.1|  PREDICTED: probable receptor-like protein ki...    422   1e-138   
ref|XP_007161446.1|  hypothetical protein PHAVU_001G069500g             412   1e-138   
ref|XP_006380301.1|  hypothetical protein POPTR_0007s02230g             420   2e-138   
ref|XP_009629972.1|  PREDICTED: probable receptor-like protein ki...    423   2e-138   
ref|XP_008218519.1|  PREDICTED: U-box domain-containing protein 3...    426   3e-138   
gb|KCW47327.1|  hypothetical protein EUGRSUZ_K01117                     416   3e-138   
gb|KCW46622.1|  hypothetical protein EUGRSUZ_K00432                     410   3e-138   
gb|KCW46714.1|  hypothetical protein EUGRSUZ_K00535                     412   3e-138   
ref|XP_010111691.1|  putative receptor-like protein kinase              420   5e-138   
ref|XP_009788881.1|  PREDICTED: probable receptor-like protein ki...    424   6e-138   
gb|KCW46692.1|  hypothetical protein EUGRSUZ_K00504                     412   6e-138   
ref|XP_009778885.1|  PREDICTED: probable receptor-like protein ki...    422   6e-138   
emb|CAN78923.1|  hypothetical protein VITISV_024238                     410   7e-138   
ref|XP_010035233.1|  PREDICTED: probable receptor-like protein ki...    422   9e-138   
ref|XP_007052344.1|  Receptor serine/threonine kinase                   421   9e-138   
ref|XP_009778886.1|  PREDICTED: probable receptor-like protein ki...    422   1e-137   
ref|XP_008370765.1|  PREDICTED: probable receptor-like protein ki...    420   1e-137   
gb|EYU32412.1|  hypothetical protein MIMGU_mgv11b0179042mg              412   1e-137   
gb|KCW46706.1|  hypothetical protein EUGRSUZ_K00525                     419   1e-137   
ref|XP_004249993.2|  PREDICTED: glycerophosphodiester phosphodies...    419   2e-137   
ref|XP_010026253.1|  PREDICTED: probable receptor-like protein ki...    424   2e-137   
gb|EYU28969.1|  hypothetical protein MIMGU_mgv1a0259881mg               410   3e-137   



>emb|CDP20809.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/350 (75%), Positives = 306/350 (87%), Gaps = 2/350 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             GRF LG+LFL ++++YK+RR HLS Y+ IE +L  PNNLMP+RY+Y +I++MTNNFK KL
Sbjct  260   GRFLLGVLFLFALIIYKMRRSHLSMYENIEDFLQSPNNLMPVRYAYSDIRKMTNNFKDKL  319

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYGTVFKG LRSGP VAVKM+GKSKA GQEFISEVATIGRIHH NVV+LIGFC EGS
Sbjct  320   GEGGYGTVFKGKLRSGPLVAVKMLGKSKANGQEFISEVATIGRIHHANVVKLIGFCFEGS  379

Query  376   KRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             KRAL+YEFMPNGSLEKYIF KE E+ SLS EK+FDI+LG+A+GIDYLHRGC+M+ILHFDI
Sbjct  380   KRALVYEFMPNGSLEKYIFRKETETASLSCEKLFDIALGIAKGIDYLHRGCEMQILHFDI  439

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDE+F+PK+SDFGLAKLYP E+S+VSLTAARGT+GYMAPEL Y+NIGG+S+KAD
Sbjct  440   KPHNILLDEHFAPKLSDFGLAKLYPTENSIVSLTAARGTLGYMAPELYYKNIGGVSYKAD  499

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLL+EM G+RKNLNP VEQ SQIYFPSWVY+QL  G  I+MGDA+E+E+K+ KKM
Sbjct  500   VYSFGMLLLEMAGKRKNLNPLVEQRSQIYFPSWVYDQLSKGNSIEMGDASEDERKMLKKM  559

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             I+VALWCIQM P  RPSM KV   + E D ELLE  PKPF +PDE+P  E
Sbjct  560   ILVALWCIQMKPINRPSMNKVT-EMLEGDGELLETPPKPFQNPDEMPAPE  608



>emb|CDP21418.1| unnamed protein product [Coffea canephora]
Length=732

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/375 (71%), Positives = 316/375 (84%), Gaps = 5/375 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             GRF LG+ FL ++++YK+RR HLS Y+ IE +L  PNNL+P+RY+Y +I++MTNNF  KL
Sbjct  352   GRFLLGVPFLFALIIYKIRRSHLSMYENIEDFLQSPNNLLPVRYAYSDIRKMTNNFNDKL  411

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYGTVFKG LRSGP VAVKM+GKSKA GQEFISEVATIGRIHH NVVRLIGFC EGS
Sbjct  412   GEGGYGTVFKGKLRSGPLVAVKMLGKSKANGQEFISEVATIGRIHHANVVRLIGFCFEGS  471

Query  376   KRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             KRAL+YEFMPNGSLEKYIF KE E+ SLS EK+F+I+LG+A+GIDYLHRGC+M+ILHFDI
Sbjct  472   KRALVYEFMPNGSLEKYIFRKETETTSLSCEKLFNIALGIAKGIDYLHRGCEMQILHFDI  531

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDE+F+PK+SDFGLAKLYP E+S+VSLTAARGT+GYMAPEL Y+NIGG+S+KAD
Sbjct  532   KPHNILLDEHFAPKLSDFGLAKLYPTENSIVSLTAARGTLGYMAPELYYKNIGGVSYKAD  591

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLL+EM G+RKNLNP V+Q SQIYFPSWVY+QL  G  I+MGDA+E+E+K+ KKM
Sbjct  592   VYSFGMLLLEMAGKRKNLNPLVDQRSQIYFPSWVYDQLSKGNSIEMGDASEDERKMLKKM  651

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVE  1092
             I+VALWCIQM P  RPSM KVI  + E D ELLEM PKPF +PDE+P  E         E
Sbjct  652   ILVALWCIQMKPINRPSMNKVI-EMLEGDGELLEMPPKPFQNPDEMPAPEAEDGGNDAEE  710

Query  1093  S---PLLSDNPVRSS  1128
             +   PLLS + V SS
Sbjct  711   TANFPLLSLDRVDSS  725



>emb|CDP21357.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/350 (74%), Positives = 304/350 (87%), Gaps = 2/350 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             GRF LG+ FL ++++YK+RR HLS Y+ IE +L  PNNL+P+RY+Y +I++MTNNF  KL
Sbjct  272   GRFLLGVPFLFALIIYKIRRSHLSMYENIEDFLQSPNNLVPVRYAYSDIRKMTNNFNDKL  331

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYGTVFKG LRSGP VAVKM+ KSKA GQEFISEVATIGRIHH NVVRLIGFC EGS
Sbjct  332   GEGGYGTVFKGKLRSGPLVAVKMLDKSKANGQEFISEVATIGRIHHANVVRLIGFCFEGS  391

Query  376   KRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             KRAL+YEFMPNGSLEKYIF KE E+ SLS EK+FDI+LG+A+GIDYLH GC+M+ILHFDI
Sbjct  392   KRALVYEFMPNGSLEKYIFQKETETTSLSCEKLFDIALGIAKGIDYLHCGCEMQILHFDI  451

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDE+F+PK+SDFGLAKLYP E+S+VSLTAARGT+GYMAPEL Y+NIGG+S+KAD
Sbjct  452   KPHNILLDEHFAPKLSDFGLAKLYPTENSIVSLTAARGTLGYMAPELYYKNIGGVSYKAD  511

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             +YSFGMLL+EM G+RKNLNP VEQ SQIYFPSWVY+QL  G  I+MGDA+E+E+K+ KKM
Sbjct  512   IYSFGMLLLEMAGKRKNLNPLVEQRSQIYFPSWVYDQLSKGNSIEMGDASEDERKMLKKM  571

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             I+VALWCIQM P  RPSM KVI  + E D ELLEM PKPF +PDE+P  E
Sbjct  572   ILVALWCIQMKPINRPSMNKVI-EMLEGDGELLEMPPKPFQNPDEMPAPE  620



>ref|XP_009765438.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=644

 Score =   529 bits (1362),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 251/344 (73%), Positives = 303/344 (88%), Gaps = 1/344 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  GL+FLI++VV+K RRRHLS Y +IE +L   +NL+PI+YSY EIK+MTN FK KLG
Sbjct  284   RFLFGLVFLIALVVHKWRRRHLSMYQSIEDFLQIQSNLVPIKYSYSEIKKMTNKFKEKLG  343

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVKMM KS  +GQEFISEV+TIGRIHH NVV+LIGFCVEGSK
Sbjct  344   EGAYGTVFKGKLRSGPFVAVKMMHKSMTSGQEFISEVSTIGRIHHVNVVQLIGFCVEGSK  403

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+Y+FMPNGSL+KYIF +E +ISLS+++MFDISLGV RG++YLHRGCDM+ILHFDIKP
Sbjct  404   RALVYDFMPNGSLDKYIFQQEGTISLSYKQMFDISLGVTRGVEYLHRGCDMQILHFDIKP  463

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENFSPK+SDFGLAKLYP +DS+VSLTAARGTMGYMAPEL Y+NIGGIS+KADVY
Sbjct  464   HNILLDENFSPKISDFGLAKLYPTDDSIVSLTAARGTMGYMAPELFYKNIGGISYKADVY  523

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN+NPF + LSQIYFP+WVY+Q  +G DI++ D T+EE+++ K+MII
Sbjct  524   SYGMLLMEMAGRRKNMNPFDDHLSQIYFPTWVYDQFNEGNDIEIHDTTDEERRMVKRMII  583

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             VALWCIQM P++RP+M KV+  + E D ELL+M P+PF++P E+
Sbjct  584   VALWCIQMKPADRPAMNKVV-EMLEGDDELLQMPPRPFIAPREI  626



>ref|XP_009780293.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=640

 Score =   526 bits (1354),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 246/347 (71%), Positives = 304/347 (88%), Gaps = 1/347 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  GL+FL++++VY+ RRRHLS Y +IE +L   +NL+PI+YSY EIK+MTN FK KLG
Sbjct  284   RFLFGLVFLVALIVYRWRRRHLSMYQSIEDFLQIQSNLVPIKYSYSEIKKMTNKFKEKLG  343

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVK+M KS  +G+EFISEV+TIGRIHH NVV+LIGFCVEGSK
Sbjct  344   EGAYGTVFKGKLRSGPFVAVKIMHKSMTSGEEFISEVSTIGRIHHVNVVQLIGFCVEGSK  403

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+Y+FMPN SL+KYIFP+E  +SLS+++MF+ISLGVARGIDYLHRGCDM+ILHFDIKP
Sbjct  404   RALVYDFMPNSSLDKYIFPQEGIVSLSYKQMFEISLGVARGIDYLHRGCDMQILHFDIKP  463

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+P++SDFGLAKLYP +DS+V+LTAARGT+GYMAPEL Y+NIGG+S+KADVY
Sbjct  464   HNILLDENFNPRISDFGLAKLYPTDDSIVTLTAARGTVGYMAPELFYKNIGGVSYKADVY  523

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN+NPF + LSQIYFP+WVY+Q  +G DI+M DA+EE++K+ KK+I 
Sbjct  524   SYGMLLMEMAGRRKNMNPFADHLSQIYFPTWVYDQFNEGNDIEMQDASEEDRKMVKKIIF  583

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             VALWCIQM P +RP+M KV+  + E DV+LL+M P+PF+SP E+  D
Sbjct  584   VALWCIQMKPVDRPAMNKVV-EMLEGDVQLLQMPPRPFISPREIAGD  629



>ref|XP_009592347.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=637

 Score =   521 bits (1343),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 246/347 (71%), Positives = 298/347 (86%), Gaps = 1/347 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  G +FLI+++VYK RRRH+S Y +IE +L   +NL+PI+YSY EIK+MTN F+ KLG
Sbjct  281   RFLCGFIFLIALIVYKWRRRHISMYQSIEDFLQTQSNLVPIKYSYSEIKKMTNKFREKLG  340

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVKMM  S  +GQEFISEV+TIGRIHH NVV+LIGFCVEGSK
Sbjct  341   EGAYGTVFKGKLRSGPFVAVKMMHNSMTSGQEFISEVSTIGRIHHVNVVQLIGFCVEGSK  400

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFMPNGSL+KYIFP+E  +SLS+++MFDISLGVA GIDYLHRGCDM+ILHFDIKP
Sbjct  401   RALVYEFMPNGSLDKYIFPQEGIVSLSYKQMFDISLGVACGIDYLHRGCDMQILHFDIKP  460

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+PK+SDFGLAKLYP +DS+VS+TAARGT+GYMAPEL Y+NIGG+S+KADVY
Sbjct  461   HNILLDENFNPKISDFGLAKLYPTDDSIVSVTAARGTVGYMAPELFYKNIGGVSYKADVY  520

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN+NP  + LSQIYFP WVY+Q  +G DI+M +  EE++++ KKM+I
Sbjct  521   SYGMLLMEMAGRRKNMNPLADHLSQIYFPRWVYDQFNEGNDIEMQNTNEEDRRMVKKMMI  580

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
              ALWCIQM P++RP+M KV+  + E DVELL M P+PF+SP E+  D
Sbjct  581   AALWCIQMKPADRPAMNKVV-EMLEGDVELLLMPPRPFISPREIAGD  626



>ref|XP_009596789.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana tomentosiformis]
Length=688

 Score =   523 bits (1346),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 248/344 (72%), Positives = 299/344 (87%), Gaps = 1/344 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R   GL+FLI+++VYK RR+HLS Y +IE +L   +N +PI+YSY EIK+MTN FK KLG
Sbjct  328   RSLFGLVFLIALIVYKWRRQHLSMYQSIEDFLQIQSNFVPIKYSYSEIKKMTNKFKEKLG  387

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVKMM KS  +GQEFISEV+TIGRIHH NVV+LIGFCVEGSK
Sbjct  388   EGAYGTVFKGKLRSGPFVAVKMMHKSMTSGQEFISEVSTIGRIHHVNVVQLIGFCVEGSK  447

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFMPNGSL+KYIF +E  +SLS+++MFDISLGVARG++YLHRGCDM+ILHFDIKP
Sbjct  448   RALVYEFMPNGSLDKYIFLQEGIVSLSYKQMFDISLGVARGVEYLHRGCDMQILHFDIKP  507

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENFSPK+SDFGLAKLYP +DS+VSLTAARGTMGYMAPEL Y+NIGGIS+KADVY
Sbjct  508   HNILLDENFSPKISDFGLAKLYPTDDSIVSLTAARGTMGYMAPELFYKNIGGISYKADVY  567

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN++PF + LSQIYFP+WVY+Q   G DI++ DAT+EE+ + KKM+I
Sbjct  568   SYGMLLMEMAGRRKNMSPFADHLSQIYFPTWVYDQFDLGNDIEIQDATDEERSMVKKMMI  627

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             VALWCIQM P++RP+M KV+  + E D ELL+  P+PF++P E+
Sbjct  628   VALWCIQMKPADRPAMNKVV-EMLEGDDELLQEPPRPFIAPREI  670



>ref|XP_006350567.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=640

 Score =   521 bits (1342),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 245/347 (71%), Positives = 303/347 (87%), Gaps = 1/347 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R   GL+FL +++VYK RRRHLS Y +IE +L   +NL+PI+YSY EIK+MTN FK KLG
Sbjct  284   RLLFGLVFLTALIVYKWRRRHLSMYQSIEDFLQVQSNLLPIKYSYSEIKKMTNKFKEKLG  343

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVKMM +S A+GQEFISEV+TIGRIHH N+V+L+GFCVEGSK
Sbjct  344   EGAYGTVFKGKLRSGPFVAVKMMHQSMASGQEFISEVSTIGRIHHVNIVQLVGFCVEGSK  403

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFM NGSL+KYI P+E ++SLS+++MFDISLGVA GIDYLHRGCD++ILHFDIKP
Sbjct  404   RALVYEFMLNGSLDKYISPQEGTVSLSYKQMFDISLGVASGIDYLHRGCDIQILHFDIKP  463

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+PK+SDFGLAKLY  +DS+VSLTAARGTMGYMAPEL Y+NIGG+SHKADVY
Sbjct  464   HNILLDENFNPKISDFGLAKLYSSDDSIVSLTAARGTMGYMAPELFYKNIGGVSHKADVY  523

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN+NPF + LSQIYFP+W+Y+Q  +G DI++ DA+EE++++ KKM+I
Sbjct  524   SYGMLLMEMAGRRKNMNPFEDHLSQIYFPAWIYDQFNEGNDIEIQDASEEDRRLVKKMMI  583

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             VALWCIQM P++RP+M KV+  + E +VELL+M P+PF++P E+  D
Sbjct  584   VALWCIQMKPADRPAMNKVV-EMLEGNVELLQMPPRPFIAPREIAGD  629



>ref|XP_009596790.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana tomentosiformis]
Length=677

 Score =   522 bits (1345),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 248/344 (72%), Positives = 299/344 (87%), Gaps = 1/344 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R   GL+FLI+++VYK RR+HLS Y +IE +L   +N +PI+YSY EIK+MTN FK KLG
Sbjct  317   RSLFGLVFLIALIVYKWRRQHLSMYQSIEDFLQIQSNFVPIKYSYSEIKKMTNKFKEKLG  376

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVKMM KS  +GQEFISEV+TIGRIHH NVV+LIGFCVEGSK
Sbjct  377   EGAYGTVFKGKLRSGPFVAVKMMHKSMTSGQEFISEVSTIGRIHHVNVVQLIGFCVEGSK  436

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFMPNGSL+KYIF +E  +SLS+++MFDISLGVARG++YLHRGCDM+ILHFDIKP
Sbjct  437   RALVYEFMPNGSLDKYIFLQEGIVSLSYKQMFDISLGVARGVEYLHRGCDMQILHFDIKP  496

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENFSPK+SDFGLAKLYP +DS+VSLTAARGTMGYMAPEL Y+NIGGIS+KADVY
Sbjct  497   HNILLDENFSPKISDFGLAKLYPTDDSIVSLTAARGTMGYMAPELFYKNIGGISYKADVY  556

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN++PF + LSQIYFP+WVY+Q   G DI++ DAT+EE+ + KKM+I
Sbjct  557   SYGMLLMEMAGRRKNMSPFADHLSQIYFPTWVYDQFDLGNDIEIQDATDEERSMVKKMMI  616

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             VALWCIQM P++RP+M KV+  + E D ELL+  P+PF++P E+
Sbjct  617   VALWCIQMKPADRPAMNKVV-EMLEGDDELLQEPPRPFIAPREI  659



>ref|XP_009760919.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 251/347 (72%), Positives = 298/347 (86%), Gaps = 1/347 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  G++FLI++VVYKLRRRHLS Y  IE +L   +NL+PI+YSY EIK+MTN FK KLG
Sbjct  289   RFLCGIIFLIALVVYKLRRRHLSEYQAIEDFLQIQSNLVPIKYSYSEIKKMTNKFKEKLG  348

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVKMM KS  +GQEFISEV+TIGRIHH NVV+LIGFC EGSK
Sbjct  349   EGAYGTVFKGKLRSGPFVAVKMMHKSMTSGQEFISEVSTIGRIHHVNVVQLIGFCGEGSK  408

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+Y+FMPNGSL+KYIFP E +I LS+++MFDISLGVARGIDYLHRGCDM+ILHFDIKP
Sbjct  409   RALVYDFMPNGSLDKYIFPAEGTIFLSYKQMFDISLGVARGIDYLHRGCDMQILHFDIKP  468

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+PK+SDFGLAKLYP +DS+VSLTAARGTMGYMAPEL Y+NIGG+S+KADVY
Sbjct  469   HNILLDENFNPKLSDFGLAKLYPTDDSIVSLTAARGTMGYMAPELFYKNIGGVSYKADVY  528

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN+NPF + LSQIYFP+WVY+Q   G D+ + D T+EE+ + KKM+I
Sbjct  529   SYGMLLMEMAGRRKNMNPFADHLSQIYFPTWVYDQFNSGNDVQIPDTTDEERIIIKKMMI  588

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
              AL CIQM P +RP+M KV+  + E DV+LL+M PKPF++P E+  D
Sbjct  589   AALRCIQMRPVDRPAMNKVV-EMLEGDVQLLQMPPKPFVAPREIAGD  634



>ref|XP_009760918.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana sylvestris]
Length=653

 Score =   520 bits (1340),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 251/347 (72%), Positives = 298/347 (86%), Gaps = 1/347 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  G++FLI++VVYKLRRRHLS Y  IE +L   +NL+PI+YSY EIK+MTN FK KLG
Sbjct  296   RFLCGIIFLIALVVYKLRRRHLSEYQAIEDFLQIQSNLVPIKYSYSEIKKMTNKFKEKLG  355

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVKMM KS  +GQEFISEV+TIGRIHH NVV+LIGFC EGSK
Sbjct  356   EGAYGTVFKGKLRSGPFVAVKMMHKSMTSGQEFISEVSTIGRIHHVNVVQLIGFCGEGSK  415

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+Y+FMPNGSL+KYIFP E +I LS+++MFDISLGVARGIDYLHRGCDM+ILHFDIKP
Sbjct  416   RALVYDFMPNGSLDKYIFPAEGTIFLSYKQMFDISLGVARGIDYLHRGCDMQILHFDIKP  475

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+PK+SDFGLAKLYP +DS+VSLTAARGTMGYMAPEL Y+NIGG+S+KADVY
Sbjct  476   HNILLDENFNPKLSDFGLAKLYPTDDSIVSLTAARGTMGYMAPELFYKNIGGVSYKADVY  535

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN+NPF + LSQIYFP+WVY+Q   G D+ + D T+EE+ + KKM+I
Sbjct  536   SYGMLLMEMAGRRKNMNPFADHLSQIYFPTWVYDQFNSGNDVQIPDTTDEERIIIKKMMI  595

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
              AL CIQM P +RP+M KV+  + E DV+LL+M PKPF++P E+  D
Sbjct  596   AALRCIQMRPVDRPAMNKVV-EMLEGDVQLLQMPPKPFVAPREIAGD  641



>ref|XP_009786425.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=637

 Score =   519 bits (1337),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 245/347 (71%), Positives = 299/347 (86%), Gaps = 1/347 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  G +FLI+++VYK RRRH+S Y +IE +L   +NL+PI+YS+ EIK+MTN FK KLG
Sbjct  281   RFFCGFIFLIALIVYKWRRRHISMYQSIEDFLQTQSNLVPIKYSFSEIKKMTNKFKEKLG  340

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVK+M KS  +GQEFISEV+TIGRIHH NVV+LIGFCVEGSK
Sbjct  341   EGAYGTVFKGKLRSGPFVAVKIMHKSMTSGQEFISEVSTIGRIHHVNVVQLIGFCVEGSK  400

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+Y+FMPNGSL+KYIFP+E  +SLS+++MFDISLGVARGIDYLHRGCDM+ILHFDIKP
Sbjct  401   RALVYDFMPNGSLDKYIFPQEGIVSLSYKQMFDISLGVARGIDYLHRGCDMQILHFDIKP  460

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+P++SDFGLAKLYP +DS+V+LTAARGTMGYMAPEL Y+NIGG+S+KADVY
Sbjct  461   HNILLDENFNPRISDFGLAKLYPTDDSIVTLTAARGTMGYMAPELFYKNIGGVSYKADVY  520

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN+NPF + LSQIYFP+WVY+Q   G D+ + D T+EE+ + KKM+I
Sbjct  521   SYGMLLMEMAGRRKNMNPFADHLSQIYFPTWVYDQFNSGNDVQIPDTTDEERIIIKKMMI  580

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
              AL CIQM P +RP+M KV+  + E DV+LL+M PKPF++P E+  D
Sbjct  581   AALRCIQMRPVDRPAMNKVV-EMLEGDVQLLQMPPKPFVAPREIAGD  626



>ref|XP_008232085.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=377

 Score =   509 bits (1311),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 253/363 (70%), Positives = 296/363 (82%), Gaps = 8/363 (2%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + + L R+ LG    + I++YK RRRH S Y TIE +L   NN +PIRYSY +IKRMT  
Sbjct  7     VGFFLPRYLLG----VGILIYKWRRRHFSMYTTIEDFLRSENNFIPIRYSYHDIKRMTRG  62

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEGGYG+VFKG LRSG F AVKM+GK KA GQEFISEVATIGRIHH NVV+L+G+
Sbjct  63    FKDKLGEGGYGSVFKGKLRSGRFAAVKMLGKPKANGQEFISEVATIGRIHHVNVVQLVGY  122

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGSKRAL+Y+FMPNGSL+KYI+ K+ESI L+ +K F+ISLGVARGI YLH GCDM+IL
Sbjct  123   CAEGSKRALVYDFMPNGSLDKYIYSKDESIPLNCKKAFEISLGVARGIKYLHEGCDMQIL  182

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLD NF PK+SDFGLAKLYPV++S+VSLTAARGTMGYMAPEL Y+NIGG+S
Sbjct  183   HFDIKPHNILLDGNFIPKISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVS  242

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
              KADVYSFGMLLMEM  RRKNLN FVE  SQIYFPSWVY+Q  +GKD++MG+  EEEK++
Sbjct  243   FKADVYSFGMLLMEMTSRRKNLNAFVEHSSQIYFPSWVYDQYNEGKDLEMGNVPEEEKEI  302

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT---DENSF  1071
              KKM+I ALWCIQM PS+RPSMKKVI  + E  VE L+M PKPFL P E+P    D++S 
Sbjct  303   MKKMVITALWCIQMKPSDRPSMKKVI-EMLEGGVEFLKMPPKPFLCPQEMPVGDLDQDSL  361

Query  1072  PNA  1080
               A
Sbjct  362   NQA  364



>ref|XP_008245765.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=406

 Score =   507 bits (1305),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 251/384 (65%), Positives = 308/384 (80%), Gaps = 13/384 (3%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             Y   +F+ G   + ++++YK RRRHLS Y+ IE +L   NNLMPIRYSY +IK+M   FK
Sbjct  22    YLAAKFTFGFPLVTALLIYKWRRRHLSMYENIEDFLRSNNNLMPIRYSYSDIKKMARGFK  81

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGGYG+V+K  LRSG  VA+KM+GKSK  GQ+FI+EV TIGRI H NVVRLIGFCV
Sbjct  82    DKLGEGGYGSVYKAKLRSGRLVAIKMLGKSKTKGQDFINEVGTIGRIRHVNVVRLIGFCV  141

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             +GSKRAL+Y+FM NGSLEKYIF ++  +SLS +K F+I+LGVARGIDYLHRGCDM+ILHF
Sbjct  142   DGSKRALVYDFMSNGSLEKYIFSQQGDVSLSCQKTFEIALGVARGIDYLHRGCDMQILHF  201

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF+PKVSDFGLAKLYP+++S+VSLTAARGTMGY+APEL Y+NIGG+S+K
Sbjct  202   DIKPHNILLDENFTPKVSDFGLAKLYPLDNSIVSLTAARGTMGYIAPELFYKNIGGVSYK  261

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVE---QLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             ADVYSFGMLLMEM GRRKNLN  +E   Q SQIYFP+WV +QLK GK+I++G DAT+EEK
Sbjct  262   ADVYSFGMLLMEMAGRRKNLNAGIEQSSQFSQIYFPTWVSDQLKAGKNIEIGDDATDEEK  321

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE----  1062
             K+ KKM++VALWCIQM P ERPSM KV+  + E ++E L+M P+PFL P ++P DE    
Sbjct  322   KIIKKMMMVALWCIQMKPIERPSMNKVV-EMLEGEIESLQMPPRPFLYPQQIPADEVGGD  380

Query  1063  NSFPNAQNV----ESPLLSDNPVR  1122
             N  P A +     E  L++D  VR
Sbjct  381   NRSPCASSASESEEITLIADANVR  404



>ref|XP_009592348.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=652

 Score =   516 bits (1328),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 247/347 (71%), Positives = 296/347 (85%), Gaps = 1/347 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  G +FLI++VVYKLRRRHLS Y  IE +L     L+PI+YSY EIK+MTN FK KLG
Sbjct  296   RFLCGFIFLIALVVYKLRRRHLSEYQAIEDFLQIQGTLVPIKYSYSEIKKMTNKFKEKLG  355

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFV+VKMM KS  +GQEFISEV+TIGRIHH NVV+L+GFCVEGSK
Sbjct  356   EGAYGTVFKGKLRSGPFVSVKMMHKSMTSGQEFISEVSTIGRIHHVNVVQLVGFCVEGSK  415

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFM NGSL+KYIF +E  +SLS+++MFDISLGV+RGIDYLHRGCDM+ILHFDIKP
Sbjct  416   RALVYEFMLNGSLDKYIFLQEGIVSLSYQQMFDISLGVSRGIDYLHRGCDMQILHFDIKP  475

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+PK+SDFGLAKLYP +DS+VSLTAARGTMGYMAPEL Y+ IGG+S+KADVY
Sbjct  476   HNILLDENFNPKISDFGLAKLYPTDDSMVSLTAARGTMGYMAPELFYKKIGGVSYKADVY  535

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GMLLMEM GRRKN+NPF + LSQIYFP+WVY+Q   G D+ + D T++E+ + KKM+I
Sbjct  536   SYGMLLMEMAGRRKNMNPFADHLSQIYFPTWVYDQFSSGNDVQIPDTTDKERMILKKMMI  595

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
              ALWCIQM P++RP+M KV+  + E DVELL+M PKPF++P E+  D
Sbjct  596   AALWCIQMKPADRPAMNKVV-EMLEGDVELLQMPPKPFVAPREIVGD  641



>ref|XP_007022130.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13655.1| PR5-like receptor kinase [Theobroma cacao]
Length=480

 Score =   506 bits (1304),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 250/370 (68%), Positives = 305/370 (82%), Gaps = 2/370 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             L R  LG+  LI++V YKLRRRHLS  DTIE +L   NNLMPIRYSY+E+KRMT NF+ K
Sbjct  74    LSRMLLGISILIALVTYKLRRRHLSVDDTIEEFLQSQNNLMPIRYSYYEVKRMTRNFQEK  133

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LGEGGYG+VFKG LRSG  VA+K++GKSKA GQ+FI+EVATIGRIHH NV +LIGFCVEG
Sbjct  134   LGEGGYGSVFKGKLRSGHLVAIKLLGKSKANGQDFINEVATIGRIHHVNVAKLIGFCVEG  193

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SK+AL+Y+FM NGSL++ IF +E  ISLS +KMFDI+LGVARGI+YLH+GCDM+ILHFDI
Sbjct  194   SKQALVYDFMSNGSLDRIIFAEENKISLSWQKMFDIALGVARGIEYLHQGCDMQILHFDI  253

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDENF PKVSDFGLAKLY V+DS+VSLTAARGT+GY+APEL Y+NIGG+S+KAD
Sbjct  254   KPHNILLDENFIPKVSDFGLAKLYSVDDSIVSLTAARGTIGYIAPELVYKNIGGVSNKAD  313

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEMVGRRKNLN F E LSQIYFP W+Y Q   G+DI++G+ T+ EK + KKM
Sbjct  314   VYSFGMLLMEMVGRRKNLNAFAEHLSQIYFPLWIYGQFHRGEDIELGEVTDGEKIIVKKM  373

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN-AQNV  1089
             +I A WCI + P++RPSM KV+  + E +VELL+M PKPF  P +V  ++ +  N +++ 
Sbjct  374   VITACWCILVPPNDRPSMSKVL-EMLETNVELLQMPPKPFQLPFKVSIEDRADENPSEDP  432

Query  1090  ESPLLSDNPV  1119
              S LLS N +
Sbjct  433   TSSLLSLNEI  442



>ref|XP_011084499.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Sesamum 
indicum]
Length=641

 Score =   511 bits (1317),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 247/349 (71%), Positives = 294/349 (84%), Gaps = 4/349 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF +G  FLI +VVYK RRRHLS  ++IE +L G NNL PI+Y+Y EIK+MTNNF  +LG
Sbjct  287   RFIIGFPFLIGLVVYKWRRRHLSMDESIEEFLQGQNNLTPIKYTYSEIKKMTNNFNQRLG  346

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTV+KG LRSGPFVAVKMMG+S AT QEFISEV TIGRIHH NVV+LIGFCVEGSK
Sbjct  347   EGAYGTVYKGKLRSGPFVAVKMMGQSMATEQEFISEVGTIGRIHHVNVVQLIGFCVEGSK  406

Query  379   RALLYEFMPNGSLEKYIFPKE--ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
              AL+YE++PNGSL++YIF +   E+++L +EKMFDI+LGVARGIDYLHRGCDM+ILHFDI
Sbjct  407   CALVYEYLPNGSLDRYIFNQLGIEALALRYEKMFDIALGVARGIDYLHRGCDMQILHFDI  466

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDENF+PK+SDFGLAKLYP + S+V+LTAARGTMGYMAPE+ Y+NIGG+S+KAD
Sbjct  467   KPHNILLDENFNPKISDFGLAKLYPTDGSVVNLTAARGTMGYMAPEMFYKNIGGVSYKAD  526

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEM GRRKN+NPF E + QIYFP W Y+QL  GK+I++ DATEEE+K+ KK+
Sbjct  527   VYSFGMLLMEMAGRRKNMNPFTEDIGQIYFPLWAYDQLYAGKEIEIKDATEEERKLVKKI  586

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             IIVALWCIQM PS+RP M KV+     ED   L M PKPF++P E+  D
Sbjct  587   IIVALWCIQMKPSDRPPMNKVV--EMLEDDSELPMPPKPFMAPREMAND  633



>emb|CDP17838.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   500 bits (1288),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 247/354 (70%), Positives = 294/354 (83%), Gaps = 5/354 (1%)
 Frame = +1

Query  91    YDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMG  270
             Y+ IE +L  PNNLMP+RY+Y +I++MTNNF  KL EGGYGTVFKG LRSGP VAVKM+G
Sbjct  2     YENIEDFLQSPNNLMPVRYAYSDIRKMTNNFNDKLVEGGYGTVFKGKLRSGPLVAVKMLG  61

Query  271   KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKE-ES  447
             KSKA GQEFISEVATIGRIHH NVVRL+GFC EGSKRAL+YEFMPNGSLEKYIF KE E+
Sbjct  62    KSKANGQEFISEVATIGRIHHANVVRLVGFCFEGSKRALVYEFMPNGSLEKYIFRKETET  121

Query  448   ISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYP  627
              SLS EK+FDI+L +A+GIDYLH GC+M+ILHFDIKPHN+LLDE F+PK+SDFGLAKLYP
Sbjct  122   TSLSCEKLFDIALAIAKGIDYLHSGCEMQILHFDIKPHNVLLDERFAPKLSDFGLAKLYP  181

Query  628   VEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQL  807
              E+S+VSLTAARGT+GYMAPEL Y+NIGG+S+KADVYSFGMLL+EM G+RKNLNP V+Q 
Sbjct  182   TENSIVSLTAARGTLGYMAPELYYKNIGGVSYKADVYSFGMLLLEMAGKRKNLNPLVDQR  241

Query  808   SQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIeml  987
             SQI+FPSWVY+QL  G  I+MGDA+E+E+K+ KKMI++ALWCIQM P  RPSM KVI  +
Sbjct  242   SQIFFPSWVYDQLSKGNSIEMGDASEDERKMFKKMILIALWCIQMKPINRPSMNKVI-EM  300

Query  988   eeedvellemAPKPFLSPDEVP---TDENSFPNAQNVESPLLSDNPVRSSSFEV  1140
              E D ELLEM PKPF +PDE+P    ++      +  + PLLS + V SS   +
Sbjct  301   LEGDGELLEMPPKPFQNPDEMPAPEAEDGGNDAEETADFPLLSLDRVDSSDMSM  354



>ref|XP_004234168.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Solanum 
lycopersicum]
Length=638

 Score =   511 bits (1315),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 242/350 (69%), Positives = 303/350 (87%), Gaps = 2/350 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R   GL+FL +++VYKLRRRHLS Y +IE +L   +NL+PI+YSY EIK+MT+ FK KLG
Sbjct  281   RLLFGLVFLTALIVYKLRRRHLSMYQSIEDFLQVQSNLLPIKYSYSEIKKMTSKFKEKLG  340

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EG YGTVFKG LRSGPFVAVKMM +S A+G EFISEV+TIGRIHH N+V+L+GFCVEGSK
Sbjct  341   EGAYGTVFKGKLRSGPFVAVKMMHQSMASGGEFISEVSTIGRIHHVNIVQLVGFCVEGSK  400

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFM NGSL+KYI P+E ++SLS+++MFDISLGVA GIDYLHRGCDM+ILHFDIKP
Sbjct  401   RALVYEFMLNGSLDKYISPQEGTVSLSYKQMFDISLGVASGIDYLHRGCDMQILHFDIKP  460

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+PK+SDFGLAKLY  +DS+VSLTAARGTMGYMAPEL Y+NIGG+S+KADVY
Sbjct  461   HNILLDENFNPKISDFGLAKLYSSDDSIVSLTAARGTMGYMAPELFYKNIGGVSYKADVY  520

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             S+GML+MEM GRRK++NPF + LSQIYFP+W+Y+Q  +G DI++ DA+EE++++ KKM+I
Sbjct  521   SYGMLMMEMAGRRKSMNPFEDHLSQIYFPTWIYDQFNEGNDIEIQDASEEDRRLVKKMMI  580

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSP-DEVPTDEN  1065
             VALWCIQM P++RP+M KV+  + E DV LL+M P+PF++P D+   D +
Sbjct  581   VALWCIQMKPADRPAMNKVV-EMLEGDVGLLQMPPRPFIAPRDQFAGDSD  629



>ref|XP_007219143.1| hypothetical protein PRUPE_ppa016018mg, partial [Prunus persica]
 gb|EMJ20342.1| hypothetical protein PRUPE_ppa016018mg, partial [Prunus persica]
Length=635

 Score =   510 bits (1313),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 250/354 (71%), Positives = 294/354 (83%), Gaps = 4/354 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             Y   +F  G   L  +++YK RRRHLS YD IE +L    NLMP+RYSY +IK+MT  FK
Sbjct  276   YQAAKFLFGYPCLAGLLIYKWRRRHLSMYDNIEEFLQSNYNLMPMRYSYSDIKKMTKGFK  335

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGGYGTV+K  LRSG FVAVKM+GKSKA GQEFI+EVATIGRIHH NVV+LIGF V
Sbjct  336   DKLGEGGYGTVYKAKLRSGHFVAVKMLGKSKANGQEFINEVATIGRIHHVNVVQLIGFSV  395

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEES---ISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             +GSKRAL+Y+FMPNGSLEKYIF +  S   ISLS+EKMF I+LGVARGI+YLH+GCDM+I
Sbjct  396   DGSKRALIYDFMPNGSLEKYIFSQSGSGVLISLSYEKMFQIALGVARGIEYLHQGCDMQI  455

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILLDENF+PKVSDFGLA+L P+E+S+VSLTAARGT+GY+APEL Y+NIGG+
Sbjct  456   LHFDIKPHNILLDENFTPKVSDFGLARLCPLENSIVSLTAARGTIGYIAPELFYKNIGGV  515

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
             S+KADVYSFGMLLME  GRRKNLN  +E  SQIYFP+WVY+QL +G DI+MGDATEEE K
Sbjct  516   SYKADVYSFGMLLMETAGRRKNLNASIEHSSQIYFPTWVYDQLSEGNDINMGDATEEENK  575

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             + +KMIIVALWCIQM PSERPSM KV+  +   ++E L+M PKPFL P E P +
Sbjct  576   IIRKMIIVALWCIQMKPSERPSMDKVV-EMLGGEIESLQMPPKPFLYPQETPLE  628



>ref|XP_008234877.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=382

 Score =   498 bits (1282),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 236/327 (72%), Positives = 276/327 (84%), Gaps = 3/327 (1%)
 Frame = +1

Query  7    YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
            Y   +F  G   L ++++YK RRRHLS YD IE +L    NLMP+RYSY +IK+MT  FK
Sbjct  35   YQAAKFLFGYPCLAALLIYKWRRRHLSMYDNIEEFLQSNCNLMPVRYSYSDIKKMTRGFK  94

Query  187  HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
             KLGEGGYGTV+K  LRSG FVAVKM+GKSKA GQEFI+EVATIGRIHH NVV+LIGF V
Sbjct  95   EKLGEGGYGTVYKAKLRSGHFVAVKMLGKSKANGQEFINEVATIGRIHHVNVVQLIGFSV  154

Query  367  EGSKRALLYEFMPNGSLEKYIFPKEES---ISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
            + SKRAL+Y+FM NGSLEKYIF +  S   ISLS+EKMF I+LGVARGI+YLHRGCDM+I
Sbjct  155  DSSKRALIYDFMANGSLEKYIFSQSRSGVLISLSYEKMFQIALGVARGIEYLHRGCDMQI  214

Query  538  LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
            LHFDIKPHNILLDENF+PKVSDFGLA+L P+++S+VSL AARGT+GY+APEL Y+NIGG+
Sbjct  215  LHFDIKPHNILLDENFTPKVSDFGLARLCPLDNSIVSLIAARGTIGYIAPELFYKNIGGV  274

Query  718  SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
            S+KADVYSFGMLLME  GRRKNLN  +E  SQIYFP+WVY+QL +G DI+MGDATEEE K
Sbjct  275  SYKADVYSFGMLLMETAGRRKNLNASIEHSSQIYFPTWVYDQLSEGNDINMGDATEEENK  334

Query  898  VSKKMIIVALWCIQMNPSERPSMKKVI  978
            + +KMIIVALWCIQM PSERPSM KV+
Sbjct  335  IIRKMIIVALWCIQMKPSERPSMDKVV  361



>ref|XP_010662458.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
Length=607

 Score =   504 bits (1298),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 250/348 (72%), Positives = 293/348 (84%), Gaps = 2/348 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             LG   ++  ++YK RRR+LS Y  IE ++   NNL PIRYSY  IK+MT  FK KLGEGG
Sbjct  248   LGSPCVLIFLIYKWRRRNLSMYHAIEEFIQAQNNLTPIRYSYSNIKKMTKGFKEKLGEGG  307

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+V+KG LRSG  VAVKMM  SKA GQ+FI+EVATIGRIHH NVV+LIGFCVEGSKR L
Sbjct  308   YGSVYKGKLRSGHLVAVKMMASSKANGQDFINEVATIGRIHHVNVVQLIGFCVEGSKRVL  367

Query  388   LYEFMPNGSLEKYIFP-KEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHN  564
             LY+FMPNGSL+KYIFP KE +ISLS EKM++ISLGVA GI+YLHRGCD +ILHFDIKPHN
Sbjct  368   LYDFMPNGSLDKYIFPEKEGNISLSLEKMYEISLGVAHGIEYLHRGCDTQILHFDIKPHN  427

Query  565   ILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSF  744
             ILLD+NF+PKVSDFGLAK YP++ S+VSLTAARGTMGYMAPEL Y+NIGG+S+KADVYSF
Sbjct  428   ILLDKNFTPKVSDFGLAKSYPIDHSIVSLTAARGTMGYMAPELFYKNIGGVSYKADVYSF  487

Query  745   GMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVA  924
             GMLLMEM GRRKNLN F E  SQIYFPSWVY+Q   GKDI+M DATEE KK+SKK+IIVA
Sbjct  488   GMLLMEMAGRRKNLNVFAEHSSQIYFPSWVYDQFSKGKDIEMEDATEEGKKLSKKLIIVA  547

Query  925   LWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENS  1068
             LWCIQ+ PS+RPSM KV+  + E +VELL+M P PFL+P EVP ++++
Sbjct  548   LWCIQLKPSDRPSMNKVV-EMLEGNVELLQMPPNPFLTPQEVPAEDHA  594



>ref|XP_008245712.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=680

 Score =   506 bits (1303),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 245/356 (69%), Positives = 297/356 (83%), Gaps = 5/356 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             Y   +FS G   + ++++YK RRRHLS Y+ IE +L   NNLMPIRYSY +IK+M   FK
Sbjct  297   YHAAKFSFGFPLVTALLIYKWRRRHLSMYENIEDFLRSNNNLMPIRYSYSDIKKMARGFK  356

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGGYG+V+K  LRSG  VA+KM+GKSK  GQ+FI+EVATIGRI H NVVRLIGFCV
Sbjct  357   DKLGEGGYGSVYKAKLRSGRLVAIKMLGKSKTNGQDFINEVATIGRIRHVNVVRLIGFCV  416

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y+FMPNGSLEKYIF ++  +SLS +K+F+I+LGVARGI YLH+GCDM+ILHF
Sbjct  417   EGSKRALVYDFMPNGSLEKYIFSQQGDVSLSCQKIFEIALGVARGIKYLHQGCDMQILHF  476

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF+P+VSDFGLAKLYP+++S+VSLTAARGTMGY+APEL Y+NIGG+S+K
Sbjct  477   DIKPHNILLDENFTPRVSDFGLAKLYPLDNSIVSLTAARGTMGYIAPELFYKNIGGVSYK  536

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVE---QLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             ADVYSFGMLLMEM GRRKNLN  +E   QLSQIYFP+WV +QL  GKDI++G DATEEEK
Sbjct  537   ADVYSFGMLLMEMAGRRKNLNAGIEQSSQLSQIYFPTWVSDQLNKGKDIEIGDDATEEEK  596

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             K+ KKM++V LWCIQM PSERP M KV+  + E D+E L + P+PFL P ++P DE
Sbjct  597   KIVKKMMMVGLWCIQMKPSERPPMNKVV-EMLEGDIESLPLPPRPFLHPQQIPADE  651



>ref|XP_011016149.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Populus 
euphratica]
Length=473

 Score =   498 bits (1283),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 245/356 (69%), Positives = 301/356 (85%), Gaps = 3/356 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNF  183
             Y +  F  GL   I  +VYK RRRHLS YD IE +L S  N+LMP+RYSY +IK++TN+F
Sbjct  97    YHVLLFLCGLPCFIIFLVYKWRRRHLSMYDNIEKFLQSHDNDLMPVRYSYSDIKKITNDF  156

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K+KLGEGG+G V+KG LRSG F AVK++ KSKA GQ+FI+EVATIGRI+H NVVRLIGF 
Sbjct  157   KNKLGEGGFGLVYKGKLRSGSFAAVKILSKSKANGQDFINEVATIGRIYHVNVVRLIGFT  216

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
             VEGSKRAL+YEFMPNGSL+KYI  ++ SISLS+EKM++ISLGVARGI+YLH+GCDM+ILH
Sbjct  217   VEGSKRALIYEFMPNGSLDKYIVSRQGSISLSNEKMYEISLGVARGIEYLHKGCDMQILH  276

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDE F PK+SDFGLAKLYP  +S+V LTAARGT+GYMAPEL Y+NIGG+SH
Sbjct  277   FDIKPHNILLDEKFIPKLSDFGLAKLYPTNNSIVPLTAARGTIGYMAPELFYKNIGGVSH  336

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGD-ATEEEKKV  900
             K+DVYSFGMLLMEM+GRRKNLNP  +  SQIYFPSW+Y+Q+ +GKD+++GD ATEE K+ 
Sbjct  337   KSDVYSFGMLLMEMIGRRKNLNPLADHSSQIYFPSWIYDQVSEGKDVELGDHATEEGKET  396

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENS  1068
             +KKMIIVALWCIQ+ P++RPSM  V+  + E DVE L+M PKPFL+P  +P D+++
Sbjct  397   TKKMIIVALWCIQLRPNDRPSMPNVV-KMLESDVESLQMPPKPFLTPHHMPKDDDT  451



>ref|XP_007022127.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13652.1| PR5-like receptor kinase [Theobroma cacao]
Length=433

 Score =   497 bits (1279),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 246/364 (68%), Positives = 301/364 (83%), Gaps = 2/364 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             G+  LI++V YK RRRHLS  DTIE +L   NNLM IRYSY EIK+MT +F+ KLGEGGY
Sbjct  66    GICCLIALVTYKWRRRHLSMDDTIEEFLQSQNNLMSIRYSYREIKKMTRSFRDKLGEGGY  125

Query  211   GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
             G+VFKG LRSG  VA+K++GKSKA GQ+FI+EVATIGRIHH NV +LIGFCVEGSK+AL+
Sbjct  126   GSVFKGKLRSGHLVAIKLLGKSKANGQDFINEVATIGRIHHVNVAKLIGFCVEGSKQALV  185

Query  391   YEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNIL  570
             Y+FM NGSL+K IF +E  I+LS +KMFDI+LGVA+GI+YLH+GCDM+ILHFDIKPHNIL
Sbjct  186   YDFMSNGSLDKIIFAEENKITLSWQKMFDIALGVAQGIEYLHQGCDMQILHFDIKPHNIL  245

Query  571   LDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGM  750
             LD+NF PKVSDFGLAKLY V+DS+VSLTAARGT+GY+APEL Y+NIGGIS+KADVYSFGM
Sbjct  246   LDDNFIPKVSDFGLAKLYSVDDSIVSLTAARGTIGYIAPELVYKNIGGISNKADVYSFGM  305

Query  751   LLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALW  930
             LLMEMVGRRKNLN F E LSQIYFPSW+Y Q   G+DI++G+ T+ EK + +KMII A W
Sbjct  306   LLMEMVGRRKNLNAFAEHLSQIYFPSWIYGQFHRGEDIELGEVTDGEKIIVRKMIITACW  365

Query  931   CIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN-AQNVESPLLS  1107
             CIQ+ P++RPSM KV+  + E +VELL+M PKPF  P EV  ++ +  N +++  S LLS
Sbjct  366   CIQVPPNDRPSMSKVL-EMLETNVELLQMPPKPFQLPFEVSIEDRADENPSEDPTSSLLS  424

Query  1108  DNPV  1119
              N +
Sbjct  425   SNEI  428



>ref|XP_010662385.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
 ref|XP_010662386.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=598

 Score =   502 bits (1292),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 246/346 (71%), Positives = 297/346 (86%), Gaps = 3/346 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             G+  +   ++YK RRR+L  Y  IE ++   NNLMPIRYSY  IK+MT NFK KLGEGG+
Sbjct  255   GIPCVFVFLIYKWRRRNLWIYSDIEEFIQSHNNLMPIRYSYSNIKKMTKNFKEKLGEGGF  314

Query  211   GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
             G+VFKG L+SG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVV+LIGFC +GSKRAL+
Sbjct  315   GSVFKGKLQSGRLVAVKMV-NSKANGQDFINEVATIGRIHHVNVVQLIGFCAKGSKRALV  373

Query  391   YEFMPNGSLEKYIFPKEES-ISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             ++FMPNGSL+KYIFP+ E+ ISL+ EKM++ISLGVA GI+YLHRGCDM+ILHFDIKPHNI
Sbjct  374   FDFMPNGSLDKYIFPRTEANISLNFEKMYEISLGVAHGIEYLHRGCDMQILHFDIKPHNI  433

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLD+NFSPKVSDFGLAKLYP + S+VS+TAARGTMGYMAPEL Y+NIGG+S+KADVYSFG
Sbjct  434   LLDKNFSPKVSDFGLAKLYPTDHSIVSVTAARGTMGYMAPELVYKNIGGVSYKADVYSFG  493

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM GRRKNLN F E  SQ+YFPSWVY+Q  +GKDI+MGDATEEE+K++KKMIIVAL
Sbjct  494   MLLMEMAGRRKNLNVFAEHSSQMYFPSWVYDQFSEGKDIEMGDATEEEQKLAKKMIIVAL  553

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             WCIQ+ PS+RPSM KV+  + E +VELL+M PKPFL+P EVP +++
Sbjct  554   WCIQLKPSDRPSMSKVV-EMLEGNVELLQMPPKPFLTPQEVPAEDH  598



>ref|XP_007206753.1| hypothetical protein PRUPE_ppa025186mg, partial [Prunus persica]
 gb|EMJ07952.1| hypothetical protein PRUPE_ppa025186mg, partial [Prunus persica]
Length=612

 Score =   502 bits (1293),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 245/354 (69%), Positives = 299/354 (84%), Gaps = 6/354 (2%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              +F++G  F+ ++++YK RRRHLS Y+ IE +L   NNLMPIRYSY +IK+M   FK KL
Sbjct  259   AKFTIGFPFVTALLIYKWRRRHLSMYENIEDFLQSNNNLMPIRYSYSDIKKMARGFKDKL  318

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKAT-GQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             GEGGYG+V+K  LRSG  VA+KM+GKSK   GQ+FI+EVATIGRI H NVVRLIGFCVEG
Sbjct  319   GEGGYGSVYKAKLRSGHLVAIKMLGKSKTNNGQDFINEVATIGRIRHVNVVRLIGFCVEG  378

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SKRALLY+FM NGSLEKYIF ++  +SLS  K+F+I+LGVARGIDYLH+GCDM+ILHFDI
Sbjct  379   SKRALLYDFMSNGSLEKYIFSQQGDVSLSCHKIFEIALGVARGIDYLHQGCDMQILHFDI  438

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILL+ENF+PKVSDFGLAKLYP+++S+VSLTAARGTMGY+APEL Y+NIGG+S+KAD
Sbjct  439   KPHNILLNENFTPKVSDFGLAKLYPLDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKAD  498

Query  733   VYSFGMLLMEMVGRRKNLNPFVE---QLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKV  900
             VYSFGMLLMEM GRRKNLN  +E   Q SQIYFP+WV +QLK GKDI++G DAT+EEKK+
Sbjct  499   VYSFGMLLMEMAGRRKNLNAGIEQSSQFSQIYFPTWVSDQLKAGKDIEIGDDATDEEKKI  558

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
              KKM++VALWCIQM P ERPSM KV+  + E ++E L+M P+PFL P ++P DE
Sbjct  559   IKKMMMVALWCIQMKPIERPSMNKVV-EMLEGEIETLQMPPRPFLYPQQIPADE  611



>ref|XP_009343242.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=389

 Score =   493 bits (1270),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 237/345 (69%), Positives = 289/345 (84%), Gaps = 2/345 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F  G   LI++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK KLG
Sbjct  13    KFLFGFPCLIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFKDKLG  71

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGG+G+V+K  LRSG  VA+KM+GKSKA GQ+FI+EVATIGRIHH NVV+L+GFCVEGSK
Sbjct  72    EGGFGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCVEGSK  131

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+Y+FMPNGS +K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHFDIKP
Sbjct  132   RALVYDFMPNGSFDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHFDIKP  191

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF PKVSDFGLA+L P+ +S+VSLTAARGT+GYMAPE  Y+NIGG+S+KADVY
Sbjct  192   HNILLDENFLPKVSDFGLARLCPLNNSIVSLTAARGTIGYMAPEFFYKNIGGVSYKADVY  251

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM G+RKNLN  +E  SQIYFP+WV+ QL  GKD+ +GDATEEEKK+ KKMI+
Sbjct  252   SFGMLLMEMAGKRKNLNANIEHSSQIYFPTWVFNQLSGGKDLTIGDATEEEKKIIKKMIV  311

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             VA WCIQM PS+RPSM KV+  + E ++E L+M PK FL P +VP
Sbjct  312   VASWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKLFLYPQQVP  355



>ref|XP_010645763.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Vitis vinifera]
Length=429

 Score =   494 bits (1272),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 251/365 (69%), Positives = 295/365 (81%), Gaps = 18/365 (5%)
 Frame = +1

Query  22    FSLGLLFLISIV---------------VYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYF  156
              S G +F+++IV               +YK RRR+LS Y  IE ++   NNL PIRYSY 
Sbjct  52    LSYGFVFIVAIVAVRTLFGSPCVVIFLIYKWRRRNLSMYHAIEEFIQAQNNLTPIRYSYS  111

Query  157   EIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHT  336
              IK+MT  F  KLGEGGYG+V+KG LRSG FVAVKMM  SKA GQ+FI+EVATIGRIHH 
Sbjct  112   NIKKMTKGFMEKLGEGGYGSVYKGKLRSGHFVAVKMMANSKANGQDFINEVATIGRIHHV  171

Query  337   NVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFP-KEESISL-SHEKMFDISLGVARGIDY  510
             NVV+LIGFC EGSKRAL+Y+FMPNGSL+KYIFP KE +ISL S EKM++ISLGVA GI+Y
Sbjct  172   NVVQLIGFCAEGSKRALVYDFMPNGSLDKYIFPEKEGNISLLSLEKMYEISLGVAYGIEY  231

Query  511   LHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPE  690
             LHRGCD +ILHFDIKPHNILLD+NF+PKVSDFGLAK YP + S+VSLTAARGT GYMAPE
Sbjct  232   LHRGCDTQILHFDIKPHNILLDKNFTPKVSDFGLAKSYPTDHSIVSLTAARGTRGYMAPE  291

Query  691   LCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDM  870
             L Y+NIGG+S+KADVYSFGMLLMEM GRRKNLN F E  SQIYFPSWVYEQ  +GKDI+M
Sbjct  292   LFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNVFAEHSSQIYFPSWVYEQFNEGKDIEM  351

Query  871   GDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
              DATEE K++SKK+IIVALWCIQ+ PS+RPSM KV+  + E +VELL+M PKP L+P EV
Sbjct  352   EDATEEGKELSKKLIIVALWCIQLKPSDRPSMNKVV-EMLEGNVELLQMPPKPLLTPQEV  410

Query  1051  PTDEN  1065
             P +++
Sbjct  411   PAEDH  415



>ref|XP_002268775.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Vitis 
vinifera]
Length=608

 Score =   500 bits (1288),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 246/350 (70%), Positives = 295/350 (84%), Gaps = 2/350 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R   G   ++  +VYK RRR+LS Y  IE ++   N LMPIRYSY  IK+MT  F  KLG
Sbjct  246   RTLFGTPCVLIFLVYKWRRRNLSMYQAIEEFIQTHNKLMPIRYSYSNIKKMTKGFNEKLG  305

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGGYG+V+KG LRSG  VAVK+M  SK+ GQ+FI+EVATIG+IHH NVV+L+GFCVEGSK
Sbjct  306   EGGYGSVYKGKLRSGHLVAVKLMTNSKSNGQDFINEVATIGKIHHVNVVQLLGFCVEGSK  365

Query  379   RALLYEFMPNGSLEKYIFP-KEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             RAL+Y+FMPNGSL+KYIFP KE +ISLS EKM+ ISLGVA GI+YLHRGCDM+ILHFDIK
Sbjct  366   RALVYDFMPNGSLDKYIFPEKEGNISLSFEKMYQISLGVAHGIEYLHRGCDMQILHFDIK  425

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLD+NF+PKVSDFGLAK YPV+ S+VSLTAARGTMGYMAPEL Y+NIGG+S+KADV
Sbjct  426   PHNILLDKNFTPKVSDFGLAKSYPVDHSIVSLTAARGTMGYMAPELFYKNIGGVSYKADV  485

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM GRRKNLN F E  SQIYFPSW Y+Q  +GK+I+MGDATEEE+ ++KKM+
Sbjct  486   YSFGMLLMEMAGRRKNLNVFAEHSSQIYFPSWAYDQFNEGKNIEMGDATEEERTLAKKMV  545

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             IVALWCIQ+ PS+RPSM+KVI  + E +V+LL+M PKP L+P EVPT+++
Sbjct  546   IVALWCIQLKPSDRPSMQKVI-EMLEGNVDLLQMPPKPSLTPQEVPTEDH  594



>ref|XP_007021958.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13483.1| PR5-like receptor kinase [Theobroma cacao]
Length=434

 Score =   493 bits (1270),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 243/369 (66%), Positives = 305/369 (83%), Gaps = 3/369 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             L R  LG+  LI++V++KLRRRHL+  D IE++L   NNLMPIRYSY E+KRMT +FK K
Sbjct  69    LARTLLGISGLIALVIHKLRRRHLAMDDMIENFLQSQNNLMPIRYSYSEVKRMTGDFKIK  128

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG+GGYG+VFKG LRSG  VA+K++ KSKA GQ+FI+EVATIGRIHH NVV+LIGFCVEG
Sbjct  129   LGQGGYGSVFKGKLRSGREVAIKLLSKSKANGQDFINEVATIGRIHHVNVVQLIGFCVEG  188

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SK+AL+Y+FM NGSL+K IF    + +LS EK+F+I+LGVARGIDYLHRGC+M+ILHFDI
Sbjct  189   SKQALVYDFMVNGSLDKIIFSTGNN-TLSWEKIFEIALGVARGIDYLHRGCEMQILHFDI  247

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHN+LLDENF PKVSDFGLAKLY V+D++VSLTAARGT+GY+APEL Y+NIGG+S+KAD
Sbjct  248   KPHNVLLDENFRPKVSDFGLAKLYSVDDNIVSLTAARGTLGYIAPELFYKNIGGVSYKAD  307

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGM+L+EMVGRRKNLNPF E  SQIYFPSW+Y+Q   G DI++GD TE E K+ KK+
Sbjct  308   VYSFGMMLIEMVGRRKNLNPFAEHSSQIYFPSWIYDQFDHGDDIELGDVTESENKIVKKI  367

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVE  1092
             +IVA WCIQ  P++RPSM KV+  + E ++EL EM PKPFL   E+ T +++  N+++ E
Sbjct  368   VIVAFWCIQTKPTDRPSMSKVL-KMLESELELPEMPPKPFLFTQEMSTKDHASKNSRD-E  425

Query  1093  SPLLSDNPV  1119
             +   S+N V
Sbjct  426   TTTDSENIV  434



>ref|XP_007029389.1| Receptor-like protein kinase [Theobroma cacao]
 gb|EOY09891.1| Receptor-like protein kinase [Theobroma cacao]
Length=599

 Score =   499 bits (1284),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 233/316 (74%), Positives = 275/316 (87%), Gaps = 0/316 (0%)
 Frame = +1

Query  31   GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
            GL  +I+ ++YK RRRHLS +D +E +L   NNL PI+YS+ EIK+MTN FK+KLGEGGY
Sbjct  264  GLPLVIAFLIYKWRRRHLSMFDMVEDFLQSQNNLTPIKYSFSEIKKMTNGFKNKLGEGGY  323

Query  211  GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
            G+V+KG LRSG  VAVK++GKSK  GQEFI+EVATIGRIHH NVV+LIGFC E SKRAL+
Sbjct  324  GSVYKGKLRSGCMVAVKILGKSKCNGQEFINEVATIGRIHHVNVVQLIGFCAERSKRALV  383

Query  391  YEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNIL  570
            YEFM NGSLEKYIF  E S SLS +KM++IS+GVARGI+YLH+GCDM+ILHFDIKPHNIL
Sbjct  384  YEFMANGSLEKYIFSNESSTSLSCKKMYEISIGVARGIEYLHKGCDMQILHFDIKPHNIL  443

Query  571  LDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGM  750
            LDENF+PKVSDFGLAKLYP+EDS+V  TAARGTMGYMAPEL Y+NIGGIS+KADVYSFGM
Sbjct  444  LDENFTPKVSDFGLAKLYPIEDSMVPQTAARGTMGYMAPELFYKNIGGISYKADVYSFGM  503

Query  751  LLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALW  930
            LLMEMVGRRKNLN F E  SQIYFPSWV++QL  GK+I++G+ T+EEK++ KKM+IV+LW
Sbjct  504  LLMEMVGRRKNLNAFAEHSSQIYFPSWVFDQLTLGKEIEIGEITDEEKEIVKKMVIVSLW  563

Query  931  CIQMNPSERPSMKKVI  978
            CIQM PS RPSM KV+
Sbjct  564  CIQMKPSNRPSMNKVV  579



>ref|XP_009343235.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=389

 Score =   489 bits (1260),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 236/349 (68%), Positives = 292/349 (84%), Gaps = 2/349 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + +F  G   LI++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK
Sbjct  9     FQVVKFLFGFPCLIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFK  67

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGG+G+V+K  LRSG  VA+KM+GKSKA GQ+FI+EVATIGRIHH NVV+L+GFCV
Sbjct  68    DKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCV  127

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y+FMPNGS +K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHF
Sbjct  128   EGSKRALVYDFMPNGSFDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHF  187

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF PKVSDFGLA+L P+++S+VSLTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  188   DIKPHNILLDENFLPKVSDFGLARLCPLDNSIVSLTAARGTIGYIAPELFYKNIGGVSYK  247

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM G+RKNLN  +E  SQIYFP+WV+ QL  G D+ +GDATEEEKK+ K
Sbjct  248   ADVYSFGMLLMEMAGKRKNLNANIEHSSQIYFPTWVFNQLSGGNDLPIGDATEEEKKIIK  307

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KMI+VA WCIQM PS+RPSM KV+  + E ++E L+M PK FL P +VP
Sbjct  308   KMIVVASWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKLFLYPQQVP  355



>ref|XP_008345477.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Malus domestica]
 ref|XP_008363209.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Malus domestica]
Length=440

 Score =   491 bits (1263),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 234/344 (68%), Positives = 287/344 (83%), Gaps = 2/344 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  G  F+I++++YK +RRHLS Y TIE +L    N +PIRYSY ++K+MT+ F  KLG
Sbjct  69    RFIFGAPFVIALLIYKWQRRHLSMYSTIEEFLQSEKNFVPIRYSYSDVKKMTSKFTEKLG  128

Query  199   EGGYGTVFKGTLRSGPFVAVKMMG-KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             EGGYG+VFKG LRSG FVA+K++G KSKA GQ+FISEVATIGRIHH NVV+L+G+CVEGS
Sbjct  129   EGGYGSVFKGKLRSGRFVAIKILGNKSKANGQDFISEVATIGRIHHVNVVQLVGYCVEGS  188

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             K  L+Y+FM NGSL+KYI+ K+ S+ LS EKM++I+LGVARGI+YLH+GCDM+ILHFDIK
Sbjct  189   KHGLVYDFMYNGSLDKYIYSKDGSVPLSCEKMYEIALGVARGIEYLHQGCDMQILHFDIK  248

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF PKVSDFGLAKLYP ++S+V+LTAARGTMGY+APEL Y+NIGG+S+KADV
Sbjct  249   PHNILLDENFVPKVSDFGLAKLYPTDNSIVTLTAARGTMGYIAPELFYKNIGGVSYKADV  308

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  ++KNLN F E  SQIYFP+WVY+Q  DGK+++MGD  EEEKK+ K M+
Sbjct  309   YSFGMLLMEMASKKKNLNAFAEHSSQIYFPTWVYDQYSDGKELEMGDVAEEEKKIIKNMV  368

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDE  1047
             I ALWCIQM PS+RPSMKKVI  + E D E  +M PKP L P +
Sbjct  369   ITALWCIQMKPSDRPSMKKVI-EMLEGDAESQQMPPKPLLFPQQ  411



>ref|XP_008345483.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Malus domestica]
 ref|XP_008363210.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Malus domestica]
Length=428

 Score =   490 bits (1261),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 234/344 (68%), Positives = 287/344 (83%), Gaps = 2/344 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF  G  F+I++++YK +RRHLS Y TIE +L    N +PIRYSY ++K+MT+ F  KLG
Sbjct  57    RFIFGAPFVIALLIYKWQRRHLSMYSTIEEFLQSEKNFVPIRYSYSDVKKMTSKFTEKLG  116

Query  199   EGGYGTVFKGTLRSGPFVAVKMMG-KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             EGGYG+VFKG LRSG FVA+K++G KSKA GQ+FISEVATIGRIHH NVV+L+G+CVEGS
Sbjct  117   EGGYGSVFKGKLRSGRFVAIKILGNKSKANGQDFISEVATIGRIHHVNVVQLVGYCVEGS  176

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             K  L+Y+FM NGSL+KYI+ K+ S+ LS EKM++I+LGVARGI+YLH+GCDM+ILHFDIK
Sbjct  177   KHGLVYDFMYNGSLDKYIYSKDGSVPLSCEKMYEIALGVARGIEYLHQGCDMQILHFDIK  236

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF PKVSDFGLAKLYP ++S+V+LTAARGTMGY+APEL Y+NIGG+S+KADV
Sbjct  237   PHNILLDENFVPKVSDFGLAKLYPTDNSIVTLTAARGTMGYIAPELFYKNIGGVSYKADV  296

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  ++KNLN F E  SQIYFP+WVY+Q  DGK+++MGD  EEEKK+ K M+
Sbjct  297   YSFGMLLMEMASKKKNLNAFAEHSSQIYFPTWVYDQYSDGKELEMGDVAEEEKKIIKNMV  356

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDE  1047
             I ALWCIQM PS+RPSMKKVI  + E D E  +M PKP L P +
Sbjct  357   ITALWCIQMKPSDRPSMKKVI-EMLEGDAESQQMPPKPLLFPQQ  399



>ref|XP_011037147.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Populus 
euphratica]
Length=423

 Score =   489 bits (1258),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 234/340 (69%), Positives = 287/340 (84%), Gaps = 2/340 (1%)
 Frame = +1

Query  43    LISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVF  222
             +I  ++YK RRRHLS YDT+E +L G NNLMP+RYSY +I+++T  FK KLGEGG+GTV+
Sbjct  62    VIVFLIYKWRRRHLSVYDTVEQFLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGFGTVY  121

Query  223   KGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFM  402
             KG LRSG F AVK++GKSKA GQ+FI+EVATIGRIHHTNVVRLIGFC EGSKRAL+Y+FM
Sbjct  122   KGKLRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHTNVVRLIGFCAEGSKRALVYDFM  181

Query  403   PNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDEN  582
             PNGSL++++F +E SISLS +K+  ISLGVARGIDYLH GCDM+ILHFDIKPHNILLDEN
Sbjct  182   PNGSLDRHLFSREGSISLSWQKLHQISLGVARGIDYLHLGCDMQILHFDIKPHNILLDEN  241

Query  583   FSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLME  762
             F+PKVSDFGLA+LYP   S+ SLTAARGT+GYMAPEL Y+NIG +S+KADVYSFGMLL+E
Sbjct  242   FTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLLLE  301

Query  763   MVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMIIVALWCIQ  939
             M G+RKN+N   E  SQIY+P WV++Q+ DGK I++G DATEEE K+ KKMI+V LWCIQ
Sbjct  302   MAGKRKNVNALAENSSQIYWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWCIQ  361

Query  940   MNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             M P +RP+MK V+  + E D+E L++ PKP L+ DE PT+
Sbjct  362   MKPMDRPTMKNVV-EMLEGDLENLQLPPKPVLNLDETPTN  400



>ref|XP_002324016.2| hypothetical protein POPTR_0017s04140g [Populus trichocarpa]
 gb|EEF04149.2| hypothetical protein POPTR_0017s04140g [Populus trichocarpa]
Length=368

 Score =   486 bits (1250),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 237/354 (67%), Positives = 294/354 (83%), Gaps = 3/354 (1%)
 Frame = +1

Query  52    IVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKG  228
             ++VYK RR+HLS Y+ IE +L S  N+LMPIRY+Y EIK++TN FK KLGEGG+G+V+KG
Sbjct  2     LLVYKWRRQHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITNGFKDKLGEGGFGSVYKG  61

Query  229   TLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPN  408
              LRSG   AVK++GKSKA GQ+FI+EVATIGRIHH N+V+LIG+ VEGSKRAL+YEFMPN
Sbjct  62    KLRSGRLAAVKLLGKSKANGQDFINEVATIGRIHHVNIVQLIGYTVEGSKRALIYEFMPN  121

Query  409   GSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFS  588
             GSLEKYIF ++  I LS+EKM++ISLGVARGI+YLH+GCDM+ILHFDIKPHNILL++ F 
Sbjct  122   GSLEKYIFSRQGCIPLSNEKMYEISLGVARGIEYLHQGCDMQILHFDIKPHNILLNDKFV  181

Query  589   PKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMV  768
             PK+SDFGLAKLYP  ++ VSLTAARGTMGYMAPELCY+NIGG+S+KADVYS+GMLLMEMV
Sbjct  182   PKISDFGLAKLYPTNNNTVSLTAARGTMGYMAPELCYKNIGGVSYKADVYSYGMLLMEMV  241

Query  769   GRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMIIVALWCIQMN  945
             GRRKNLN      SQIYFPSWVY+Q+ +GKDI++  D  E EKK +KKMIIVALWCIQ+ 
Sbjct  242   GRRKNLNASASHSSQIYFPSWVYDQVNEGKDIEVQEDVMEHEKKTTKKMIIVALWCIQLK  301

Query  946   PSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVESPLLS  1107
             P +RPSM KV+  + E D+E L M PKPFL+P ++  D++   +++  +  L S
Sbjct  302   PVDRPSMHKVV-EMLESDIESLRMPPKPFLTPHQISKDDDRANHSKLAKETLQS  354



>ref|XP_009341644.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=428

 Score =   488 bits (1256),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 234/349 (67%), Positives = 291/349 (83%), Gaps = 2/349 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + +F  G   +I++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK
Sbjct  35    FQVVKFLFGFPCVIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFK  93

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGG+G+V+K  LRSG  VA+KM+GKSKA GQ+FI+EVATIGRIHH NVV+L+GFCV
Sbjct  94    DKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCV  153

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y+FMPNGSL K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHF
Sbjct  154   EGSKRALVYDFMPNGSLNKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHF  213

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF PKVSDFGLA+L P+++S+VSLTA RGT+GY+APE  Y+NIGG+S+K
Sbjct  214   DIKPHNILLDENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPEFFYKNIGGVSYK  273

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM G+RKNLN  +E  SQIYFP+WV++QL  G D+ +GDATEEEKK+ K
Sbjct  274   ADVYSFGMLLMEMAGKRKNLNANIEHSSQIYFPTWVFDQLSGGNDLTIGDATEEEKKIIK  333

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KMI+VA WCIQM PS+RPSM KV+  + E ++E L+M PK FL P +VP
Sbjct  334   KMIVVASWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKLFLYPQQVP  381



>ref|XP_010645762.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Vitis vinifera]
Length=628

 Score =   495 bits (1274),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 251/365 (69%), Positives = 295/365 (81%), Gaps = 18/365 (5%)
 Frame = +1

Query  22    FSLGLLFLISIV---------------VYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYF  156
              S G +F+++IV               +YK RRR+LS Y  IE ++   NNL PIRYSY 
Sbjct  251   LSYGFVFIVAIVAVRTLFGSPCVVIFLIYKWRRRNLSMYHAIEEFIQAQNNLTPIRYSYS  310

Query  157   EIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHT  336
              IK+MT  F  KLGEGGYG+V+KG LRSG FVAVKMM  SKA GQ+FI+EVATIGRIHH 
Sbjct  311   NIKKMTKGFMEKLGEGGYGSVYKGKLRSGHFVAVKMMANSKANGQDFINEVATIGRIHHV  370

Query  337   NVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFP-KEESISL-SHEKMFDISLGVARGIDY  510
             NVV+LIGFC EGSKRAL+Y+FMPNGSL+KYIFP KE +ISL S EKM++ISLGVA GI+Y
Sbjct  371   NVVQLIGFCAEGSKRALVYDFMPNGSLDKYIFPEKEGNISLLSLEKMYEISLGVAYGIEY  430

Query  511   LHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPE  690
             LHRGCD +ILHFDIKPHNILLD+NF+PKVSDFGLAK YP + S+VSLTAARGT GYMAPE
Sbjct  431   LHRGCDTQILHFDIKPHNILLDKNFTPKVSDFGLAKSYPTDHSIVSLTAARGTRGYMAPE  490

Query  691   LCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDM  870
             L Y+NIGG+S+KADVYSFGMLLMEM GRRKNLN F E  SQIYFPSWVYEQ  +GKDI+M
Sbjct  491   LFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNVFAEHSSQIYFPSWVYEQFNEGKDIEM  550

Query  871   GDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
              DATEE K++SKK+IIVALWCIQ+ PS+RPSM KV+  + E +VELL+M PKP L+P EV
Sbjct  551   EDATEEGKELSKKLIIVALWCIQLKPSDRPSMNKVV-EMLEGNVELLQMPPKPLLTPQEV  609

Query  1051  PTDEN  1065
             P +++
Sbjct  610   PAEDH  614



>ref|XP_004306204.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=671

 Score =   496 bits (1276),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/360 (67%), Positives = 297/360 (83%), Gaps = 6/360 (2%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + +   +   G  F+I++++YK RRRHLS Y+ IE +L   NNLMP+RYSY +IK+M   
Sbjct  297   VLFQAAKLLFGSPFVIALLIYKCRRRHLSMYENIEDFLQSNNNLMPVRYSYADIKKMARG  356

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLG GGYGTV+K  LRSG  VA+KM+GK +A GQEFI+EVATIGRIHH NVV+LIGF
Sbjct  357   FKDKLGAGGYGTVYKAKLRSGHLVAIKMLGKFRANGQEFINEVATIGRIHHVNVVQLIGF  416

Query  361   CVEGSKRALLYEFMPNGSLEKYIF--PKEESISLSHEKMFDISLGVARGIDYLHRGCDMR  534
             CV+GS RAL+YEFMPNGSLEKYIF  P  E I LS EK+F+I+LGVARGIDYLHRGCDM+
Sbjct  417   CVDGSNRALIYEFMPNGSLEKYIFSQPGPEVIFLSCEKIFEIALGVARGIDYLHRGCDMQ  476

Query  535   ILHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGG  714
             ILHFDIKPHNILLDENF+PKVSDFGLA+L P+++S+V +TAARGT+GY+APEL Y+NIGG
Sbjct  477   ILHFDIKPHNILLDENFTPKVSDFGLARLNPLDNSMVPMTAARGTIGYIAPELFYKNIGG  536

Query  715   ISHKADVYSFGMLLMEMVGRRKNLNPFVE---QLSQIYFPSWVYEQLKDGKDIDMGDATE  885
             IS+KADVYSFGMLLMEM GRRKNL+  VE   + SQ+YFP+WV +QL +GK I++GDATE
Sbjct  537   ISYKADVYSFGMLLMEMAGRRKNLDSTVEDSSECSQMYFPTWVSDQLTEGKHIEIGDATE  596

Query  886   EEKKVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             EE K+++KMIIVALWCIQM PSERPSM +V+  + E  +E L M PKPFL P ++P+D++
Sbjct  597   EEMKITRKMIIVALWCIQMKPSERPSMNEVV-EMLEGKIESLAMPPKPFLYPQQIPSDKD  655



>ref|XP_004498416.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Cicer arietinum]
Length=707

 Score =   497 bits (1279),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 297/368 (81%), Gaps = 1/368 (0%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
             S+   RF LG    I++++YK R+RHLS Y+ IE YL   NN+MPIRYSY EIK M   F
Sbjct  324   SFVASRFLLGTTLFIALLIYKWRKRHLSMYEYIEIYLQQQNNMMPIRYSYKEIKNMARGF  383

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K KLGEGG+GTVFKG LRSGP +A+KM+GKSK  GQ+FISEV+TIGRIHH NVV+LIGFC
Sbjct  384   KVKLGEGGFGTVFKGNLRSGPSIAIKMLGKSKGNGQDFISEVSTIGRIHHLNVVQLIGFC  443

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
              EGSKRAL+YEFM NGSL+KYIF KE SI +S++++F+IS+GVARGI YLH GC+M+ILH
Sbjct  444   AEGSKRALVYEFMSNGSLDKYIFSKEGSIDISYDRIFEISVGVARGIAYLHHGCEMKILH  503

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDENF+PKVSDFGLAKL+P+E+S+V++TAARGT+GYMAPEL Y+NIGG+S+
Sbjct  504   FDIKPHNILLDENFTPKVSDFGLAKLHPIENSIVTMTAARGTIGYMAPELFYKNIGGVSY  563

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVS  903
             KADVYSFGMLLMEM  +R+NLNP VE  SQ+YFP W+Y+QL   +DI+M D TEEEKK+ 
Sbjct  564   KADVYSFGMLLMEMASKRRNLNPRVEHSSQLYFPLWIYDQLGKEQDIEMEDTTEEEKKIV  623

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQ  1083
             KKMIIVALWCIQ+ P +RPSM KV+  + E DVE LEM PKP L P E  +++      Q
Sbjct  624   KKMIIVALWCIQLKPDDRPSMSKVL-EMLEGDVENLEMPPKPILYPHETISNDQGTNFNQ  682

Query  1084  NVESPLLS  1107
              + S   S
Sbjct  683   TMSSDWTS  690



>ref|XP_009348963.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=430

 Score =   487 bits (1253),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 234/349 (67%), Positives = 292/349 (84%), Gaps = 2/349 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + +F  G   LI++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK
Sbjct  50    FQVVKFLFGFPCLIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFK  108

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGG+G+V+K  LRSG  VA+KM+G+SKA GQ+FI+EVATIGRIHH NVV+L+GFCV
Sbjct  109   DKLGEGGFGSVYKAKLRSGRLVAIKMLGRSKANGQDFINEVATIGRIHHVNVVQLVGFCV  168

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGS+RAL+Y+FMPNGSL+K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHF
Sbjct  169   EGSERALVYDFMPNGSLDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHF  228

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF PKVSDFGLA+L P+++S+VSLTA RGT+GY+APEL Y+NIGG+S+K
Sbjct  229   DIKPHNILLDENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPELFYKNIGGVSYK  288

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM G+RKNLN  +E  SQIYFP+WV+ QL  G D+ +GDATEEEKK+ K
Sbjct  289   ADVYSFGMLLMEMAGKRKNLNANIEHSSQIYFPTWVFNQLSGGNDLAIGDATEEEKKIIK  348

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KMI+VA WCIQM PS+RPSM KV+  + E ++E L+M PK FL P +VP
Sbjct  349   KMIVVASWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKLFLYPQQVP  396



>ref|XP_004498409.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Cicer arietinum]
Length=674

 Score =   495 bits (1275),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 243/342 (71%), Positives = 292/342 (85%), Gaps = 2/342 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             GLLF+   ++YK RRRHLSAYD++E +L   NNLMPIRYSY +IK++T  FK KLGEGGY
Sbjct  305   GLLFVPMYMIYKWRRRHLSAYDSVEEFLKTHNNLMPIRYSYSDIKKITKGFKDKLGEGGY  364

Query  211   GTVFKGTLRSGPFVAVKMMG-KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             G+V+KG LR+G  VA+KM+G KS+A GQEFI+EVATIG IHH NVV LIGFCVE SKRAL
Sbjct  365   GSVYKGQLRNGHLVAIKMLGGKSRANGQEFINEVATIGTIHHVNVVHLIGFCVEKSKRAL  424

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF +E+ + LS EKMFDI+LGVA GI+YLHRGCDMRILHFDIKPHNI
Sbjct  425   VYEFMPNGSLDKHIFSREKMVPLSCEKMFDIALGVAHGIEYLHRGCDMRILHFDIKPHNI  484

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLD NF+PKVSDFGLAKLYP+++S+VSLTAARGTMGYMAPEL Y+NIGG+S+KADVYSFG
Sbjct  485   LLDVNFTPKVSDFGLAKLYPIDNSIVSLTAARGTMGYMAPELFYKNIGGVSYKADVYSFG  544

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM  RR+N+N   +  SQ+YFPSWVY+Q  +G++I+MG+ TEEE+K+ KKMIIVAL
Sbjct  545   MLLMEMASRRRNMNEGEDHKSQVYFPSWVYDQFSEGREIEMGNGTEEEEKLLKKMIIVAL  604

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             WCIQM PS+RPSM KV+  L E DVE L+M PKPF +P  +P
Sbjct  605   WCIQMKPSDRPSMNKVV-ELLEGDVESLQMPPKPFQTPKGMP  645



>ref|XP_004305475.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=671

 Score =   495 bits (1274),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 237/349 (68%), Positives = 293/349 (84%), Gaps = 4/349 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              +  +G+  L ++++YK RRRHLS YD IE +L   NNLMP+RYSY +IK+MT +FK KL
Sbjct  299   AKLVIGIPCLTALLIYKWRRRHLSMYDDIEDFLRTNNNLMPVRYSYSDIKKMTRDFKEKL  358

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             G+GGYGTV+K TLRSG  VA+KM+GKS+A GQ+FI+EVATIGRIHH NVV+LIGFCVEGS
Sbjct  359   GQGGYGTVYKATLRSGRLVAIKMLGKSQANGQDFINEVATIGRIHHVNVVQLIGFCVEGS  418

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
              RAL+Y+FMPNGSL+KYIF  +   +LS +K+F+I+L VARGIDYLHRGCDM+ILHFDIK
Sbjct  419   TRALVYDFMPNGSLDKYIFLPQGVSTLSFKKIFEIALRVARGIDYLHRGCDMQILHFDIK  478

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PKVSDFGLA+LYP+++S+VSLTA RGT+GY+APEL Y+NIGG+S+KADV
Sbjct  479   PHNILLDENFTPKVSDFGLARLYPLDNSIVSLTAVRGTIGYIAPELFYKNIGGVSYKADV  538

Query  736   YSFGMLLMEMVGRRKNLNPFVE---QLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             YSFGMLLMEM GRRKNLN  +E   Q S+ YFPSWV  QL +GKDI++ DATE+E K+ K
Sbjct  539   YSFGMLLMEMAGRRKNLNAGIEYSSQFSENYFPSWVSNQLNEGKDIEIEDATEDEMKIIK  598

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KMI+VA+WCIQM PSERPSM KV+  + E ++E L++ PKPFL P E P
Sbjct  599   KMIVVAMWCIQMKPSERPSMTKVV-EMLEGELESLQIPPKPFLYPQEFP  646



>ref|XP_007022122.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13647.1| PR5-like receptor kinase [Theobroma cacao]
Length=633

 Score =   493 bits (1270),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 246/363 (68%), Positives = 295/363 (81%), Gaps = 2/363 (1%)
 Frame = +1

Query  34    LLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYG  213
             L   +++V YK RRRHLS  DTIE +L   N+LMPIRYSY EIKRMT +F+ KLGEGGYG
Sbjct  267   LCLGVTVVTYKWRRRHLSVDDTIEEFLQSQNDLMPIRYSYREIKRMTRSFRDKLGEGGYG  326

Query  214   TVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLY  393
             +VFKG LRSG FVA+K++G SKA GQ+FI+EVAT+GRIHH NV +LIGFCVEGSK+AL+Y
Sbjct  327   SVFKGKLRSGHFVAIKLLGTSKADGQDFINEVATMGRIHHVNVAKLIGFCVEGSKQALVY  386

Query  394   EFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILL  573
             +FMPNGSL+K IF +E    LS +KMFDI+LGVARGI+YLH+GCDM+ILHFDIKPHNILL
Sbjct  387   DFMPNGSLDKIIFAEENKTILSWQKMFDIALGVARGIEYLHQGCDMQILHFDIKPHNILL  446

Query  574   DENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGML  753
             DENF PKVSDFGLAKLY V DS+VSLTAARGT+GY+APEL Y+NIG IS+KADVYSFGML
Sbjct  447   DENFIPKVSDFGLAKLYSVADSIVSLTAARGTIGYIAPELVYKNIGAISYKADVYSFGML  506

Query  754   LMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWC  933
             LMEMVGRRKNLN F E LSQIYFPSW+Y +   G+D D+G+ T+ EK + KKMII A WC
Sbjct  507   LMEMVGRRKNLNAFAEHLSQIYFPSWIYGRFHQGEDFDLGEVTDGEKVIVKKMIITACWC  566

Query  934   IQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN-AQNVESPLLSD  1110
             IQ+ P++RPSM KV+  + E DVELL+M PKPF  P EV T ++   N +++  S L S 
Sbjct  567   IQVTPNDRPSMGKVL-QMLETDVELLQMPPKPFQLPFEVSTKDHVDDNPSKDPTSSLFSS  625

Query  1111  NPV  1119
             N +
Sbjct  626   NAI  628



>ref|XP_002267821.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=632

 Score =   493 bits (1270),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 240/347 (69%), Positives = 293/347 (84%), Gaps = 2/347 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             L + F++  ++YK RRR+LS Y  IE ++   NNLMPIRYSY  IK+MT  F  KLGEGG
Sbjct  273   LAIPFVLIFLIYKWRRRNLSMYAAIEEFIQTHNNLMPIRYSYSNIKKMTKGFSEKLGEGG  332

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+V+KG LRSG  VAVK+M  SKA GQ+FI+EVATIGRIHH NVV+LIGFC E SKRAL
Sbjct  333   YGSVYKGKLRSGHLVAVKVMNISKANGQDFINEVATIGRIHHVNVVQLIGFCAEESKRAL  392

Query  388   LYEFMPNGSLEKYIFPKEES-ISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHN  564
             +Y+FMPNGSL+KYIFP++E  ISLS+ KM++ISLGVA GI+YLHRGCD++ILHFDIKPHN
Sbjct  393   VYDFMPNGSLDKYIFPQQEDRISLSYRKMYEISLGVAHGIEYLHRGCDIQILHFDIKPHN  452

Query  565   ILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSF  744
             ILLD+NF+PK+SDFGLAK YP + + VSLTAARGTMGYMAPEL Y+NIGG+S+KADVYS+
Sbjct  453   ILLDQNFTPKISDFGLAKSYPTDHNTVSLTAARGTMGYMAPELFYKNIGGVSYKADVYSY  512

Query  745   GMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVA  924
             GMLLMEM  RRKNLN F E LSQIYFP+WVY+QL +GKDI+M D +EEE+K++KKMI VA
Sbjct  513   GMLLMEMASRRKNLNVFAESLSQIYFPTWVYDQLTEGKDIEMEDTSEEEQKLAKKMITVA  572

Query  925   LWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             LWCIQ+ PS+RPSM KV+  + EE+VELL+M PKPFL+P EV  +++
Sbjct  573   LWCIQLKPSDRPSMNKVV-EMLEENVELLQMPPKPFLTPREVLAEDD  618



>ref|XP_008245471.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=400

 Score =   485 bits (1248),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 237/354 (67%), Positives = 294/354 (83%), Gaps = 3/354 (1%)
 Frame = +1

Query  1     ISYALG-RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTN  177
             I+ ALG R  LG L LI +++YK +RRHLS Y  IE +L   NNLMPIRYSY +I++MT 
Sbjct  14    IASALGIRAILGALCLIVLLIYKFKRRHLSMYGLIEEFLQSHNNLMPIRYSYSDIRKMTK  73

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGGYG+V+KG LRSG  VA+KM+GKS   GQ+FI+EVATIGRIHH +VV+LIG
Sbjct  74    GFKEKLGEGGYGSVYKGKLRSGRLVAIKMLGKSNTNGQDFINEVATIGRIHHVHVVQLIG  133

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             +CVEGSKRAL+YEFM NGSL+K+IF KE   SL+++K F+ISLGVARGIDYLH+GC+M+I
Sbjct  134   YCVEGSKRALVYEFMTNGSLDKHIFRKEGPSSLNYKKSFEISLGVARGIDYLHQGCEMQI  193

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
              HFDIKPHNILL+E+F PK+SDFGLA+L P+++S ++LTAARGT+GY+APEL Y+NIGG+
Sbjct  194   FHFDIKPHNILLNEDFVPKISDFGLARLCPLDESSLTLTAARGTIGYIAPELFYKNIGGV  253

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
             S+KAD+YSFGMLLME+ G+RKNLN      SQIYFPSWVY+Q  +GKDIDM DATEEE K
Sbjct  254   SNKADIYSFGMLLMEIAGKRKNLNAIAAHSSQIYFPSWVYDQFNEGKDIDMEDATEEEMK  313

Query  898   VSKKMIIVALWCIQMNPSERP-SMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             ++KKM+IVALWCIQM PSERP SM KV+  + E ++E L+M+PKPFL P + P 
Sbjct  314   ITKKMLIVALWCIQMKPSERPNSMGKVV-EMLEGEIESLQMSPKPFLYPQDKPV  366



>gb|KEH40396.1| stress-induced receptor-like kinase, putative [Medicago truncatula]
Length=655

 Score =   494 bits (1272),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 245/342 (72%), Positives = 288/342 (84%), Gaps = 2/342 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             GLLF+   + YK RRRHLSAYD++E +L   NNLMPIRYSY +IK+MT  FK KLGEGGY
Sbjct  286   GLLFIPMYMAYKWRRRHLSAYDSVEEFLKSHNNLMPIRYSYSDIKKMTKGFKDKLGEGGY  345

Query  211   GTVFKGTLRSGPFVAVKMMG-KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             G+V+KG LR+G  VA+K++G KS+A GQEFI+EVATIG IHH NVV LIGFCVE +KRAL
Sbjct  346   GSVYKGQLRNGHLVAIKLLGGKSRANGQEFINEVATIGTIHHVNVVHLIGFCVEKTKRAL  405

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSLEK+IF +E   SLS EKMFDI+LGVARGI+YLHRGCDMRILHFDIKPHNI
Sbjct  406   VYEFMPNGSLEKHIFSRERMGSLSSEKMFDIALGVARGIEYLHRGCDMRILHFDIKPHNI  465

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLD NF+PKVSDF LAKLYP ++S+VSLTAARGTMGYMAPEL Y+NIGG+S+KADVYSFG
Sbjct  466   LLDVNFTPKVSDFRLAKLYPTDNSIVSLTAARGTMGYMAPELFYKNIGGVSYKADVYSFG  525

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM  RR+N+N   +  SQ+YFPSWVY+Q  +GK+I+MG+ TEEE+K+ KKMIIVAL
Sbjct  526   MLLMEMASRRRNMNESEDHKSQVYFPSWVYDQFSEGKEIEMGNGTEEEEKILKKMIIVAL  585

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             WCIQM P +RPSM KV+  L E DVE LEM PKPF +P  +P
Sbjct  586   WCIQMKPIDRPSMNKVV-ELLEGDVESLEMPPKPFQTPKGMP  626



>ref|XP_006372700.1| hypothetical protein POPTR_0017s04100g [Populus trichocarpa]
 gb|ERP50497.1| hypothetical protein POPTR_0017s04100g [Populus trichocarpa]
Length=360

 Score =   483 bits (1243),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 239/349 (68%), Positives = 290/349 (83%), Gaps = 3/349 (1%)
 Frame = +1

Query  58    VYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTL  234
             +YK RRRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN FK KLGEGG+G+V+KG L
Sbjct  1     MYKWRRRHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITNGFKDKLGEGGFGSVYKGKL  60

Query  235   RSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGS  414
             RSG F AVK++GKSKA GQ+FI+EVATIGRIHH NVV+LIGF VEG KRAL+YEFMPNGS
Sbjct  61    RSGRFAAVKLLGKSKANGQDFINEVATIGRIHHVNVVQLIGFTVEGLKRALIYEFMPNGS  120

Query  415   LEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPK  594
             LEKYIF +E S+ LS+EKM++ISLGVARGI+YLH+GCDM+ILHFDI+PHNILL++ F PK
Sbjct  121   LEKYIFSREGSVPLSNEKMYEISLGVARGIEYLHQGCDMQILHFDIRPHNILLNDKFVPK  180

Query  595   VSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGR  774
             +SDFGLAKLYP  ++ V LTAARGTMGYMAPELCY+NIGG+S+KADVYS+GMLLMEM GR
Sbjct  181   ISDFGLAKLYPTNNNTVPLTAARGTMGYMAPELCYKNIGGVSYKADVYSYGMLLMEMAGR  240

Query  775   RKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMIIVALWCIQMNPS  951
             RKNLN F    SQIYFPSWVY+Q+ +GKDI++  DA + E K +KKMIIVALWCIQ  P 
Sbjct  241   RKNLNAFANHSSQIYFPSWVYDQVSEGKDIEVQEDAMKHEMKTTKKMIIVALWCIQWKPV  300

Query  952   ERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVESP  1098
             +RPSM KV+  + E DVE L M PKPFLSP ++P +++   +A+    P
Sbjct  301   DRPSMHKVV-EMLESDVESLRMPPKPFLSPHQMPEEDDRANHAKLSNPP  348



>ref|XP_008231576.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=399

 Score =   484 bits (1246),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 238/380 (63%), Positives = 297/380 (78%), Gaps = 2/380 (1%)
 Frame = +1

Query  1     ISYALG-RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTN  177
             I+ ALG R  LG L LI +++YK +RRHLS Y  IE +L   NNLMPIRYSY +I++MT 
Sbjct  14    IASALGIRAILGALCLIVLLIYKFKRRHLSMYGLIEEFLQSHNNLMPIRYSYSDIRKMTK  73

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGGYG+V+KG LRSG  VA+KM+GKS   GQ+FI+EVATIGRIHH +VV+LIG
Sbjct  74    GFKEKLGEGGYGSVYKGKLRSGRLVAIKMLGKSNTNGQDFINEVATIGRIHHVHVVQLIG  133

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             +CVEGSKRAL+YEFM NGSL+K+IF KE   SL+++K F+ISLGVARGIDYLH+GC+M+I
Sbjct  134   YCVEGSKRALVYEFMTNGSLDKHIFRKEGPSSLNYKKSFEISLGVARGIDYLHQGCEMQI  193

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
              HFDIKPHNILL+E+F PK+SDFGLA+L P+++S ++LTAARGT+GY+APEL Y+NIGG+
Sbjct  194   FHFDIKPHNILLNEDFVPKISDFGLARLCPLDESSLTLTAARGTIGYIAPELFYKNIGGV  253

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
             S KAD+YSFGMLLME+ G+RKNLN      SQ+YFPSWVY+Q  +GKDIDM DATEEE K
Sbjct  254   SSKADIYSFGMLLMEIAGKRKNLNAVAAHSSQVYFPSWVYDQFNEGKDIDMEDATEEEMK  313

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP-TDENSFP  1074
             ++KKM+IVALWCIQM PSERP+    +  + E + E L+M PKPFL P + P  D+   P
Sbjct  314   ITKKMLIVALWCIQMKPSERPTSMSKVVQMLEGETEALQMPPKPFLYPQDKPVVDDEDNP  373

Query  1075  NAQNVESPLLSDNPVRSSSF  1134
                   S   +D+   S S 
Sbjct  374   ETTWPSSTQSNDDSEDSISL  393



>ref|XP_002323918.2| hypothetical protein POPTR_0017s04200g [Populus trichocarpa]
 gb|EEF04051.2| hypothetical protein POPTR_0017s04200g [Populus trichocarpa]
Length=641

 Score =   493 bits (1268),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 246/374 (66%), Positives = 306/374 (82%), Gaps = 7/374 (2%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             F  GL  L+++++YK RRRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN FK KLG
Sbjct  270   FPCGLPCLLTLLIYKWRRRHLSIYEDIEKFLQSHDNDLMPIRYTYLEIKKITNGFKDKLG  329

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGG+G+V+KG LRSG F AVK++GKSKA GQ+FI+EVATIGRIHH NVV+LIG+ VEGSK
Sbjct  330   EGGFGSVYKGKLRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHVNVVQLIGYTVEGSK  389

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFMPNGSLEKYIF +E S+ LS+EKM++ISL VARGI+YLH+GCDM+ILHFDIKP
Sbjct  390   RALIYEFMPNGSLEKYIFSREGSVPLSNEKMYEISLRVARGIEYLHQGCDMQILHFDIKP  449

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDE F PK+SDFGLAKLYP  ++ V LTAARGT+GYMAPEL Y+NIGG+S+KADVY
Sbjct  450   HNILLDEKFVPKISDFGLAKLYPTSNNTVPLTAARGTIGYMAPELFYKNIGGVSYKADVY  509

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMI  915
             S+GMLLMEM+G+RKNLN F    SQIYFPSWVY+Q+ +GKDI++  DA E EKK +KKMI
Sbjct  510   SYGMLLMEMIGKRKNLNAFANHSSQIYFPSWVYDQVSEGKDIEVQEDAMEHEKKTTKKMI  569

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             IVALWCIQ+ P +RPSM KVI  + E DVE L+M PKPF +P ++P +++   +A+  + 
Sbjct  570   IVALWCIQLKPVDRPSMHKVI-EMLESDVESLQMPPKPFFTPHQMPEEDDRANHAKLSDP  628

Query  1096  PLLSDNPVRSSSFE  1137
             P    N    SS++
Sbjct  629   P----NNCTDSSYQ  638



>ref|XP_008232188.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=697

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 240/344 (70%), Positives = 290/344 (84%), Gaps = 2/344 (1%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGE  201
             +  G    I+ ++YK +RRHLS +D IE +L   N LMP+RYSY  IK+M   FK KLGE
Sbjct  235   YVFGFPCAIAFIIYKWKRRHLSMHDNIEDFLQN-NKLMPVRYSYSNIKKMAKGFKEKLGE  293

Query  202   GGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKR  381
             GGYG+V+K  LRSG  VA+KM+GKSKA GQ+FI+EVATIGRIHH NVVRLIGFCVEGS R
Sbjct  294   GGYGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVRLIGFCVEGSTR  353

Query  382   ALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPH  561
             AL+Y+FMPNGSL+KY+F ++  ISL+ EKMF+I+LGVARGI+YLHRGCDM+ILHFDIKPH
Sbjct  354   ALIYDFMPNGSLDKYLFSQQGVISLNCEKMFEIALGVARGIEYLHRGCDMQILHFDIKPH  413

Query  562   NILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYS  741
             NILLDENF PKVSDFGLA+L P+++S+VSLTAARGT+GY+APEL Y+NIGGIS+KADVYS
Sbjct  414   NILLDENFLPKVSDFGLARLCPLDNSIVSLTAARGTIGYIAPELFYKNIGGISYKADVYS  473

Query  742   FGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIV  921
             FGMLLMEM GRRKNLN  +E+ SQIYFP+WV++QL DGKDI + DATEEE+K+ KKMIIV
Sbjct  474   FGMLLMEMAGRRKNLNATIEKSSQIYFPTWVFDQLSDGKDIKVEDATEEEEKIIKKMIIV  533

Query  922   ALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             ALWCIQM PS+RPSM K +  + E ++E LEM PKPFL P ++P
Sbjct  534   ALWCIQMKPSDRPSMNKAV-EMLEGEIECLEMPPKPFLYPQQMP  576



>ref|XP_007022133.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13658.1| PR5-like receptor kinase [Theobroma cacao]
Length=674

 Score =   494 bits (1271),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/364 (67%), Positives = 303/364 (83%), Gaps = 2/364 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             G+  LI++V YK RRRHLS  DTIE +L   N+L+PIRYSY EIKRMT +F+ KLGEGGY
Sbjct  307   GICCLIALVTYKWRRRHLSMDDTIEEFLQSQNDLIPIRYSYREIKRMTRSFRDKLGEGGY  366

Query  211   GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
             G+VFKG LRSG  VA+K++GKSKA GQ+FI+EVATIGRIHH NV +LIGFCVEGSK+AL+
Sbjct  367   GSVFKGKLRSGHLVAIKLLGKSKANGQDFINEVATIGRIHHVNVAKLIGFCVEGSKQALV  426

Query  391   YEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNIL  570
             Y+FM NGSL++ IF +E  I+L+ +KMFDI+LGVARGI+YLH+GCDM+ILHFDIKPHNIL
Sbjct  427   YDFMSNGSLDRIIFAEENKITLNWQKMFDIALGVARGIEYLHQGCDMQILHFDIKPHNIL  486

Query  571   LDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGM  750
             LDENF PKVSDFGLAKLY V+DS+VSLTAARGT+GY+APEL Y+NIGGIS+KADVYSFGM
Sbjct  487   LDENFVPKVSDFGLAKLYSVDDSIVSLTAARGTIGYIAPELVYKNIGGISNKADVYSFGM  546

Query  751   LLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALW  930
             LLMEMVG+RKNLN F + LSQIYFPSW+Y QL   +DI++G+ T+ EK + +KMII A W
Sbjct  547   LLMEMVGKRKNLNAFADHLSQIYFPSWIYGQLHQEEDIELGEVTDGEKIIVRKMIITACW  606

Query  931   CIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN-AQNVESPLLS  1107
             CIQ+ P++RPSM KV+  + E DVELL+M PKPF  P EV  ++++  N +++  S LLS
Sbjct  607   CIQLPPNDRPSMSKVL-EMLETDVELLQMPPKPFQLPFEVSIEDHADENPSEDPTSSLLS  665

Query  1108  DNPV  1119
              N +
Sbjct  666   SNEI  669



>gb|KEH40395.1| stress-induced receptor-like kinase, putative [Medicago truncatula]
Length=694

 Score =   494 bits (1273),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 247/348 (71%), Positives = 290/348 (83%), Gaps = 2/348 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             L R   GLLF+   + YK RRRHLSAYD++E +L   NNLMPIRYSY +IK+MT  FK K
Sbjct  319   LIRIMGGLLFIPMYMAYKWRRRHLSAYDSVEEFLKSHNNLMPIRYSYSDIKKMTKGFKDK  378

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMG-KSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             LGEGGYG+V+KG LR+G  VA+K++G KS+A GQEFI+EVATIG IHH NVV LIGFCVE
Sbjct  379   LGEGGYGSVYKGQLRNGHLVAIKLLGGKSRANGQEFINEVATIGTIHHVNVVHLIGFCVE  438

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
              +KRAL+YEFMPNGSLEK+IF +E   SLS EKMFDI+LGVARGI+YLHRGCDMRILHFD
Sbjct  439   KTKRALVYEFMPNGSLEKHIFSRERMGSLSSEKMFDIALGVARGIEYLHRGCDMRILHFD  498

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
             IKPHNILLD NF+PKVSDF LAKLYP ++S+VSLTAARGTMGYMAPEL Y+NIGG+S+KA
Sbjct  499   IKPHNILLDVNFTPKVSDFRLAKLYPTDNSIVSLTAARGTMGYMAPELFYKNIGGVSYKA  558

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLLMEM  RR+N+N   +  SQ+YFPSWVY+Q  +GK+I+MG+ TEEE+K+ KK
Sbjct  559   DVYSFGMLLMEMASRRRNMNESEDHKSQVYFPSWVYDQFSEGKEIEMGNGTEEEEKILKK  618

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             MIIVALWCIQM P +RPSM KV+  L E DVE LEM PKPF +P  +P
Sbjct  619   MIIVALWCIQMKPIDRPSMNKVV-ELLEGDVESLEMPPKPFQTPKGMP  665



>ref|XP_011037044.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Populus 
euphratica]
Length=544

 Score =   488 bits (1257),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 234/340 (69%), Positives = 287/340 (84%), Gaps = 2/340 (1%)
 Frame = +1

Query  43    LISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVF  222
             +I  ++YK RRRHLS YDT+E +L G NNLMP+RYSY +I+++T  FK KLGEGG+GTV+
Sbjct  183   VIVFLIYKWRRRHLSVYDTVEQFLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGFGTVY  242

Query  223   KGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFM  402
             KG LRSG F AVK++GKSKA GQ+FI+EVATIGRIHHTNVVRLIGFC EGSKRAL+Y+FM
Sbjct  243   KGKLRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHTNVVRLIGFCAEGSKRALVYDFM  302

Query  403   PNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDEN  582
             PNGSL++++F +E SISLS +K+  ISLGVARGIDYLH GCDM+ILHFDIKPHNILLDEN
Sbjct  303   PNGSLDRHLFSREGSISLSWQKLHQISLGVARGIDYLHLGCDMQILHFDIKPHNILLDEN  362

Query  583   FSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLME  762
             F+PKVSDFGLA+LYP   S+ SLTAARGT+GYMAPEL Y+NIG +S+KADVYSFGMLL+E
Sbjct  363   FTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLLLE  422

Query  763   MVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMIIVALWCIQ  939
             M G+RKN+N   E  SQIY+P WV++Q+ DGK I++G DATEEE K+ KKMI+V LWCIQ
Sbjct  423   MAGKRKNVNALAENSSQIYWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWCIQ  482

Query  940   MNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             M P +RP+MK V+  + E D+E L++ PKP L+ DE PT+
Sbjct  483   MKPMDRPTMKNVV-EMLEGDLENLQLPPKPVLNLDETPTN  521



>ref|XP_009348961.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=563

 Score =   489 bits (1259),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 236/345 (68%), Positives = 290/345 (84%), Gaps = 2/345 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F  G   LI++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK KLG
Sbjct  174   KFLFGFPCLIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFKDKLG  232

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGG+G+V+K  LRSG  VA+KM+GKSKA GQ+FI+EVATIGRIHH NVV+LIGFCVEGSK
Sbjct  233   EGGFGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLIGFCVEGSK  292

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+Y+FMPNGSL+K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHFDIKP
Sbjct  293   RALVYDFMPNGSLDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHFDIKP  352

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF PKVSDFGLA+L P+++S+VSLTA RGT+GY+APE  Y+NIGG+S+KADVY
Sbjct  353   HNILLDENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPEFFYKNIGGVSYKADVY  412

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM G+RKNLN  +E  SQIYFP+WV++QL  G D+ +GDATEEEKK+ KKMI+
Sbjct  413   SFGMLLMEMAGKRKNLNANIEHSSQIYFPTWVFDQLSGGNDLTIGDATEEEKKIIKKMIV  472

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             VA WCIQM PS+RPSM KV+  + E ++E L+M PK FL P +VP
Sbjct  473   VASWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKLFLYPQQVP  516



>ref|XP_008232172.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=629

 Score =   491 bits (1264),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 238/344 (69%), Positives = 290/344 (84%), Gaps = 2/344 (1%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGE  201
             +  G     ++++YK RRRHLS +  IE +L   N L+P+RYSY  IK+M   FK KLGE
Sbjct  256   YVFGFPCATALIIYKWRRRHLSVHHNIEDFLQN-NELVPVRYSYSNIKKMAKGFKEKLGE  314

Query  202   GGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKR  381
             GGYG+V+K  LRSG  VA+KM+GKSKA GQ+FI+EVATIGRIHH NVVRLIGFCVEGSKR
Sbjct  315   GGYGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVRLIGFCVEGSKR  374

Query  382   ALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPH  561
             AL+Y+FMPNGSL+KY+F ++  ISL+ EKMF+I++GVARGI+YLHRGCDM+ILHFDIKPH
Sbjct  375   ALVYDFMPNGSLDKYLFSQQGVISLNCEKMFEIAVGVARGIEYLHRGCDMQILHFDIKPH  434

Query  562   NILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYS  741
             NILLDENF PKVSDFGLA+L P+++S+VSLTAARGT+GY+APEL Y+NIGGIS+KADVYS
Sbjct  435   NILLDENFLPKVSDFGLARLCPLDNSIVSLTAARGTIGYIAPELFYKNIGGISYKADVYS  494

Query  742   FGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIV  921
             FGMLLMEM GRRKNLN  +E+ SQIYFP+WV++QL DGKDI + DATEEE+K+ KKMIIV
Sbjct  495   FGMLLMEMAGRRKNLNATIEKSSQIYFPTWVFDQLSDGKDIKVEDATEEEEKIIKKMIIV  554

Query  922   ALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             ALWCIQM PS+RPSM K +  + E ++E LEM PKPFL P ++P
Sbjct  555   ALWCIQMKPSDRPSMNKAV-EMLEGEIECLEMPPKPFLYPQQMP  597



>ref|XP_007161182.1| hypothetical protein PHAVU_001G0490001g, partial [Phaseolus vulgaris]
 gb|ESW33176.1| hypothetical protein PHAVU_001G0490001g, partial [Phaseolus vulgaris]
Length=374

 Score =   481 bits (1239),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 233/346 (67%), Positives = 285/346 (82%), Gaps = 2/346 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
              GL FLI I + K R RH+S Y  IE+YL   N+L PIRYSY +IK+M   FK KLGEGG
Sbjct  26    FGLPFLIFIFICKWRNRHMSMYKNIENYLE-QNSLAPIRYSYKDIKKMAAGFKEKLGEGG  84

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             +G+VFK  LRSGPFVA+KM+ KSKA GQ+FI EVATIGRIHH NVV+LIGFC  GSKRAL
Sbjct  85    FGSVFKAKLRSGPFVAIKMLDKSKANGQDFICEVATIGRIHHQNVVQLIGFCASGSKRAL  144

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF KE +I LS+EK+++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  145   VYEFMPNGSLDKFIFSKEINIHLSYEKIYNISIGVARGIAYLHHGCEMQILHFDIKPHNI  204

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF PKVSDFGLAKLYP+++S+V++TAARGT+GYMAPEL Y NIGGISHK DVYSFG
Sbjct  205   LLDENFIPKVSDFGLAKLYPIDNSIVTMTAARGTIGYMAPELFYNNIGGISHKVDVYSFG  264

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM  +RKNLNP+ +  SQ+YFP W+Y+ +++ +D+D+ D TEEE K++KKMIIVAL
Sbjct  265   MLLMEMASKRKNLNPYADHSSQLYFPLWIYDHIREEEDVDIEDVTEEENKIAKKMIIVAL  324

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             WCIQ+ P++RPSM +V+  + E D+E LE+ PKP L PDE  T E 
Sbjct  325   WCIQLKPNDRPSMNRVV-EMLEGDIEDLEIPPKPILFPDETVTKEQ  369



>ref|XP_009335119.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Pyrus 
x bretschneideri]
Length=640

 Score =   490 bits (1262),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 237/357 (66%), Positives = 290/357 (81%), Gaps = 2/357 (1%)
 Frame = +1

Query  10    ALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKH  189
             A+G    G   ++ I + K RRR+LS Y  IE +L G  +++P RYSY +IK+MTN FK 
Sbjct  270   AVGMLMFGASCVVWIWIMKWRRRNLSMYSAIEDFLQGDTSIIPKRYSYSDIKKMTNRFKD  329

Query  190   KLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             KLGEGGYG VFKG LRSG F A+KM+GKSKA GQ+F++EVATIGRIHH NVV+L+G+CVE
Sbjct  330   KLGEGGYGCVFKGNLRSGRFGAIKMLGKSKANGQDFVNEVATIGRIHHVNVVQLVGYCVE  389

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
             GS R L+Y+FMPNGSL+KY++ KE +  LS+EKM+ ISLGVARGI+YLH+GCDM+ILHFD
Sbjct  390   GSNRCLVYDFMPNGSLDKYVYLKEGTTYLSYEKMYQISLGVARGIEYLHQGCDMQILHFD  449

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
             IKPHNILLDENF+PK+SDFGLAKLYP ++S+VSLTAARGTMGYMAPEL Y+NIGG+S+KA
Sbjct  450   IKPHNILLDENFNPKISDFGLAKLYPTDNSIVSLTAARGTMGYMAPELFYKNIGGVSYKA  509

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLLMEM  RRKNL+   E  SQ+Y P+WVY++  +G D++M DATEEEKK+ KK
Sbjct  510   DVYSFGMLLMEMASRRKNLDALAEHSSQLYLPTWVYDRYNEGTDLEMSDATEEEKKMVKK  569

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT-DENSFPN  1077
             M+I ALWCIQM P +RPSM KVI  + E DVE L+M PKPFL P E+P  D  + PN
Sbjct  570   MVITALWCIQMKPGDRPSMNKVI-EMLEGDVECLQMPPKPFLFPQEIPIGDPQNNPN  625



>ref|XP_011037045.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Populus 
euphratica]
Length=667

 Score =   491 bits (1263),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 240/365 (66%), Positives = 297/365 (81%), Gaps = 5/365 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             G   +I  ++YK RRRHLS YDT+E +L G NNLMP+RYSY +I+++T  FK KLGEGG+
Sbjct  302   GTPCVIVFLIYKWRRRHLSVYDTVEQFLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGF  361

Query  211   GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
             GTV+KG  RSG F AVK++GKSKA GQ+FI+EVATIGRIHHTNVVRLIGFC EGSKRAL+
Sbjct  362   GTVYKGKFRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHTNVVRLIGFCAEGSKRALV  421

Query  391   YEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNIL  570
             Y+FMPNGSL++++F +E SISLS +K+  ISLGVARGIDYLH GCDM+ILHFDIKPHNIL
Sbjct  422   YDFMPNGSLDRHLFSREGSISLSWQKLHQISLGVARGIDYLHLGCDMQILHFDIKPHNIL  481

Query  571   LDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGM  750
             LDENF+PKVSDFGLA+LYP   S+ SLTAARGT+GYMAPEL Y+NIG +S+KADVYSFGM
Sbjct  482   LDENFTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGM  541

Query  751   LLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMIIVAL  927
             LL+EM G+RKN+N   E  SQIY+P WV++Q+ DGK I++G DATEEE K+ KKMI+V L
Sbjct  542   LLLEMAGKRKNVNALAENSSQIYWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGL  601

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD---ENSFPNAQNVESP  1098
             WCIQM P +RP+MK V+  + E D+E L++ PKP L+ DE PT+   E+S  +  + ES 
Sbjct  602   WCIQMKPMDRPTMKNVV-EMLEGDLENLQLPPKPVLNLDETPTNIEGESSSLSGDSTEST  660

Query  1099  LLSDN  1113
              L +N
Sbjct  661   SLVEN  665



>ref|XP_009348966.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=563

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 234/349 (67%), Positives = 291/349 (83%), Gaps = 2/349 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + +F  G   LI++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK
Sbjct  170   FQVVKFLFGFPCLIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFK  228

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGG+G+V+K  LRSG  VA+KM+GKSKA GQ+FI+EVATIGRIHH NVV+L+GFCV
Sbjct  229   DKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCV  288

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y+FMPNGS +K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHF
Sbjct  289   EGSKRALVYDFMPNGSFDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHF  348

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF PKVSDFGLA+L P+++S+VSLTA RGT+GY+APE  Y+NIGG+S+K
Sbjct  349   DIKPHNILLDENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPEFFYKNIGGVSYK  408

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM G+RKNLN  +E  SQIYFP+WV++QL  G D+ +GDATEEEKK+ K
Sbjct  409   ADVYSFGMLLMEMAGKRKNLNANIEHSSQIYFPTWVFDQLSGGNDLTIGDATEEEKKIIK  468

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KMI+VA WCIQM PS+RPSM KV+  + E ++E L+M PK FL P +VP
Sbjct  469   KMIVVASWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKLFLYPQQVP  516



>ref|XP_004306407.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=376

 Score =   480 bits (1235),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/352 (64%), Positives = 292/352 (83%), Gaps = 4/352 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             + + SLGL F+ ++++YK RRRHLS Y+ IE +L    NLMP+RYSY +IK+M N FK +
Sbjct  1     MAKLSLGLPFITALLIYKWRRRHLSMYEKIEDFLQSNINLMPVRYSYSDIKKMANGFKDR  60

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG GG+G V+K  LRSG  VA+KM+ +SK  G++FI+EVATIGRIHH NVVRLIGFC + 
Sbjct  61    LGGGGFGIVYKAKLRSGRLVAIKMLSESKTNGEDFINEVATIGRIHHVNVVRLIGFCADR  120

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SKRAL+Y+FM NGSLEK+IF ++ +ISLS EK+F+I++GVARGI YLH+GCDMRILHFD+
Sbjct  121   SKRALVYDFMSNGSLEKHIFAQQGAISLSCEKIFEIAVGVARGIQYLHQGCDMRILHFDL  180

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLD+NF+ K+SDFGLA+LYP+++S+VSLTAARGT+GYMAPEL Y+NIGG+S+KAD
Sbjct  181   KPHNILLDDNFTAKISDFGLARLYPLDNSIVSLTAARGTIGYMAPELFYKNIGGVSYKAD  240

Query  733   VYSFGMLLMEMVGRRKNLNPFVE---QLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVS  903
             VYSFGML++EM GRRKNLN  ++   + SQ+YFP+WV +QL  GK+I++GD TE+E K+ 
Sbjct  241   VYSFGMLMLEMAGRRKNLNAAIDHSSEFSQMYFPTWVSDQLNQGKEIEVGDFTEDEMKII  300

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             KKMIIVALWCIQM P ERPSM KV+  + E D+E L++ PKPFL P ++P D
Sbjct  301   KKMIIVALWCIQMKPVERPSMSKVV-EMLEGDIESLQIPPKPFLYPQQIPED  351



>ref|XP_007022126.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13651.1| PR5-like receptor kinase [Theobroma cacao]
Length=597

 Score =   487 bits (1254),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 245/370 (66%), Positives = 298/370 (81%), Gaps = 2/370 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             L R  LG+  LI++V YK R+RHL   DTIE +L   ++L+PIRYSY EIKRMT +F+ K
Sbjct  11    LLRTLLGICCLIALVTYKWRKRHLCVDDTIEEFLQKQSDLIPIRYSYREIKRMTRSFRDK  70

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LGEGGYG+VFKG LRSG  VA+K++GKSKA GQ+FI+EVATIGRIHH NV +LIGFCVEG
Sbjct  71    LGEGGYGSVFKGKLRSGHLVAIKLLGKSKANGQDFINEVATIGRIHHFNVAKLIGFCVEG  130

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SK+AL+Y+FMPNGSL+K IF +E   +LS +KMFDI+LGVARGI+YLH GC+M+ILHFDI
Sbjct  131   SKQALVYDFMPNGSLDKIIFTEENETTLSWQKMFDIALGVARGIEYLHHGCNMQILHFDI  190

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDENF PKVSDFGLAKLY V+DS+VSLTAARGT+GY+APEL Y++IGGIS KAD
Sbjct  191   KPHNILLDENFVPKVSDFGLAKLYSVDDSIVSLTAARGTIGYIAPELVYKSIGGISFKAD  250

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEMVGRRKNLN F E LSQIYFPSW+Y +   G++I  GD T+ EK + +KM
Sbjct  251   VYSFGMLLMEMVGRRKNLNAFAEHLSQIYFPSWIYGRFHQGENIKFGDVTDGEKIIVRKM  310

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN-AQNV  1089
             II A WCIQ+ PS RPSM KV+  + E D+ELL+M PKPF  P E+   ++   N +++ 
Sbjct  311   IITAFWCIQVTPSVRPSMSKVL-EMLETDIELLQMPPKPFQLPLEISAQDHVDDNPSEDP  369

Query  1090  ESPLLSDNPV  1119
              S LLS N +
Sbjct  370   TSSLLSSNEI  379



>ref|XP_008232079.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Prunus mume]
Length=651

 Score =   488 bits (1256),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 238/340 (70%), Positives = 285/340 (84%), Gaps = 1/340 (0%)
 Frame = +1

Query  40    FLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTV  219
             F+I+ ++Y  R+RH S Y TIE++L   NN  PIRYSY +IK+M+N FK+KLGEGG+G V
Sbjct  291   FVIAFLIYTWRKRHSSMYSTIENFLHDDNNFPPIRYSYLDIKKMSNEFKNKLGEGGFGMV  350

Query  220   FKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEF  399
             FKG LRSG F A+KM+ KSKA G++FISEVATIGRIHH NVV+L+G+CVEGSKRAL+YEF
Sbjct  351   FKGKLRSGHFGAIKMLSKSKANGEDFISEVATIGRIHHVNVVQLVGYCVEGSKRALVYEF  410

Query  400   MPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDE  579
             M NGSL+KYI+ KE +  LS++KM+DISLGVARGI+YLH+GCDM+ILHFDIKPHNILLDE
Sbjct  411   MQNGSLDKYIYSKEGNNLLSYKKMYDISLGVARGIEYLHQGCDMQILHFDIKPHNILLDE  470

Query  580   NFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLM  759
             NF PK+SDFGLAKLYP  +S+V LTAARGTMGYMAPEL Y+NIGG+SHKADVYSFGMLLM
Sbjct  471   NFVPKISDFGLAKLYPTVNSIVLLTAARGTMGYMAPELFYKNIGGVSHKADVYSFGMLLM  530

Query  760   EMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQ  939
             EM  +RKNLN   E  SQIYFPSWVY+Q K+GK+++M D TEEEKK+ KKM+I ALWCIQ
Sbjct  531   EMGSKRKNLNARAEHSSQIYFPSWVYDQYKEGKELEMEDITEEEKKIVKKMVITALWCIQ  590

Query  940   MNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             M PS+RP+M +VI  + E DVE L M PKPFL P E+  D
Sbjct  591   MKPSDRPAMNEVI-KMLEGDVESLRMPPKPFLCPQEMSVD  629



>ref|XP_011015080.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase V.3 isoform X2 [Populus euphratica]
Length=699

 Score =   489 bits (1259),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 243/357 (68%), Positives = 297/357 (83%), Gaps = 3/357 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTN  177
             + Y +  F+ GL FL+++++YK RRRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN
Sbjct  321   VIYHVLLFACGLPFLVTLLIYKWRRRHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITN  380

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGG+G+V+KG LRSG F AVK++GKSKA GQ+FI+EVATIGRIHH NVV+LIG
Sbjct  381   GFKDKLGEGGFGSVYKGKLRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHVNVVQLIG  440

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             F VEGSKRAL+YEFMPNGSLEKYIF +E SI LS+EKM++ISLGVARGI+YLH+GCD++I
Sbjct  441   FTVEGSKRALIYEFMPNGSLEKYIFSREGSIPLSNEKMYEISLGVARGIEYLHQGCDIQI  500

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILL++ F PK+SDFGLAKLYP  ++ V LTAARGT+GYMAPEL Y+NIGG+
Sbjct  501   LHFDIKPHNILLNDKFVPKISDFGLAKLYPTNNNTVPLTAARGTIGYMAPELFYKNIGGV  560

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             S+KADVYSFGMLLMEMVGRRKNLN      SQIYFPSW ++Q+  GKDI++  DATE EK
Sbjct  561   SYKADVYSFGMLLMEMVGRRKNLNALANHSSQIYFPSWAHDQVSAGKDIEVQEDATEHEK  620

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             K +KKMIIVALWCIQ+ P +RPSM K    + E DVE L M PKPFL+P ++  D++
Sbjct  621   KTTKKMIIVALWCIQLKPVDRPSMHKA-AEMLESDVESLRMPPKPFLTPHQMSGDDD  676



>ref|XP_008232075.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=488

 Score =   482 bits (1240),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 235/360 (65%), Positives = 285/360 (79%), Gaps = 1/360 (0%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R   G+  LI+ V+YK RRRHLS+Y  IE +L   NN +PIRYSY EIK+MT  FK KL
Sbjct  119   ARLIFGVPCLIAFVIYKWRRRHLSSYSIIEDFLQSDNNFLPIRYSYSEIKKMTGKFKDKL  178

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG+VFKG LRSG FVA+K++GK K  GQ+F SEVATIGRIHH NVV+L+G+CVEG 
Sbjct  179   GEGGYGSVFKGKLRSGRFVAIKLLGKPKGNGQDFTSEVATIGRIHHVNVVQLVGYCVEGL  238

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
              RAL+Y+FMPN SL+KYI+ KEE++ LS +KM++ISLGVARGI+YLH+GCDM+ILHFDIK
Sbjct  239   NRALVYDFMPNSSLDKYIYTKEENMPLSCKKMYEISLGVARGIEYLHQGCDMQILHFDIK  298

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PK+SDFGLAKLY V++S+VSLTAARGTMGY+APEL Y+NIGG+S+KADV
Sbjct  299   PHNILLDENFNPKISDFGLAKLYSVDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADV  358

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKN +  VE+ SQ YFP W Y+Q   G D++MGD  EEEKK+ KKM+
Sbjct  359   YSFGMLLMEMASRRKNFSSMVERSSQTYFPLWAYDQYNKGNDLEMGDFNEEEKKIIKKMV  418

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             I ALWCIQM PS+RPSM KVIEML  +   L     +PFL P E+   +    N  ++ S
Sbjct  419   ITALWCIQMKPSDRPSMNKVIEMLGGDVECLKMPI-RPFLYPQEMHAGDVQENNLNSIGS  477



>ref|NP_001238112.1| stress-induced receptor-like kinase precursor [Glycine max]
 gb|ACJ37416.1| stress-induced receptor-like kinase [Glycine max]
Length=698

 Score =   488 bits (1256),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 241/386 (62%), Positives = 305/386 (79%), Gaps = 5/386 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y  G+F  G+ F I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   
Sbjct  314   LPYLAGKFLFGMTFFIVLLIYKWRKRHLSTYENIENYLE-QNNLMPIGYSYKEIKKMARG  372

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEGGYG VFKG LRSGP VA+KM+ KSK  GQ+FISE+ATIGRIHH NVV+LIG+
Sbjct  373   FKDKLGEGGYGFVFKGKLRSGPSVAIKMLHKSKGNGQDFISEIATIGRIHHQNVVQLIGY  432

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             CVEGSKRAL+YEFMPNGSL+K+IF K+ +I L+++K+++I++GVARGI YLH GC+M+IL
Sbjct  433   CVEGSKRALVYEFMPNGSLDKFIFTKDGNIHLTYDKIYNIAIGVARGIAYLHHGCEMQIL  492

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PKVSDFGLAKLYP+++S+V++TAARGT+GYMAPEL Y+NIGGIS
Sbjct  493   HFDIKPHNILLDETFTPKVSDFGLAKLYPIDNSIVTMTAARGTIGYMAPELFYKNIGGIS  552

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             HKADVYSFGMLLMEM  +RKNLNP  +  SQ+YFP W+Y QL    DI+M   TEEE K+
Sbjct  553   HKADVYSFGMLLMEMASKRKNLNPHADHSSQLYFPFWIYNQLGKETDIEMEGVTEEENKI  612

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNA  1080
             +KKMIIV+LWCIQ+ PS+RPSM KV+  + E D+E LE+ PKP L P E   ++ S  ++
Sbjct  613   AKKMIIVSLWCIQLKPSDRPSMNKVV-EMLEGDIESLEIPPKPSLYPHETMENDQSIYSS  671

Query  1081  QNVESPLLSDNPVRSSSFEVCEN*II  1158
             Q +    +S +   S S E+  N ++
Sbjct  672   QTMSMDFISSS---SYSKEIVTNPLV  694



>ref|XP_002513561.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF48964.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=394

 Score =   477 bits (1227),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 238/350 (68%), Positives = 284/350 (81%), Gaps = 2/350 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             I +   R  LG   +I+ + YK RRRHLS YD +E +L   NNLMPI YSY +IK++   
Sbjct  15    IWHTGARCVLGAPCVIAFLAYKWRRRHLSMYDKVEAFLRSHNNLMPIMYSYSDIKKIIRG  74

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEGG+G+V+KG L SG  VAVK++ K K+ GQ+FI+EVATIGRIHH NVV+LIGF
Sbjct  75    FKDKLGEGGFGSVYKGKLSSGRIVAVKILSKPKSDGQDFINEVATIGRIHHVNVVQLIGF  134

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C E SKRAL+Y+FMPNGSLEKYIF +   + LS E+M+ ISLG ARGI+YLHRGCDM+IL
Sbjct  135   CAERSKRALVYDFMPNGSLEKYIFSENGDVPLSCEQMYKISLGTARGIEYLHRGCDMQIL  194

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDENF+PKVSDFGLAKLYP+E S+VSLTA RGTMGYMAPEL Y+NIGGIS
Sbjct  195   HFDIKPHNILLDENFAPKVSDFGLAKLYPIEGSIVSLTAPRGTMGYMAPELFYKNIGGIS  254

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KADVYSFGMLLMEM GRRKNLN F E  SQIYFPSWVYEQL  G +I++ +AT EE+K+
Sbjct  255   YKADVYSFGMLLMEMAGRRKNLNAFAEHSSQIYFPSWVYEQLNAGNEIEIENAT-EERKI  313

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             +KKM+IVAL CIQM P +RPSM +V+  + E +VE L+M PKPFLSP E+
Sbjct  314   TKKMMIVALCCIQMKPGDRPSMNRVV-EMLEGEVESLQMPPKPFLSPQEL  362



>emb|CAN71175.1| hypothetical protein VITISV_037666 [Vitis vinifera]
Length=590

 Score =   484 bits (1245),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 237/342 (69%), Positives = 279/342 (82%), Gaps = 1/342 (0%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
              G+  ++  ++YK +RR LS Y  IE ++   NNL PIR SY  IK+MT  F  KLGEGG
Sbjct  249   FGVPCVLIFLIYKWKRRSLSMYHAIEEFIQTHNNLKPIRXSYSNIKKMTKGFTEKLGEGG  308

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+V+KG L SG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVV+LIGFCVEGSKRAL
Sbjct  309   YGSVYKGKLXSGHLVAVKMLANSKANGQDFINEVATIGRIHHFNVVQLIGFCVEGSKRAL  368

Query  388   LYEFMPNGSLEKYIFP-KEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHN  564
             +Y+FMPNGSL+KYIFP KEE ISLS EKM+ ISLGVA GI+YLHRGCDM+ILHFDIKPHN
Sbjct  369   VYDFMPNGSLDKYIFPEKEEXISLSFEKMYQISLGVAHGIEYLHRGCDMQILHFDIKPHN  428

Query  565   ILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSF  744
             ILLD+N +PKVSDFGLAK YP + S+VSLT ARGT GYMAPEL Y+NIGG+S+KADVYSF
Sbjct  429   ILLDKNXTPKVSDFGLAKSYPADHSIVSLTGARGTRGYMAPELFYKNIGGVSYKADVYSF  488

Query  745   GMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVA  924
             GMLLMEM GRR+NLN F E  SQIYFPSW Y+Q  +GKDI++GDATEEE+K+ KKM++VA
Sbjct  489   GMLLMEMAGRRRNLNVFAEHSSQIYFPSWAYDQFNEGKDIEIGDATEEEQKLEKKMVLVA  548

Query  925   LWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             LWCIQ  PSERPSM +VI  + E  V+ L+M  KPFL+P EV
Sbjct  549   LWCIQFKPSERPSMHRVIIEMLEGKVDQLQMPSKPFLTPQEV  590



>ref|XP_004498297.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
isoform X2 [Cicer arietinum]
Length=644

 Score =   485 bits (1249),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 241/367 (66%), Positives = 291/367 (79%), Gaps = 5/367 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F LG  F+I +++YK RRRHLS YD IE +L G NN+MPIRYSY +IKRMT  FK KLG
Sbjct  269   KFVLGAPFIIVLLIYKWRRRHLSMYDGIEDFLRGDNNIMPIRYSYKDIKRMTQKFKTKLG  328

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
              GGYG+VFKG LRSG FVAVK++ K+K+ GQ+FI+EV+TIGRIHH NVV LIGFCVEGSK
Sbjct  329   NGGYGSVFKGQLRSGRFVAVKLLDKAKSNGQDFINEVSTIGRIHHVNVVHLIGFCVEGSK  388

Query  379   RALLYEFMPNGSLEKYIF-PKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             RAL+YEFM NGSLEKYIF P EES SLS EK++DISLGVARGI+YLH GC+++ILHFDIK
Sbjct  389   RALIYEFMSNGSLEKYIFSPIEESYSLSCEKLYDISLGVARGIEYLHNGCNIKILHFDIK  448

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PKVSDFGLA+L P  +S+VSLTAARGT+GYMAPEL YRN+G IS+KADV
Sbjct  449   PHNILLDENFNPKVSDFGLARLCPTNNSIVSLTAARGTIGYMAPELFYRNVGTISYKADV  508

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RR+NLN   EQ SQIYFP WVY++L DG+++   + T  E K++KKM+
Sbjct  509   YSFGMLLMEMASRRRNLNALDEQESQIYFPFWVYDRLHDGREVTFENDTNHEMKLAKKMM  568

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD--ENSFPNAQNV  1089
             IVALWCIQ  PS+RPSM KV+     E+   L M  KP+L P ++P +   +S  N+   
Sbjct  569   IVALWCIQTKPSDRPSMDKVL--EMLEEDGDLSMPNKPYLYPQDLPVEGRNDSISNSSTS  626

Query  1090  ESPLLSD  1110
                 +SD
Sbjct  627   YGTSISD  633



>ref|XP_004498441.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Cicer arietinum]
Length=430

 Score =   477 bits (1227),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/349 (66%), Positives = 290/349 (83%), Gaps = 2/349 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RF+LG +F   +++Y  RRRH+S Y+ IE +L G + LMPIRYSY +IK MT +FK KLG
Sbjct  52    RFTLGSIFCCGLLIYTCRRRHISIYENIEIFLRG-STLMPIRYSYRQIKNMTRSFKDKLG  110

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGG+G+V+KG L SGPFVA+KM+GKSK  GQ+FI+EVATIGRIHHTNVVRLIGFCV+GSK
Sbjct  111   EGGFGSVYKGKLSSGPFVAIKMLGKSKGNGQDFINEVATIGRIHHTNVVRLIGFCVDGSK  170

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFMPNGSL+KYI   +++I L++++M++ISLGVARGI YLH+GCDM+ILHFDIKP
Sbjct  171   RALVYEFMPNGSLDKYISSSQDAIFLTYKQMYEISLGVARGITYLHQGCDMQILHFDIKP  230

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF PKVSDFGLAKLYP ++S+V+LTAARGT+GYMAPEL Y+NIGG+S+KADVY
Sbjct  231   HNILLDENFIPKVSDFGLAKLYPNDNSIVTLTAARGTIGYMAPELFYKNIGGVSYKADVY  290

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM  +R+NLNP  ++ SQ++FP W+Y QL + ++I M + T EEK   KKM I
Sbjct  291   SFGMLLMEMASKRRNLNPLADRSSQLFFPFWIYNQLIEEREIQMDEITNEEKSNVKKMFI  350

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
              ALWCIQ+ P +RP+M KVI  + E D+E +EM PKP L P+E+  ++N
Sbjct  351   TALWCIQLKPCDRPAMNKVI-EMLEGDIENIEMPPKPSLYPNEMIQEDN  398



>ref|XP_004498296.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
isoform X1 [Cicer arietinum]
Length=655

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 241/367 (66%), Positives = 291/367 (79%), Gaps = 5/367 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F LG  F+I +++YK RRRHLS YD IE +L G NN+MPIRYSY +IKRMT  FK KLG
Sbjct  280   KFVLGAPFIIVLLIYKWRRRHLSMYDGIEDFLRGDNNIMPIRYSYKDIKRMTQKFKTKLG  339

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
              GGYG+VFKG LRSG FVAVK++ K+K+ GQ+FI+EV+TIGRIHH NVV LIGFCVEGSK
Sbjct  340   NGGYGSVFKGQLRSGRFVAVKLLDKAKSNGQDFINEVSTIGRIHHVNVVHLIGFCVEGSK  399

Query  379   RALLYEFMPNGSLEKYIF-PKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             RAL+YEFM NGSLEKYIF P EES SLS EK++DISLGVARGI+YLH GC+++ILHFDIK
Sbjct  400   RALIYEFMSNGSLEKYIFSPIEESYSLSCEKLYDISLGVARGIEYLHNGCNIKILHFDIK  459

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PKVSDFGLA+L P  +S+VSLTAARGT+GYMAPEL YRN+G IS+KADV
Sbjct  460   PHNILLDENFNPKVSDFGLARLCPTNNSIVSLTAARGTIGYMAPELFYRNVGTISYKADV  519

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RR+NLN   EQ SQIYFP WVY++L DG+++   + T  E K++KKM+
Sbjct  520   YSFGMLLMEMASRRRNLNALDEQESQIYFPFWVYDRLHDGREVTFENDTNHEMKLAKKMM  579

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD--ENSFPNAQNV  1089
             IVALWCIQ  PS+RPSM KV+     E+   L M  KP+L P ++P +   +S  N+   
Sbjct  580   IVALWCIQTKPSDRPSMDKVL--EMLEEDGDLSMPNKPYLYPQDLPVEGRNDSISNSSTS  637

Query  1090  ESPLLSD  1110
                 +SD
Sbjct  638   YGTSISD  644



>ref|XP_009367880.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=419

 Score =   476 bits (1224),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 242/363 (67%), Positives = 288/363 (79%), Gaps = 7/363 (2%)
 Frame = +1

Query  22    FSLGLLFLISI----VVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKH  189
             F+  LLF I I    +VYK RRRHLS Y TIE +L    N +PIRYSY +IK+MT  FK 
Sbjct  50    FTARLLFGIPIAAVFLVYKWRRRHLSMYSTIEDFLQRDKNFVPIRYSYSDIKKMTRRFKD  109

Query  190   KLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             KLGEGGYG+VFKG LRSG FVA+K++GKSKA GQ+FISE+ATIGRI H NVVRL+G+CVE
Sbjct  110   KLGEGGYGSVFKGKLRSGRFVAIKVLGKSKANGQDFISEIATIGRIRHVNVVRLVGYCVE  169

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
             GSKRAL+Y FM NGSL+KYI+ KE S+ L+ +KM++ISLGVA+GI+YLH+GC+M+ILHFD
Sbjct  170   GSKRALVYVFMANGSLDKYIYSKEGSVPLTIDKMYEISLGVAQGIEYLHQGCEMQILHFD  229

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
             IKPHNILLDENF  KVSDFGLAKLYPV++S+V+LTAARGTMGY+A EL Y+NIGG+SHKA
Sbjct  230   IKPHNILLDENFKAKVSDFGLAKLYPVDNSIVTLTAARGTMGYIALELFYKNIGGVSHKA  289

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLLMEM  RRKNLN  VE  SQIYFP WVY+Q   G D++M + TEEEK V KK
Sbjct  290   DVYSFGMLLMEMASRRKNLNTRVEHSSQIYFPLWVYDQYNVGNDLEMDNVTEEEKNVIKK  349

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDE--VPTDENSFPNAQ  1083
             M+I ALWCIQM P++RPSM K+I  +   DVE L+M P+P L P E  V   +   P   
Sbjct  350   MVITALWCIQMKPTDRPSMHKLI-EMLGGDVECLQMPPRPSLCPQETHVAVGDIQDPICS  408

Query  1084  NVE  1092
             NVE
Sbjct  409   NVE  411



>ref|XP_007036623.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY21124.1| PR5-like receptor kinase [Theobroma cacao]
Length=413

 Score =   475 bits (1223),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 219/320 (68%), Positives = 268/320 (84%), Gaps = 0/320 (0%)
 Frame = +1

Query  19   RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
            R  LG+  LI+ V+ K RRRHLS  DTIE +L   NNLMPIRYSY E+K+MT  FK KLG
Sbjct  40   RTLLGVSCLIAAVLIKFRRRHLSMDDTIEEFLQMQNNLMPIRYSYSEVKKMTKCFKDKLG  99

Query  199  EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
            +GGYG+VFKGTLRSG  VA+K++  SK+ GQ+FI+EVATIGRIHH NVV+LIGFCVEGSK
Sbjct  100  QGGYGSVFKGTLRSGRLVAIKLLNMSKSHGQDFINEVATIGRIHHVNVVQLIGFCVEGSK  159

Query  379  RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
            +AL+Y+FMPNGSL+K IF  E   +L  EK+F+I++GVARGI+YLH+GC M+ILHFDIKP
Sbjct  160  QALVYDFMPNGSLDKIIFSGERDTTLCWEKIFEIAIGVARGIEYLHQGCQMQILHFDIKP  219

Query  559  HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
            HNILLDENF+PK+SDFGLAKLY V+ S+VSLTAARGT+GY+APEL Y+NIG ISHK DVY
Sbjct  220  HNILLDENFTPKISDFGLAKLYAVDHSIVSLTAARGTLGYIAPELFYKNIGSISHKVDVY  279

Query  739  SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
            SFGMLLMEMVG+R+NLN F EQ SQIYFPSW+Y++    +DI++GD TE EKK  +KM+I
Sbjct  280  SFGMLLMEMVGKRRNLNAFAEQSSQIYFPSWIYDRFDKEEDIELGDVTENEKKTVRKMVI  339

Query  919  VALWCIQMNPSERPSMKKVI  978
             A WCIQ+ P++RPS+ KV+
Sbjct  340  TAFWCIQIKPTDRPSISKVL  359



>ref|XP_008355114.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Malus 
domestica]
Length=408

 Score =   475 bits (1222),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 233/376 (62%), Positives = 291/376 (77%), Gaps = 3/376 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y   +   G+L + + ++Y  RRRHLS + TIE +L   NN MPIRYSY +IK+MT  
Sbjct  32    VCYFPSQICFGVLVVTAFLIYTWRRRHLSMHSTIEDFLQCNNNFMPIRYSYSDIKKMTRK  91

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK +LG+GG+G+VFKG LRSG FVAVK++GK K   Q+FISE+ATIGRIHH NVV+L+G+
Sbjct  92    FKDRLGKGGFGSVFKGKLRSGRFVAVKVLGKPKDDDQDFISEIATIGRIHHANVVQLVGY  151

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             CVEGSKRAL+Y+FMPNGSL+KYI+ KE S+ L+ + M++ISLGVA+GI+YLH+GC+M+IL
Sbjct  152   CVEGSKRALVYDFMPNGSLDKYIYSKEGSLPLTIKTMYEISLGVAQGIEYLHQGCEMQIL  211

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDENF  K+SDFGLAKLYPV++S+VSLTAARGTMGY+APEL Y+NIGG+S
Sbjct  212   HFDIKPHNILLDENFKAKISDFGLAKLYPVDNSIVSLTAARGTMGYIAPELFYKNIGGVS  271

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KADVYSFGMLLMEM  RRKNLN  VE  SQIYFP WVY+Q   G D++M + TEEEKKV
Sbjct  272   YKADVYSFGMLLMEMASRRKNLNAMVEHSSQIYFPLWVYDQYIVGNDLEMDNITEEEKKV  331

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNA  1080
              +KM+I ALWCIQM PS+RPSM KV+EML  +   L     KP L P E P       + 
Sbjct  332   IRKMVITALWCIQMKPSDRPSMSKVVEMLGGDVECLQMPL-KPSLCPQEAPVTAGDIQD-  389

Query  1081  QNVESPLLSDNPVRSS  1128
              N  +P+ S+  +  S
Sbjct  390   -NELNPICSNAELTCS  404



>ref|XP_011047639.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X4 [Populus euphratica]
Length=713

 Score =   486 bits (1250),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 236/359 (66%), Positives = 291/359 (81%), Gaps = 2/359 (1%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGE  201
             F LGL  L++ ++Y  RRRHLS YDTIE +L   +NLMP+RYSY EIK++TN+FK KLGE
Sbjct  345   FLLGLPCLVTYIIYTWRRRHLSMYDTIEEFLQTNDNLMPVRYSYSEIKKITNDFKEKLGE  404

Query  202   GGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKR  381
             GG+G+V+KG LRSG F AVK++  SKA GQ+F +EV TIGRI+H NVV+LIGF  EGSKR
Sbjct  405   GGFGSVYKGKLRSGRFAAVKILSNSKANGQDFTNEVDTIGRIYHVNVVQLIGFTAEGSKR  464

Query  382   ALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPH  561
              L+YEFMPNGSL+KYIF K+ S  LS EKMFDISLG+ARGIDYLH+GCDM+ILHFDIKPH
Sbjct  465   GLIYEFMPNGSLDKYIFSKQGSTKLSKEKMFDISLGIARGIDYLHQGCDMQILHFDIKPH  524

Query  562   NILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYS  741
             NILLDE F PK+SDFGLAKLYP  +++V LTAARGTMGY+APEL Y+NIGG+S+KADVYS
Sbjct  525   NILLDEKFVPKISDFGLAKLYPTNNNIVPLTAARGTMGYIAPELFYKNIGGVSYKADVYS  584

Query  742   FGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKKVSKKMII  918
             FGMLLM+M+GR+KNL+  V   SQIYFPSWVYEQ+ +G D++ +GD TE+EKK++KKMII
Sbjct  585   FGMLLMDMIGRKKNLSELVVDASQIYFPSWVYEQVCEGNDLEVLGDTTEQEKKITKKMII  644

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             VA WCIQ+ P +RPSM +V+  + E DVE L+M+PKPFL+  +     +   N  N  S
Sbjct  645   VASWCIQLKPEDRPSMHEVV-KMLETDVESLQMSPKPFLTTSQQMPKHDDVANQSNPSS  702



>ref|XP_011047638.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g23950 isoform X3 [Populus euphratica]
Length=724

 Score =   486 bits (1250),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 236/359 (66%), Positives = 291/359 (81%), Gaps = 2/359 (1%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGE  201
             F LGL  L++ ++Y  RRRHLS YDTIE +L   +NLMP+RYSY EIK++TN+FK KLGE
Sbjct  356   FLLGLPCLVTYIIYTWRRRHLSMYDTIEEFLQTNDNLMPVRYSYSEIKKITNDFKEKLGE  415

Query  202   GGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKR  381
             GG+G+V+KG LRSG F AVK++  SKA GQ+F +EV TIGRI+H NVV+LIGF  EGSKR
Sbjct  416   GGFGSVYKGKLRSGRFAAVKILSNSKANGQDFTNEVDTIGRIYHVNVVQLIGFTAEGSKR  475

Query  382   ALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPH  561
              L+YEFMPNGSL+KYIF K+ S  LS EKMFDISLG+ARGIDYLH+GCDM+ILHFDIKPH
Sbjct  476   GLIYEFMPNGSLDKYIFSKQGSTKLSKEKMFDISLGIARGIDYLHQGCDMQILHFDIKPH  535

Query  562   NILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYS  741
             NILLDE F PK+SDFGLAKLYP  +++V LTAARGTMGY+APEL Y+NIGG+S+KADVYS
Sbjct  536   NILLDEKFVPKISDFGLAKLYPTNNNIVPLTAARGTMGYIAPELFYKNIGGVSYKADVYS  595

Query  742   FGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKKVSKKMII  918
             FGMLLM+M+GR+KNL+  V   SQIYFPSWVYEQ+ +G D++ +GD TE+EKK++KKMII
Sbjct  596   FGMLLMDMIGRKKNLSELVVDASQIYFPSWVYEQVCEGNDLEVLGDTTEQEKKITKKMII  655

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             VA WCIQ+ P +RPSM +V+  + E DVE L+M+PKPFL+  +     +   N  N  S
Sbjct  656   VASWCIQLKPEDRPSMHEVV-KMLETDVESLQMSPKPFLTTSQQMPKHDDVANQSNPSS  713



>ref|XP_009340420.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Pyrus 
x bretschneideri]
Length=681

 Score =   484 bits (1246),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 241/364 (66%), Positives = 285/364 (78%), Gaps = 3/364 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + L R   G+      +VYK RRRHLS Y TIE +L    N MPIRYSY +IK+MT  FK
Sbjct  311   FFLARLLFGVPIAAVFLVYKWRRRHLSMYSTIEDFLQRDKNFMPIRYSYSDIKQMTRKFK  370

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGGYG+VFKG LRSG FVA+K++GKSKA GQ+FISE+ATIG IHH NVVRL+G+CV
Sbjct  371   DKLGEGGYGSVFKGKLRSGRFVAIKVLGKSKANGQDFISEIATIGTIHHVNVVRLVGYCV  430

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+YEFM NGSL+KYI+ KE S+ L+ +KM++IS GVA+GI+YLH+GC M+ILHF
Sbjct  431   EGSKRALVYEFMANGSLDKYIYSKEGSVPLTIDKMYEISFGVAQGIEYLHQGCTMQILHF  490

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF  KVSDFGLAKLYPV++S+V+LTAARGTMGY+APEL Y+NIGG+SHK
Sbjct  491   DIKPHNILLDENFKAKVSDFGLAKLYPVDNSIVTLTAARGTMGYIAPELFYKNIGGVSHK  550

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM  RRKNLN  VE  SQIYFP WVY+Q   G D++M + TEEEK V +
Sbjct  551   ADVYSFGMLLMEMASRRKNLNTTVEHSSQIYFPLWVYDQYNVGNDLEMDNVTEEEKNVIR  610

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSF--PNA  1080
             KM+I ALWCIQM P++RPSM KVI  +   DVE L+M P+P L P E P        P  
Sbjct  611   KMVITALWCIQMKPTDRPSMHKVI-EMLGGDVECLQMPPRPSLCPQETPVAMGDIQDPIC  669

Query  1081  QNVE  1092
              NVE
Sbjct  670   SNVE  673



>ref|XP_011047634.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X1 [Populus euphratica]
Length=728

 Score =   485 bits (1249),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 236/359 (66%), Positives = 291/359 (81%), Gaps = 2/359 (1%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGE  201
             F LGL  L++ ++Y  RRRHLS YDTIE +L   +NLMP+RYSY EIK++TN+FK KLGE
Sbjct  360   FLLGLPCLVTYIIYTWRRRHLSMYDTIEEFLQTNDNLMPVRYSYSEIKKITNDFKEKLGE  419

Query  202   GGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKR  381
             GG+G+V+KG LRSG F AVK++  SKA GQ+F +EV TIGRI+H NVV+LIGF  EGSKR
Sbjct  420   GGFGSVYKGKLRSGRFAAVKILSNSKANGQDFTNEVDTIGRIYHVNVVQLIGFTAEGSKR  479

Query  382   ALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPH  561
              L+YEFMPNGSL+KYIF K+ S  LS EKMFDISLG+ARGIDYLH+GCDM+ILHFDIKPH
Sbjct  480   GLIYEFMPNGSLDKYIFSKQGSTKLSKEKMFDISLGIARGIDYLHQGCDMQILHFDIKPH  539

Query  562   NILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYS  741
             NILLDE F PK+SDFGLAKLYP  +++V LTAARGTMGY+APEL Y+NIGG+S+KADVYS
Sbjct  540   NILLDEKFVPKISDFGLAKLYPTNNNIVPLTAARGTMGYIAPELFYKNIGGVSYKADVYS  599

Query  742   FGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKKVSKKMII  918
             FGMLLM+M+GR+KNL+  V   SQIYFPSWVYEQ+ +G D++ +GD TE+EKK++KKMII
Sbjct  600   FGMLLMDMIGRKKNLSELVVDASQIYFPSWVYEQVCEGNDLEVLGDTTEQEKKITKKMII  659

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             VA WCIQ+ P +RPSM +V+  + E DVE L+M+PKPFL+  +     +   N  N  S
Sbjct  660   VASWCIQLKPEDRPSMHEVV-KMLETDVESLQMSPKPFLTTSQQMPKHDDVANQSNPSS  717



>ref|XP_011047635.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X2 [Populus euphratica]
 ref|XP_011047637.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like 
isoform X2 [Populus euphratica]
Length=726

 Score =   485 bits (1248),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 236/359 (66%), Positives = 291/359 (81%), Gaps = 2/359 (1%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGE  201
             F LGL  L++ ++Y  RRRHLS YDTIE +L   +NLMP+RYSY EIK++TN+FK KLGE
Sbjct  358   FLLGLPCLVTYIIYTWRRRHLSMYDTIEEFLQTNDNLMPVRYSYSEIKKITNDFKEKLGE  417

Query  202   GGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKR  381
             GG+G+V+KG LRSG F AVK++  SKA GQ+F +EV TIGRI+H NVV+LIGF  EGSKR
Sbjct  418   GGFGSVYKGKLRSGRFAAVKILSNSKANGQDFTNEVDTIGRIYHVNVVQLIGFTAEGSKR  477

Query  382   ALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPH  561
              L+YEFMPNGSL+KYIF K+ S  LS EKMFDISLG+ARGIDYLH+GCDM+ILHFDIKPH
Sbjct  478   GLIYEFMPNGSLDKYIFSKQGSTKLSKEKMFDISLGIARGIDYLHQGCDMQILHFDIKPH  537

Query  562   NILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYS  741
             NILLDE F PK+SDFGLAKLYP  +++V LTAARGTMGY+APEL Y+NIGG+S+KADVYS
Sbjct  538   NILLDEKFVPKISDFGLAKLYPTNNNIVPLTAARGTMGYIAPELFYKNIGGVSYKADVYS  597

Query  742   FGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKKVSKKMII  918
             FGMLLM+M+GR+KNL+  V   SQIYFPSWVYEQ+ +G D++ +GD TE+EKK++KKMII
Sbjct  598   FGMLLMDMIGRKKNLSELVVDASQIYFPSWVYEQVCEGNDLEVLGDTTEQEKKITKKMII  657

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             VA WCIQ+ P +RPSM +V+  + E DVE L+M+PKPFL+  +     +   N  N  S
Sbjct  658   VASWCIQLKPEDRPSMHEVV-KMLETDVESLQMSPKPFLTTSQQMPKHDDVANQSNPSS  715



>ref|XP_008378068.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=365

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 230/353 (65%), Positives = 289/353 (82%), Gaps = 2/353 (1%)
 Frame = +1

Query  10    ALG-RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             ALG R  +G+  +I +++YK ++RHLS Y  IE +L   NNLMPIRYSY +IK+MT  F+
Sbjct  5     ALGARTVIGVPCVIVLLIYKWKKRHLSMYVLIEEFLQSHNNLMPIRYSYSDIKKMTTGFR  64

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGGYG+V+KG LRSG FV +KM+GKSKA GQ+FI+EV TIGRIHH NVV+LIG+CV
Sbjct  65    DKLGEGGYGSVYKGKLRSGRFVGIKMLGKSKANGQDFINEVGTIGRIHHVNVVQLIGYCV  124

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+YEFM NGSL+++IF KE  +SLS ++ F+ISLGVARGIDYLH+GCDM+ILHF
Sbjct  125   EGSKRALVYEFMSNGSLDRHIFSKEGPVSLSCKRAFEISLGVARGIDYLHQGCDMQILHF  184

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLD+N+ PKVSDFGLA+L PV+DS ++LTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  185   DIKPHNILLDDNYVPKVSDFGLARLCPVDDSSLTLTAARGTIGYIAPELFYKNIGGVSNK  244

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             AD+YSFGMLLME+ G+RKNLN      SQIYFPSWVY+Q  +G DI+   ATEEE +++K
Sbjct  245   ADIYSFGMLLMEIAGKRKNLN-VAAHSSQIYFPSWVYDQFSEGNDIESEGATEEENEITK  303

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             KM+IVALWCIQM PS+RP+    +  + E ++E LEM PKPFL P E P  ++
Sbjct  304   KMLIVALWCIQMKPSDRPTSMNKVVEMLEGEIECLEMPPKPFLYPQEKPVVDD  356



>ref|XP_009335039.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=737

 Score =   485 bits (1249),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 291/349 (83%), Gaps = 2/349 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + +F  G   +I++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK
Sbjct  344   FQVVKFLFGFPCVIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFK  402

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGG+G+V+K  LRSG  VA+KM+GKSKA GQ+FI+EVATIGRIHH NVV+L+GFCV
Sbjct  403   DKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCV  462

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y+FMPNGS +K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHF
Sbjct  463   EGSKRALVYDFMPNGSFDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHF  522

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF PKVSDFGLA+L P+++S+VSLTA RGT+GY+APE  Y+NIGG+S+K
Sbjct  523   DIKPHNILLDENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPEFFYKNIGGVSYK  582

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM G+RKNLN  +E  SQIYFP+WV++QL  G D+ +GDATEEEKK+ K
Sbjct  583   ADVYSFGMLLMEMAGKRKNLNANIEHSSQIYFPTWVFDQLSGGNDLTIGDATEEEKKIIK  642

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KMI+VA WCIQM PS+RPSM KV+  + E ++E L+M PK FL P +VP
Sbjct  643   KMIVVASWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKLFLYPQQVP  690



>ref|XP_009335117.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Pyrus x bretschneideri]
Length=386

 Score =   472 bits (1215),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 279/345 (81%), Gaps = 1/345 (0%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + +GR  LG+ FLI+ ++Y+ RRRHLS +  IE +L   NN MPIRYSY +IKRMTN FK
Sbjct  40    HLVGRLLLGVPFLIAFLIYRWRRRHLSGFSIIEDFLQTENNFMPIRYSYSDIKRMTNKFK  99

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLG+GGYG+VFKG LRSG FVA+K++G  K  GQ+F SEVATIGRIHH NVV+L+G+CV
Sbjct  100   DKLGQGGYGSVFKGKLRSGRFVAIKLLGTPKNNGQDFTSEVATIGRIHHVNVVQLVGYCV  159

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             E SKRAL+Y+FMPN SL+KYI+ KE SI LS +KM++I+ GVARGI+YLH+GCDM+ILHF
Sbjct  160   EASKRALVYDFMPNSSLDKYIYSKEGSIPLSCKKMYEIAFGVARGIEYLHQGCDMQILHF  219

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF+PK+SDFGLAKLYPV++S+V+LTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  220   DIKPHNILLDENFNPKISDFGLAKLYPVDNSIVTLTAARGTIGYIAPELFYKNIGGVSYK  279

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKD-IDMGDATEEEKKVS  903
             ADVYSFGMLLMEM  RRKN +   E  SQ YFP W Y+Q  +G D ++MG+ TEEEK + 
Sbjct  280   ADVYSFGMLLMEMASRRKNFSTTAEHSSQDYFPLWAYDQYSEGNDLLEMGNVTEEEKIMI  339

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLS  1038
             KKM++ A WCIQM PS+RP M KVI+ML  +   L    PKPF S
Sbjct  340   KKMVMTAFWCIQMKPSDRPLMDKVIQMLGGDVENLKLPPPKPFFS  384



>ref|XP_008344514.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=396

 Score =   472 bits (1215),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 231/350 (66%), Positives = 277/350 (79%), Gaps = 1/350 (0%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + R  LG+  +   +VYK RRRH S Y TIE +L   NN MPIRYSY EIK+MT  F 
Sbjct  22    FLIVRLLLGVPVVTVFLVYKWRRRHWSMYSTIEDFLQCNNNFMPIRYSYSEIKKMTRKFN  81

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGE G+G+VFKG LRSG FVA+K++GK KA GQ+FISE+ATIGRIHH NVV+L+G+CV
Sbjct  82    DKLGEXGFGSVFKGKLRSGRFVAIKVLGKXKANGQDFISEIATIGRIHHANVVQLVGYCV  141

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
              GSKRAL+Y+FMPNGSL+KYI+ KE SI LS + M++ISLGVA+GI+YLH+GCDM+ILHF
Sbjct  142   XGSKRALVYDFMPNGSLDKYIYSKEGSIPLSIKNMYEISLGVAQGIEYLHQGCDMQILHF  201

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF  K+SDFGLAKLYPV++S+VSLTAARGTMGY+APEL Y+NIGG+S+K
Sbjct  202   DIKPHNILLDENFKAKISDFGLAKLYPVDNSIVSLTAARGTMGYIAPELFYKNIGGVSYK  261

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM  RRKN    VE  SQ +FP WVY+Q   G D++M + TEEEKKV +
Sbjct  262   ADVYSFGMLLMEMASRRKNWKAXVEHSSQXFFPLWVYDQYIVGNDLEMDNVTEEEKKVIR  321

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             KM+I ALWCIQM PS+RPSM KVIEML      L     +P L P E+P 
Sbjct  322   KMVITALWCIQMKPSDRPSMSKVIEMLGGNVECLQMPL-RPSLCPQEMPA  370



>ref|XP_007021970.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13495.1| PR5-like receptor kinase [Theobroma cacao]
Length=622

 Score =   480 bits (1236),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 226/322 (70%), Positives = 276/322 (86%), Gaps = 1/322 (0%)
 Frame = +1

Query  13   LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
            L R  LG+  LI++V+ KLR+RHLS  D IE++L   NNLMPIRYSYFEIKRMT+ FK+K
Sbjct  279  LLRTFLGISCLIALVIQKLRKRHLSMDDEIENFLQSHNNLMPIRYSYFEIKRMTDGFKNK  338

Query  193  LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
            LG+GGYG+VFKG LRSG  VA+K++ KSKA GQ+FI+EVATIGRIHH NVV+LIGFCV+G
Sbjct  339  LGQGGYGSVFKGKLRSGQLVAIKLLNKSKANGQDFINEVATIGRIHHVNVVKLIGFCVKG  398

Query  373  SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
            SK+AL+Y+FM NGSL+K IF   ES +LS +KMF+I+LGVARGI+YLHRGC+M+ILHFDI
Sbjct  399  SKQALVYDFMQNGSLDKIIF-STESNTLSWQKMFEIALGVARGIEYLHRGCEMQILHFDI  457

Query  553  KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
            KPHNILLDENF+PKVSDFGLAKLY V+D +VSLTAARGT+GYMAPEL Y+NIGGIS+KAD
Sbjct  458  KPHNILLDENFTPKVSDFGLAKLYSVDDDIVSLTAARGTLGYMAPELFYKNIGGISYKAD  517

Query  733  VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
            VYSFGM+LME+VGRRKNLN   E  SQIYFPSW+Y++ ++G  I++GD TE E K+ +KM
Sbjct  518  VYSFGMMLMEIVGRRKNLNASAEYSSQIYFPSWIYDRFEEGDIIELGDVTENENKIMRKM  577

Query  913  IIVALWCIQMNPSERPSMKKVI  978
            +IVA WC QM P++RPSM K +
Sbjct  578  VIVAFWCTQMRPTDRPSMSKAL  599



>ref|XP_008370381.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Malus domestica]
Length=434

 Score =   473 bits (1218),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 235/379 (62%), Positives = 293/379 (77%), Gaps = 9/379 (2%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + L  F  G+L + + ++Y  RRRHLS + TIE +L   NN M IRYSY +IK+MT  FK
Sbjct  60    FFLAXFVFGVLVVTAFLIYTWRRRHLSMHXTIEDFLQCNNNFMXIRYSYSDIKKMTRKFK  119

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              +LG+GG+G+VFKG LRSG FVAVK++GK K   Q+FISE+ATIGRIHH NVV+L+G+CV
Sbjct  120   DRLGKGGFGSVFKGKLRSGRFVAVKVLGKPKXDDQDFISEIATIGRIHHANVVQLVGYCV  179

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y+FMPNGSL+KYI+ KE S+ L+ + M++ISLGVA+GI+YLH+GC+M+ILHF
Sbjct  180   EGSKRALVYDFMPNGSLDKYIYSKEGSLPLTIKTMYEISLGVAQGIEYLHQGCEMQILHF  239

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF  K+SDFGLAKLYPV++S+VSLTAARGTMGY+APEL Y+NIGG+S+K
Sbjct  240   DIKPHNILLDENFKAKISDFGLAKLYPVDNSIVSLTAARGTMGYIAPELFYKNIGGVSYK  299

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM  RRKNLN  VE  SQIYFP WVY+Q   G D++M + TEEEKKV +
Sbjct  300   ADVYSFGMLLMEMASRRKNLNAMVEHSSQIYFPLWVYDQYIVGNDLEMBNITEEEKKVIR  359

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             KM+I ALWCIQM PS+RPSM KV+EML  +   L     KP L P E P        A +
Sbjct  360   KMVITALWCIQMKPSDRPSMSKVVEMLGGDVECLQMPL-KPSLCPQEAPV------XAGD  412

Query  1087  VESPLLSDNPVRSSSFEVC  1143
             ++   L  NP+ S++   C
Sbjct  413   IQDNEL--NPICSNAXLTC  429



>ref|XP_004308818.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   481 bits (1237),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 235/359 (65%), Positives = 293/359 (82%), Gaps = 3/359 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             G+   G  F+I++++YK RRRH S Y TIE +L   +N MPIRYSY  IK+M+  FK KL
Sbjct  271   GKIIFGGPFVIALLIYKWRRRHWSTYSTIEDFLHS-DNFMPIRYSYSNIKKMSAGFKDKL  329

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             G GGYG+VFK  LRSG F A+K++ KS A G++F+SEVATIGRIHH NVV+L+G+CVEGS
Sbjct  330   GVGGYGSVFKCKLRSGHFGAIKLLDKSNANGEDFMSEVATIGRIHHVNVVQLVGYCVEGS  389

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             KRAL+Y+FMPNGSL++YI+ KEESI+LS++KM++I++GVA+GI+YLH+GC+M+ILHFDIK
Sbjct  390   KRALVYDFMPNGSLDRYIYSKEESITLSYKKMYEIAVGVAQGIEYLHQGCEMQILHFDIK  449

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF PK+SDFGLAKLYP  +S+VS  AARGTMGY+APEL Y+NIGG+S+KADV
Sbjct  450   PHNILLDENFVPKISDFGLAKLYPANNSIVSSMAARGTMGYIAPELFYKNIGGVSYKADV  509

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKNLN +V+  SQIYFPSWV++Q  +GKD+++GDAT EEKK+ +KMI
Sbjct  510   YSFGMLLMEMASRRKNLNAYVDHSSQIYFPSWVHDQYNEGKDLEIGDATAEEKKLIRKMI  569

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVE  1092
             +VALWCIQM PS+RPSMK+V   +   DVE LEM PKP L P   P   N  P   NVE
Sbjct  570   VVALWCIQMKPSDRPSMKRV-TQMLVGDVENLEMPPKPSLCPQPTPV-SNLIPTCSNVE  626



>ref|XP_008385065.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=432

 Score =   473 bits (1217),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 224/322 (70%), Positives = 270/322 (84%), Gaps = 0/322 (0%)
 Frame = +1

Query  13   LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
            L RF  G L + + ++Y  RRRHLS Y TIE +L   NN MPIRYS+ +IK+MT  FK K
Sbjct  83   LXRFVFGGLVVTTFLIYTWRRRHLSMYSTIEDFLQCNNNFMPIRYSHSDIKKMTRRFKDK  142

Query  193  LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
            LG+GG+G+VFKG LRSG FVAVK++GK KA GQ+FISE+ATIGRI+H NVV+L+G+CVEG
Sbjct  143  LGKGGFGSVFKGKLRSGRFVAVKVLGKPKADGQDFISEIATIGRIYHANVVQLVGYCVEG  202

Query  373  SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
            SKRAL+Y+FMPNGSL+KYI+ KE S+ L+ + M++ISLGVA+GI+YLH+GC M+ILHFDI
Sbjct  203  SKRALVYDFMPNGSLDKYIYSKEGSLPLTIKTMYEISLGVAQGIEYLHQGCQMQILHFDI  262

Query  553  KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
            KPHNILLDENF  KVSDFGLAKLYPV+ S+VSLTAARGTMGY+APEL Y+NIGG+S+KAD
Sbjct  263  KPHNILLDENFKAKVSDFGLAKLYPVDKSIVSLTAARGTMGYIAPELFYKNIGGVSYKAD  322

Query  733  VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
            VYSFGMLLMEM  RRKNLN  VE  SQIYFP WVY+Q   G D++M + TEEEKKV +KM
Sbjct  323  VYSFGMLLMEMASRRKNLNATVEHSSQIYFPLWVYDQYIMGNDLEMDNVTEEEKKVIRKM  382

Query  913  IIVALWCIQMNPSERPSMKKVI  978
            +I ALWCIQM PS+RPSM KV+
Sbjct  383  VITALWCIQMKPSDRPSMSKVV  404



>ref|XP_008245839.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=645

 Score =   481 bits (1237),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 231/353 (65%), Positives = 288/353 (82%), Gaps = 2/353 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R  LG   LI++++YK +RRHLS Y  IE +L   NNLMPIRYSY +I++MT  FK KL
Sbjct  266   ARAILGAPCLIALLIYKFKRRHLSMYGNIEEFLQSHNNLMPIRYSYSDIRKMTKGFKEKL  325

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG+V+KG LRS   VA+K++GKSKA GQEFI+EVATIGRIHH NVV+LIG+CVEGS
Sbjct  326   GEGGYGSVYKGKLRSRRLVAIKILGKSKANGQEFINEVATIGRIHHVNVVQLIGYCVEGS  385

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             KRAL+YEFM NGSL+K+IF KE   +L+++K F+ISLGVARGIDYLHRGC+M+I HFDIK
Sbjct  386   KRALVYEFMSNGSLDKHIFSKEGPSTLNYKKAFEISLGVARGIDYLHRGCEMQIFHFDIK  445

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILL+E F PKVSDFGLA+L P+++S ++LTAARGT+GY+APEL Y+NIGG+S+KAD+
Sbjct  446   PHNILLNETFVPKVSDFGLARLCPLDESSLTLTAARGTIGYIAPELFYKNIGGVSNKADI  505

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLME+ G+RKNLN      SQIYFPSWVY+Q  +GKDI++ DATEEE K++KKM+
Sbjct  506   YSFGMLLMEIAGKRKNLNAIAAHSSQIYFPSWVYDQFNEGKDIEIEDATEEEMKITKKML  565

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT--DENS  1068
             IVALWCIQM PSERP+    +  + E + E L+M PKPFL P + P   DE++
Sbjct  566   IVALWCIQMKPSERPTSMSKVVQMLEGETEALQMPPKPFLYPQDKPVVDDEDN  618



>ref|XP_008345516.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=597

 Score =   479 bits (1232),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 237/371 (64%), Positives = 287/371 (77%), Gaps = 17/371 (5%)
 Frame = +1

Query  28    LGLLFLISIV----------VYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTN  177
             +GLLFL  I+          +Y+ RRRHLS Y TIE +L   NN MPIRYSY +IK+MT 
Sbjct  220   IGLLFLAKIIFGVPVVTAFLIYRWRRRHLSMYSTIEDFLQCDNNFMPIRYSYSDIKKMTR  279

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FKHKLGEGG+GTVFKG LRSG FVAVK++GK KA GQ+FISE+ATIGRIHH NVV+L+G
Sbjct  280   RFKHKLGEGGFGTVFKGKLRSGRFVAVKVLGKPKANGQDFISEIATIGRIHHANVVQLVG  339

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             +CVEGSKRAL+Y+FMPNGSL+KYI+ KE S+ L+ + M++ISLGVA+GI+YLH+GC+M+I
Sbjct  340   YCVEGSKRALVYDFMPNGSLDKYIYSKEGSLPLTIKNMYEISLGVAQGIEYLHQGCEMQI  399

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILLD+NF  KVSDFGLAKLYP+++S+V LTAARGT+GY+APEL Y+NIGG+
Sbjct  400   LHFDIKPHNILLDQNFKAKVSDFGLAKLYPIDNSIVPLTAARGTLGYIAPELFYKNIGGV  459

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
             S+KADVYSFGMLLMEM  RRKN N  VE  SQ YFP WVY+Q   G D++M + TEEEKK
Sbjct  460   SYKADVYSFGMLLMEMASRRKNWNARVEHSSQNYFPVWVYDQYIVGNDLEMDNVTEEEKK  519

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD------  1059
             V +KM+I ALWCIQM PS+RPSM KV++ML  +   L     +P L P E P        
Sbjct  520   VIRKMVITALWCIQMKPSDRPSMSKVVKMLGGDVECLQMPL-RPSLCPQETPMTVGNIQV  578

Query  1060  ENSFPNAQNVE  1092
               S P   NVE
Sbjct  579   NKSNPICSNVE  589



>ref|XP_008376288.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=424

 Score =   472 bits (1215),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 233/354 (66%), Positives = 281/354 (79%), Gaps = 4/354 (1%)
 Frame = +1

Query  40    FLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTV  219
             F+ + ++Y  +RRHLS Y++IE +L G  N +PIRYSY  IK+M+N FK KLGEGGYG+V
Sbjct  65    FVTAFLIYTWKRRHLSMYNSIEEFLHGEKNFVPIRYSYSNIKKMSNKFKEKLGEGGYGSV  124

Query  220   FKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEF  399
             FK  LRSG F A+KM+ K K  GQ+FISEV TIGRIHH NVV+L+G+CVEGSK AL+Y+F
Sbjct  125   FKARLRSGRFAAIKMLDKPKGNGQDFISEVNTIGRIHHVNVVQLVGYCVEGSKHALVYDF  184

Query  400   MPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDE  579
             M NGSL+KYI+ KE SI LS +  ++ISLGVARGI YLH GCDM+ILHFDIKPHNILLDE
Sbjct  185   MLNGSLDKYIYCKEGSIPLSCKTTYEISLGVARGIKYLHEGCDMQILHFDIKPHNILLDE  244

Query  580   NFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLM  759
             NF PK+SDFGLAKLYPV++S+VSLTAARGTMGYMAPEL Y+NIGG+S KADVYSFGMLLM
Sbjct  245   NFVPKISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADVYSFGMLLM  304

Query  760   EMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQ  939
             EM  RRKNLN   E  SQ+YFPSWVY Q  +GKD ++G+  EEEK + +KMII ALWCIQ
Sbjct  305   EMASRRKNLNALAEHSSQLYFPSWVYNQYNEGKDFEVGEVLEEEKSLIRKMIITALWCIQ  364

Query  940   MNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT---DENSFPNAQNVE  1092
             + PS+RPSMK+V+  + E DVELL M P+P L P E+P    ++N  P    VE
Sbjct  365   LKPSDRPSMKEVL-QMLEGDVELLRMPPEPLLYPQEMPVGAPNDNPNPTYSKVE  417



>ref|XP_008232089.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=385

 Score =   471 bits (1211),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 240/362 (66%), Positives = 287/362 (79%), Gaps = 4/362 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R   G+  LI  V+YK RRRHLS+Y  IE +L   +N +PIRYSY EIK+MT+ FK KL
Sbjct  17    ARLIFGVPCLIVFVIYKWRRRHLSSYSIIEDFLQSDSNFLPIRYSYSEIKKMTSKFKKKL  76

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG+VFKG LRSG FVA+K++GK+K  GQ+F SEVATIGRIHH NVV+L+G+CVEG 
Sbjct  77    GEGGYGSVFKGKLRSGRFVAIKLLGKAKGNGQDFTSEVATIGRIHHVNVVQLVGYCVEGL  136

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
              RAL+Y+FMPNGSL+KYI+ KEES+ LS  KM++ISLGVARGI+YLHRGCDM+ILHFDIK
Sbjct  137   NRALVYDFMPNGSLDKYIYSKEESMPLSCMKMYEISLGVARGIEYLHRGCDMQILHFDIK  196

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PK+SDFGLAKLYP+++S+VSLTAARGTMGY+APEL Y+NIGG+S+KADV
Sbjct  197   PHNILLDENFNPKISDFGLAKLYPIDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADV  256

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKN +  VE  +QIYFP W Y+Q   G D++M D  EEEKKV KKM+
Sbjct  257   YSFGMLLMEMASRRKNWSTMVEHSNQIYFPLWAYDQYNKGNDLEMRDVNEEEKKVIKKMV  316

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV---PTDENSFPNAQN  1086
             I ALWCIQM PS+RPSM KVIEML  +   L     +PFL P E+      EN  P + N
Sbjct  317   ITALWCIQMKPSDRPSMNKVIEMLGGDGESLKMPL-RPFLYPQEMHVGAVQENLNPISSN  375

Query  1087  VE  1092
              E
Sbjct  376   GE  377



>ref|XP_009370623.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Pyrus 
x bretschneideri]
Length=677

 Score =   481 bits (1238),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 237/379 (63%), Positives = 294/379 (78%), Gaps = 1/379 (0%)
 Frame = +1

Query  1     ISYAL-GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTN  177
             I Y L  R  LG+  LI +++YK +RRHLS Y  IE +L   NNLMPIRYSY +IK+MT 
Sbjct  291   ILYVLPARTLLGISCLIVLLIYKWKRRHLSMYVLIEEFLQSHNNLMPIRYSYSDIKKMTR  350

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGGYG+V+KG LRSG FVA+KM+GKSKA GQ+FI+EV TIGRIHH NVV+LIG
Sbjct  351   GFKSKLGEGGYGSVYKGKLRSGRFVAIKMLGKSKANGQDFINEVGTIGRIHHVNVVQLIG  410

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             +C EGSKRAL+YEFM NGSL+++IFPKE SI LS    F+ISLGVARG+DYLHRGCDM+I
Sbjct  411   YCAEGSKRALVYEFMSNGSLDRHIFPKEGSIPLSCMMSFEISLGVARGVDYLHRGCDMQI  470

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
              HFDIKPHNILLD+NF PKVSDFGLA+L P++DS ++LTAARGT+GY+APEL Y+NIG +
Sbjct  471   FHFDIKPHNILLDDNFVPKVSDFGLARLCPLDDSSLTLTAARGTIGYIAPELFYKNIGSV  530

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
             S++AD+YSFGMLLME+ GRRKNLN      SQIYFPSWVY+Q   G D+++ +A EEEK+
Sbjct  531   SNRADIYSFGMLLMEIAGRRKNLNAVAAHTSQIYFPSWVYDQFSKGNDVEIENAIEEEKE  590

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN  1077
             ++KKM+IVALWCIQM PS+RP+    +  + E ++E +EM PKPFL P E P  ++   +
Sbjct  591   ITKKMLIVALWCIQMKPSDRPTSMNKVVEMLEGEIECIEMPPKPFLYPQEKPVVDDEDDS  650

Query  1078  AQNVESPLLSDNPVRSSSF  1134
                  S L  D+   S S 
Sbjct  651   ETTWSSGLSKDDVEESPSL  669



>ref|XP_008345497.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=455

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 236/374 (63%), Positives = 288/374 (77%), Gaps = 3/374 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + R  LG+  +   +VYK RRRH S Y TIE +L   NN MPIRYSY EIK+MT  F 
Sbjct  81    FLIVRLLLGVPVVTVFLVYKWRRRHWSMYSTIEDFLQCNNNFMPIRYSYSEIKKMTRKFN  140

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGE G+G+VFKG LRSG FVA+K++GK KA GQ+FISE+ATIGRIHH NVV+L+G+CV
Sbjct  141   DKLGEDGFGSVFKGKLRSGRFVAIKVLGKPKANGQDFISEIATIGRIHHANVVQLVGYCV  200

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             +GSKRAL+Y+FMPNGSL+KYI+ KE SI LS + M++ISLGVA+GI+YLH+GCDM+ILHF
Sbjct  201   DGSKRALVYDFMPNGSLDKYIYSKEGSIPLSIKNMYEISLGVAQGIEYLHQGCDMQILHF  260

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF  K+SDFGLAKLYPV++S+VSLTAARGTMGY+APEL Y+NIGG+S+K
Sbjct  261   DIKPHNILLDENFKAKISDFGLAKLYPVDNSIVSLTAARGTMGYIAPELFYKNIGGVSYK  320

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM  RRKN    VE  SQI+FP WVY+Q   G D++M + TEEEKKV +
Sbjct  321   ADVYSFGMLLMEMASRRKNWKATVEHSSQIFFPLWVYDQYIVGNDLEMDNVTEEEKKVIR  380

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             KM+I ALWCIQM PS+RPSM KVIEML      L     +P L P E+P       +  N
Sbjct  381   KMVITALWCIQMKPSDRPSMSKVIEMLGGNVECLQMPL-RPSLCPQEMPATMGDIQD--N  437

Query  1087  VESPLLSDNPVRSS  1128
               +P+ S+  +  S
Sbjct  438   KLNPICSNXELTCS  451



>ref|XP_003634140.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=385

 Score =   470 bits (1209),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 231/365 (63%), Positives = 299/365 (82%), Gaps = 5/365 (1%)
 Frame = +1

Query  10    ALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKH  189
              +GR  LG+L L + ++YK  RRHLS  D+IE +L    NL PI+YSY +IK+MT+NF +
Sbjct  11    VIGRTMLGMLCLFAYLIYKFHRRHLSLDDSIEEFLRSQKNLQPIKYSYSDIKKMTHNFAN  70

Query  190   KLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             KLG+GG+G+V+KG LRSG  VAVK++  SKA GQ+FI+EVATIGRIHH NVVRL+GFCV+
Sbjct  71    KLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQ  130

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             GSK AL+Y+FMPNGSL+K+IF KEE+ + LS E+++ ++LGV RGI+YLH+GCDM+ILHF
Sbjct  131   GSKWALIYDFMPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHF  190

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  191   DIKPHNILLDEDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGGVSYK  250

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEMVGRRKN+N      SQIYFPSW+Y++   G +ID+GDATE+EKK+ K
Sbjct  251   ADVYSFGMLLMEMVGRRKNVNANAAHSSQIYFPSWIYDRYDQGDNIDLGDATEDEKKLVK  310

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             KM+IVALWCIQM P +RPSM K +  + E +VELLEM PKP L  +E+  +++    +  
Sbjct  311   KMVIVALWCIQMKPIDRPSMSKAL-EMLEGEVELLEMPPKPTLYSEEMSVEDHM---SNP  366

Query  1087  VESPL  1101
             +E+P+
Sbjct  367   IEAPI  371



>ref|XP_007161172.1| hypothetical protein PHAVU_001G048500g, partial [Phaseolus vulgaris]
 gb|ESW33166.1| hypothetical protein PHAVU_001G048500g, partial [Phaseolus vulgaris]
Length=459

 Score =   473 bits (1216),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 230/351 (66%), Positives = 288/351 (82%), Gaps = 3/351 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
              GL FLI I + K R+RH+S Y+ IE+YL   N+  PIRYSY EIK+MT  FK+KLGEGG
Sbjct  111   FGLPFLIVIFICKWRKRHMSMYENIENYLE-QNSWAPIRYSYKEIKKMTAGFKYKLGEGG  169

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             +G+VFK  LRSGP+VA+KM+ KSK  GQ+FISEVATIGRIHH NVV+LIGFCV GS RAL
Sbjct  170   FGSVFKAKLRSGPYVAIKMLDKSKGNGQDFISEVATIGRIHHQNVVQLIGFCVSGSNRAL  229

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFM NGSL+K+IF K+ S+ LS+EK+++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  230   VYEFMSNGSLDKFIFSKDGSVHLSYEKIYNISIGVARGIAYLHHGCEMQILHFDIKPHNI  289

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF PKVSDFGLAKLYP+E+S+V++TAARGT+GYMAPEL Y+NIGGISHKADVYSFG
Sbjct  290   LLDENFIPKVSDFGLAKLYPIENSIVTMTAARGTIGYMAPELFYKNIGGISHKADVYSFG  349

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM  +RKNLNP  +  SQ+YFP W+Y+ +++G+D+D+ D TEE  K++ KMIIVAL
Sbjct  350   MLLMEMASKRKNLNPHADHSSQLYFPLWIYDHIREGEDVDVEDVTEEGNKIA-KMIIVAL  408

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNA  1080
             WCIQ+ P++RPSM +V+  + E D+E LE+ PKP L P++    E    N+
Sbjct  409   WCIQLKPNDRPSMNRVV-EMLEGDIEDLEIPPKPILFPEDETVREYQTTNS  458



>ref|XP_010247812.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
Length=394

 Score =   469 bits (1208),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 228/363 (63%), Positives = 293/363 (81%), Gaps = 4/363 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R   G++     ++YKLRRRHLS  ++IE  L   NNLMPIRYSY  IK++T +FK KL
Sbjct  8     ARTICGIMCFFPFLIYKLRRRHLSIDESIEDLLQSHNNLMPIRYSYSSIKKVTKSFKEKL  67

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             G+GGYG+VFKG L+SG  VA+KM+ ++K  GQ+FI+EVATIGRIHH NVV+LIGFC EGS
Sbjct  68    GQGGYGSVFKGKLKSGHHVAIKMLDQTKGNGQDFINEVATIGRIHHVNVVQLIGFCSEGS  127

Query  376   KRALLYEFMPNGSLEKYIFPKEES--ISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
             KRAL+YEFMPNGSL+KYI  ++E   ISLS EKM  I LGV RGI+YLHRGC+ +ILHFD
Sbjct  128   KRALIYEFMPNGSLDKYISARQEENIISLSWEKMLGIVLGVGRGIEYLHRGCNTQILHFD  187

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAA-RGTMGYMAPELCYRNIGGISHK  726
             IKPHNILLD+NF PK+SDFGLAK +  +DS+VSLTAA RGT+GY+APE+ Y+NIGGIS+K
Sbjct  188   IKPHNILLDDNFVPKISDFGLAKFFSTDDSIVSLTAAPRGTIGYIAPEMIYKNIGGISNK  247

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLL+E+ GR+K +N   +  SQ YFPSW+Y++L  G+DI++GDAT++EK ++K
Sbjct  248   ADVYSFGMLLLEITGRKKAINALRDHSSQFYFPSWIYDRLCHGEDIEIGDATDDEKTIAK  307

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             K++IVALWCIQMNP +RPSM KV+  + E+D+E+L+M P+PFLSP E+P D+ SF  + +
Sbjct  308   KLVIVALWCIQMNPVDRPSMSKVV-DMLEDDIEVLQMPPRPFLSPPELPIDDTSFDTSHS  366

Query  1087  VES  1095
               S
Sbjct  367   ETS  369



>ref|XP_009348964.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=430

 Score =   471 bits (1211),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 236/350 (67%), Positives = 295/350 (84%), Gaps = 2/350 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + +F  G   LI++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK
Sbjct  50    FQVVKFLFGFPCLIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFK  108

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGG+G+V+K  LRSG  VA+KM+G+SKA GQ+FI+EVATIGRIHH NVV+L+GFCV
Sbjct  109   DKLGEGGFGSVYKAKLRSGRLVAIKMLGRSKANGQDFINEVATIGRIHHVNVVQLVGFCV  168

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGS+RAL+Y+FMPNGSL+K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHF
Sbjct  169   EGSERALVYDFMPNGSLDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHF  228

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF PKVSDFGLA+L P+++S+VSLTA RGT+GY+APEL Y+NIGG+S+K
Sbjct  229   DIKPHNILLDENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPELFYKNIGGVSYK  288

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM G+RKNLN  +E  SQIYFP+WV++QL  G D+ +GDATEEEKK+ K
Sbjct  289   ADVYSFGMLLMEMAGKRKNLNANIEHSSQIYFPTWVFDQLSGGNDLTIGDATEEEKKIIK  348

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             KMIIVALWCIQM PS+RPSM KV+  + E ++E L+M PKPFL P ++P 
Sbjct  349   KMIIVALWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKPFLYPQQMPV  397



>ref|XP_006601168.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Glycine max]
Length=643

 Score =   478 bits (1230),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 233/343 (68%), Positives = 287/343 (84%), Gaps = 2/343 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             L +   I I+  K R+RHLS +++IE+YL   NNLMPIRYSY E+K+M   FK KLGEGG
Sbjct  301   LTMPLFIVILTCKWRKRHLSMFESIENYLE-QNNLMPIRYSYKEVKKMAGGFKDKLGEGG  359

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+VFKG LRSG  VA+KM+GKSK  GQ+FISEVATIGR +H N+V+LIGFCV GSKRAL
Sbjct  360   YGSVFKGKLRSGSCVAIKMLGKSKGNGQDFISEVATIGRTYHQNIVQLIGFCVHGSKRAL  419

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF K+ESI LS++++++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  420   VYEFMPNGSLDKFIFSKDESIHLSYDRIYNISIGVARGIAYLHYGCEMQILHFDIKPHNI  479

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF+PKVSDFGLAKLYP+++S+V  TAARGT+GYMAPEL Y NIGGISHKADVYS+G
Sbjct  480   LLDENFTPKVSDFGLAKLYPIDNSIVPRTAARGTIGYMAPELFYNNIGGISHKADVYSYG  539

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM G+RKNLNP  E+ SQ++FP W+Y  ++DG+DI+M D TEEEKK+ KKMIIVAL
Sbjct  540   MLLMEMAGKRKNLNPHAERSSQLFFPFWIYNHIRDGEDIEMEDVTEEEKKMVKKMIIVAL  599

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             WCIQ+ P++RPSM +V+  + E D+E LE+ PKP L P E  T
Sbjct  600   WCIQLKPNDRPSMNEVV-EMLEGDIENLEIPPKPTLYPSETIT  641



>ref|XP_010099998.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB81103.1| putative receptor-like protein kinase [Morus notabilis]
Length=601

 Score =   477 bits (1227),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 227/311 (73%), Positives = 265/311 (85%), Gaps = 2/311 (1%)
 Frame = +1

Query  31   GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
            G+ FLI + +YK RRRHLS Y +IE +L   NNLMPIRYSY E+++MT  FK KLGEGG+
Sbjct  259  GISFLIGLGIYKWRRRHLSIYKSIEEFLQSHNNLMPIRYSYSEVRKMTKGFKTKLGEGGF  318

Query  211  GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
            G VFKG LRSG FVA+KM+GKSKA+GQ+F++EVATIGRIHH NVVRLIGFCVEGSKRAL+
Sbjct  319  GCVFKGKLRSGRFVAIKMLGKSKASGQDFVNEVATIGRIHHINVVRLIGFCVEGSKRALV  378

Query  391  YEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
            Y+FMPNGSLEKYIF +E  S SLS EK+FDISLG+ARGI+YLHRGCDM+ILHFDIKPHNI
Sbjct  379  YDFMPNGSLEKYIFLREGTSCSLSFEKIFDISLGIARGIEYLHRGCDMQILHFDIKPHNI  438

Query  568  LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
            LLDENF PK+SDFGLA+  P+++S+VSLTAARGT+GYMAPEL YRNIGG+SHKADVYSFG
Sbjct  439  LLDENFIPKISDFGLARPCPLDNSIVSLTAARGTIGYMAPELYYRNIGGVSHKADVYSFG  498

Query  748  MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKKVSKKMIIVA  924
            MLLMEM  RRKNLN   E  SQIYFP W+Y+Q   GKD++ M DA EEE K+ K+MIIV 
Sbjct  499  MLLMEMANRRKNLNADAENSSQIYFPLWIYDQFDQGKDLEIMEDAAEEELKMIKRMIIVG  558

Query  925  LWCIQMNPSER  957
            LWCIQ+ P +R
Sbjct  559  LWCIQLKPCDR  569



>ref|XP_008232094.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Prunus mume]
Length=352

 Score =   467 bits (1202),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 227/342 (66%), Positives = 274/342 (80%), Gaps = 1/342 (0%)
 Frame = +1

Query  70    RRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPF  249
             RRRHLS+Y  IE +L    N +PIRYSY EIK+MT  FK KLGEGGYG+VFKG LRSG F
Sbjct  1     RRRHLSSYSIIEDFLQSDINFLPIRYSYSEIKKMTGKFKDKLGEGGYGSVFKGKLRSGRF  60

Query  250   VAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYI  429
             VA+K++GK K  GQ+F SEVATIGRIHH NVV+L+G+CVEG  RAL+Y+FMPN SL+KYI
Sbjct  61    VAIKLLGKPKGNGQDFTSEVATIGRIHHVNVVQLVGYCVEGLNRALVYDFMPNSSLDKYI  120

Query  430   FPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFG  609
             + KEE++ LS +KM++ISLGVARGI+YLH+GCDM+ILHFDIKPHNILLDENF+PK+SDFG
Sbjct  121   YTKEENMPLSCKKMYEISLGVARGIEYLHQGCDMQILHFDIKPHNILLDENFNPKISDFG  180

Query  610   LAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLN  789
             LAKLY V++S+VSLTAARGTMGY+APEL Y+NIGG+S+KADVYSFGMLLMEM  RRKN +
Sbjct  181   LAKLYSVDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASRRKNFS  240

Query  790   PFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMK  969
               VE+ SQ YFP W Y+Q   G D++MGD  EEEKK+ KKM+I ALWCIQM PS+RPSM 
Sbjct  241   SMVERSSQTYFPLWAYDQYNKGNDLEMGDFNEEEKKIIKKMVITALWCIQMKPSDRPSMN  300

Query  970   KVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             KVIEML  +   L     +PFL P E+   +    N  ++ S
Sbjct  301   KVIEMLGGDVECLKMPI-RPFLYPQEMHAGDVQENNLNSIGS  341



>ref|XP_009335041.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
 ref|XP_009335045.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=556

 Score =   474 bits (1220),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 241/350 (69%), Positives = 294/350 (84%), Gaps = 2/350 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + RF  G   LI++++YK +RRHLS Y+ IE +L   N LMP+RYSY +IK+M   FK
Sbjct  176   FQVVRFLFGFPCLIALIIYKCKRRHLSMYENIEDFLQN-NQLMPVRYSYSDIKKMARGFK  234

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGG+G+V+K  LRSG  VA+KM+GKSKA GQ+FI+EV TIGRIHH NVV+LIGFCV
Sbjct  235   DKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKANGQDFINEVDTIGRIHHVNVVQLIGFCV  294

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y+FMPNGSL+K+IF ++  ISLS EKMF+ISLGVARGI+YLHRGCDM+ILHF
Sbjct  295   EGSKRALVYDFMPNGSLDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHF  354

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF PKVSDFGLA+L P+++S+VSLTAARGT+GYMAPE  Y+NIGG+S+K
Sbjct  355   DIKPHNILLDENFLPKVSDFGLARLCPLDNSIVSLTAARGTIGYMAPEFFYKNIGGVSYK  414

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEM G+RKNLN  +E LSQIYFP+WV+ QL  G D+ +GDATEEEKK+ K
Sbjct  415   ADVYSFGMLLMEMAGKRKNLNANIEHLSQIYFPTWVFNQLSGGNDLTIGDATEEEKKIIK  474

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             KMIIVALWCIQM PS+RPSM KV+  + E ++E L+M PKPFL P ++P 
Sbjct  475   KMIIVALWCIQMKPSDRPSMNKVV-EMLEGEIESLQMPPKPFLYPQQMPV  523



>ref|XP_009336987.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
 ref|XP_009336988.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=419

 Score =   469 bits (1207),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 228/350 (65%), Positives = 282/350 (81%), Gaps = 2/350 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + +GR  LG+ FLI+ ++Y+ RRRHLS +  IE +    NN MPIRYSY +IKRMTN FK
Sbjct  47    HLVGRLLLGVPFLIAFLIYRWRRRHLSGFSIIEDFQQTENNFMPIRYSYSDIKRMTNKFK  106

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLG+GGYG+VFKG LRSG FVA+K++G  K  GQ+F SEVATIGRIHH NVV+L+G+CV
Sbjct  107   DKLGQGGYGSVFKGKLRSGRFVAIKLLGTPKNNGQDFTSEVATIGRIHHVNVVQLVGYCV  166

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y FMPN SL+KYI+ KE SI LS +KM++I+ GVARGI+YLH+GCDM+ILHF
Sbjct  167   EGSKRALVYGFMPNSSLDKYIYSKEGSIPLSCKKMYEIAFGVARGIEYLHQGCDMQILHF  226

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF+PK+SDFGLAKLYPV++S+V+LTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  227   DIKPHNILLDENFNPKISDFGLAKLYPVDNSIVTLTAARGTIGYIAPELFYKNIGGVSYK  286

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKD-IDMGDATEEEKKVS  903
             ADVYSFGMLLMEM  RRKN +   E  SQ YFP W Y+Q   G D ++MG+ T EEK + 
Sbjct  287   ADVYSFGMLLMEMASRRKNFSTTAEHSSQDYFPLWAYDQYSKGNDLLEMGNVTGEEKIMI  346

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KKM++ A WCIQM PS+RPSM KVI  +   DVE L++ PKPF +  E+P
Sbjct  347   KKMVMTAFWCIQMKPSDRPSMDKVI-QMLGGDVENLKLPPKPFFNQQEMP  395



>ref|XP_003619232.1| Kinase-like protein [Medicago truncatula]
 gb|AES75450.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=423

 Score =   469 bits (1207),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/359 (64%), Positives = 292/359 (81%), Gaps = 3/359 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             RFSLG +    +++Y  R RH S Y+ IE +L G + LMPIRYSY EIK+MT  F+ KLG
Sbjct  58    RFSLGFIVFFVLLIYTCRSRHNSIYENIEVFLRG-STLMPIRYSYKEIKKMTRGFRDKLG  116

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGG+G V+KG L SGPFVA+KM+GKSK+ GQ+FI+EVATIGRIHHTNVVRLIGFCVEGSK
Sbjct  117   EGGFGAVYKGKLCSGPFVAIKMLGKSKSNGQDFINEVATIGRIHHTNVVRLIGFCVEGSK  176

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFMPNGSL+KYI   E++ISL++++M++ISLGVARG+ YLH+GC+M+ILHFDIKP
Sbjct  177   RALVYEFMPNGSLDKYISSSEDAISLTYKQMYEISLGVARGMAYLHQGCNMQILHFDIKP  236

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF PKVSDFGLAKLYP E S+V+LTAARGT+GYMAPEL Y+NIGG+S+KADVY
Sbjct  237   HNILLDENFIPKVSDFGLAKLYPNEISIVTLTAARGTIGYMAPELFYKNIGGVSYKADVY  296

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM  +R+NLNP  ++ SQ++FP W+Y QL + ++I+M   ++EE+    KM I
Sbjct  297   SFGMLLMEMASKRRNLNPHADRSSQLFFPFWIYNQLIEKREIEMDQISDEERNNVNKMFI  356

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
              ALWCIQ+ PS+RPSM +VI  + E D+E +EM PKP L P+E+  +E+   N+   ES
Sbjct  357   TALWCIQLKPSDRPSMNRVI-EMLEGDIENVEMPPKPSLYPNEM-IEEDLDVNSNETES  413



>ref|XP_002513565.1| kinase, putative [Ricinus communis]
 gb|EEF48968.1| kinase, putative [Ricinus communis]
Length=662

 Score =   477 bits (1228),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 235/340 (69%), Positives = 280/340 (82%), Gaps = 4/340 (1%)
 Frame = +1

Query  40    FLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTV  219
             F    ++YK R+RHLS YD IE +L   NN MPIRYSY +I++MTNNFK KLGEGGYG+V
Sbjct  289   FAFVFLIYKWRKRHLSMYDNIEEFLESQNNFMPIRYSYLDIRKMTNNFKDKLGEGGYGSV  348

Query  220   FKGTLRSGPFVAVKMMGKSKAT-GQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYE  396
             +KG LRSG   AVK++GKSKA  GQEF++EVATIGRIHH NVVRL+GFC EGSKRAL+YE
Sbjct  349   YKGKLRSGCLAAVKILGKSKAANGQEFMNEVATIGRIHHINVVRLVGFCFEGSKRALVYE  408

Query  397   FMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLD  576
             FMPNGSL+KYIF +E   SLS  KM++ISLGVARGI+YLHRGC+M+ILHFDIKPHNILLD
Sbjct  409   FMPNGSLDKYIFYEEGYASLSWRKMYEISLGVARGIEYLHRGCEMQILHFDIKPHNILLD  468

Query  577   ENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLL  756
             ENF+P+VSDFGLAKLYP   + VSLTAARGTMGY+APEL Y+NIGG+S KADVYSFGMLL
Sbjct  469   ENFTPRVSDFGLAKLYPTNHNTVSLTAARGTMGYIAPELFYKNIGGVSFKADVYSFGMLL  528

Query  757   MEMVGRRKNLNPFVE-QLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWC  933
             MEM+G+RKN NP V+   SQ YFP WVY Q+ +GK +++GDAT++E ++ KKMIIVALWC
Sbjct  529   MEMIGKRKNWNPLVDPSSSQDYFPFWVYNQMSNGK-VELGDATDDEMRIRKKMIIVALWC  587

Query  934   IQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             IQM PS RP M +VI  + EED+E L + PKP   P+E P
Sbjct  588   IQMKPSSRPPMNRVI-NMLEEDLESLVLPPKPAFYPEETP  626



>ref|XP_007161178.1| hypothetical protein PHAVU_001G048800g [Phaseolus vulgaris]
 gb|ESW33172.1| hypothetical protein PHAVU_001G048800g [Phaseolus vulgaris]
Length=621

 Score =   475 bits (1223),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 232/351 (66%), Positives = 287/351 (82%), Gaps = 2/351 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
              GL FLI I + K R+RH+S Y+ IE+YL   N+L PIRYSY EIK M   FK KLGEGG
Sbjct  272   FGLPFLIVIFICKWRKRHMSIYENIENYLQ-QNSLAPIRYSYKEIKNMAAGFKEKLGEGG  330

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             +G+VFK  LRSGP VA+KM+GK K  GQ+FISEVATIGRIHH NVVRLIGFCV GSKRAL
Sbjct  331   FGSVFKAKLRSGPSVAIKMLGKFKGNGQDFISEVATIGRIHHQNVVRLIGFCVSGSKRAL  390

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF KE +I LS+E++++IS+GVA GI YLH GC+M+ILHFDIKPHNI
Sbjct  391   VYEFMPNGSLDKFIFSKEINIHLSYERIYNISIGVACGIAYLHHGCEMQILHFDIKPHNI  450

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF PKVSDFGLAKLYP+++++V++TA RGT+GYMAPEL Y+NIGGISHKADVYSFG
Sbjct  451   LLDENFIPKVSDFGLAKLYPIDNNIVTMTATRGTIGYMAPELFYKNIGGISHKADVYSFG  510

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM  +RKNLNP  +  SQIYFP W+Y+ +++G+D+D+ + TEEE K++KKMIIVAL
Sbjct  511   MLLMEMASKRKNLNPHADHSSQIYFPLWIYDHIREGEDVDVENVTEEENKIAKKMIIVAL  570

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNA  1080
             WCIQ+ P++RPSM KV+  + E D+E LE+ PKP L P++    E    N+
Sbjct  571   WCIQLKPNDRPSMNKVV-KMLEGDIEELEIPPKPILFPEDEIVSEYQTINS  620



>ref|XP_008354817.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=563

 Score =   473 bits (1217),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 232/346 (67%), Positives = 277/346 (80%), Gaps = 1/346 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R  LG+  +   +VYK RRRH S Y TIE +L   NN MPIRYSY EIK+MT  F  KLG
Sbjct  193   RLLLGVPVVTVFLVYKWRRRHWSMYSTIEDFLQCNNNFMPIRYSYSEIKKMTRKFNDKLG  252

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             E G+G+VFKG LRSG FVA+K++GK KA GQ+FISE+ATIGRIHH NVV+L+G+CV+GSK
Sbjct  253   EDGFGSVFKGKLRSGRFVAIKVLGKPKANGQDFISEIATIGRIHHANVVQLVGYCVDGSK  312

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+Y+FMPNGSL+KYI+ KE SI LS + M++ISLGVA+GI+YLH+GCDM+ILHFDIKP
Sbjct  313   RALVYDFMPNGSLDKYIYSKEGSIPLSIKNMYEISLGVAQGIEYLHQGCDMQILHFDIKP  372

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF  K+SDFGLAKLYPV++S+VSLTAARGTMGY+APEL Y+NIGG+S+KADVY
Sbjct  373   HNILLDENFKAKISDFGLAKLYPVDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVY  432

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM  RRKN    VE  SQI+FP WVY+Q   G D++M + TEEEKKV +KM+I
Sbjct  433   SFGMLLMEMASRRKNWKATVEHSSQIFFPLWVYDQYIVGNDLEMDNVTEEEKKVIRKMVI  492

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
              ALWCIQM PS+RPSM KVIEML      L     +P L P E+P 
Sbjct  493   TALWCIQMKPSDRPSMSKVIEMLGGNVECLQMPL-RPSLCPQEMPA  537



>ref|XP_009335109.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Pyrus x bretschneideri]
Length=663

 Score =   476 bits (1226),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 228/350 (65%), Positives = 286/350 (82%), Gaps = 2/350 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             Y +GR  LG+ FLI+ ++Y+ RRRHLS +  IE +L   NN MPIRYSY +IKRMTN FK
Sbjct  291   YLVGRLLLGVPFLIAFLIYRWRRRHLSGFSIIEDFLQTENNFMPIRYSYLDIKRMTNKFK  350

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLG+GGYG+VFKG LRSG FVA+K++GK K  GQ+F SEVATIGRIHH NVV+L+G+CV
Sbjct  351   DKLGQGGYGSVFKGKLRSGRFVAIKLLGKPKNNGQDFTSEVATIGRIHHVNVVQLVGYCV  410

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y FMPN SL+KY++ KE SI LS +KM++I+ GVARGI+YLH+GCDM+ILHF
Sbjct  411   EGSKRALVYVFMPNSSLDKYVYSKEGSIPLSCKKMYEIAFGVARGIEYLHQGCDMQILHF  470

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF+PK+SDFGLAKLYP+++S+V+LTAARGT+GY+APEL Y+NIGG+S++
Sbjct  471   DIKPHNILLDENFNPKISDFGLAKLYPIDNSIVTLTAARGTIGYIAPELFYKNIGGVSYR  530

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKD-IDMGDATEEEKKVS  903
             ADVYSFGMLLMEM  RRKN +   E  SQ YFP W Y+Q   G D +++G+ TEEEK + 
Sbjct  531   ADVYSFGMLLMEMASRRKNFSTTAEHSSQDYFPLWAYDQYSGGNDLLEIGNVTEEEKIMI  590

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KKM++ A WCIQM P++RPSM KVI  +   DVE L++ PKPFL+  E+P
Sbjct  591   KKMVMTAFWCIQMKPNDRPSMDKVI-QMLGGDVENLKLPPKPFLNQQEMP  639



>ref|XP_009335107.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009335108.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Pyrus x bretschneideri]
Length=673

 Score =   476 bits (1226),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 228/350 (65%), Positives = 286/350 (82%), Gaps = 2/350 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             Y +GR  LG+ FLI+ ++Y+ RRRHLS +  IE +L   NN MPIRYSY +IKRMTN FK
Sbjct  301   YLVGRLLLGVPFLIAFLIYRWRRRHLSGFSIIEDFLQTENNFMPIRYSYLDIKRMTNKFK  360

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLG+GGYG+VFKG LRSG FVA+K++GK K  GQ+F SEVATIGRIHH NVV+L+G+CV
Sbjct  361   DKLGQGGYGSVFKGKLRSGRFVAIKLLGKPKNNGQDFTSEVATIGRIHHVNVVQLVGYCV  420

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+Y FMPN SL+KY++ KE SI LS +KM++I+ GVARGI+YLH+GCDM+ILHF
Sbjct  421   EGSKRALVYVFMPNSSLDKYVYSKEGSIPLSCKKMYEIAFGVARGIEYLHQGCDMQILHF  480

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF+PK+SDFGLAKLYP+++S+V+LTAARGT+GY+APEL Y+NIGG+S++
Sbjct  481   DIKPHNILLDENFNPKISDFGLAKLYPIDNSIVTLTAARGTIGYIAPELFYKNIGGVSYR  540

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKD-IDMGDATEEEKKVS  903
             ADVYSFGMLLMEM  RRKN +   E  SQ YFP W Y+Q   G D +++G+ TEEEK + 
Sbjct  541   ADVYSFGMLLMEMASRRKNFSTTAEHSSQDYFPLWAYDQYSGGNDLLEIGNVTEEEKIMI  600

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KKM++ A WCIQM P++RPSM KVI  +   DVE L++ PKPFL+  E+P
Sbjct  601   KKMVMTAFWCIQMKPNDRPSMDKVI-QMLGGDVENLKLPPKPFLNQQEMP  649



>ref|XP_011047738.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Populus euphratica]
Length=373

 Score =   466 bits (1198),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 226/345 (66%), Positives = 281/345 (81%), Gaps = 2/345 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             GL  LI++++YK RRRHLS Y  IE +L S  +NL  IRYSY EIK++T+ F  KLGEGG
Sbjct  3     GLPCLITLLIYKWRRRHLSMYGNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGG  62

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+V+KG LRSG F A+K++ K KA GQ+FI+EVATIGRIHH NVV+LIGF VEGSKRAL
Sbjct  63    YGSVYKGKLRSGRFAAIKILRKEKANGQDFINEVATIGRIHHCNVVQLIGFTVEGSKRAL  122

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +Y+FMPNGSLEKYIF ++ SI LS++K+++ISLGVA GI+YLH GCDM+ILHFDIKPHNI
Sbjct  123   IYDFMPNGSLEKYIFSRQGSIPLSNQKIYEISLGVALGIEYLHEGCDMQILHFDIKPHNI  182

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF+PK+SDFGLAKLYP  +S+VSLT ARGT+GYMAPEL Y++IGG+S+KADVYSFG
Sbjct  183   LLDENFTPKISDFGLAKLYPTNNSIVSLTMARGTIGYMAPELFYKSIGGVSYKADVYSFG  242

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEMVGRRKNLN      SQ+YFP W+Y+Q+ +G+DI    ATE+EK   KKM I AL
Sbjct  243   MLLMEMVGRRKNLNTLANHSSQMYFPLWIYDQVNEGRDILEDQATEQEKNTIKKMTIAAL  302

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             WCIQ+ P +RPSM +V+  + + ++E L+M PKPFL P +   D+
Sbjct  303   WCIQLKPIDRPSMHRVV-QMLQANIESLQMPPKPFLVPQQTSNDD  346



>ref|XP_008381955.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Malus domestica]
Length=355

 Score =   465 bits (1196),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 229/347 (66%), Positives = 274/347 (79%), Gaps = 7/347 (2%)
 Frame = +1

Query  70    RRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPF  249
             RRRHLS Y TIE +L   NN MPIRYSY ++K+MT  FK KLGEGG+G+VFKG LRSG F
Sbjct  2     RRRHLSMYSTIEDFLQCNNNFMPIRYSYLDVKKMTCRFKDKLGEGGFGSVFKGKLRSGRF  61

Query  250   VAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYI  429
             VAVK++GK KA GQ+FISE+ATIGRIHH NVV+L+G+CVEGSKRAL+Y+FMPNGSL+KYI
Sbjct  62    VAVKVLGKPKADGQDFISEIATIGRIHHANVVQLVGYCVEGSKRALVYDFMPNGSLDKYI  121

Query  430   FPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFG  609
             + KE S+ L+ + M++ISLGVA+GI+YLH+GC+M+ILHFDIKPHNILLDENF  KVSDFG
Sbjct  122   YSKEGSVPLTIKNMYEISLGVAQGIEYLHQGCEMQILHFDIKPHNILLDENFKAKVSDFG  181

Query  610   LAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLN  789
             LAKLYPV++S+V LTAARGT+GY+APEL Y+NIGG+S+KADVYSFGMLLMEM  RRKN N
Sbjct  182   LAKLYPVDNSIVPLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASRRKNWN  241

Query  790   PFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMK  969
               VE  SQ YFP WVY+Q   G D++M + TEEEKKV +KM+I ALWCIQM PS+RPSM 
Sbjct  242   ARVEHSSQNYFPVWVYDQYIVGNDLEMDNVTEEEKKVIRKMVITALWCIQMKPSDRPSMS  301

Query  970   KVIemleeedvellemAPKPFLSPDEVPT------DENSFPNAQNVE  1092
             KV+EML  +   L     +P L P E P       D    P   N E
Sbjct  302   KVVEMLGGDVECLQMPL-RPSLCPLETPVTVGDIQDNELNPRCSNAE  347



>ref|XP_008232095.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=676

 Score =   476 bits (1226),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 233/349 (67%), Positives = 280/349 (80%), Gaps = 3/349 (1%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
             S+   R   G+  +I+ V+YK RRRHLS Y  IE +L   +N +PIRYSY EIK+MTN F
Sbjct  306   SFFAARLIFGVPCMIAFVIYKWRRRHLSMYSVIEDFLQSDSNFLPIRYSYSEIKKMTNKF  365

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K KLGEGGYG+VFKG LRSG FVA+K++GK K  GQ+F SEVATIGRIHH NVV+LIG+C
Sbjct  366   KDKLGEGGYGSVFKGKLRSGRFVAIKVLGKPKGNGQDFTSEVATIGRIHHVNVVQLIGYC  425

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
             V+GS RAL+YEFMPN SL+KYI+ KE+S+ LS +  ++ISLGVARGI+YLH+GC+M+ILH
Sbjct  426   VQGSNRALVYEFMPNSSLDKYIYSKEKSMPLSCK--YEISLGVARGIEYLHQGCEMQILH  483

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDENF+ K+SDFGLAKLY V+DS+VSLTAARGTMGY+APEL Y+NIGG+S+
Sbjct  484   FDIKPHNILLDENFNAKISDFGLAKLYSVDDSIVSLTAARGTMGYIAPELFYKNIGGVSY  543

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVS  903
             KADVYSFGMLLMEM  RRKN N  VE+ SQ YFP W Y+Q   G D++MGD  EEEKK+ 
Sbjct  544   KADVYSFGMLLMEMASRRKNFNSMVERSSQTYFPLWAYDQYNKGNDLEMGDFNEEEKKII  603

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             KKM+I ALWCIQM PS+RPSM KVIEML  +   L     +PFL P E+
Sbjct  604   KKMVITALWCIQMKPSDRPSMNKVIEMLGGDVESLKMPI-RPFLYPQEM  651



>ref|XP_006372927.1| hypothetical protein POPTR_0017s06310g [Populus trichocarpa]
 gb|ERP50724.1| hypothetical protein POPTR_0017s06310g [Populus trichocarpa]
Length=717

 Score =   478 bits (1229),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 228/344 (66%), Positives = 284/344 (83%), Gaps = 2/344 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             G   +I  ++YK RRRHLS YDT+E +L   NNLMP+RYSY +I+++T  FK +LG+GG+
Sbjct  276   GTPCVIIFLIYKWRRRHLSVYDTVEQFLQSQNNLMPVRYSYSDIRKITRGFKDELGKGGF  335

Query  211   GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
             GTV+KG LRSG F A+K++GKSKA GQ+FI+EVATIGRIHHTNVV+LIGFC EGSKRAL+
Sbjct  336   GTVYKGKLRSGRFAAIKLLGKSKANGQDFINEVATIGRIHHTNVVQLIGFCAEGSKRALV  395

Query  391   YEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNIL  570
             Y+FMPNGSL+ ++F +E SISLS +K+  ISLGVA GIDYLH GCDM+ILHFDIKPHNIL
Sbjct  396   YDFMPNGSLDSHLFSQEGSISLSWQKLHQISLGVACGIDYLHLGCDMQILHFDIKPHNIL  455

Query  571   LDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGM  750
             LDENF+PKVSDFGLA+LYP   S+ SLTAARGT+GYMAPEL Y+NIG +S+KADVYSFGM
Sbjct  456   LDENFTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGM  515

Query  751   LLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMIIVAL  927
             LL+EM G+RKNLN   E  SQIY+P WV++Q+ DGK +++G DATEEE K+ KKMI+V L
Sbjct  516   LLLEMAGKRKNLNALAENSSQIYWPYWVHDQVSDGKAVEIGDDATEEESKIVKKMIVVGL  575

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             WCIQM P +RP+MK V+  + E D+E L++ PKP  + DE PT+
Sbjct  576   WCIQMKPMDRPTMKNVV-EMLEGDLENLQLPPKPVFNVDETPTN  618



>ref|XP_004307212.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=664

 Score =   476 bits (1224),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 235/379 (62%), Positives = 301/379 (79%), Gaps = 4/379 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             I ++  +  LG+  +I  +++KL+RRHLS Y  IE +L   NNLMPIRYSY   K+MT  
Sbjct  281   ILWSGTKIVLGVPCVIVFLIFKLKRRHLSMYGLIEDFLQSHNNLMPIRYSYSNTKKMTKG  340

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEGGYG+V+KG LRSG  VAVKM+GKSKA GQ+F++EVATIGRIHH NVVRLIG+
Sbjct  341   FKDKLGEGGYGSVYKGKLRSGRLVAVKMLGKSKANGQDFMNEVATIGRIHHVNVVRLIGY  400

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGSKRAL+YE+M NGSL+K+IF KE SISLS ++ F+ISLGVARGI YLH+GCDM+IL
Sbjct  401   CAEGSKRALIYEYMSNGSLDKHIFSKEGSISLSCKEAFEISLGVARGIGYLHQGCDMKIL  460

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDENF PKVSDFGLA+L P++DS + LTAARGT+GY+APEL Y+NIGG++
Sbjct  461   HFDIKPHNILLDENFVPKVSDFGLARLCPLDDSSLILTAARGTIGYIAPELFYKNIGGVT  520

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KAD+YSFGMLLME+ G+RKNLN      SQIYFPSWVY+Q  +G ++++ DAT+EE+++
Sbjct  521   NKADMYSFGMLLMEIAGKRKNLNAVAAHSSQIYFPSWVYDQFSEGNEMEIEDATDEERRL  580

Query  901   SKKMIIVALWCIQMNPSERP-SMKKVIemleeedvellemAPKPFLSPDEVPT--DENSF  1071
             ++KM++VALWCIQM P +RP SM KV+  + E +VE + M PKPFL P ++P   DE+  
Sbjct  581   TRKMLMVALWCIQMKPCDRPKSMSKVV-EMLEGEVESIPMPPKPFLYPQDMPVVDDEDDT  639

Query  1072  PNAQNVESPLLSDNPVRSS  1128
               A +   PL ++ P  +S
Sbjct  640   ETALSSSLPLKNEAPESTS  658



>ref|XP_010662972.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=678

 Score =   476 bits (1226),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 304/375 (81%), Gaps = 4/375 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             GR +LG+L LI+ ++YK RRRHLS  D+IE +L    NL PIRYSY EIK+MT+NFK  L
Sbjct  305   GRSALGILCLIAYLIYKFRRRHLSLDDSIEEFLQKHKNLQPIRYSYSEIKKMTDNFKTSL  364

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             G+GG+G+V+KG L+SG  VAVK++  SKA G++FI+EVATIGRIHH NVVRLIGFC  GS
Sbjct  365   GKGGFGSVYKGKLQSGSIVAVKVLATSKANGEDFINEVATIGRIHHMNVVRLIGFCANGS  424

Query  376   KRALLYEFMPNGSLEKYIFPKEE-SISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             K AL+Y+FMPNGSL+KYIF K E S+ LS E ++ I+LG+ARGI+YLHRGCDM+ILHFDI
Sbjct  425   KWALIYDFMPNGSLDKYIFLKRENSVYLSWEMLYKIALGIARGIEYLHRGCDMQILHFDI  484

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLTAARGT+GY+APEL Y+NIGGIS+KAD
Sbjct  485   KPHNILLDEDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGGISYKAD  544

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEMVGRRKN+  F E  SQIYFPSWV+++   G++++MGDATE+EKK  KKM
Sbjct  545   VYSFGMLLMEMVGRRKNVQAFAEHSSQIYFPSWVHDKYDRGENMEMGDATEDEKKSVKKM  604

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVE  1092
             ++VALWCIQ+ P++RPSM K +  + E +VELL+M PKP LS +E+   EN   N   V+
Sbjct  605   VLVALWCIQLKPTDRPSMGKAL-EMLEGEVELLQMPPKPTLSYEEMSI-ENQINNPIGVQ  662

Query  1093  SPLLSDNPVRSSSFE  1137
              P+ S N + + S +
Sbjct  663   -PISSCNAMDTISLD  676



>ref|XP_006372706.1| hypothetical protein POPTR_0017s04180g [Populus trichocarpa]
 gb|ERP50503.1| hypothetical protein POPTR_0017s04180g [Populus trichocarpa]
Length=398

 Score =   466 bits (1199),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 234/363 (64%), Positives = 295/363 (81%), Gaps = 4/363 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTN  177
             + Y +  F  GL  L+++++YK +RRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN
Sbjct  23    VIYHVLLFPCGLSCLLTLLIYKWQRRHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITN  82

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGG G+V+KG LRSG F AVK++ K K  GQ+F++EVATIGRIHH NVV+LIG
Sbjct  83    GFKDKLGEGGSGSVYKGKLRSGRFAAVKILDKLKDNGQDFMNEVATIGRIHHVNVVQLIG  142

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             F ++GSKRAL+YEFMPNGSLEKYIF +E ++SLS+EKM +ISLGVA GI+YLH+GCDM+I
Sbjct  143   FTIDGSKRALIYEFMPNGSLEKYIFYREGNVSLSNEKMHEISLGVAHGIEYLHQGCDMQI  202

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILLD+ F PKVSDFGLAKLYP  ++ VSL+AARGT+GYMAPEL Y++IG +
Sbjct  203   LHFDIKPHNILLDDKFVPKVSDFGLAKLYPTNNNTVSLSAARGTIGYMAPELFYKSIGRV  262

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             S KADVYS+GMLLMEMVGRRKNLN F    SQIYFPSW+Y+Q+ +GKDI++  D  E E+
Sbjct  263   SDKADVYSYGMLLMEMVGRRKNLNAFASHSSQIYFPSWIYDQVSEGKDIEVQEDVMEHEE  322

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFP  1074
             K  KKMIIVALWCIQ+ P +RPSM KV+  + E DVE L M PKPFL+P ++P +++   
Sbjct  323   KTMKKMIIVALWCIQLKPVDRPSMHKVV-EMLESDVESLRMPPKPFLTP-QMPEEDDRAN  380

Query  1075  NAQ  1083
             +A+
Sbjct  381   HAK  383



>ref|XP_011001827.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X4 [Populus euphratica]
Length=442

 Score =   468 bits (1204),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/371 (64%), Positives = 301/371 (81%), Gaps = 6/371 (2%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             F  GL  L+ +++YK +RRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN FK KLG
Sbjct  71    FLCGLPCLVILLIYKWQRRHLSMYNNIEKFLQSHGNDLMPIRYNYSEIKKITNGFKDKLG  130

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             +GGYG+V+KG LRSG FVAVK++ KSKA GQ+FI+EVATIGRI+H NV+R+IGF VEGSK
Sbjct  131   QGGYGSVYKGKLRSGRFVAVKILDKSKANGQDFINEVATIGRIYHVNVMRIIGFAVEGSK  190

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+ EFMPNGSLEKY+F K+ SI LS+ KM++ISLGVARGI+YLH+GCDM+ILHFDIKP
Sbjct  191   RALILEFMPNGSLEKYLFSKQGSIPLSNNKMYEISLGVARGIEYLHQGCDMQILHFDIKP  250

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDE F PK+SDFGLAKLYP  ++ VSLT ARGT+GYMAPEL Y+NIGG+S K+DVY
Sbjct  251   HNILLDEKFIPKISDFGLAKLYPSGNNNVSLTTARGTIGYMAPELLYKNIGGVSFKSDVY  310

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMI  915
             SFGMLLM+MVGRRKNLN      S+IYFP+WVY+++ +GKDI+   DA E EKK+ KK++
Sbjct  311   SFGMLLMDMVGRRKNLNALANHSSRIYFPAWVYDKVSEGKDIETQEDAPEYEKKILKKVM  370

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             IVALWCIQ+ P +RPS+ KV+  + E DV+ L++ PKPFLSP ++  D++    A  ++ 
Sbjct  371   IVALWCIQLKPDDRPSIHKVV-EMLESDVDFLQIPPKPFLSPHQILEDDD---RANPIKL  426

Query  1096  PLLSDNPVRSS  1128
               LS++ + SS
Sbjct  427   SDLSNDWIDSS  437



>gb|KDP46881.1| hypothetical protein JCGZ_24090 [Jatropha curcas]
Length=680

 Score =   476 bits (1226),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 231/367 (63%), Positives = 283/367 (77%), Gaps = 2/367 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y +  F  G   +I+  +YK RRRHLS +  IE +L   NNLMPIRYSY +IK MTN 
Sbjct  301   VVYRIAIFICGTPCVIAFFIYKWRRRHLSMFANIEEFLQTHNNLMPIRYSYSDIKSMTNG  360

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLG+GG+G+V+KG LRSG F A+KM+ KSK+ G++F+SEV+TIG+IHH N+VRLIG+
Sbjct  361   FKDKLGQGGFGSVYKGKLRSGDFAAIKMLDKSKSNGKDFVSEVSTIGKIHHVNIVRLIGY  420

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             CVEGSK+AL+YEFM NGSL++YIF +E +  LS+EKM++I LGVARGIDYLHRGCDM+IL
Sbjct  421   CVEGSKQALVYEFMVNGSLDRYIFSEERNNLLSNEKMYEICLGVARGIDYLHRGCDMQIL  480

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PK+SDFGLAKLYP   + V+LTAARGT+GYMAPE CY NIGGIS
Sbjct  481   HFDIKPHNILLDEKFNPKISDFGLAKLYPTYSNTVTLTAARGTIGYMAPEFCYANIGGIS  540

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
              KADVYSFGMLLMEM GRRKN+N F E LSQIYFPSW YE    GK I++ D +EEE+ +
Sbjct  541   FKADVYSFGMLLMEMAGRRKNVNAFAENLSQIYFPSWAYEHFCKGKSIELEDISEEERNI  600

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKP-FLSPDEVPTDENSFPN  1077
             +KKM+IVALWCIQ  PS+RP + K I  + E +VE L M PKP F   D    D     +
Sbjct  601   TKKMVIVALWCIQFKPSDRPPIHKAI-EMLEGEVESLIMPPKPSFFPTDRAQEDIQVEED  659

Query  1078  AQNVESP  1098
             +  + SP
Sbjct  660   STQITSP  666



>ref|XP_010662971.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=688

 Score =   476 bits (1226),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 304/375 (81%), Gaps = 4/375 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             GR +LG+L LI+ ++YK RRRHLS  D+IE +L    NL PIRYSY EIK+MT+NFK  L
Sbjct  315   GRSALGILCLIAYLIYKFRRRHLSLDDSIEEFLQKHKNLQPIRYSYSEIKKMTDNFKTSL  374

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             G+GG+G+V+KG L+SG  VAVK++  SKA G++FI+EVATIGRIHH NVVRLIGFC  GS
Sbjct  375   GKGGFGSVYKGKLQSGSIVAVKVLATSKANGEDFINEVATIGRIHHMNVVRLIGFCANGS  434

Query  376   KRALLYEFMPNGSLEKYIFPKEE-SISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             K AL+Y+FMPNGSL+KYIF K E S+ LS E ++ I+LG+ARGI+YLHRGCDM+ILHFDI
Sbjct  435   KWALIYDFMPNGSLDKYIFLKRENSVYLSWEMLYKIALGIARGIEYLHRGCDMQILHFDI  494

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLTAARGT+GY+APEL Y+NIGGIS+KAD
Sbjct  495   KPHNILLDEDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGGISYKAD  554

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEMVGRRKN+  F E  SQIYFPSWV+++   G++++MGDATE+EKK  KKM
Sbjct  555   VYSFGMLLMEMVGRRKNVQAFAEHSSQIYFPSWVHDKYDRGENMEMGDATEDEKKSVKKM  614

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVE  1092
             ++VALWCIQ+ P++RPSM K +  + E +VELL+M PKP LS +E+   EN   N   V+
Sbjct  615   VLVALWCIQLKPTDRPSMGKAL-EMLEGEVELLQMPPKPTLSYEEMSI-ENQINNPIGVQ  672

Query  1093  SPLLSDNPVRSSSFE  1137
              P+ S N + + S +
Sbjct  673   -PISSCNAMDTISLD  686



>gb|KEH40341.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=432

 Score =   467 bits (1202),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 229/349 (66%), Positives = 278/349 (80%), Gaps = 2/349 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R   G+ F I++++YK R+RH S Y+ IE YL   NNLMPI YSY EIK+M   FK KL
Sbjct  53    ARILFGITFFIALLIYKWRKRHWSMYECIEIYLQ-QNNLMPIGYSYREIKKMARGFKDKL  111

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGG+GTVF+G  RSGP VA+KM+GKSK  GQ+FISEV TIGRIHH NVV+L+GFC+EGS
Sbjct  112   GEGGFGTVFQGNQRSGPCVAIKMLGKSKGNGQDFISEVMTIGRIHHVNVVKLLGFCIEGS  171

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             KRAL+YEFM NGSL+K+IF KE S  L   ++ DIS+GVARGI YLH GC+M+ILHFDIK
Sbjct  172   KRALIYEFMSNGSLDKFIFSKEGSKELCCSQIHDISIGVARGIAYLHHGCEMKILHFDIK  231

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF PK+SDFGLAKLYP+E+S+V++TAARGT+GYMAPEL Y+NIGG+S+KADV
Sbjct  232   PHNILLDENFIPKISDFGLAKLYPIENSIVTMTAARGTIGYMAPELFYKNIGGVSYKADV  291

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  +RKNLN   E  SQ+YFP W+Y+Q     +I++ D TEEE K+ KKMI
Sbjct  292   YSFGMLLMEMASKRKNLNAHAEYSSQLYFPLWIYDQFAQEGEIEIEDVTEEENKILKKMI  351

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             IVALWCIQ+ P++RPSM KV+  + E DVE LEM PKP + P E   D+
Sbjct  352   IVALWCIQLKPADRPSMNKVV-EMLEGDVESLEMPPKPIIYPHETVVDD  399



>ref|XP_007036613.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY21114.1| PR5-like receptor kinase [Theobroma cacao]
Length=639

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 275/324 (85%), Gaps = 0/324 (0%)
 Frame = +1

Query  7    YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
            Y + R  LG+  LI +V+ K RRRHLS  DTIE +L   NNL PI+YSY EIK+MT  FK
Sbjct  262  YIIIRTLLGVSCLIVVVLIKFRRRHLSTDDTIEEFLQMQNNLKPIKYSYSEIKKMTKCFK  321

Query  187  HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
             KLG+GGYG+VFKGTLRSG  +AVK++  SK+ GQ+FI+EVATIGRIHH NVV+LIGFCV
Sbjct  322  DKLGQGGYGSVFKGTLRSGRPIAVKLLEMSKSHGQDFINEVATIGRIHHVNVVQLIGFCV  381

Query  367  EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
            +GSK+AL+Y+FMPNGSL+K IF +E+  +L  EK+F+I++GV RGI+YLH+GC+M+ILHF
Sbjct  382  DGSKQALVYDFMPNGSLDKIIFSREKDTTLCWEKIFEIAIGVVRGIEYLHQGCEMQILHF  441

Query  547  DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
            DIKPHNILLD+NF PK+SDFGLAKLY V+ S+VSLTAARGT+GY+APEL Y+NIG ISHK
Sbjct  442  DIKPHNILLDKNFIPKISDFGLAKLYAVDQSIVSLTAARGTLGYIAPELFYKNIGSISHK  501

Query  727  ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
            ADVYSFGMLLMEMVGRRKNLN F EQ SQIYFP+W+Y++ + G+D ++GDATE EKK+ +
Sbjct  502  ADVYSFGMLLMEMVGRRKNLNAFAEQSSQIYFPTWIYDRFEKGEDAELGDATESEKKIVR  561

Query  907  KMIIVALWCIQMNPSERPSMKKVI  978
            KM+IVA WCIQM P++RPS+ KV+
Sbjct  562  KMVIVAFWCIQMRPTDRPSISKVL  585



>ref|XP_004498418.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Cicer arietinum]
Length=740

 Score =   478 bits (1229),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 234/353 (66%), Positives = 295/353 (84%), Gaps = 3/353 (1%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
             SY + RF LGL+   + ++   R RH S Y+ IE +L G N+L+PIRYSY EIK MT +F
Sbjct  358   SYIIVRFVLGLIVFFTKLINIYRTRHTSMYENIEDFLQG-NSLVPIRYSYKEIKNMTKSF  416

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K KLGEGGYGTV+KGTLRSGP VA+KM+GKSK  GQ+FI+EVATIGRIHHTNVVRLIGFC
Sbjct  417   KDKLGEGGYGTVYKGTLRSGPLVAIKMLGKSKGNGQDFINEVATIGRIHHTNVVRLIGFC  476

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
             VEGSKRAL+Y+FMPNGSL++YI  ++++ISL+++KM++ISLGVARGI YLH+GCDM+ILH
Sbjct  477   VEGSKRALVYDFMPNGSLDRYISSRDDTISLTYKKMYEISLGVARGIAYLHQGCDMQILH  536

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDE+F  KVSDFGLAKLYPV++S+VSLTAARGT+GYMAPEL Y+NIGG+S+
Sbjct  537   FDIKPHNILLDEDFISKVSDFGLAKLYPVDNSIVSLTAARGTIGYMAPELFYKNIGGVSY  596

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKKV  900
             KADVYSFGMLLME+  RR+NLN   +  SQI+FP W+Y QL + ++I+ +GDAT+E+K  
Sbjct  597   KADVYSFGMLLMEIANRRRNLNSHADDSSQIFFPFWIYNQLIEEREIEILGDATDEDKSN  656

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
              KKM I+ALWCIQ+NPS+RPSM++VI  + E D+E +++ PKP   P E+  D
Sbjct  657   VKKMFIIALWCIQLNPSDRPSMERVI-EMLEGDIENIKIPPKPSPYPTEIIQD  708



>ref|XP_004307211.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Fragaria vesca subsp. vesca]
Length=651

 Score =   474 bits (1221),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 238/372 (64%), Positives = 297/372 (80%), Gaps = 8/372 (2%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             LG   +I  +++KL+RRHLS Y  IE +L   NNLMPIRYSY  IK+MT  FK KLGEGG
Sbjct  277   LGFPCVIVFLIFKLKRRHLSGYGVIEEFLQTHNNLMPIRYSYSNIKKMTKGFKDKLGEGG  336

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+V+KG LRSG  VAVK++GKSKA GQ+FI+EVATIGRIHH NVV+LIG+C EGSKRAL
Sbjct  337   YGSVYKGKLRSGRLVAVKLLGKSKANGQDFINEVATIGRIHHVNVVQLIGYCAEGSKRAL  396

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFM NGSL+K+IF KE SISLS ++ F+ISLGVARGI YLH+GCDM+ILHFDIKPHNI
Sbjct  397   VYEFMANGSLDKHIFSKEGSISLSCKEAFEISLGVARGIGYLHQGCDMKILHFDIKPHNI  456

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDE F PKVSDFGLA+L P++DS + LTA RGT+GY+APEL Y+NIGG+S+KAD+YSFG
Sbjct  457   LLDEKFVPKVSDFGLARLCPLDDSSLILTAVRGTIGYIAPELFYKNIGGVSNKADMYSFG  516

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLME+ G+RKNLN      SQIYFPSWVY+Q  +G ++++ DAT+EEKK++KKM++VAL
Sbjct  517   MLLMEIAGKRKNLNAVAAHSSQIYFPSWVYDQFSEGNEMEIEDATDEEKKLTKKMLMVAL  576

Query  928   WCIQMNPSERP-SMKKVIemleeedvellemAPKPFLSPDEVP-TDENSFPNAQNVESPL  1101
             WCIQM PS+RP SM KV+  + E +VE + M PKPFL P ++P  DE       + E+ L
Sbjct  577   WCIQMKPSDRPKSMNKVV-EMLEGEVESIPMPPKPFLYPQDMPVVDEE-----DDSETAL  630

Query  1102  LSDNPVRSSSFE  1137
              S  P+++ + E
Sbjct  631   SSSLPLKNEAQE  642



>ref|XP_002323916.2| hypothetical protein POPTR_0017s04230g [Populus trichocarpa]
 gb|EEF04049.2| hypothetical protein POPTR_0017s04230g [Populus trichocarpa]
Length=350

 Score =   463 bits (1192),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 230/327 (70%), Positives = 275/327 (84%), Gaps = 3/327 (1%)
 Frame = +1

Query  91    YDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMM  267
             YD IE +L S  N+LMPIRYSY EIK++T  F+ KLGEGG+G V+KG LRSG F AVK++
Sbjct  2     YDNIEKFLQSHENDLMPIRYSYSEIKKITTGFRDKLGEGGFGLVYKGKLRSGRFAAVKVL  61

Query  268   GKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEES  447
             GKSKA GQ+FI+EVATIGRIHH NVV+LIGF VEGSKRAL+YEFMPNGSLEKYIF K+ S
Sbjct  62    GKSKANGQDFINEVATIGRIHHVNVVQLIGFTVEGSKRALIYEFMPNGSLEKYIFSKQGS  121

Query  448   ISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYP  627
             + LS+E++++ISLGVARGI+YLH+GCDM+ILHFDIKPHNILLDE F PK+SDFGLAKLYP
Sbjct  122   VPLSNERIYEISLGVARGIEYLHQGCDMQILHFDIKPHNILLDEKFVPKISDFGLAKLYP  181

Query  628   VEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQL  807
               ++ V LTAARGT+GYMAPEL Y+NIGG+S+KADVYSFGMLLM+MVGRRKNLN      
Sbjct  182   TSNNTVPLTAARGTIGYMAPELFYKNIGGVSYKADVYSFGMLLMDMVGRRKNLNALANHS  241

Query  808   SQIYFPSWVYEQLKDGKDIDMGDATEE-EKKVSKKMIIVALWCIQMNPSERPSMKKVIem  984
             SQIYFPSWVYEQ+  G DI++ + T E EKK +KKMIIVALWCIQ+ PS+RPSM KV+  
Sbjct  242   SQIYFPSWVYEQVSAGNDIEVQENTTEYEKKTTKKMIIVALWCIQLKPSDRPSMHKVV-E  300

Query  985   leeedvellemAPKPFLSPDEVPTDEN  1065
             + E DVE L+M PKPFL+   +P D++
Sbjct  301   MLESDVESLQMPPKPFLTLQHIPEDDD  327



>ref|XP_011014554.1| PREDICTED: probable receptor-like protein kinase At1g67000, partial 
[Populus euphratica]
Length=595

 Score =   472 bits (1215),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 278/340 (82%), Gaps = 2/340 (1%)
 Frame = +1

Query  40    FLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTV  219
             F+ + ++YK  RRHLS YD IE +L   NN  PIRYSY +IK++TN FK +LG+GGYG+V
Sbjct  230   FVFAFLIYKWLRRHLSMYDIIEEFLQSQNNFAPIRYSYSDIKKITNGFKERLGQGGYGSV  289

Query  220   FKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEF  399
             +KG LRSG   AVKM+ KS A GQ+FI+EVATIGRIHH NVVRLIGFC EGSKRAL+Y+F
Sbjct  290   YKGKLRSGHLAAVKMLDKSSANGQDFINEVATIGRIHHVNVVRLIGFCAEGSKRALVYDF  349

Query  400   MPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDE  579
             MPNGSL+KY+  ++ + +LS +KM++ISLGVARGI+YLHRGCDM+ILHFDIKPHN+LLDE
Sbjct  350   MPNGSLDKYVLSRQGNTTLSWQKMYEISLGVARGIEYLHRGCDMQILHFDIKPHNVLLDE  409

Query  580   NFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLM  759
             NF+PKVSDFGLAKLYP  ++ V LTAARGT+GY+APEL Y+NIG +S+KADVYSFGMLLM
Sbjct  410   NFAPKVSDFGLAKLYPTNNNTVMLTAARGTIGYIAPELFYKNIGSVSYKADVYSFGMLLM  469

Query  760   EMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQ  939
             EMVG+R+N NP  E  S+ YFP WVY Q+ DG+ +++GDAT++E K++KKMIIVALWCIQ
Sbjct  470   EMVGKRQNTNPVTESNSENYFPDWVYNQVVDGR-VEIGDATKDENKLAKKMIIVALWCIQ  528

Query  940   MNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             M P  RP M KV+  + E DVE LE  PKP L PDE P +
Sbjct  529   MKPINRPPMNKVV-EMLEGDVESLEFPPKPVLFPDETPPN  567



>ref|XP_003635630.2| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=375

 Score =   464 bits (1194),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 229/375 (61%), Positives = 297/375 (79%), Gaps = 9/375 (2%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             +GR  +G+L L + ++YK RRRHLS  D IE +L    NL PI+Y+Y +IK+MT NFKHK
Sbjct  6     IGRAVIGILCLFAYLIYKFRRRHLSLDDDIEEFLHNYQNLRPIKYTYSDIKKMTYNFKHK  65

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG+GG+G+V+KG LRSG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVVRL+GFC++ 
Sbjct  66    LGQGGFGSVYKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQR  125

Query  373   SKRALLYEFMPNGSLEKYIF-PKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
             SK AL+Y++MPNGSL+K++F  +E +I LS E+++ I+LGV RGI YLH+GCDM+ILHFD
Sbjct  126   SKWALIYDYMPNGSLDKFVFLDQENNIPLSWERLYKIALGVGRGIKYLHQGCDMQILHFD  185

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
             IKPHNILLDE+F+PKVSDFGLAKLY  ++S+VS+TAARGT+GY+APEL Y+NIGG+S KA
Sbjct  186   IKPHNILLDEDFTPKVSDFGLAKLYSTDESIVSVTAARGTLGYIAPELFYKNIGGVSFKA  245

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLL+EMVG+RKN+N F E  SQIYFPSW+Y++   G+D++MGDATE+EKK  +K
Sbjct  246   DVYSFGMLLLEMVGKRKNVNAFAEHSSQIYFPSWIYDRYDQGEDMEMGDATEDEKKYVRK  305

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNV  1089
             M+IVALWC+QM P +RPSM K +  + E ++ELL+M PKP L    +   E S      V
Sbjct  306   MVIVALWCVQMKPVDRPSMSKTL-EMLEGEIELLKMPPKPTLW--SIENHEQSM-----V  357

Query  1090  ESPLLSDNPVRSSSF  1134
             E P+ S N + + S 
Sbjct  358   EVPISSSNSMGTISL  372



>gb|KHN05172.1| Putative receptor-like protein kinase [Glycine soja]
Length=664

 Score =   474 bits (1220),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 237/386 (61%), Positives = 302/386 (78%), Gaps = 9/386 (2%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y  G+F  G+ F I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   
Sbjct  284   LPYLAGKFLFGMTFFIVLLIYKWRKRHLSTYENIENYLE-QNNLMPIGYSYKEIKKMARG  342

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEGGYG VFKG LRSGP VA+KM+ K+K +GQ+FISE+ATIGRIHH NVV+ IG+
Sbjct  343   FKDKLGEGGYGFVFKGKLRSGPSVAIKMLHKAKGSGQDFISEIATIGRIHHQNVVQPIGY  402

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGSKRAL+YEFMPNGSL+K+IF K+ SI L+++++F+I++GVARGI YLH GC+M+IL
Sbjct  403   CAEGSKRALVYEFMPNGSLDKFIFTKDGSIHLTYDEIFNIAIGVARGIAYLHHGCEMQIL  462

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PKVSDFGLAKLYP+++S+V++TAARGT+GYMAPEL Y+NIGGIS
Sbjct  463   HFDIKPHNILLDETFTPKVSDFGLAKLYPIDNSIVTMTAARGTIGYMAPELFYKNIGGIS  522

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             HKADVYSFGMLLMEM  +RKNLNP  +  S++YFP W+Y QL    DI+M   TEEE   
Sbjct  523   HKADVYSFGMLLMEMASKRKNLNPHADHSSRLYFPFWIYNQLGKETDIEMEGVTEEE---  579

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNA  1080
              KKMIIV+LWCIQ+ PS+RPSM KV+  + E D+E LE+ PKP L P E   ++ S  ++
Sbjct  580   -KKMIIVSLWCIQLKPSDRPSMNKVV-EMLEGDIESLEIPPKPSLYPHETMENDQSIYSS  637

Query  1081  QNVESPLLSDNPVRSSSFEVCEN*II  1158
             Q + +  +S +   S S E+  N ++
Sbjct  638   QTMSTDFISSS---SYSKEIVTNPLV  660



>ref|XP_004308549.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=641

 Score =   473 bits (1218),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 235/364 (65%), Positives = 284/364 (78%), Gaps = 5/364 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             L +F +G  F+I+ +VY  RRRHLS Y TIE +L   NN  PIRYSY EIKRM+N FK +
Sbjct  271   LVKFIVGFPFVIAFLVYIWRRRHLSMYITIEDFLHEDNNFGPIRYSYSEIKRMSNGFKDE  330

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG+GGYG+VFKG LRSG F A+KM+ +SK++G +F+SEVATIGRIHH NVV+L+G+CVEG
Sbjct  331   LGKGGYGSVFKGKLRSGRFGAIKMLHESKSSGDDFVSEVATIGRIHHVNVVQLVGYCVEG  390

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SKRAL+YE+MP GSL+KYI+ KEE ++LS +KMF +SLGVA GIDYLH+GCDM+ILHFDI
Sbjct  391   SKRALVYEYMPKGSLDKYIYSKEECLTLSCKKMFQVSLGVAYGIDYLHQGCDMQILHFDI  450

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDENF PKVSDFGLAKLYP E+S+VSLTAARGTMGY+APEL Y+NIGG+S+KAD
Sbjct  451   KPHNILLDENFIPKVSDFGLAKLYPTENSIVSLTAARGTMGYIAPELFYKNIGGVSYKAD  510

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEM  RRKN     E  SQ YFPSWVY+Q  +G  +     TE+E  + +KM
Sbjct  511   VYSFGMLLMEMASRRKNFKELAEHESQTYFPSWVYDQYNEGNYLKASHHTEDENNMIQKM  570

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT----DENSFPNA  1080
             +I ALWCIQM PS+RPSM KVI  + E DVE L++ P+P L P +       D N  P  
Sbjct  571   VITALWCIQMKPSDRPSMNKVI-EMLEGDVENLQLPPRPLLYPQQTDVTEQIDNNLNPTC  629

Query  1081  QNVE  1092
              NVE
Sbjct  630   SNVE  633



>ref|XP_008346612.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=670

 Score =   474 bits (1219),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 280/347 (81%), Gaps = 0/347 (0%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R   G+  +I  ++YK +RRHLS Y  IE +L   NNL PIRYSY +IK+MT  FK KL
Sbjct  290   ARTVFGVPCVIVFLIYKWKRRHLSMYVHIEEFLQSHNNLTPIRYSYSDIKKMTRGFKDKL  349

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG+V+KG LRSG FV +KM+GKSKATGQ+FI+EV TIGRIHH NVV+LIG+CVEGS
Sbjct  350   GEGGYGSVYKGKLRSGRFVGIKMLGKSKATGQDFINEVGTIGRIHHVNVVQLIGYCVEGS  409

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             KRAL+YEFM NGSL+++IF KE  +SLS ++ F+ISLGVARGI YLH+GCDM+ILHFDIK
Sbjct  410   KRALVYEFMSNGSLDRHIFSKEGPVSLSFKRAFEISLGVARGIGYLHQGCDMQILHFDIK  469

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLD+N+ PK+SDFGLA+L P++DS + LTAARGT+GY+APEL Y+NIGG+S+KAD+
Sbjct  470   PHNILLDDNYVPKISDFGLARLCPLDDSSLXLTAARGTIGYIAPELFYKNIGGVSNKADI  529

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLME+ GRRKNLN      SQIYFPSWVY+Q  +G DI++ DATEEE +++KKM+
Sbjct  530   YSFGMLLMEIAGRRKNLNTVAAHESQIYFPSWVYDQFSEGNDIEIEDATEEENEITKKML  589

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             IVALWCIQ  PS+RP+    +  + E ++  LEM PKPFL P E P 
Sbjct  590   IVALWCIQFKPSDRPASMNKVVEMLEGEIXCLEMPPKPFLYPQEKPV  636



>ref|XP_007039001.1| Kinase, putative [Theobroma cacao]
 gb|EOY23502.1| Kinase, putative [Theobroma cacao]
Length=636

 Score =   473 bits (1216),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 284/339 (84%), Gaps = 2/339 (1%)
 Frame = +1

Query  55    VVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTL  234
             VV+K RRRHLS YDT+E +L   NNLMP+RYSY ++K+MT+ F+ KLGEGGYG V+KG L
Sbjct  287   VVHKWRRRHLSMYDTVEEFLQSHNNLMPVRYSYSDVKKMTDGFRVKLGEGGYGYVYKGKL  346

Query  235   RSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGS  414
             RSG   A+KM+ KSKA GQ+FI+EVATIGRIHH NVV+LIGFC +GSKRAL+Y+FMPNGS
Sbjct  347   RSGRIAAIKMLSKSKADGQDFINEVATIGRIHHVNVVQLIGFCAKGSKRALVYDFMPNGS  406

Query  415   LEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPK  594
             L+KYIF  E   +LS +K ++I++GVA GI+YLHRGCDM+ILHFDIKPHNILLDENF PK
Sbjct  407   LDKYIFSPERCTTLSWKKTYEIAVGVAHGIEYLHRGCDMQILHFDIKPHNILLDENFIPK  466

Query  595   VSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGR  774
             +SDFGLAKLY V+DS+VSLTAARGTMGY+APEL Y+NIGG+S+KADVYSFGMLL+EM+GR
Sbjct  467   ISDFGLAKLYAVDDSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLLEMIGR  526

Query  775   RKNLNPFVEQLSQIYFPSWVYEQLKDGKDI-DMGDATEEEKKVSKKMIIVALWCIQMNPS  951
             RKNL+P  E  S+IYFP +VY Q+ +G ++ ++GDATEE+K++ KKM IVALWCIQM PS
Sbjct  527   RKNLDPLAEHSSEIYFPFYVYGQIIEGNNVNEVGDATEEDKEMIKKMSIVALWCIQMKPS  586

Query  952   ERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENS  1068
             +RPSM KV+  + E  +E L++ PKP L P+E   D+ +
Sbjct  587   DRPSMSKVV-EMLEGGLESLQVPPKPLLYPEERVGDQTN  624



>ref|XP_010247816.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
Length=579

 Score =   470 bits (1210),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 224/354 (63%), Positives = 289/354 (82%), Gaps = 4/354 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R   G++     ++YKLRRRHLS  D+IE +L   NNLMPIRYSY  IK+MT  FK KLG
Sbjct  198   RTLCGIMCFFPFLIYKLRRRHLSMDDSIEDFLQSHNNLMPIRYSYSSIKKMTKGFKEKLG  257

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             +GGYG+VFKG L+SG  VA+KM+ +SK+ GQEFI+EVATIGRIHH NVV+LIGFC EGSK
Sbjct  258   QGGYGSVFKGKLKSGHLVAIKMLDQSKSNGQEFINEVATIGRIHHVNVVQLIGFCSEGSK  317

Query  379   RALLYEFMPNGSLEKYIFPKEE--SISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             RAL+YEFMPNGSL+KYI  ++E  SISLS EKM DI LGV RGI+YLHRGC+++ILHFDI
Sbjct  318   RALIYEFMPNGSLDKYISARQEGNSISLSWEKMLDIVLGVGRGIEYLHRGCNIQILHFDI  377

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAA-RGTMGYMAPELCYRNIGGISHKA  729
             KPHNILLD+NF PK+SDFGLAK +  +D  VSL+AA RGT+GY+APE+ Y+NIGG+++KA
Sbjct  378   KPHNILLDDNFVPKISDFGLAKFFATDDRTVSLSAAPRGTIGYIAPEMIYKNIGGVTYKA  437

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLL+E+ GR+K +N   +  SQ YFPSW+Y+++  G+DI++GDAT++EK ++KK
Sbjct  438   DVYSFGMLLLEITGRKKAINASRDHSSQFYFPSWIYDRVSQGEDIEIGDATDDEKTIAKK  497

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSF  1071
             ++IVALWCIQMNP  RPSM +++  + E D+E+L+M P+PFLSP E+P D+ + 
Sbjct  498   LVIVALWCIQMNPVNRPSMNRIV-DMLEGDIEVLQMPPRPFLSPPEMPIDDTTL  550



>ref|XP_004298577.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
[Fragaria vesca subsp. vesca]
Length=640

 Score =   473 bits (1216),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 233/363 (64%), Positives = 290/363 (80%), Gaps = 3/363 (1%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
             S    +   G  F+I+++++K RRRH S Y TIE +L   +N MPIRYSY  IK+M+  F
Sbjct  273   SIVAAKLVFGGPFVIALLIHKWRRRHWSTYRTIEDFLHS-DNFMPIRYSYSNIKKMSAGF  331

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K KLG GGYG VFK  LRSG F A+K++GKS A G++F+SEVATIGRIHH NVV+L+G+C
Sbjct  332   KDKLGAGGYGFVFKCKLRSGRFGAIKLLGKSNANGEDFMSEVATIGRIHHVNVVQLVGYC  391

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
             VEGSKRAL+Y+FMPNGSL++YI+ KEESI LS++K+++I++GVA+GI+YLH+GC+M+ILH
Sbjct  392   VEGSKRALVYDFMPNGSLDRYIYSKEESIPLSYKKIYEIAVGVAQGIEYLHQGCEMQILH  451

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDENF PK+SDFGLAKLYP  +S+VS  AARGTMGY+APEL Y+NIGG+S+
Sbjct  452   FDIKPHNILLDENFVPKISDFGLAKLYPANNSIVSSMAARGTMGYIAPELFYKNIGGVSY  511

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVS  903
             KADVYSFGMLLMEM  RRKNLN  V+  SQIYFPSWV++Q  +GKD+++GDAT EEKK+ 
Sbjct  512   KADVYSFGMLLMEMASRRKNLNANVDHSSQIYFPSWVHDQYNEGKDLEIGDATAEEKKLI  571

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQ  1083
             +KMI+ ALWCIQM PS+RPSMK+V   +   DVE LEM PKP L P   P   N  P   
Sbjct  572   RKMIVAALWCIQMKPSDRPSMKRVT-QMLVGDVENLEMPPKPSLCPQPTPV-SNLIPACS  629

Query  1084  NVE  1092
             NVE
Sbjct  630   NVE  632



>ref|XP_007161166.1| hypothetical protein PHAVU_001G047900g [Phaseolus vulgaris]
 gb|ESW33160.1| hypothetical protein PHAVU_001G047900g [Phaseolus vulgaris]
Length=663

 Score =   473 bits (1218),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 235/353 (67%), Positives = 287/353 (81%), Gaps = 2/353 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
              GL FLI I + K R+RH S Y+ IE+YL   N+L PIRYSY EIK+M+  FK KLGEGG
Sbjct  307   FGLPFLIVIFICKWRKRHTSMYENIENYLQ-QNSLAPIRYSYKEIKKMSAGFKEKLGEGG  365

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             +G VFK  L SGP VA+KM+GKSKA GQ+FI+EVATIGRIHH NVVRLIGFCV GSKRAL
Sbjct  366   FGYVFKAKLCSGPSVAIKMLGKSKANGQDFINEVATIGRIHHQNVVRLIGFCVSGSKRAL  425

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF KE +I LS+E +++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  426   VYEFMPNGSLDKFIFSKERNIHLSYENVYNISIGVARGIAYLHHGCEMQILHFDIKPHNI  485

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF PKVSDFGLAKLYP+++S+V++T ARGT+GYMAPEL Y+NIGGISHKADVYSFG
Sbjct  486   LLDENFIPKVSDFGLAKLYPIDNSIVTMTIARGTIGYMAPELFYKNIGGISHKADVYSFG  545

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM  +RKNLNP V+  SQ+YFP W+Y+ +KD +DID    T+EEK ++KKMIIV+L
Sbjct  546   MLLMEMASKRKNLNPHVDHSSQLYFPLWIYDHIKDEEDIDKEYLTKEEKIIAKKMIIVSL  605

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             WCIQ+ PS+RPSM +V+  + E D+E LE+ PKP L  DE+  D  +  +  N
Sbjct  606   WCIQLKPSDRPSMNRVV-EMLEGDIEDLEIPPKPALFLDELSRDGETINSTSN  657



>ref|XP_010275348.1| PREDICTED: probable receptor-like protein kinase At5g39030, partial 
[Nelumbo nucifera]
Length=357

 Score =   462 bits (1189),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 227/329 (69%), Positives = 276/329 (84%), Gaps = 3/329 (1%)
 Frame = +1

Query  79    HLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAV  258
             H    D IE +LS  NNLMPIRYSY +IK+MT  FK KLG+GGYG+VF+G LRSG  VA+
Sbjct  3     HSQGDDNIEDFLSSYNNLMPIRYSYSKIKKMTRGFKEKLGQGGYGSVFEGKLRSGHPVAI  62

Query  259   KMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIF-P  435
             KM+ +SK  GQEFI+EVATIGRIHH NVV+L+GFC EGSKRAL+Y+FMPNGSLEKYIF P
Sbjct  63    KMLDQSKGNGQEFINEVATIGRIHHVNVVQLVGFCSEGSKRALVYDFMPNGSLEKYIFSP  122

Query  436   KEESISL-SHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGL  612
             +E S  L S ++M+DI+LGVARGI YLH+GCD+ ILHFDIKPHNILLDENF PK+SDFGL
Sbjct  123   QENSTPLISWKQMYDIALGVARGIAYLHQGCDIHILHFDIKPHNILLDENFIPKISDFGL  182

Query  613   AKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNP  792
             AK Y  ++S+VSLTAARGTMGY+APEL Y+NIG +S+KADVYSFGMLLMEM GRRKN+N 
Sbjct  183   AKFYSTDESIVSLTAARGTMGYIAPELVYKNIGNVSYKADVYSFGMLLMEMAGRRKNINA  242

Query  793   FVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKK  972
             F E  SQIYFPSWVY+QL +G+++++ D TEEEK+++KK ++VALWCIQMNP +RPSM K
Sbjct  243   FEEHSSQIYFPSWVYDQLHEGRNLEIRDVTEEEKEIAKKFVVVALWCIQMNPMDRPSMSK  302

Query  973   VIemleeedvellemAPKPFLSPDEVPTD  1059
             VI  + E +VELL+M PKPFL P ++P +
Sbjct  303   VI-EMLESNVELLQMPPKPFLYPPDMPVN  330



>ref|XP_011003873.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Populus 
euphratica]
Length=646

 Score =   473 bits (1216),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 278/340 (82%), Gaps = 2/340 (1%)
 Frame = +1

Query  40    FLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTV  219
             F+ + ++YK  RRHLS YD IE +L   NN  PIRYSY +IK++TN FK +LG+GGYG+V
Sbjct  281   FVFAFLIYKWLRRHLSMYDIIEEFLQSQNNFAPIRYSYSDIKKITNGFKERLGQGGYGSV  340

Query  220   FKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEF  399
             +KG LRSG   AVKM+ KS A GQ+FI+EVATIGRIHH NVVRLIGFC EGSKRAL+Y+F
Sbjct  341   YKGKLRSGHLAAVKMLDKSSANGQDFINEVATIGRIHHVNVVRLIGFCAEGSKRALVYDF  400

Query  400   MPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDE  579
             MPNGSL+KY+  ++ + +LS +KM++ISLGVARGI+YLHRGCDM+ILHFDIKPHN+LLDE
Sbjct  401   MPNGSLDKYVLSRQGNTTLSWQKMYEISLGVARGIEYLHRGCDMQILHFDIKPHNVLLDE  460

Query  580   NFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLM  759
             NF+PKVSDFGLAKLYP  ++ V LTAARGT+GY+APEL Y+NIG +S+KADVYSFGMLLM
Sbjct  461   NFAPKVSDFGLAKLYPTNNNTVMLTAARGTIGYIAPELFYKNIGSVSYKADVYSFGMLLM  520

Query  760   EMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQ  939
             EMVG+R+N NP  E  S+ YFP WVY Q+ DG+ +++GDAT++E K++KKMIIVALWCIQ
Sbjct  521   EMVGKRQNTNPVTESNSENYFPDWVYNQVVDGR-VEIGDATKDENKLAKKMIIVALWCIQ  579

Query  940   MNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             M P  RP M KV+  + E DVE LE  PKP L PDE P +
Sbjct  580   MKPINRPPMNKVV-EMLEGDVESLEFPPKPVLFPDETPPN  618



>ref|XP_007022132.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13657.1| PR5-like receptor kinase [Theobroma cacao]
Length=773

 Score =   476 bits (1225),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 232/340 (68%), Positives = 285/340 (84%), Gaps = 2/340 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             L R  LG+  L+++V YKLRRRHLS  DTIE ++   +N MPIRYS+ EIKRMT +F+ K
Sbjct  315   LPRILLGISCLVALVTYKLRRRHLSMDDTIEEFIQSQHNFMPIRYSFREIKRMTRDFRDK  374

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LGEGGYG+VFKG LRSG FVA+K++  SKA GQ+FI+EVA+IGRIHH NV +LIGFCVEG
Sbjct  375   LGEGGYGSVFKGKLRSGHFVAIKLLS-SKANGQDFINEVASIGRIHHVNVAKLIGFCVEG  433

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SK+AL+YEFMPNGSL++ IF K+  I+LS +KMFDI+LGVARGI+YLH+GCDM+ILHFDI
Sbjct  434   SKQALVYEFMPNGSLDRIIFAKDNKITLSWQKMFDIALGVARGIEYLHQGCDMQILHFDI  493

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLD+NF PKVSDFGLAKLY V DS+VSLTAARGT+GYMAPEL Y+NIGGIS+KAD
Sbjct  494   KPHNILLDKNFIPKVSDFGLAKLYSVADSVVSLTAARGTVGYMAPELVYQNIGGISYKAD  553

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLL+E+VG+RKNL+ FVEQ SQIYFPSW+Y+Q     +I+  + T++EK + KKM
Sbjct  554   VYSFGMLLLEIVGKRKNLDTFVEQSSQIYFPSWIYDQFDQRDNIEFREVTDDEKIIVKKM  613

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPF  1032
             +I A WCIQ+ P +RPSM +V+  + E D+E LEM PKPF
Sbjct  614   VITAFWCIQLKPIDRPSMSRVL-EMLETDIESLEMPPKPF  652



>ref|XP_006593811.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
isoform X2 [Glycine max]
Length=703

 Score =   474 bits (1219),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 229/371 (62%), Positives = 294/371 (79%), Gaps = 2/371 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y +G+F  G+   I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   
Sbjct  319   LPYLVGKFLFGMTLFIVLLIYKWRKRHLSIYENIENYLE-QNNLMPIGYSYKEIKKMARG  377

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEG YG VFKG LRSGPFVA+KM+ K+K  GQ+FISE+ATIGRIHH NVV+LIG+
Sbjct  378   FKEKLGEGDYGFVFKGKLRSGPFVAIKMLHKAKGNGQDFISEIATIGRIHHQNVVQLIGY  437

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGS RAL+YEFMPNGSL+K+IF K+ SI L+++++F+I++GVARGI YLH GC+M+IL
Sbjct  438   CAEGSNRALVYEFMPNGSLDKFIFTKDGSIHLTYDEIFNIAIGVARGIAYLHHGCEMQIL  497

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PKVSDFGLAKLYP+++S+V++TAARG +GYMAP+L Y+NIGGIS
Sbjct  498   HFDIKPHNILLDETFTPKVSDFGLAKLYPIDNSIVTMTAARGIIGYMAPKLFYKNIGGIS  557

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             HKADVYSFGMLLMEM  +RKNLNP  +  SQ+YFP W+Y QL    +I M   TEEE K+
Sbjct  558   HKADVYSFGMLLMEMASKRKNLNPHADHSSQLYFPFWIYNQLGKETNIGMEGVTEEENKI  617

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNA  1080
             +KKMIIV+LWCIQ+ P++R SM KV+  + E D+E LE+ PKP L P E   ++ S  ++
Sbjct  618   AKKMIIVSLWCIQLKPTDRLSMNKVV-EMLEGDIESLEIPPKPSLYPHETMENDQSIYSS  676

Query  1081  QNVESPLLSDN  1113
             Q + +  +S +
Sbjct  677   QTMSTDFISSS  687



>ref|XP_006593810.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
isoform X1 [Glycine max]
Length=707

 Score =   474 bits (1219),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 229/371 (62%), Positives = 294/371 (79%), Gaps = 2/371 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y +G+F  G+   I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   
Sbjct  323   LPYLVGKFLFGMTLFIVLLIYKWRKRHLSIYENIENYLE-QNNLMPIGYSYKEIKKMARG  381

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEG YG VFKG LRSGPFVA+KM+ K+K  GQ+FISE+ATIGRIHH NVV+LIG+
Sbjct  382   FKEKLGEGDYGFVFKGKLRSGPFVAIKMLHKAKGNGQDFISEIATIGRIHHQNVVQLIGY  441

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGS RAL+YEFMPNGSL+K+IF K+ SI L+++++F+I++GVARGI YLH GC+M+IL
Sbjct  442   CAEGSNRALVYEFMPNGSLDKFIFTKDGSIHLTYDEIFNIAIGVARGIAYLHHGCEMQIL  501

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PKVSDFGLAKLYP+++S+V++TAARG +GYMAP+L Y+NIGGIS
Sbjct  502   HFDIKPHNILLDETFTPKVSDFGLAKLYPIDNSIVTMTAARGIIGYMAPKLFYKNIGGIS  561

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             HKADVYSFGMLLMEM  +RKNLNP  +  SQ+YFP W+Y QL    +I M   TEEE K+
Sbjct  562   HKADVYSFGMLLMEMASKRKNLNPHADHSSQLYFPFWIYNQLGKETNIGMEGVTEEENKI  621

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNA  1080
             +KKMIIV+LWCIQ+ P++R SM KV+  + E D+E LE+ PKP L P E   ++ S  ++
Sbjct  622   AKKMIIVSLWCIQLKPTDRLSMNKVV-EMLEGDIESLEIPPKPSLYPHETMENDQSIYSS  680

Query  1081  QNVESPLLSDN  1113
             Q + +  +S +
Sbjct  681   QTMSTDFISSS  691



>ref|XP_007220160.1| hypothetical protein PRUPE_ppa017667mg [Prunus persica]
 gb|EMJ21359.1| hypothetical protein PRUPE_ppa017667mg [Prunus persica]
Length=590

 Score =   469 bits (1206),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 227/344 (66%), Positives = 284/344 (83%), Gaps = 2/344 (1%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGE  201
             +  G     ++++YK +RRHLS +D IE +L   N LMP+RYSY  IK+M   FK KLGE
Sbjct  236   YVFGFPCATALIIYKWKRRHLSMHDNIEDFLQN-NKLMPVRYSYSNIKKMAKGFKEKLGE  294

Query  202   GGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKR  381
             GGYG+V+K  LRSG  VA+KM+GKS A GQ+FI+EVATIGRIHH NV +LIGFCVEGSKR
Sbjct  295   GGYGSVYKAKLRSGRLVAIKMLGKSNANGQDFINEVATIGRIHHVNVEQLIGFCVEGSKR  354

Query  382   ALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPH  561
             AL+Y+FMP+GSL+KY+F ++  ISL+ EKMF+I+LGVARGI+YLHRGC+M+ILHFDIKPH
Sbjct  355   ALVYDFMPSGSLDKYLFSQQGVISLNCEKMFEIALGVARGIEYLHRGCEMQILHFDIKPH  414

Query  562   NILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYS  741
             NILLD+NF PKVSDFGLA+L P+++S+VSL AAR T+GY+APEL Y+NIGGIS+KADVYS
Sbjct  415   NILLDDNFLPKVSDFGLARLCPLDNSIVSLMAARETLGYIAPELFYKNIGGISYKADVYS  474

Query  742   FGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIV  921
             F MLLMEM  RRKNLN  +E+ SQIYFP+  ++QL DGKDI +GDAT+EE+K+ KKMIIV
Sbjct  475   FRMLLMEMACRRKNLNATIEKSSQIYFPTLAFDQLSDGKDIKIGDATDEEEKIIKKMIIV  534

Query  922   ALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             ALWC+QM PS+RPSM K +  + E ++E LEM PKPFL P ++P
Sbjct  535   ALWCVQMKPSDRPSMNKAV-EMLEGEIESLEMPPKPFLYPQQMP  577



>gb|KDP42843.1| hypothetical protein JCGZ_23785 [Jatropha curcas]
Length=411

 Score =   462 bits (1188),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 227/353 (64%), Positives = 280/353 (79%), Gaps = 2/353 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             G++ L+S  +YK +RRHLS YD IE +L   +NL PIRYSY EIK++TN FK KLGEGG+
Sbjct  38    GIIGLLSFWIYKWQRRHLSKYDNIEEFLQSYDNLFPIRYSYSEIKKITNGFKEKLGEGGF  97

Query  211   GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
             G+V+KG LRSG F AVKM+  SK  G++FI+EVATIGRI H NVVRL+GF  E SKRAL+
Sbjct  98    GSVYKGKLRSGNFAAVKMLNMSKGNGRDFINEVATIGRIRHINVVRLVGFYAEKSKRALV  157

Query  391   YEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNIL  570
             Y+FM NGSLEKYIF +E S  ++ EKM++ISLGVARGIDYLHRGC M+ILHFDIKPHNIL
Sbjct  158   YDFMSNGSLEKYIFSEERSNLITIEKMYEISLGVARGIDYLHRGCHMKILHFDIKPHNIL  217

Query  571   LDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGM  750
             L+ENF PK+SDFGLAKLY  ++S+V LTAARGTMGYMAPEL Y+NIGGISHKADVYSFG+
Sbjct  218   LNENFLPKISDFGLAKLYSTDESIVCLTAARGTMGYMAPELIYKNIGGISHKADVYSFGI  277

Query  751   LLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGD-ATEEEKKVSKKMIIVAL  927
             LLMEMVGRRK+LN F   +SQ+YFP+WVYEQ   GKD+++GD  +EEE  ++KKM +VAL
Sbjct  278   LLMEMVGRRKHLNAFAAHVSQVYFPTWVYEQFNKGKDMELGDNVSEEESTMTKKMALVAL  337

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             WCIQ+ P  RPSM +VI  + E + E L++ PKP L P +   ++    N  +
Sbjct  338   WCIQLEPIYRPSMHEVI-EMLEGEFENLKLPPKPSLVPQDKKKEDVGINNGSS  389



>ref|XP_007022121.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13646.1| PR5-like receptor kinase [Theobroma cacao]
Length=647

 Score =   470 bits (1210),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 234/364 (64%), Positives = 290/364 (80%), Gaps = 2/364 (1%)
 Frame = +1

Query  31    GLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGY  210
             G+  LI +V YK RRRHLS  D IE +    N+++PIRYSY EIKRMT +F+ KLGEGGY
Sbjct  280   GICCLIVVVTYKWRRRHLSVDDMIEEFFQSQNDIIPIRYSYREIKRMTKSFRDKLGEGGY  339

Query  211   GTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALL  390
              +V+KG L SG FVA+K++GKSKA GQ+FI+EVATIGRIHH NV RLIGFC EGSK+A +
Sbjct  340   SSVYKGKLCSGHFVAIKLLGKSKANGQDFINEVATIGRIHHANVARLIGFCAEGSKQAFV  399

Query  391   YEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNIL  570
             Y+FM NGSL+K IF +E    LS ++MFDI+LGVARGI+YLH+GCDM+ILHFDIKPHN+L
Sbjct  400   YDFMSNGSLDKIIFAEENKTILSWQQMFDIALGVARGIEYLHQGCDMQILHFDIKPHNVL  459

Query  571   LDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGM  750
             LDENF PKVSDFGLAKLY V+D++VSLTAARGT+GY+APEL Y+NIGGIS+KADVYSFGM
Sbjct  460   LDENFIPKVSDFGLAKLYSVDDNIVSLTAARGTIGYIAPELVYKNIGGISYKADVYSFGM  519

Query  751   LLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALW  930
             LLMEMVGRRKNLN   E LSQIYFPSW+Y +L  G+D ++ + T+ EK + KKMII   W
Sbjct  520   LLMEMVGRRKNLNVLAEHLSQIYFPSWIYGRLHQGQDFELREVTDFEKILVKKMIITTCW  579

Query  931   CIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN-AQNVESPLLS  1107
             CIQ+ P++RPSM KV+  + E DVEL++M PK F  P E+ T ++   N +++  S LLS
Sbjct  580   CIQVTPNDRPSMNKVL-QMLETDVELIQMPPKSFQLPFEISTGDHVDDNPSEDPTSSLLS  638

Query  1108  DNPV  1119
              N +
Sbjct  639   SNEI  642



>ref|XP_010662819.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Vitis vinifera]
Length=384

 Score =   461 bits (1186),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 231/375 (62%), Positives = 297/375 (79%), Gaps = 9/375 (2%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             +GR   G+L L+  ++YK RRRHLS  D IE +L    NL PI+YSY E+K+MT+NFK+K
Sbjct  15    IGRAVPGILCLLVYLIYKFRRRHLSLDDGIEEFLHSHKNLQPIKYSYSELKKMTHNFKNK  74

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG+GG+G+V+KG LRSG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVVRL+GF ++G
Sbjct  75    LGQGGFGSVYKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFYIQG  134

Query  373   SKRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
             SK AL+Y+FMPNGSL+K++F  +  +I LS E+++ I+LGVARGI+YLH+GCDM+ILHFD
Sbjct  135   SKWALVYDFMPNGSLDKFVFLDQGNNIPLSWERLYKIALGVARGIEYLHQGCDMQILHFD  194

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
             IKPHNILLDE+F+PKVSDFGLAKLY ++D++VS+TAARGT+GY+APEL Y+N+GG+S KA
Sbjct  195   IKPHNILLDEDFTPKVSDFGLAKLYSIDDNIVSITAARGTLGYIAPELFYKNLGGVSFKA  254

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLL+EMVG+RKN+N F E  SQIYFPSW+Y +   G+D++MGDATE+EKK  +K
Sbjct  255   DVYSFGMLLLEMVGKRKNVNAFAEHSSQIYFPSWIYNRYDQGEDMEMGDATEDEKKYVRK  314

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNV  1089
             M+IVALWCIQM P +RPSM K +  + E  VELL+M PKP L    +   E S      V
Sbjct  315   MVIVALWCIQMKPMDRPSMSKTL-EMLEGAVELLKMPPKPTLW--SIENHEQSM-----V  366

Query  1090  ESPLLSDNPVRSSSF  1134
             E P+ S N + + S 
Sbjct  367   ELPISSSNSMGTISL  381



>emb|CAN72345.1| hypothetical protein VITISV_041721 [Vitis vinifera]
Length=495

 Score =   465 bits (1196),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 212/323 (66%), Positives = 273/323 (85%), Gaps = 1/323 (0%)
 Frame = +1

Query  13   LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
            +GR  +G+L L + ++YK RRRHLS  D IE +L    NL PI+Y+Y +IK+MT NFKHK
Sbjct  126  IGRAVIGILCLFAYLIYKFRRRHLSLDDDIEEFLHNYQNLRPIKYTYSDIKKMTYNFKHK  185

Query  193  LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
            LG+GG+G+V+KG LRSG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVVRL+GFC++ 
Sbjct  186  LGQGGFGSVYKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQR  245

Query  373  SKRALLYEFMPNGSLEKYIF-PKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
            SK AL+Y++MPNGSL+K++F  +E +I LS E+++ I+LGV RGI+YLH+GCDM+ILHFD
Sbjct  246  SKWALIYDYMPNGSLDKFVFLDQENNIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFD  305

Query  550  IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
            IKPHNILLDE+F+PKVSDFGLAKLY  ++S+VS+TAARGT+GY+APEL Y+NIGG+S KA
Sbjct  306  IKPHNILLDEDFTPKVSDFGLAKLYSTDESIVSVTAARGTLGYIAPELFYKNIGGVSFKA  365

Query  730  DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
            DVYSFGMLL+EMVG+RKN+N F E  SQIYFPSW+Y++   G+D++MGDATE+EKK  +K
Sbjct  366  DVYSFGMLLLEMVGKRKNVNAFAEHSSQIYFPSWIYDRYDQGEDMEMGDATEDEKKYVRK  425

Query  910  MIIVALWCIQMNPSERPSMKKVI  978
            M+IVALWC+QM P +RPSM K +
Sbjct  426  MVIVALWCVQMKPVDRPSMSKTL  448



>ref|XP_007161186.1| hypothetical protein PHAVU_001G049200g [Phaseolus vulgaris]
 gb|ESW33180.1| hypothetical protein PHAVU_001G049200g [Phaseolus vulgaris]
Length=330

 Score =   458 bits (1179),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 223/327 (68%), Positives = 274/327 (84%), Gaps = 3/327 (1%)
 Frame = +1

Query  91    YDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMG  270
             Y+ IE+YL   N+L PIRYSY EIK+M   FK KLGEGG+G+VFK  L SGPFVA+KM+G
Sbjct  2     YNNIENYLQ-QNSLTPIRYSYKEIKKMAAGFKEKLGEGGFGSVFKAKLCSGPFVAIKMLG  60

Query  271   KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEESI  450
             KSK  GQ+FISEVATIGRIHH NVVRLIGFCV GSKRAL+YEFMPNGSL+K+IF KE +I
Sbjct  61    KSKTNGQDFISEVATIGRIHHQNVVRLIGFCVSGSKRALVYEFMPNGSLDKFIFSKERNI  120

Query  451   SLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYPV  630
              LS+EK+++IS+GVARGI YLH GC+M+ILHFDIKPHNILLDEN+ PKV DFGLAKLYP+
Sbjct  121   HLSYEKIYNISIGVARGIAYLHHGCEMQILHFDIKPHNILLDENYIPKVFDFGLAKLYPI  180

Query  631   EDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQLS  810
             ++S+V++TAARGT+GYMAPEL Y+NIGGISHKADVYSFGMLLMEM  +RKNLNP V+  S
Sbjct  181   DNSIVTMTAARGTIGYMAPELFYKNIGGISHKADVYSFGMLLMEMASKRKNLNPHVDHSS  240

Query  811   QIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIemle  990
             Q+YFP W+Y+ ++  +D+D+ D TEEE K++KKMIIVALWCIQ+  ++RPSM +V+  + 
Sbjct  241   QLYFPLWIYDHIRKWEDVDIKDVTEEENKIAKKMIIVALWCIQLKSNDRPSMNRVV-KML  299

Query  991   eedvellemAPKPFLSP-DEVPTDENS  1068
             E D+E LE+ PKP L P DE   D+ +
Sbjct  300   EGDIEDLEIPPKPILFPEDETMIDDQT  326



>ref|XP_002263061.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=399

 Score =   461 bits (1186),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 228/365 (62%), Positives = 294/365 (81%), Gaps = 5/365 (1%)
 Frame = +1

Query  10    ALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKH  189
              +GR  LG+L L + ++YK  RRHLS  D IE +L    NL PI+YSY  IK+MTNNF +
Sbjct  25    VIGRTMLGMLCLFAYLIYKFHRRHLSFDDNIEEFLRSHKNLQPIKYSYSNIKKMTNNFAN  84

Query  190   KLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             KLG+GG+G+V+KG LRSG  VAVK++  SKA GQ+FI+EVATIGRIHH NVVRL+GFCV+
Sbjct  85    KLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQ  144

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             GSK AL+Y+FMPNGSL+K+IF KEE+ + LS E+++ ++LGV RGI+YLH+GCDM+ILHF
Sbjct  145   GSKWALIYDFMPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHF  204

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLTAARGT+GY+A EL Y+NIGG+S+K
Sbjct  205   DIKPHNILLDEDFTPKVSDFGLAKLYSTDESMVSLTAARGTLGYIALELFYKNIGGVSYK  264

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLME VGRRKN+N   E  SQIYFPSW+Y++   G +ID+GDA E+EKK+ +
Sbjct  265   ADVYSFGMLLMETVGRRKNVNANAEHSSQIYFPSWIYDRYDQGDNIDLGDAIEDEKKLVR  324

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             KM+IVALWCIQM P  RPSM K +  + E +VELLE+ PKP L  +E+  +++    +  
Sbjct  325   KMVIVALWCIQMKPINRPSMSKAL-EMLEGEVELLEIPPKPTLYYEEMLVEDHM---SNP  380

Query  1087  VESPL  1101
             +E+P+
Sbjct  381   IEAPI  385



>ref|XP_002321441.2| hypothetical protein POPTR_0015s02040g [Populus trichocarpa]
 gb|EEF05568.2| hypothetical protein POPTR_0015s02040g [Populus trichocarpa]
Length=618

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 231/367 (63%), Positives = 288/367 (78%), Gaps = 3/367 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             + R  L   F+ + +VY+  RRHLS YD IE +L   NN  PIRYSY +IK++TN FK K
Sbjct  244   IARTVLCSPFVFAFLVYRWLRRHLSMYDIIEEFLQSQNNFAPIRYSYSDIKKITNGFKEK  303

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG+GGYG+V+KG LRSG   AVKM+ KS A GQ+FI+EVATIGRIHH NVVRLIGFC EG
Sbjct  304   LGQGGYGSVYKGKLRSGHLAAVKMLDKSSANGQDFINEVATIGRIHHVNVVRLIGFCAEG  363

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SKRAL+Y+FMPNGSL+KY+  ++ +  LS +KM++ISLGVARGI+YLHRGCDM+ILHFDI
Sbjct  364   SKRALVYDFMPNGSLDKYVLSRQGNTILSWQKMYEISLGVARGIEYLHRGCDMQILHFDI  423

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHN+LLDENF+PKVSDFGLAKLYP  ++ V LTAARGT+GY+APEL Y+NIG +S+KAD
Sbjct  424   KPHNVLLDENFAPKVSDFGLAKLYPTNNNTVMLTAARGTLGYIAPELFYKNIGSVSYKAD  483

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEMVG+R++ NP  E  S+ YFP WVY Q+ DG+ +++ DAT +E K++KKM
Sbjct  484   VYSFGMLLMEMVGKRQSTNPVTESNSKNYFPDWVYNQVVDGR-VEIEDATIDENKLAKKM  542

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVE  1092
             IIVALWCIQM P +RP M KV+  + E DVE L+  PKP L PDE PT + S+   +   
Sbjct  543   IIVALWCIQMKPIDRPPMNKVV-EMLEGDVENLKFPPKPVLFPDETPT-KYSYSTDETHS  600

Query  1093  SPLLSDN  1113
             S +L D+
Sbjct  601   SSMLFDS  607



>ref|XP_007021960.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13485.1| PR5-like receptor kinase [Theobroma cacao]
Length=583

 Score =   467 bits (1201),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 263/305 (86%), Gaps = 1/305 (0%)
 Frame = +1

Query  64   KLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSG  243
            KL+RRHLS  D IE++L   NNLMPIRYSY EIKRMT+ FK+KLG+GGYG VFKG LRSG
Sbjct  257  KLKRRHLSVDDDIENFLQSQNNLMPIRYSYSEIKRMTDGFKNKLGQGGYGYVFKGKLRSG  316

Query  244  PFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEK  423
              VA+K++  SKA GQ+FI+EVATIGRIHH NVVRLIGFCV+GSK+AL+Y+FM NGSL+K
Sbjct  317  QLVAIKLLNNSKANGQDFINEVATIGRIHHVNVVRLIGFCVKGSKQALVYDFMKNGSLDK  376

Query  424  YIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSD  603
             IF  E + +LS +KMF+I+LGVARGI+YLHRGC+M+ILHFDIKP NILLDENF+PKVSD
Sbjct  377  IIFSAENN-TLSWQKMFEIALGVARGIEYLHRGCEMQILHFDIKPRNILLDENFTPKVSD  435

Query  604  FGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKN  783
            FGLAKLY V++ ++SLTAARGT+GYMAPEL Y+N+GGIS+KADVYSFGM+LME+ GRRKN
Sbjct  436  FGLAKLYSVDNDIISLTAARGTVGYMAPELFYKNLGGISYKADVYSFGMMLMEITGRRKN  495

Query  784  LNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPS  963
            LN   EQ SQIYFPSW+Y++L +G  +D+GD  E E K+ +KM+IVALWCIQM P++RPS
Sbjct  496  LNASAEQSSQIYFPSWIYDRLDEGDIMDLGDLIENENKIMRKMVIVALWCIQMKPTDRPS  555

Query  964  MKKVI  978
            M KV+
Sbjct  556  MSKVL  560



>ref|XP_009370622.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Pyrus 
x bretschneideri]
Length=672

 Score =   470 bits (1209),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 231/357 (65%), Positives = 284/357 (80%), Gaps = 3/357 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R   G   +I +++YK +RRHLS Y  IE +L   NNL PIRYSY +IK+MT  FK KL
Sbjct  293   ARVVFGFPCVIVLLIYKWKRRHLSMYVLIEEFLQSHNNLTPIRYSYSDIKKMTRGFKDKL  352

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG+V+KG LRSG FVA+KM+GKSKA GQ+FI+EV TIGRIHH NVV+LIG+C EGS
Sbjct  353   GEGGYGSVYKGKLRSGRFVAIKMLGKSKANGQDFINEVGTIGRIHHVNVVQLIGYCAEGS  412

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             KRAL+YEFM NGSL+K+IFPKE  ISL  ++ F+ISLGVARGIDYLH+GCDM+ILHFDIK
Sbjct  413   KRALVYEFMSNGSLDKHIFPKEGLISLRCKRAFEISLGVARGIDYLHQGCDMKILHFDIK  472

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILL++N+ PKVSDFGLA+L P +DS ++LTAARGT+GY+APEL Y+NIGG+S+KAD+
Sbjct  473   PHNILLNDNYVPKVSDFGLARLCPADDSSLTLTAARGTIGYIAPELFYKNIGGVSNKADI  532

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLME+ G+RKNLN      SQIYFPSWVY+Q  +G DI+   ATEEE +++KKM+
Sbjct  533   YSFGMLLMEIAGKRKNLN-VAAHSSQIYFPSWVYDQFSEGNDIESEGATEEENEITKKML  591

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT--DENSFPNA  1080
             IVALWCIQM PS+RP+    +  + E ++E LEM PKPFL P E P   DE+    A
Sbjct  592   IVALWCIQMKPSDRPASMNKVVEMLEGEIECLEMPPKPFLYPQEKPVLDDEDDSETA  648



>gb|KEH40331.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=403

 Score =   460 bits (1183),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 228/360 (63%), Positives = 292/360 (81%), Gaps = 2/360 (1%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
             S  L RF  G+ F I++++YK R+RH S Y+ IE YL   NNLMPI YSY EIK+M   F
Sbjct  46    SILLARFLFGISFFIALLIYKWRKRHWSMYECIEIYLQ-HNNLMPIGYSYKEIKKMAKGF  104

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K +LG+GG+GTVFKG LRSGP VA+KM+GKSK  GQ+FI+EV TIGRIHH NVV+L+GFC
Sbjct  105   KEELGKGGFGTVFKGNLRSGPCVAIKMLGKSKGNGQDFINEVTTIGRIHHLNVVQLLGFC  164

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
             +EGSKRAL+YEFMPNGSL+K+IF KE SI+LS+ K++DI++GVARGI YLH GC+M+ILH
Sbjct  165   IEGSKRALVYEFMPNGSLDKFIFSKEGSINLSYNKIYDIAIGVARGIAYLHHGCEMKILH  224

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDENF PK+SDFGLAKL+P+E+S++++TAARGT+GYMAPEL Y+NIGG+S+
Sbjct  225   FDIKPHNILLDENFIPKISDFGLAKLHPIENSVITMTAARGTIGYMAPELFYKNIGGVSY  284

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVS  903
             KADVYSFGMLLMEM  +RKNLN   E  SQ+YFP W+Y+QL    +I++ +  EE+ K+ 
Sbjct  285   KADVYSFGMLLMEMASKRKNLNTKAEHSSQLYFPFWIYDQLGKQGEIEIENVVEEDMKIV  344

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQ  1083
             KKMI+VALWCIQ+ P++RPSM +V+  + E D+E LEM P+P + PDEV + +    N+ 
Sbjct  345   KKMIMVALWCIQLKPNDRPSMSRVV-EMLEGDIETLEMPPEPTMYPDEVISRDEITTNSN  403



>ref|XP_004498488.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X2 [Cicer arietinum]
Length=719

 Score =   471 bits (1212),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 230/353 (65%), Positives = 291/353 (82%), Gaps = 3/353 (1%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
             SY + R  LGL+   + ++   R RH S Y+ IE +L G N+L+PIRYSY EIK MT +F
Sbjct  339   SYIVARILLGLIIFYTKLIRTYRTRHASMYENIEDFLQG-NSLVPIRYSYKEIKNMTKSF  397

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K KLGEGGYGTV+KGTLRSGP VA+KM+GKSK  GQ+FI+EVATIGRIHHTNVV+LIGFC
Sbjct  398   KDKLGEGGYGTVYKGTLRSGPLVAIKMLGKSKGNGQDFINEVATIGRIHHTNVVQLIGFC  457

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
             V+GSKRAL+YEFMPNGSL+KYI   +++I L++++M++ISLGVARGI YLH+GCDM+ILH
Sbjct  458   VDGSKRALVYEFMPNGSLDKYISSSQDAIFLTYKQMYEISLGVARGITYLHQGCDMQILH  517

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDENF PKVSDFGLAKLYP  +S+V++TAARGT+GYMAPEL Y+NIGG+S+
Sbjct  518   FDIKPHNILLDENFIPKVSDFGLAKLYPNNNSIVTVTAARGTIGYMAPELFYKNIGGVSY  577

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKKV  900
             KADVYSFGMLLME+  RR+NLN   +  SQI+FP W+Y QL + ++I+ +GDAT+E+K  
Sbjct  578   KADVYSFGMLLMEIANRRRNLNSHADDSSQIFFPFWIYNQLIEEREIEILGDATDEDKSN  637

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
              KKM I+ALWCIQ+NPS+RPSM++VI  + E D+E +++ PKP   P E+  D
Sbjct  638   VKKMFIIALWCIQLNPSDRPSMERVI-EMLEGDIENIKIPPKPSPYPTEIIQD  689



>gb|KDP42826.1| hypothetical protein JCGZ_23768 [Jatropha curcas]
Length=680

 Score =   469 bits (1207),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 296/380 (78%), Gaps = 4/380 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             + + R   G  F+ + ++YK RRRHLS Y+TIE +L   NNLMPIRY+Y +IK+MT  FK
Sbjct  277   FLVARCLCGTPFVTAFLIYKWRRRHLSGYNTIEEFLQSHNNLMPIRYAYSDIKKMTGGFK  336

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGG+G V+KG LRSG F A+KM+GKSKA GQ+FI+EVATIGRIHH NVV+LIGFCV
Sbjct  337   EKLGEGGFGCVYKGKLRSGQFAAIKMLGKSKANGQDFINEVATIGRIHHANVVKLIGFCV  396

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EG+KRAL+YEF+ NGSL+KYIF ++  +SL  EK++ IS GVARGI+YLHRGC+M+ILHF
Sbjct  397   EGTKRALVYEFLSNGSLDKYIFSRQGYVSLCWEKLYQISQGVARGIEYLHRGCEMQILHF  456

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF+PK+SDFGLAKLYP + S+ SLTAARGT+GYMAPEL Y+NIG +S+K
Sbjct  457   DIKPHNILLDENFTPKISDFGLAKLYPTKGSIASLTAARGTIGYMAPELFYKNIGRVSYK  516

Query  727   ADVYSFGMLLMEMVGRRKNLNP-FVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVS  903
             ADVYSFGMLL+EM GRRK LN      LS++Y+P WVY++L +G ++++ DATEEE K++
Sbjct  517   ADVYSFGMLLLEMTGRRKKLNAKATADLSEVYYPFWVYDRLSNG-ELEVEDATEEENKIA  575

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDE-VPTDENSFPNA  1080
             +KMII  LWCIQM PS+RP M KVI  + E D+E L++ P+P L P E    DE    + 
Sbjct  576   RKMIITGLWCIQMKPSDRPPMNKVI-EMLEGDLENLQLPPRPVLYPAESFAKDEGESSSM  634

Query  1081  QNVESPLLSDNPVRSSSFEV  1140
             Q   +  L+ +   SSS +V
Sbjct  635   QVDFAESLAKDEGESSSMQV  654



>ref|XP_011001826.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X3 [Populus euphratica]
Length=592

 Score =   466 bits (1199),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 236/371 (64%), Positives = 301/371 (81%), Gaps = 6/371 (2%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             F  GL  L+ +++YK +RRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN FK KLG
Sbjct  221   FLCGLPCLVILLIYKWQRRHLSMYNNIEKFLQSHGNDLMPIRYNYSEIKKITNGFKDKLG  280

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             +GGYG+V+KG LRSG FVAVK++ KSKA GQ+FI+EVATIGRI+H NV+R+IGF VEGSK
Sbjct  281   QGGYGSVYKGKLRSGRFVAVKILDKSKANGQDFINEVATIGRIYHVNVMRIIGFAVEGSK  340

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+ EFMPNGSLEKY+F K+ SI LS+ KM++ISLGVARGI+YLH+GCDM+ILHFDIKP
Sbjct  341   RALILEFMPNGSLEKYLFSKQGSIPLSNNKMYEISLGVARGIEYLHQGCDMQILHFDIKP  400

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDE F PK+SDFGLAKLYP  ++ VSLT ARGT+GYMAPEL Y+NIGG+S K+DVY
Sbjct  401   HNILLDEKFIPKISDFGLAKLYPSGNNNVSLTTARGTIGYMAPELLYKNIGGVSFKSDVY  460

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMI  915
             SFGMLLM+MVGRRKNLN      S+IYFP+WVY+++ +GKDI+   DA E EKK+ KK++
Sbjct  461   SFGMLLMDMVGRRKNLNALANHSSRIYFPAWVYDKVSEGKDIETQEDAPEYEKKILKKVM  520

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             IVALWCIQ+ P +RPS+ KV+  + E DV+ L++ PKPFLSP ++  D++    A  ++ 
Sbjct  521   IVALWCIQLKPDDRPSIHKVV-EMLESDVDFLQIPPKPFLSPHQILEDDD---RANPIKL  576

Query  1096  PLLSDNPVRSS  1128
               LS++ + SS
Sbjct  577   SDLSNDWIDSS  587



>ref|XP_004498487.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120-like isoform X1 [Cicer arietinum]
Length=741

 Score =   471 bits (1212),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 230/353 (65%), Positives = 291/353 (82%), Gaps = 3/353 (1%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
             SY + R  LGL+   + ++   R RH S Y+ IE +L G N+L+PIRYSY EIK MT +F
Sbjct  361   SYIVARILLGLIIFYTKLIRTYRTRHASMYENIEDFLQG-NSLVPIRYSYKEIKNMTKSF  419

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K KLGEGGYGTV+KGTLRSGP VA+KM+GKSK  GQ+FI+EVATIGRIHHTNVV+LIGFC
Sbjct  420   KDKLGEGGYGTVYKGTLRSGPLVAIKMLGKSKGNGQDFINEVATIGRIHHTNVVQLIGFC  479

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
             V+GSKRAL+YEFMPNGSL+KYI   +++I L++++M++ISLGVARGI YLH+GCDM+ILH
Sbjct  480   VDGSKRALVYEFMPNGSLDKYISSSQDAIFLTYKQMYEISLGVARGITYLHQGCDMQILH  539

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDENF PKVSDFGLAKLYP  +S+V++TAARGT+GYMAPEL Y+NIGG+S+
Sbjct  540   FDIKPHNILLDENFIPKVSDFGLAKLYPNNNSIVTVTAARGTIGYMAPELFYKNIGGVSY  599

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKKV  900
             KADVYSFGMLLME+  RR+NLN   +  SQI+FP W+Y QL + ++I+ +GDAT+E+K  
Sbjct  600   KADVYSFGMLLMEIANRRRNLNSHADDSSQIFFPFWIYNQLIEEREIEILGDATDEDKSN  659

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
              KKM I+ALWCIQ+NPS+RPSM++VI  + E D+E +++ PKP   P E+  D
Sbjct  660   VKKMFIIALWCIQLNPSDRPSMERVI-EMLEGDIENIKIPPKPSPYPTEIIQD  711



>emb|CBI23149.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   461 bits (1186),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 229/357 (64%), Positives = 289/357 (81%), Gaps = 3/357 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             GR  LG+L L + V+Y+ RRRHLS  D+IE +L    NL PIRYSY EIK++TN FK KL
Sbjct  90    GRTVLGILCLSAYVIYRFRRRHLSLDDSIEDFLQNHRNLQPIRYSYSEIKKITNGFKDKL  149

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             G+GG+G+V+KG LRSG  VAVKM+  SK  GQ+FI+EVATIGRIHH NVVRLIGFCVEG 
Sbjct  150   GQGGFGSVYKGKLRSGCIVAVKMLVMSKTNGQDFINEVATIGRIHHVNVVRLIGFCVEGP  209

Query  376   KRALLYEFMPNGSLEKYIFP-KEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             K AL+Y+FMPNGSL+KYIFP ++ S+ LS E ++ I+LGV RGI+YLH+GCDM+ILHFDI
Sbjct  210   KWALIYDFMPNGSLDKYIFPERKNSVPLSWEILYKIALGVGRGIEYLHQGCDMQILHFDI  269

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLD+ F+PKVSDFGLAKLY V  S+VSLTAARGT+GY+APEL Y+NIGG+S+KAD
Sbjct  270   KPHNILLDKTFAPKVSDFGLAKLYSVNQSIVSLTAARGTLGYIAPELFYKNIGGVSYKAD  329

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEMVG+++ +N   +  S++YFPSW+Y+++  G+D++MGDATE+EKK  +KM
Sbjct  330   VYSFGMLLMEMVGKKRYVNAHKDDSSEMYFPSWIYDRINKGEDMEMGDATEDEKKCVRKM  389

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFL-SPDEVPTDENSFPNA  1080
             +IVALWCIQM P++RPSM K +  + E D+ELL+M PKP L S +    D  + PN 
Sbjct  390   VIVALWCIQMKPTDRPSMSKAL-EMLEGDIELLKMPPKPTLYSQNRSIEDHGNNPNG  445



>ref|XP_004308548.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Fragaria vesca subsp. vesca]
Length=658

 Score =   468 bits (1204),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 231/359 (64%), Positives = 287/359 (80%), Gaps = 5/359 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             LG  F+I +++ K R RHLS Y TIE +L   +N +PIRYS+ EIK+M+NNFK KLGEGG
Sbjct  293   LGAPFVIVLLIKKWRTRHLSMYRTIEDFLHNGSNFVPIRYSFSEIKKMSNNFKTKLGEGG  352

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG VFKG LRSG F A+KMM  SK+ G++F+SEVATIGRIHH NVVRLIG+CVEGSKRAL
Sbjct  353   YGCVFKGVLRSGRFGAIKMMASSKSNGEDFVSEVATIGRIHHVNVVRLIGYCVEGSKRAL  412

Query  388   LYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHN  564
             +Y+FMPNGSL+KYI+ K  E+I LS +KM++ISLGVA+GI+YLH+GC+M+ILHFDIKPHN
Sbjct  413   IYDFMPNGSLDKYIYSKNAETIPLSVKKMYEISLGVAQGIEYLHQGCEMQILHFDIKPHN  472

Query  565   ILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSF  744
             ILLDENF PK+SDFGLAKLY  +DS+V+LT ARGTMGY+APEL Y+NIGG+S+KADVYSF
Sbjct  473   ILLDENFIPKISDFGLAKLYSTDDSIVTLTQARGTMGYIAPELFYKNIGGVSYKADVYSF  532

Query  745   GMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVA  924
             GMLLMEM  +RKN     E  SQ YFPSWVY+Q   G+D+++GDA++EEK + K+M+I A
Sbjct  533   GMLLMEMASKRKNFKELAEHESQTYFPSWVYDQYVKGRDMELGDASDEEKNIIKRMVITA  592

Query  925   LWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP---TDENSFPNAQNVE  1092
             LWCIQMNP  RPSM+KV   + E DVELL+M   PF   +++P    + N  P+  N E
Sbjct  593   LWCIQMNPIHRPSMRKV-REMLEGDVELLQMPSNPFTCSEDIPLARVETNIDPSCSNTE  650



>ref|XP_007036624.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY21125.1| PR5-like receptor kinase [Theobroma cacao]
Length=646

 Score =   467 bits (1202),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 227/343 (66%), Positives = 281/343 (82%), Gaps = 1/343 (0%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             Y + R  LG+  LI+ V+ K RRRHLS  D IE +L   NNLMPIRYSY ++++MT  FK
Sbjct  269   YIIIRTLLGVSCLIAAVLIKFRRRHLSMDDNIEEFLQMQNNLMPIRYSYSKVQKMTKCFK  328

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLG+GGYG+VFKGTLRSG  VA K++  SK+ GQ+FI+EVATIGRIHH NVV+LIGFCV
Sbjct  329   DKLGQGGYGSVFKGTLRSGRLVAKKLLNMSKSHGQDFINEVATIGRIHHVNVVQLIGFCV  388

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSK+AL+Y+FMPNGSL+K IF +E   +L  EK+F+I++GVARGI+YLH+GC M+ILHF
Sbjct  389   EGSKQALVYDFMPNGSLDKIIFSEERDTTLCWEKIFEIAIGVARGIEYLHQGCQMQILHF  448

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDENF+PK+SDFGLAKLY V+ S+ SLTAARGT+GY+APEL Y+NIG ISHK
Sbjct  449   DIKPHNILLDENFTPKISDFGLAKLYAVDHSIASLTAARGTLGYIAPELFYKNIGSISHK  508

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
              DVYSFGMLLMEMVG+R+NLN F EQ SQIYFPSW+Y++    +DI++GD TE EKK  +
Sbjct  509   VDVYSFGMLLMEMVGKRRNLNAFAEQSSQIYFPSWIYDRFDKEEDIELGDVTENEKKTVR  568

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFL  1035
             KM+I A WCIQ+ P++RPS+ KV   + E +VELLE+ PKPFL
Sbjct  569   KMVITAFWCIQIKPTDRPSISKV-LEMLEGEVELLELPPKPFL  610



>ref|XP_003634115.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=429

 Score =   459 bits (1182),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 215/327 (66%), Positives = 274/327 (84%), Gaps = 1/327 (0%)
 Frame = +1

Query  1    ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
            I+   GR  LG+L L S +++K  RRHLS+ + IE +L    N  PIRYSY  +K+MTNN
Sbjct  52   ITIVGGRTVLGMLCLFSYLIFKFHRRHLSSDEDIEEFLQNHKNFQPIRYSYSHLKKMTNN  111

Query  181  FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
            FK+KLG+GG+G+V+KG LRSG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVVRL+GF
Sbjct  112  FKNKLGQGGFGSVYKGKLRSGQIVAVKMLVISKANGQDFINEVATIGRIHHINVVRLVGF  171

Query  361  CVEGSKRALLYEFMPNGSLEKYIFPK-EESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
            CVEGSK AL+Y+FM NGSL+K+IF K E+SI LS E+++ I+LGV RGI+YLH+GCDM+I
Sbjct  172  CVEGSKWALIYDFMSNGSLDKFIFLKGEKSIPLSWERLYKIALGVGRGIEYLHQGCDMQI  231

Query  538  LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
            LHFDIKPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLTAARGT+GY+APEL Y+NIG +
Sbjct  232  LHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGHV  291

Query  718  SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
            S+KADVYSFGMLLMEMVG+R++++   E LS+I+FPSW+Y+Q++ G  ++MGDATE+EKK
Sbjct  292  SYKADVYSFGMLLMEMVGKRRHVSAHEENLSEIFFPSWIYDQIEQGGHMEMGDATEDEKK  351

Query  898  VSKKMIIVALWCIQMNPSERPSMKKVI  978
              +KMIIVALWC+QM P +RPSM K +
Sbjct  352  YMRKMIIVALWCVQMKPIDRPSMSKAL  378



>gb|KHG10630.1| hypothetical protein F383_14633 [Gossypium arboreum]
Length=650

 Score =   467 bits (1202),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 284/339 (84%), Gaps = 1/339 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R  +G+  L  +VV+K RRRHL   DTIE +L   N LMPIRYSY +IKRMT +FK KLG
Sbjct  278   RTLIGVSSLSIVVVFKFRRRHLCVDDTIEEFLRMQNKLMPIRYSYSDIKRMTESFKEKLG  337

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             +GG+G+VFKG LRSG FVA+K++  SK+ GQ+FI+EVATIGRIHH NVVRL+GFCVEGSK
Sbjct  338   QGGFGSVFKGKLRSGHFVAIKLLELSKSQGQDFINEVATIGRIHHVNVVRLVGFCVEGSK  397

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             +AL+Y+FMPN SL+K IF KE++I+LS EK+F+I++GVA+GI+YLH+GC M+ILHFDIKP
Sbjct  398   QALVYDFMPNSSLDKVIFSKEKNINLSWEKVFEIAIGVAQGIEYLHQGCIMQILHFDIKP  457

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+PKVSDFGLAKL  +++S+VSLTAARGT+GY+APEL Y+NIG I+HKADVY
Sbjct  458   HNILLDENFTPKVSDFGLAKLNAIDNSIVSLTAARGTLGYIAPELFYKNIGNITHKADVY  517

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM GRR NLN    Q S+IYFPSW+Y++   G+D+++ DATE EKK  +KMII
Sbjct  518   SFGMLLMEMAGRRSNLNAQARQSSEIYFPSWIYDRFDRGEDLEVEDATESEKKTVRKMII  577

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFL  1035
             VA WCIQ+ P++RPSM KV+  + E +VELLE+ PKPFL
Sbjct  578   VAFWCIQIKPTDRPSMSKVL-EMLEGNVELLEIPPKPFL  615



>gb|KHG10629.1| hypothetical protein F383_14633 [Gossypium arboreum]
Length=654

 Score =   467 bits (1202),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 284/339 (84%), Gaps = 1/339 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R  +G+  L  +VV+K RRRHL   DTIE +L   N LMPIRYSY +IKRMT +FK KLG
Sbjct  278   RTLIGVSSLSIVVVFKFRRRHLCVDDTIEEFLRMQNKLMPIRYSYSDIKRMTESFKEKLG  337

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             +GG+G+VFKG LRSG FVA+K++  SK+ GQ+FI+EVATIGRIHH NVVRL+GFCVEGSK
Sbjct  338   QGGFGSVFKGKLRSGHFVAIKLLELSKSQGQDFINEVATIGRIHHVNVVRLVGFCVEGSK  397

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             +AL+Y+FMPN SL+K IF KE++I+LS EK+F+I++GVA+GI+YLH+GC M+ILHFDIKP
Sbjct  398   QALVYDFMPNSSLDKVIFSKEKNINLSWEKVFEIAIGVAQGIEYLHQGCIMQILHFDIKP  457

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF+PKVSDFGLAKL  +++S+VSLTAARGT+GY+APEL Y+NIG I+HKADVY
Sbjct  458   HNILLDENFTPKVSDFGLAKLNAIDNSIVSLTAARGTLGYIAPELFYKNIGNITHKADVY  517

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM GRR NLN    Q S+IYFPSW+Y++   G+D+++ DATE EKK  +KMII
Sbjct  518   SFGMLLMEMAGRRSNLNAQARQSSEIYFPSWIYDRFDRGEDLEVEDATESEKKTVRKMII  577

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFL  1035
             VA WCIQ+ P++RPSM KV+  + E +VELLE+ PKPFL
Sbjct  578   VAFWCIQIKPTDRPSMSKVL-EMLEGNVELLEIPPKPFL  615



>ref|XP_003589650.1| serine/threonine protein kinase [Medicago truncatula]
 gb|AES59901.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=648

 Score =   467 bits (1201),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/320 (68%), Positives = 267/320 (83%), Gaps = 1/320 (0%)
 Frame = +1

Query  19   RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
            +F LG   +I++V+YK RR+HLS YD IE +L   N++MPIRYSY +IKR+T  FK KLG
Sbjct  283  KFVLGAPLIIALVIYKWRRKHLSMYDGIEDFLRSDNSIMPIRYSYKDIKRITEQFKTKLG  342

Query  199  EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             GGYG+VFKG LRSG  VAVK++ ++K+  ++F++EVATIGRIHH NVV+LIGFCVEGSK
Sbjct  343  NGGYGSVFKGQLRSGRLVAVKLLDRAKSNDRDFVNEVATIGRIHHVNVVQLIGFCVEGSK  402

Query  379  RALLYEFMPNGSLEKYIFP-KEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
            R L+YEFMPNGSLEKYIF   EE+ SLS E+++ ISLGVARGI+YLH GCDM+ILHFDIK
Sbjct  403  RVLIYEFMPNGSLEKYIFSHNEENYSLSCEQLYSISLGVARGIEYLHNGCDMKILHFDIK  462

Query  556  PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
            PHNILLDENF+PKVSDFGLA+L P + S+V+LTAARGT+GYMAPEL YRN+G IS+KADV
Sbjct  463  PHNILLDENFNPKVSDFGLARLCPTDKSIVTLTAARGTIGYMAPELFYRNVGTISYKADV  522

Query  736  YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
            YSFGMLLMEM  RRKNLN   +Q SQIYFP WVY+QL+DG+++ + + T  E K++KKM+
Sbjct  523  YSFGMLLMEMANRRKNLNALADQSSQIYFPFWVYDQLQDGREMTILNDTNHEMKLAKKMM  582

Query  916  IVALWCIQMNPSERPSMKKV  975
            IVALWCIQ  PS+RP M KV
Sbjct  583  IVALWCIQAKPSDRPPMDKV  602



>ref|XP_010662996.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X1 [Vitis vinifera]
Length=673

 Score =   467 bits (1202),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 227/352 (64%), Positives = 294/352 (84%), Gaps = 2/352 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             +GR +LG+L L+  ++YK +RRHLS  D IE +L   NNL  I+YSY E+K+MT+NFK+K
Sbjct  300   IGRTALGILCLLVYLIYKFQRRHLSLDDDIEEFLHSHNNLQLIKYSYSEVKKMTHNFKNK  359

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG+GG+G+V+KG LRSG  VAVKM+  SKA GQ+F++EVATIGRIHH NVVRLIGFC++G
Sbjct  360   LGQGGFGSVYKGRLRSGHIVAVKMLVMSKANGQDFVNEVATIGRIHHVNVVRLIGFCIQG  419

Query  373   SKRALLYEFMPNGSLEKYIF-PKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
             SK AL+Y+FMPNGSL+K++F  +  +I LS E+++ I+LGV RGI+YLH+GCDM+ILHFD
Sbjct  420   SKWALVYDFMPNGSLDKFVFLDRGNNIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFD  479

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
             IKPHNILLDE+F+PKVSDFGLAKL+  ++S+VSLTAARGT+GY+APEL Y+NIGG+S+KA
Sbjct  480   IKPHNILLDEDFTPKVSDFGLAKLHSTDESIVSLTAARGTLGYIAPELFYKNIGGVSYKA  539

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLL+EM G+RKN+N F E  SQIYFPSW+Y+Q   G+D++MGDATE+EKK  +K
Sbjct  540   DVYSFGMLLLEMAGKRKNVNAFAEHSSQIYFPSWIYDQYDRGEDMEMGDATEDEKKFVRK  599

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             M+IVALWCIQM P +RPSM K +  + E DVELL+M PKP L   E+P +++
Sbjct  600   MVIVALWCIQMKPIDRPSMSKAL-EMLEGDVELLQMPPKPTLYSMEMPVEDH  650



>ref|XP_011014404.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Populus 
euphratica]
Length=668

 Score =   467 bits (1201),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 228/349 (65%), Positives = 283/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPI-RYSYFEIKRMTNNFKHKL  195
             +F  G  F+I+ ++YKLRRRHLSAYDT+E +L   NNLMP+ RYSY EIK+MT  FK KL
Sbjct  304   KFIFGSPFVIAFLIYKLRRRHLSAYDTVEEFLQTHNNLMPVVRYSYSEIKKMTGGFKEKL  363

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGG+G V+KG LRSG   A+K++GKSKA GQ+F +EVATIGRIHHTNVV+L+GFC EGS
Sbjct  364   GEGGFGCVYKGKLRSGHSAAIKLLGKSKANGQDFFNEVATIGRIHHTNVVQLVGFCAEGS  423

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             KRAL+Y+FMPNGSL  +IF +E S+SLS EK+ +ISLGVA GI+YLHRGC+M+ILHFDIK
Sbjct  424   KRALVYDFMPNGSLNNFIFSQERSVSLSWEKLHEISLGVAHGIEYLHRGCEMQILHFDIK  483

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PKVSDFGLA L P  +SL SLTA  GT+GYMAPEL Y+NIG +S+KADV
Sbjct  484   PHNILLDENFAPKVSDFGLAMLCPANESLKSLTAPGGTIGYMAPELFYKNIGRVSYKADV  543

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGD-ATEEEKKVSKKM  912
             YSFGMLL+EM GRRK LNP  E+ S+IY+P WV++Q+ + K ID+GD  T+EEK + KKM
Sbjct  544   YSFGMLLLEMAGRRKKLNPLAERCSEIYWPDWVHDQVSNEKAIDIGDGGTDEEKNIVKKM  603

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             II  LWCIQMNP  RP+M +V+  + E D+E L++ P+P L+ DE P +
Sbjct  604   IIAGLWCIQMNPLNRPAMNEVV-EMLEGDMESLQLPPRPVLNLDEKPMN  651



>gb|KCW59546.1| hypothetical protein EUGRSUZ_H02301 [Eucalyptus grandis]
Length=406

 Score =   457 bits (1177),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 221/354 (62%), Positives = 285/354 (81%), Gaps = 1/354 (0%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + +   +F LG   ++  ++ K  RRH +    IE +L   NN  PIRYSY +IKR+T N
Sbjct  17    VHFLATKFILGAPCVLIFLILKWMRRHQATDANIEEFLRAHNNFFPIRYSYSDIKRITQN  76

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEGGYG V++G LRSG  VAVK++ KSK+ GQ+FISEVATIGRIHH NVV+L+GF
Sbjct  77    FKCKLGEGGYGFVYRGILRSGNEVAVKILNKSKSNGQDFISEVATIGRIHHVNVVQLVGF  136

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C E SK+AL+Y+FMPNGSL+K+I  K+    L ++KM+DISLG+ARGI+YLHRGCDM+IL
Sbjct  137   CFEYSKQALVYDFMPNGSLDKHISYKDGDDPLDYKKMYDISLGIARGIEYLHRGCDMQIL  196

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLD++F+PKVSDFGLA+LYP + S+VSLTAARGT+GYMAPEL Y++IGGIS
Sbjct  197   HFDIKPHNILLDQSFTPKVSDFGLARLYPTDRSIVSLTAARGTLGYMAPELFYKDIGGIS  256

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KADVYSFGMLLMEM GRR+NLN   E+ SQIYFP WVY+QL   K+++M D  EEE++ 
Sbjct  257   YKADVYSFGMLLMEMAGRRRNLNAHAERSSQIYFPLWVYDQLSKEKELEMVDVIEEERET  316

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             ++KMIIVALWCIQ++P++RPSM+KV+  + E D++ L+++PKP L P E P D+
Sbjct  317   TRKMIIVALWCIQLSPNDRPSMRKVL-DMLEGDMDKLQLSPKPLLYPREAPIDD  369



>ref|XP_007161169.1| hypothetical protein PHAVU_001G048200g [Phaseolus vulgaris]
 gb|ESW33163.1| hypothetical protein PHAVU_001G048200g [Phaseolus vulgaris]
Length=590

 Score =   464 bits (1194),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 228/345 (66%), Positives = 283/345 (82%), Gaps = 3/345 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
              GL FLI I + K R+RH+S Y+ IE+YL   N+L  IRYSY EIK+M   FK KLGEGG
Sbjct  241   FGLPFLIVIFIRKWRKRHMSMYENIENYLQ-QNSLAHIRYSYKEIKKMAAGFKDKLGEGG  299

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             +G VFK  LRSGP+VA+KM+GK K  GQ FISEVATIGRIHH NVV+LIGFCV GSKRAL
Sbjct  300   FGYVFKAKLRSGPYVAIKMLGKCKGNGQNFISEVATIGRIHHQNVVKLIGFCVSGSKRAL  359

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+I  KE +I LS+EK+++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  360   VYEFMPNGSLDKFILSKERNIHLSYEKIYNISIGVARGIAYLHHGCEMQILHFDIKPHNI  419

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF PKVSDFGLAKLYP+ +S+V++TAARGT+GYMAP+L Y NIGGIS+KA+VYSFG
Sbjct  420   LLDENFIPKVSDFGLAKLYPINNSIVTMTAARGTIGYMAPKLFYNNIGGISYKANVYSFG  479

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM  +RKNLN   +  SQ+YFP W+++ +++ +D+D+GD TEEE K++KKMIIVAL
Sbjct  480   MLLMEMASKRKNLNTHADHSSQLYFPLWIHDYIREEEDVDIGDVTEEENKIAKKMIIVAL  539

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLS-PDEVPTD  1059
             WCIQ+ P++RPSM +V+  + E D+E LE+ PKP L   DE+ TD
Sbjct  540   WCIQLKPNDRPSMNRVV-KMLEGDIEDLEIPPKPILFLEDEIVTD  583



>ref|XP_008232092.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=360

 Score =   456 bits (1172),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 220/316 (70%), Positives = 264/316 (84%), Gaps = 0/316 (0%)
 Frame = +1

Query  16   GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             R   G+  LI+ V+Y  RRRHLS+Y  IE +L    N +PIRYSY EIK+MT+ FK KL
Sbjct  39   ARLIFGVPCLIAFVIYIWRRRHLSSYSIIEDFLQSDINFLPIRYSYSEIKKMTSKFKKKL  98

Query  196  GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
            GEGGYG+VFKG LRSG FVA+K++GK+K  GQ+F SEVATIGRIHH NVV+L+G+CVEG 
Sbjct  99   GEGGYGSVFKGKLRSGRFVAIKLLGKAKGNGQDFTSEVATIGRIHHVNVVQLVGYCVEGL  158

Query  376  KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             RAL+Y+FMPNGSL+KYI+ KEES+ LS  KM++ISLGVARGI+YLH+GCDM+ILHFDIK
Sbjct  159  NRALVYDFMPNGSLDKYIYSKEESMPLSCMKMYEISLGVARGIEYLHQGCDMQILHFDIK  218

Query  556  PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
            PHNILLDENF+PK+SDFGLAKLYP+++S+VSLTAARGTMGY+APEL Y+NIGG+S+KADV
Sbjct  219  PHNILLDENFNPKISDFGLAKLYPIDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADV  278

Query  736  YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
            YSFGMLLMEM  RRKN +  VE  +QIYFP W Y+Q   G D++M D  EEEKKV KKM+
Sbjct  279  YSFGMLLMEMASRRKNWSTMVEHSNQIYFPLWAYDQYNKGNDLEMRDVNEEEKKVIKKMV  338

Query  916  IVALWCIQMNPSERPS  963
            I ALWCIQM PS+RPS
Sbjct  339  ITALWCIQMKPSDRPS  354



>ref|XP_007161165.1| hypothetical protein PHAVU_001G047800g [Phaseolus vulgaris]
 gb|ESW33159.1| hypothetical protein PHAVU_001G047800g [Phaseolus vulgaris]
Length=331

 Score =   454 bits (1168),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 269/329 (82%), Gaps = 2/329 (1%)
 Frame = +1

Query  82    LSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVK  261
             +S Y+ IE YL   N+L PIRYSY EIK+M   FK KLGEGG+G VF   LRSGP VA+K
Sbjct  1     MSMYENIESYLE-QNSLAPIRYSYKEIKKMAAGFKEKLGEGGFGYVFMAKLRSGPSVAIK  59

Query  262   MMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKE  441
             ++ KSK  GQ+FISEVATIGRIHH NVV+LIGFCV GSKRAL+YEFMPNGSL+K+IF KE
Sbjct  60    ILNKSKGNGQDFISEVATIGRIHHQNVVQLIGFCVSGSKRALVYEFMPNGSLDKFIFSKE  119

Query  442   ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKL  621
              +  LS+EK+++IS+GVARGI YLH GC+M+ILHFDIKPHNILLDENF PKVSDFGL KL
Sbjct  120   RNTHLSYEKIYNISIGVARGIAYLHHGCEMQILHFDIKPHNILLDENFIPKVSDFGLVKL  179

Query  622   YPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVE  801
             YP+++S+V++T ARGT+GYMAPEL Y+NIGGISHKADVYSFGMLLMEM  +RKNLNP  +
Sbjct  180   YPIDNSIVTMTVARGTIGYMAPELFYKNIGGISHKADVYSFGMLLMEMTSKRKNLNPHAD  239

Query  802   QLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIe  981
               SQ+YFP W+Y+ +++ KD D+ D TEEE K++KKMIIVALWCIQ+ P++RPSM  ++ 
Sbjct  240   HSSQLYFPLWIYDHIREEKDADIEDVTEEENKIAKKMIIVALWCIQLKPNDRPSM-NIVM  298

Query  982   mleeedvellemAPKPFLSPDEVPTDENS  1068
              + E D+E LE+ PKP L PDE  T + +
Sbjct  299   EMLEGDIEDLEIPPKPILFPDETVTKDQT  327



>ref|XP_006593817.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like isoform X2 [Glycine max]
Length=441

 Score =   458 bits (1179),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 230/384 (60%), Positives = 297/384 (77%), Gaps = 10/384 (3%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + +  G+F  G+   I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   
Sbjct  60    LPFLAGKFLFGMTLFIVLLIYKWRKRHLSIYENIENYLE-QNNLMPIGYSYKEIKKMARG  118

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLG GGYG VFKG L SGP VA+KM+ K+K +GQ+FISE+ATIGRIHH NVV+LIG+
Sbjct  119   FKEKLGGGGYGIVFKGKLHSGPSVAIKMLHKAKGSGQDFISEIATIGRIHHQNVVQLIGY  178

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             CVEGSKRAL+YEFMPNGSL+K+IFPK+ +I L+++++++I++GVARGI YLH GC+M+IL
Sbjct  179   CVEGSKRALVYEFMPNGSLDKFIFPKDGNIHLTYDEIYNIAIGVARGIAYLHHGCEMKIL  238

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PKVSDFGLAKLYP+++S+V+ T ARGT+GYMAPEL Y NIGGIS
Sbjct  239   HFDIKPHNILLDETFTPKVSDFGLAKLYPIDNSIVTRTEARGTIGYMAPELFYGNIGGIS  298

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFV-EQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
             HKADVYSFGMLL++M  +RKN NP   +  SQ+YFP+W+Y QL    DI+M   TEEE  
Sbjct  299   HKADVYSFGMLLIDMTNKRKNPNPHADDHSSQLYFPTWIYNQLGKETDIEMEGVTEEE--  356

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN  1077
               KKMIIV+LWCIQ+ PS+RPSM KV+  + E D+E LE+ PKP L P +   ++ S  +
Sbjct  357   --KKMIIVSLWCIQLKPSDRPSMNKVV-EMLEGDIESLEIPPKPSLYPHDTMENDQSIYS  413

Query  1078  AQNVESPLLSDNPVRSSSFEVCEN  1149
             +Q + +  +S +   S S E+  N
Sbjct  414   SQTMSTDFISSS---SYSKEIVTN  434



>ref|XP_008365840.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=439

 Score =   458 bits (1179),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 215/324 (66%), Positives = 264/324 (81%), Gaps = 0/324 (0%)
 Frame = +1

Query  7    YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
            + L RF  G+  + + ++Y  R RHLS Y  IE +L   NN MPIRYSY ++K+MT  FK
Sbjct  65   FFLARFVFGVPVVTAFLIYTWRIRHLSMYSAIEDFLQCNNNFMPIRYSYSDVKKMTRRFK  124

Query  187  HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
             KLG GG+G+VFKG LRSG FVAVK++ K K  GQ+FI E ATIGRIHH NVV+L+G+ V
Sbjct  125  DKLGXGGFGSVFKGKLRSGRFVAVKVLXKPKXDGQDFIXEJATIGRIHHANVVQLVGYXV  184

Query  367  EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
            EGSKRAL+Y+FMPNGSL+KYI+ KE S+ L+ + M++ISLGVA+GI+YLH+GC M+ILHF
Sbjct  185  EGSKRALVYDFMPNGSLDKYIYSKEGSVPLTIKNMYEISLGVAQGIEYLHQGCXMQILHF  244

Query  547  DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
            DIKPHNILLDENF  KVSDFGLAKLY V++S+VSLTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  245  DIKPHNILLDENFKAKVSDFGLAKLYHVDNSIVSLTAARGTLGYIAPELFYKNIGGVSYK  304

Query  727  ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
            +DVYSFGMLLMEM  RR+NLNP VE  SQIYFP WVY+Q   G D++M + TEEEKKV +
Sbjct  305  SDVYSFGMLLMEMASRRRNLNPTVEHSSQIYFPMWVYDQYIVGNDLEMDNVTEEEKKVIR  364

Query  907  KMIIVALWCIQMNPSERPSMKKVI  978
            KM+I ALWCIQM PS+RPSM KV+
Sbjct  365  KMVITALWCIQMKPSDRPSMSKVV  388



>ref|XP_008231870.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=662

 Score =   466 bits (1199),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 273/318 (86%), Gaps = 2/318 (1%)
 Frame = +1

Query  100   IEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSK  279
             +E +L   N LMP+RYSY  IK+M   FK KLGEGGYG+V+K  LRSG  VA+KM+GKS 
Sbjct  318   VEDFLQN-NKLMPVRYSYSNIKKMAKGFKEKLGEGGYGSVYKAKLRSGRLVAIKMLGKSN  376

Query  280   ATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEESISLS  459
             A GQ+FI+EVATIGRIHH NVV+LIGFCVEGSKRAL+Y+FMPNGSL+KY+F ++  +SL+
Sbjct  377   ANGQDFINEVATIGRIHHVNVVQLIGFCVEGSKRALVYDFMPNGSLDKYLFSQQGVVSLN  436

Query  460   HEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDS  639
              EKMF+I+LGVARGI+YLHRGC+M+ILHFDIKPHNILLDENF PKVSDFGLA+L P+++S
Sbjct  437   CEKMFEIALGVARGIEYLHRGCEMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLDNS  496

Query  640   LVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIY  819
             +VSLTAARGT+GY+APEL Y+NIG IS+KADVYSFGMLLMEM GRRKNLN  +E+ SQIY
Sbjct  497   IVSLTAARGTLGYIAPELFYKNIGSISYKADVYSFGMLLMEMAGRRKNLNATIEKSSQIY  556

Query  820   FPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIemleeed  999
             FP+W ++QL DGKDI +GDAT+EE+K+ KKMIIVALWCIQM PS+RPSM K +  + E +
Sbjct  557   FPTWAFDQLSDGKDIKIGDATDEEEKIIKKMIIVALWCIQMKPSDRPSMNKAV-EMLEGE  615

Query  1000  vellemAPKPFLSPDEVP  1053
             +E LEM PKPFL P ++P
Sbjct  616   IESLEMPPKPFLYPQQMP  633



>ref|XP_008373817.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Malus domestica]
Length=373

 Score =   456 bits (1172),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 234/362 (65%), Positives = 284/362 (78%), Gaps = 4/362 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              +F LG  F+ + ++Y  +RRHLS Y++IE +L G   L+PIRYSY  IK+M+N FK KL
Sbjct  5     AKFLLGAPFVTAFLIYTWKRRHLSMYNSIEEFLHGEKTLVPIRYSYSNIKKMSNKFKEKL  64

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG+VFK  LRSG F A+KM+ K K  GQ+FISEV TIGRIHH NVV+L+G+CVEG+
Sbjct  65    GEGGYGSVFKARLRSGRFGAIKMLDKPKGNGQDFISEVNTIGRIHHVNVVQLVGYCVEGT  124

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             K AL+Y+FM NGSL+KYI+ KE SI LS +  ++I+LGVARGI YLH GCDM+ILHFDIK
Sbjct  125   KHALVYDFMLNGSLDKYIYCKEGSIPLSCKTTYEIALGVARGIKYLHEGCDMQILHFDIK  184

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF PK+SDFGLAKLYPV++S+VSLTAARGTMGYMAPEL Y+NIGG+S KADV
Sbjct  185   PHNILLDENFVPKISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADV  244

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKNLN   E  SQ+YFPSWVY Q  +GKD ++G+  EEEK +  KMI
Sbjct  245   YSFGMLLMEMGSRRKNLNALAEHSSQLYFPSWVYNQYNEGKDFEVGEVVEEEKPLIGKMI  304

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT---DENSFPNAQN  1086
             I ALWCIQ+ PS+RPSMK+V+  + E DVELL M P+P L P E+P    ++N  P    
Sbjct  305   ITALWCIQLKPSDRPSMKEVL-QMLEGDVELLRMPPEPLLYPQEMPVGAPNDNLNPTYSK  363

Query  1087  VE  1092
             VE
Sbjct  364   VE  365



>ref|XP_006372704.1| hypothetical protein POPTR_0017s04160g [Populus trichocarpa]
 gb|ERP50501.1| hypothetical protein POPTR_0017s04160g [Populus trichocarpa]
Length=354

 Score =   455 bits (1170),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 281/347 (81%), Gaps = 20/347 (6%)
 Frame = +1

Query  43    LISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVF  222
             L+++++YK R+  L ++D         N+LMPI+Y+Y EIK++TN FK KLGEG +G+V+
Sbjct  11    LLTLLIYKWRK-FLQSHD---------NDLMPIKYTYLEIKKITNGFKDKLGEGSFGSVY  60

Query  223   KGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFM  402
             KG LRSG F AVK++GKSKA GQ+FI+EVATIGRIHH NVV+LIG+ VEGSK AL+YEFM
Sbjct  61    KGKLRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHVNVVQLIGYTVEGSKHALIYEFM  120

Query  403   PNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDEN  582
             PNGSLEKYIF +E S+ LS+EKM++ISLGVA GI YLH+GCDM+ILHFDIKPHNILL++ 
Sbjct  121   PNGSLEKYIFSREGSVPLSNEKMYEISLGVAHGIQYLHQGCDMQILHFDIKPHNILLNDK  180

Query  583   FSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLME  762
             F PKVSDFGLAKLYP  +++VSLTAARGTMGYMAPELCY+NIGG+S KADVYS+GMLLME
Sbjct  181   FVPKVSDFGLAKLYPTNNNIVSLTAARGTMGYMAPELCYKNIGGVSFKADVYSYGMLLME  240

Query  763   MVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQM  942
             MVGRRKNLN      SQIYFPSWVY+Q+ +GK+I+         K +KKMIIVALWCIQ+
Sbjct  241   MVGRRKNLNALANHSSQIYFPSWVYDQVSEGKNIE---------KTTKKMIIVALWCIQL  291

Query  943   NPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQ  1083
              P +RPSM KV+  + E DVE L M PKPFL+P ++P D++   +A+
Sbjct  292   KPVDRPSMHKVV-EMLESDVESLRMPPKPFLTPHQMPEDDDRANHAK  337



>gb|KEH40363.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=356

 Score =   455 bits (1170),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 226/335 (67%), Positives = 278/335 (83%), Gaps = 3/335 (1%)
 Frame = +1

Query  91    YDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMG  270
             Y+ IE +L G + LMPIRYSY EIK+MT +FK KLGEGG+G V+KG L SGPFVA+KM+G
Sbjct  2     YEDIEVFLQG-STLMPIRYSYKEIKKMTRSFKDKLGEGGFGAVYKGKLCSGPFVAIKMLG  60

Query  271   KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEESI  450
             KSK  GQ+FISEVATIGRIHHTNVVRLIGFCVEGSKRAL+YEFM NGSL+KYI  +E++I
Sbjct  61    KSKGNGQDFISEVATIGRIHHTNVVRLIGFCVEGSKRALVYEFMSNGSLDKYISSREDTI  120

Query  451   SLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYPV  630
             SL+++KM++ISLGVARG+ YLH+GCDM+ILHFDIKPHNILLDENF PKVSDFGLAKLYP 
Sbjct  121   SLNYQKMYEISLGVARGMAYLHQGCDMQILHFDIKPHNILLDENFIPKVSDFGLAKLYPN  180

Query  631   EDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQLS  810
             E S+V+LTAARGT+GYMAPEL Y+NIGG+S+KADVYSFGMLLMEM  +++NLNP  E+ S
Sbjct  181   EISIVTLTAARGTIGYMAPELFYKNIGGVSYKADVYSFGMLLMEMASKKRNLNPHAERSS  240

Query  811   QIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIemle  990
             QI+FP W+Y QL D ++I+M + + EE    KKM I+ALWCIQ+ P +RPSM KVI  + 
Sbjct  241   QIFFPIWIYNQLADEREIEMDEISYEENINVKKMFIIALWCIQLKPCDRPSMNKVI-EML  299

Query  991   eedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             E ++E +EM PKP L P+E+   E+   N+  +ES
Sbjct  300   EGNIENIEMPPKPSLYPNEM-IQEDLDINSNEIES  333



>ref|XP_003589647.1| Kinase R-like protein [Medicago truncatula]
Length=681

 Score =   466 bits (1200),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 223/350 (64%), Positives = 285/350 (81%), Gaps = 2/350 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             ++L +F LG L +I +++YK RR+HLS YD +E +LS  N+++PIRYSY +IK++T  FK
Sbjct  309   FSLFKFVLGALCMIVLLIYKWRRKHLSMYDGVEDFLSSDNSIIPIRYSYRDIKKITEQFK  368

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLG GGYG+VFKG LRSG  VAVK++ K+K++ Q+F++EVATIGRIHH NVV+LIGFCV
Sbjct  369   TKLGNGGYGSVFKGQLRSGRLVAVKLLDKAKSSDQDFVNEVATIGRIHHVNVVQLIGFCV  428

Query  367   EGSKRALLYEFMPNGSLEKYIFP-KEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
             EGSKR L+YEFMPNGSLEKYIF   +E+ SLS E+++ ISLGVARGI+YLH GC+M+ILH
Sbjct  429   EGSKRVLIYEFMPNGSLEKYIFSHTKENYSLSCEQLYSISLGVARGIEYLHHGCNMKILH  488

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLDENF+PKVSDFGLA+L P + S+VSLTAARGT+GYMAPEL YRN+G IS+
Sbjct  489   FDIKPHNILLDENFNPKVSDFGLARLCPTDKSIVSLTAARGTIGYMAPELFYRNVGTISY  548

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVS  903
             KADVYSFGMLLMEM  RRKNLN   EQ SQIYFP W+Y++  DG ++ + + T++E K++
Sbjct  549   KADVYSFGMLLMEMASRRKNLNALAEQSSQIYFPFWIYDKFHDGSEVTIENDTDQEMKLA  608

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             KKM+IVALWCIQ  P +RPSM KV+  + EE+   L++  KP+  P + P
Sbjct  609   KKMMIVALWCIQTKPDDRPSMDKVL-EMLEEEDGDLQIPNKPYFCPQDSP  657



>ref|XP_006601166.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
isoform X4 [Glycine max]
Length=521

 Score =   461 bits (1185),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 232/343 (68%), Positives = 287/343 (84%), Gaps = 2/343 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             L +   I I+  K R+RHLS +++IE+YL   NNLMPIRYSY E+K+M   FK KLGEGG
Sbjct  179   LTVPLFIVILTCKWRKRHLSMFESIENYLE-QNNLMPIRYSYKEVKKMAGGFKDKLGEGG  237

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+VFKG LRSG  VA+KM+GKSK  GQ+FISEVATIGR +H N+V+LIGFCV GSKRAL
Sbjct  238   YGSVFKGKLRSGSCVAIKMLGKSKGNGQDFISEVATIGRTYHQNIVQLIGFCVHGSKRAL  297

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF K+ESI LS++++++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  298   VYEFMPNGSLDKFIFSKDESIHLSYDRIYNISIGVARGIAYLHYGCEMQILHFDIKPHNI  357

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF+PKVSDFGLAKLYP+++S+V  TAARGT+GYMAPEL Y NIGGISHKADVYS+G
Sbjct  358   LLDENFTPKVSDFGLAKLYPIDNSIVPRTAARGTIGYMAPELFYNNIGGISHKADVYSYG  417

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM G+RKNLNP  E+ SQ++FP W+Y  ++DG+DI+M D T+EEKK+ KKMIIVAL
Sbjct  418   MLLMEMAGKRKNLNPHAERSSQLFFPFWIYNHIRDGEDIEMEDVTKEEKKMVKKMIIVAL  477

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             WCIQ+ P++RPSM +V+  + E D+E LE+ PKP L P E  T
Sbjct  478   WCIQLKPNDRPSMNEVV-EMLEGDIENLEIPPKPTLYPSETIT  519



>ref|XP_008376310.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=420

 Score =   457 bits (1175),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 234/362 (65%), Positives = 283/362 (78%), Gaps = 4/362 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              +F LG  F+ + ++Y  +RRHLS Y++IE +L G   L+PIRYSY  IK+M+N FK KL
Sbjct  52    AKFLLGAPFVTAFLIYTWKRRHLSMYNSIEEFLHGEKTLVPIRYSYSNIKKMSNKFKEKL  111

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG+VFK  LRSG F A+KM+ K K  GQ+FISEV TIGRIHH NVV+L+G+CVEG+
Sbjct  112   GEGGYGSVFKARLRSGRFGAIKMLDKPKGNGQDFISEVNTIGRIHHVNVVQLVGYCVEGT  171

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             K AL+Y+FM NGSL+KYI+ KE SI LS +  ++I+LGVARGI YLH GCDM+ILHFDIK
Sbjct  172   KHALVYDFMLNGSLDKYIYCKEGSIPLSCKTTYEIALGVARGIKYLHEGCDMQILHFDIK  231

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF PK+SDFGLAKLYPV++S+VSLTAARGTMGYMAPEL Y+NIGG+S KADV
Sbjct  232   PHNILLDENFVPKISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADV  291

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKNLN   E  SQ+YFPSWVY Q  +GKD ++G+  EEEK +  KMI
Sbjct  292   YSFGMLLMEMXSRRKNLNALAEHSSQLYFPSWVYNQYNEGKDFEVGEVXEEEKXLIXKMI  351

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT---DENSFPNAQN  1086
             I ALWCIQ+ PS+RPSMK+V+  + E DVELL M P+P L P E P    ++N  P    
Sbjct  352   ITALWCIQLKPSDRPSMKEVL-QMLEGDVELLRMPPEPLLYPQEXPVGAPNDNXNPXYSK  410

Query  1087  VE  1092
             VE
Sbjct  411   VE  412



>ref|XP_007161443.1| hypothetical protein PHAVU_001G069200g [Phaseolus vulgaris]
 gb|ESW33437.1| hypothetical protein PHAVU_001G069200g [Phaseolus vulgaris]
Length=384

 Score =   455 bits (1171),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/346 (63%), Positives = 280/346 (81%), Gaps = 2/346 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             + R+ +  +  I+I+ YK RRRH S Y+ IE YL   NNLMPIRY+Y EIK+M   F  K
Sbjct  7     IKRYVIVTVLFIAILTYKWRRRHSSEYENIESYLE-QNNLMPIRYTYKEIKKMAIGFSEK  65

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LGEGGYG+VFKG LRSGP VA+K++ KSK  GQ+FI+EVATIGRIHH NVV+LIG+CVEG
Sbjct  66    LGEGGYGSVFKGKLRSGPCVAIKVLRKSKGNGQDFINEVATIGRIHHQNVVQLIGYCVEG  125

Query  373   SKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             SK AL+Y+FM NGSL+K+IF +E ++ L+++ +++I++GVARGI YLH GC+M+ILHFDI
Sbjct  126   SKHALVYQFMSNGSLDKFIFSREGNLHLTYDTIYNIAIGVARGISYLHHGCEMQILHFDI  185

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDE F+PKVSDFGLAKLYP++ S+V++TAARGT+GYMAPEL Y NIG IS K+D
Sbjct  186   KPHNILLDEKFTPKVSDFGLAKLYPIDKSVVTMTAARGTIGYMAPELFYTNIGRISDKSD  245

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLME+  +RKNLNP  E+ SQ+YF  W+Y+QL   KDIDM D  EEEKK++KKM
Sbjct  246   VYSFGMLLMEIASKRKNLNPHAERSSQLYFSFWIYDQLDKEKDIDMEDVIEEEKKIAKKM  305

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             +IV+LWCIQ+ P++RPS+ KV+  + E D+E L++ PKP L P E 
Sbjct  306   MIVSLWCIQLKPNDRPSINKVV-EMLEGDIENLKIPPKPSLYPHET  350



>ref|XP_007161185.1| hypothetical protein PHAVU_001G049100g [Phaseolus vulgaris]
 gb|ESW33179.1| hypothetical protein PHAVU_001G049100g [Phaseolus vulgaris]
Length=617

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 239/359 (67%), Positives = 292/359 (81%), Gaps = 5/359 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
              GL F+I I +YK R+RH+S Y+ IE+YL   N+L PIRYSY EIK+M   FK KLGEGG
Sbjct  261   FGLPFIIVIFIYKWRKRHMSLYENIENYLE-QNSLAPIRYSYKEIKKMAAGFKEKLGEGG  319

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             +G+VFK  L SGPFVA+KM+GKSK  GQ+FI+EVATIGRIHH NVVRLIGFCV GSKRAL
Sbjct  320   FGSVFKAKLLSGPFVAIKMLGKSKGNGQDFINEVATIGRIHHQNVVRLIGFCVSGSKRAL  379

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFM NGSL+K+IF KE +I LS+EK+++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  380   VYEFMSNGSLDKFIFSKERNIHLSYEKIYNISIGVARGIAYLHHGCEMQILHFDIKPHNI  439

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF P +SDFGLAKL P+++S+V++T ARGT+GYMAPEL Y+NIGGISHKADVYSFG
Sbjct  440   LLDENFIPMISDFGLAKLNPIDNSIVTMTGARGTIGYMAPELFYKNIGGISHKADVYSFG  499

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM  RRKNLNP V+  SQ+YFP W+Y+ +++ +DIDM D TEEEK ++KKMIIV+L
Sbjct  500   MLLMEMASRRKNLNPHVDHSSQLYFPIWIYDHIEEEEDIDMEDLTEEEKIIAKKMIIVSL  559

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD---ENSFPNAQNVES  1095
             WCIQ+ PS RPSM +V+  + E D+E LE+ PKP L  DE+ TD    NS  N  N+ S
Sbjct  560   WCIQLKPSNRPSMNRVV-EMLEGDIEDLEIPPKPTLFLDEMSTDVETTNSTSNELNMFS  617



>ref|XP_006372702.1| hypothetical protein POPTR_0017s04120g [Populus trichocarpa]
 gb|ERP50499.1| hypothetical protein POPTR_0017s04120g [Populus trichocarpa]
Length=346

 Score =   454 bits (1167),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 225/338 (67%), Positives = 277/338 (82%), Gaps = 3/338 (1%)
 Frame = +1

Query  91    YDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMM  267
             YD IE +L S  N+LMPIRY+Y EIK++TN FK KLGEGG+ +V+KG LRSG F AVK++
Sbjct  2     YDDIEKFLQSHDNDLMPIRYTYLEIKKITNGFKDKLGEGGFDSVYKGKLRSGRFSAVKLL  61

Query  268   GKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEES  447
             GKSKA GQ+FI+EVATIGRIHH N V+LIG+ VEG KRAL+YEFMPNGSLEKYIF +E S
Sbjct  62    GKSKANGQDFINEVATIGRIHHVNAVQLIGYTVEGLKRALIYEFMPNGSLEKYIFSREGS  121

Query  448   ISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYP  627
             +SLS+EK+++ISL VARGI+YLH+GCDM+ILHFDIKPHNILLDE F PK+SDFGLAK YP
Sbjct  122   VSLSNEKIYEISLRVARGIEYLHQGCDMQILHFDIKPHNILLDEKFIPKISDFGLAKSYP  181

Query  628   VEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQL  807
               ++ V LTAARGT+GYMAPEL Y+NIGG+S+KADVYS+ MLLMEMVG+RKNLN      
Sbjct  182   TSNNTVPLTAARGTIGYMAPELFYKNIGGVSYKADVYSYRMLLMEMVGKRKNLNTLANHS  241

Query  808   SQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIem  984
             SQIYFPSWVY+Q+ +G DI++  DA E EKK  KKMIIVALWCIQ+ P +RPSM KV+  
Sbjct  242   SQIYFPSWVYDQVSEGNDIEVQEDAMEHEKKTMKKMIIVALWCIQLKPVDRPSMHKVV-E  300

Query  985   leeedvellemAPKPFLSPDEVPTDENSFPNAQNVESP  1098
             + E DVE + M PKPFL+P ++P +++   +A+  + P
Sbjct  301   MLESDVESIRMPPKPFLTPHQMPEEDDRANHAKLSDPP  338



>gb|KHN05168.1| Putative receptor-like protein kinase [Glycine soja]
Length=702

 Score =   466 bits (1200),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 228/371 (61%), Positives = 292/371 (79%), Gaps = 2/371 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y +G+F  G+   I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   
Sbjct  323   LPYLVGKFLFGMTLFIVLLIYKWRKRHLSIYENIENYLE-QNNLMPIGYSYKEIKKMARG  381

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEG YG VFKG LRSGPFVA+KM+ K+K  GQ+FISE+ATIGRIH  NVV+LIG 
Sbjct  382   FKEKLGEGDYGFVFKGKLRSGPFVAIKMLHKAKGNGQDFISEIATIGRIHLHNVVQLIGN  441

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGS RAL+YEFMPNGSL+K+IF K+ SI L+++++F+I++GVARGI YLH GC+M+IL
Sbjct  442   CAEGSNRALVYEFMPNGSLDKFIFTKDGSIHLTYDEIFNIAIGVARGIAYLHHGCEMQIL  501

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PKVSDFGLAKLYP+++S+V++TAARG +GYMAP+L Y+NIGGIS
Sbjct  502   HFDIKPHNILLDETFTPKVSDFGLAKLYPIDNSIVTMTAARGIIGYMAPKLFYKNIGGIS  561

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             HKADVYSFGMLLMEM  +RKNLNP  +  SQ+YFP W+Y QL    +I M   TEEE K+
Sbjct  562   HKADVYSFGMLLMEMASKRKNLNPHADHSSQLYFPFWIYNQLGKETNIGMEGVTEEENKI  621

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNA  1080
             +KKMIIV+LWCIQ+ P++R SM KV+  + E D+E LE+ PKP L P E   ++ S  ++
Sbjct  622   AKKMIIVSLWCIQLKPTDRLSMNKVV-EMLEGDIESLEIPPKPSLYPHETMENDQSIYSS  680

Query  1081  QNVESPLLSDN  1113
             Q + +  +S +
Sbjct  681   QTMSTDFISSS  691



>gb|KEH40336.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=356

 Score =   454 bits (1167),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 223/354 (63%), Positives = 284/354 (80%), Gaps = 15/354 (4%)
 Frame = +1

Query  91    YDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMG  270
             Y+ IE YL   NN MPI YSY EIK+M   FK KLGEGG+GTVFKG LRSGP VA+KM+G
Sbjct  2     YECIELYLQQQNNSMPIGYSYKEIKKMARGFKDKLGEGGFGTVFKGNLRSGPGVAIKMLG  61

Query  271   KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEESI  450
             KSK  GQ+FISEVATIGRIHH NVV+L GFC+EGSKRAL+YEFMPNGSL+K+IF KE SI
Sbjct  62    KSKGNGQDFISEVATIGRIHHLNVVQLFGFCIEGSKRALVYEFMPNGSLDKFIFSKEGSI  121

Query  451   SLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYPV  630
             +LS+ K++DI++GVARGI YLH GC+M+ILHFDIKPHNILLDENF PK+SDFGLAKL+P+
Sbjct  122   NLSYNKIYDIAIGVARGIAYLHHGCEMKILHFDIKPHNILLDENFIPKLSDFGLAKLHPI  181

Query  631   EDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQLS  810
             E+S++++TAARGT+GYMAPEL Y+NIGG+S+KADVYSFGMLLMEM G+RKNL    +  S
Sbjct  182   ENSVITMTAARGTIGYMAPELFYKNIGGVSYKADVYSFGMLLMEMAGKRKNLKTNAQHSS  241

Query  811   QIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIemle  990
             QIYFP W+Y+QL+  ++ID+ + +EE+ K+ KKMI+VALWCIQ+ P++RPSM KV+  + 
Sbjct  242   QIYFPFWIYDQLRKEEEIDIENISEEDMKIVKKMIMVALWCIQLKPNDRPSMSKVV-EML  300

Query  991   eedvellemAPKPFLSPDE-VPTDE-------------NSFPNAQNVESPLLSD  1110
             E ++E +EM P+P + PDE +  DE             +S  + +N+ +PLL +
Sbjct  301   EGNIERIEMPPEPTMYPDETISRDETTSFDQTTSGDFISSSDSGENMSNPLLEN  354



>gb|KEH33223.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=423

 Score =   456 bits (1173),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 220/327 (67%), Positives = 275/327 (84%), Gaps = 2/327 (1%)
 Frame = +1

Query  70    RRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPF  249
             RRRH SAY+ IE +L G + LMPIRYSY +IK+MT +FK KLGEGG+G+V+KG LRSG F
Sbjct  66    RRRHTSAYENIEVFLRG-STLMPIRYSYKDIKKMTKSFKDKLGEGGFGSVYKGKLRSGAF  124

Query  250   VAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYI  429
             VA+KM+GKSK  GQ+FISEVATIGRIHH NVVRLIGFCVE SK  L+YEFMPNGSL+KYI
Sbjct  125   VAIKMLGKSKGNGQDFISEVATIGRIHHANVVRLIGFCVERSKCTLVYEFMPNGSLDKYI  184

Query  430   FPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFG  609
               K++ I+L+++KM++IS+GVARGI YLH+GCDM+ILHFDIKPHNILLDENF PKVSDFG
Sbjct  185   SSKDDVINLTYKKMYEISIGVARGIAYLHQGCDMQILHFDIKPHNILLDENFIPKVSDFG  244

Query  610   LAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLN  789
             LAKLYP ++S+V+LTAARGT+GYMAPEL Y+NIGG+S+KADVYSFGMLLMEM  +R+NLN
Sbjct  245   LAKLYPNDNSIVNLTAARGTIGYMAPELFYKNIGGVSYKADVYSFGMLLMEMASKRRNLN  304

Query  790   PFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMK  969
             P  ++ SQ++FP W+Y QL +  +I+M + T+EE    KKM I+ALWCIQ+ PS+RP+M 
Sbjct  305   PHADRSSQLFFPYWIYNQLIEENEIEMDEITDEESSNVKKMFIIALWCIQLKPSDRPAMN  364

Query  970   KVIemleeedvellemAPKPFLSPDEV  1050
             KVI  + E ++E +EM PKP   P+E+
Sbjct  365   KVI-EMLEGNIENIEMPPKPSFCPNEI  390



>ref|XP_011001825.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Populus euphratica]
Length=710

 Score =   466 bits (1199),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/371 (64%), Positives = 301/371 (81%), Gaps = 6/371 (2%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             F  GL  L+ +++YK +RRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN FK KLG
Sbjct  339   FLCGLPCLVILLIYKWQRRHLSMYNNIEKFLQSHGNDLMPIRYNYSEIKKITNGFKDKLG  398

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             +GGYG+V+KG LRSG FVAVK++ KSKA GQ+FI+EVATIGRI+H NV+R+IGF VEGSK
Sbjct  399   QGGYGSVYKGKLRSGRFVAVKILDKSKANGQDFINEVATIGRIYHVNVMRIIGFAVEGSK  458

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+ EFMPNGSLEKY+F K+ SI LS+ KM++ISLGVARGI+YLH+GCDM+ILHFDIKP
Sbjct  459   RALILEFMPNGSLEKYLFSKQGSIPLSNNKMYEISLGVARGIEYLHQGCDMQILHFDIKP  518

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDE F PK+SDFGLAKLYP  ++ VSLT ARGT+GYMAPEL Y+NIGG+S K+DVY
Sbjct  519   HNILLDEKFIPKISDFGLAKLYPSGNNNVSLTTARGTIGYMAPELLYKNIGGVSFKSDVY  578

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMI  915
             SFGMLLM+MVGRRKNLN      S+IYFP+WVY+++ +GKDI+   DA E EKK+ KK++
Sbjct  579   SFGMLLMDMVGRRKNLNALANHSSRIYFPAWVYDKVSEGKDIETQEDAPEYEKKILKKVM  638

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             IVALWCIQ+ P +RPS+ KV+  + E DV+ L++ PKPFLSP ++  D++    A  ++ 
Sbjct  639   IVALWCIQLKPDDRPSIHKVV-EMLESDVDFLQIPPKPFLSPHQILEDDD---RANPIKL  694

Query  1096  PLLSDNPVRSS  1128
               LS++ + SS
Sbjct  695   SDLSNDWIDSS  705



>ref|XP_008347200.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=416

 Score =   456 bits (1172),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/362 (65%), Positives = 284/362 (78%), Gaps = 4/362 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              +F LG  F+ + ++Y  +RRHLS Y++IE +L G   L+PIRYSY  IK+M+N FK KL
Sbjct  48    AKFLLGAPFVTAFLIYTWKRRHLSMYNSIEEFLHGEKTLVPIRYSYSNIKKMSNKFKEKL  107

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG+VFK  LRSG F A+KM+ K K  GQ+FISEV TIGRIHH NVV+L+G+CVEG+
Sbjct  108   GEGGYGSVFKXRLRSGRFGAIKMLDKPKGNGQDFISEVNTIGRIHHVNVVQLVGYCVEGT  167

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             K AL+Y+FM NGSL+KYI+ KE SI LS +  ++I+LGVARGI YLH GCDM+ILHFDIK
Sbjct  168   KHALVYDFMLNGSLDKYIYCKEGSIPLSCKTTYEIALGVARGIKYLHEGCDMQILHFDIK  227

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF PK+SDFGLAKLYPV++S+VSLTAARGTMGYMAPEL Y+NIGG+S KADV
Sbjct  228   PHNILLDENFVPKISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADV  287

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKNLN   E  SQ+YFPSWVY Q  +GKD ++G+  EEEK +  KMI
Sbjct  288   YSFGMLLMEMXSRRKNLNALAEHSSQLYFPSWVYNQYNEGKDFEVGEVXEEEKPLIXKMI  347

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT---DENSFPNAQN  1086
             I ALWCIQ+ PS+RPSMK+V+  + E DVELL M P+P L P E+P    ++N  P    
Sbjct  348   ITALWCIQLKPSDRPSMKEVL-QMLEGDVELLRMPPEPLLYPQEMPVGAPNDNXNPXYSK  406

Query  1087  VE  1092
             VE
Sbjct  407   VE  408



>ref|XP_011001823.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Populus euphratica]
 ref|XP_011001824.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Populus euphratica]
Length=720

 Score =   466 bits (1200),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 236/371 (64%), Positives = 301/371 (81%), Gaps = 6/371 (2%)
 Frame = +1

Query  22    FSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             F  GL  L+ +++YK +RRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN FK KLG
Sbjct  349   FLCGLPCLVILLIYKWQRRHLSMYNNIEKFLQSHGNDLMPIRYNYSEIKKITNGFKDKLG  408

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             +GGYG+V+KG LRSG FVAVK++ KSKA GQ+FI+EVATIGRI+H NV+R+IGF VEGSK
Sbjct  409   QGGYGSVYKGKLRSGRFVAVKILDKSKANGQDFINEVATIGRIYHVNVMRIIGFAVEGSK  468

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+ EFMPNGSLEKY+F K+ SI LS+ KM++ISLGVARGI+YLH+GCDM+ILHFDIKP
Sbjct  469   RALILEFMPNGSLEKYLFSKQGSIPLSNNKMYEISLGVARGIEYLHQGCDMQILHFDIKP  528

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDE F PK+SDFGLAKLYP  ++ VSLT ARGT+GYMAPEL Y+NIGG+S K+DVY
Sbjct  529   HNILLDEKFIPKISDFGLAKLYPSGNNNVSLTTARGTIGYMAPELLYKNIGGVSFKSDVY  588

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKKVSKKMI  915
             SFGMLLM+MVGRRKNLN      S+IYFP+WVY+++ +GKDI+   DA E EKK+ KK++
Sbjct  589   SFGMLLMDMVGRRKNLNALANHSSRIYFPAWVYDKVSEGKDIETQEDAPEYEKKILKKVM  648

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             IVALWCIQ+ P +RPS+ KV+  + E DV+ L++ PKPFLSP ++  D++    A  ++ 
Sbjct  649   IVALWCIQLKPDDRPSIHKVV-EMLESDVDFLQIPPKPFLSPHQILEDDD---RANPIKL  704

Query  1096  PLLSDNPVRSS  1128
               LS++ + SS
Sbjct  705   SDLSNDWIDSS  715



>ref|XP_008232077.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=649

 Score =   464 bits (1193),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 275/340 (81%), Gaps = 2/340 (1%)
 Frame = +1

Query  40    FLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTV  219
             F+I   +Y  R+RH S Y TIE++L   NN  PIRYSY +IK+M+N FK+KLGEGG+G V
Sbjct  291   FVIGFFIYTWRKRHSSMYSTIENFLHDDNNFPPIRYSYLDIKKMSNKFKNKLGEGGFGMV  350

Query  220   FKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEF  399
             FKG LRSG F A+KM+ KSKA G++FISEVATIGRIHH NVV+L+G+CVEGSKRAL+YEF
Sbjct  351   FKGKLRSGHFGAIKMLSKSKANGEDFISEVATIGRIHHVNVVQLVGYCVEGSKRALVYEF  410

Query  400   MPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDE  579
             M NGSL+KYI+ K+ +  LS++KM+DISLGVARGI+YLH+GCDM+ILHFDIKPHNILLDE
Sbjct  411   MQNGSLDKYIYSKQGNNLLSYKKMYDISLGVARGIEYLHQGCDMQILHFDIKPHNILLDE  470

Query  580   NFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLM  759
             NF PK+SDFGLAKLYP             TMGYMAPEL Y+NIGG+S+KADVYSFGMLLM
Sbjct  471   NFVPKISDFGLAKLYPTXXXXXXXXXXX-TMGYMAPELFYKNIGGVSYKADVYSFGMLLM  529

Query  760   EMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQ  939
             EM  +RKNLN   E  SQIYFPSWVY+Q ++GK+++M D TEEEKK+ KKM+I ALWCIQ
Sbjct  530   EMGSKRKNLNARAEHSSQIYFPSWVYDQYREGKELEMEDITEEEKKIVKKMVITALWCIQ  589

Query  940   MNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             M PS+RP+M +VI  + E DVE L+M PKPFL P E+P D
Sbjct  590   MKPSDRPAMNEVI-KMLEGDVESLQMPPKPFLCPQEMPVD  628



>ref|XP_010662816.1| PREDICTED: cysteine-rich receptor-like protein kinase 37 [Vitis 
vinifera]
Length=719

 Score =   466 bits (1198),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 230/365 (63%), Positives = 299/365 (82%), Gaps = 5/365 (1%)
 Frame = +1

Query  10    ALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKH  189
              +GR  LG+L L + ++YK  RRHLS  D+IE +L    NL PI+YSY +IK+MT+NF +
Sbjct  345   VIGRTMLGMLCLFAYLIYKFHRRHLSLDDSIEEFLRSQKNLQPIKYSYSDIKKMTHNFAN  404

Query  190   KLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             KLG+GG+G+V+KG LRSG  VAVK++  SKA GQ+FI+EVATIGRIHH NVVRL+GFCV+
Sbjct  405   KLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQ  464

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             GSK AL+Y+FMPNGSL+K+IF KEE+ + LS E+++ ++LGV RGI+YLH+GCDM+ILHF
Sbjct  465   GSKWALIYDFMPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHF  524

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  525   DIKPHNILLDEDFTPKVSDFGLAKLYSTDESMVSLTAARGTLGYIAPELFYKNIGGVSYK  584

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEMVGRRKN+N      SQIYFPSW+Y++   G +ID+GDATE+EKK+ +
Sbjct  585   ADVYSFGMLLMEMVGRRKNVNANAAHSSQIYFPSWIYDRYDQGDNIDLGDATEDEKKLVR  644

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             KM+IVALWCIQM P +RPSM K +  + E +VELLEM PKP L  +E+  +++    +  
Sbjct  645   KMVIVALWCIQMKPIDRPSMSKAL-EMLEGEVELLEMPPKPTLYSEEMLVEDHM---SNP  700

Query  1087  VESPL  1101
             +E+P+
Sbjct  701   IEAPI  705



>ref|XP_003589626.1| Kinase-like protein [Medicago truncatula]
 gb|AES59877.1| receptor-like kinase [Medicago truncatula]
Length=665

 Score =   464 bits (1194),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 223/357 (62%), Positives = 285/357 (80%), Gaps = 2/357 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F LG   +I++++YK RR+H S YD +E +L   NN+MPIRYSY +IK++T+ FK KLG
Sbjct  294   KFVLGAPCIIALLIYKWRRKHFSMYDGVEDFLRSDNNIMPIRYSYKDIKKITHQFKTKLG  353

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
              GGYG+VFKG L+SG  VAVK++ K+K+ GQ+FI+EV TIGRIHH NV  LIGFCVEGSK
Sbjct  354   NGGYGSVFKGQLQSGRLVAVKLLDKAKSNGQDFINEVVTIGRIHHVNVAHLIGFCVEGSK  413

Query  379   RALLYEFMPNGSLEKYIFP-KEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             R L+YEFMPNGSLEKYIF   +E+ SLS E+++ ISLGVARGI+YLH GC+M+ILHFDIK
Sbjct  414   RVLIYEFMPNGSLEKYIFSHTKENYSLSCEQLYSISLGVARGIEYLHNGCNMKILHFDIK  473

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PKVSDFGLA+L P + S+VSLTAARGT+GYMAPEL YRN+G ISHKADV
Sbjct  474   PHNILLDENFNPKVSDFGLARLSPTDKSIVSLTAARGTIGYMAPELFYRNVGTISHKADV  533

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKNLN   +Q S+IYFP W+Y++L DG+++ + + T++E K++KKM+
Sbjct  534   YSFGMLLMEMASRRKNLNALADQSSEIYFPFWIYDRLHDGREVTIENDTDQEMKLAKKMM  593

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             IVALWCIQ  P +RPSM+KV+  + EE+   L++  KP+  P + PT +    N  N
Sbjct  594   IVALWCIQTKPEDRPSMEKVL-EMLEEEDGDLQIPNKPYFCPQDPPTADVGDDNCSN  649



>ref|XP_002263251.3| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Vitis vinifera]
Length=409

 Score =   455 bits (1170),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 214/327 (65%), Positives = 270/327 (83%), Gaps = 2/327 (1%)
 Frame = +1

Query  1    ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
            I Y   R  LG+ F+ + ++YK RRRHLS  D IE +L    +L  I+YSY++IK+MTN+
Sbjct  33   IIYVGVRIVLGM-FMFAYLIYKFRRRHLSLDDNIEEFLQNHKSLQLIKYSYYDIKKMTNS  91

Query  181  FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
            FK KLG+GG+G+V+KG L+SG  VAVK++  SKA GQ+FI+EVATIGRIHH NVV+L+GF
Sbjct  92   FKDKLGQGGFGSVYKGKLKSGRVVAVKVLLMSKADGQDFINEVATIGRIHHINVVKLVGF  151

Query  361  CVEGSKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRI  537
            C+EGSK AL+Y+FMPNGSL+K+IFPK E+ + LS E+++ I+LGV RGI+YLH+GCDM+I
Sbjct  152  CIEGSKWALIYDFMPNGSLDKFIFPKHENNTPLSWERLYKIALGVGRGIEYLHQGCDMKI  211

Query  538  LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
            LHFDIKPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLT ARGTMGY+APEL Y+NIG I
Sbjct  212  LHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIVSLTKARGTMGYIAPELFYKNIGCI  271

Query  718  SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
            S+KADVYSFGMLLMEMVG+RKNLN   +  SQIYFPSW+Y++   G+DI+M DAT+ EK 
Sbjct  272  SNKADVYSFGMLLMEMVGKRKNLNALADHSSQIYFPSWIYDKFYQGEDIEMEDATDSEKI  331

Query  898  VSKKMIIVALWCIQMNPSERPSMKKVI  978
              KKM+IVALWCIQM P+ RPSM K +
Sbjct  332  SVKKMVIVALWCIQMKPTNRPSMSKAL  358



>ref|XP_010662566.1| PREDICTED: cysteine-rich receptor-like protein kinase 37 [Vitis 
vinifera]
Length=715

 Score =   466 bits (1198),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 230/365 (63%), Positives = 299/365 (82%), Gaps = 5/365 (1%)
 Frame = +1

Query  10    ALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKH  189
              +GR  LG+L L + ++YK  RRHLS  D+IE +L    NL PI+YSY +IK+MT+NF +
Sbjct  341   VIGRTMLGMLCLFAYLIYKFHRRHLSLDDSIEEFLRSQKNLQPIKYSYSDIKKMTHNFAN  400

Query  190   KLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             KLG+GG+G+V+KG LRSG  VAVK++  SKA GQ+FI+EVATIGRIHH NVVRL+GFCV+
Sbjct  401   KLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQ  460

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             GSK AL+Y+FMPNGSL+K+IF KEE+ + LS E+++ ++LGV RGI+YLH+GCDM+ILHF
Sbjct  461   GSKWALIYDFMPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHF  520

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  521   DIKPHNILLDEDFTPKVSDFGLAKLYSTDESMVSLTAARGTLGYIAPELFYKNIGGVSYK  580

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEMVGRRKN+N      SQIYFPSW+Y++   G +ID+GDATE+EKK+ +
Sbjct  581   ADVYSFGMLLMEMVGRRKNVNANAAHSSQIYFPSWIYDRYDQGDNIDLGDATEDEKKLVR  640

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             KM+IVALWCIQM P +RPSM K +  + E +VELLEM PKP L  +E+  +++    +  
Sbjct  641   KMVIVALWCIQMKPIDRPSMSKAL-EMLEGEVELLEMPPKPTLYSEEMLVEDHM---SNP  696

Query  1087  VESPL  1101
             +E+P+
Sbjct  697   IEAPI  701



>ref|XP_011047642.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X7 [Populus euphratica]
Length=699

 Score =   464 bits (1194),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 280/340 (82%), Gaps = 2/340 (1%)
 Frame = +1

Query  46    ISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVF  222
             I++++YK RRRHLS Y  IE +L S  +NL  IRYSY EIK++T+ F  KLGEGGYG+V+
Sbjct  334   ITLLIYKWRRRHLSMYGNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVY  393

Query  223   KGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFM  402
             KG LRSG F AVK++ K KA GQ+FI+EVATIGRIHH NVV+LIGF VEGSKRAL+Y+FM
Sbjct  394   KGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHRNVVQLIGFTVEGSKRALIYDFM  453

Query  403   PNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDEN  582
             PNGSLEKYIF ++ SI LS++K+++ISLGVA GI+YLH GCDM+ILHFDIKPHNILLDEN
Sbjct  454   PNGSLEKYIFSRQGSIPLSNQKIYEISLGVALGIEYLHEGCDMQILHFDIKPHNILLDEN  513

Query  583   FSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLME  762
             F+PK+SDFGLAKLYP  +S+VSLT ARGT+GYMAPEL Y++IGG+S+KADVYSFGMLLME
Sbjct  514   FTPKISDFGLAKLYPTNNSIVSLTMARGTIGYMAPELFYKSIGGVSYKADVYSFGMLLME  573

Query  763   MVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQM  942
             MVGRRKNLN      SQ+YFPSW+Y+Q+ +G+DI    ATE+EK   KKM IVALWCIQ+
Sbjct  574   MVGRRKNLNTLANHSSQMYFPSWIYDQVNEGRDILEDQATEQEKNTIKKMTIVALWCIQL  633

Query  943   NPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
              P +RPSM +V+  + + ++E L+M PKPFL P +   D+
Sbjct  634   KPIDRPSMHRVV-QMLQANIESLQMPPKPFLVPQQTSNDD  672



>ref|XP_003589645.1| Kinase-like protein [Medicago truncatula]
Length=653

 Score =   462 bits (1189),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 230/349 (66%), Positives = 281/349 (81%), Gaps = 4/349 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F LG+   I +++YK R++HLS YD IE +L   N++MPIRYSY +IK++T  FK KLG
Sbjct  284   KFVLGVP--IVLLIYKWRQKHLSVYDGIEDFLRSDNSIMPIRYSYKDIKKITEQFKIKLG  341

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
              GGYGTVFKG LRS   VAVK++ K+K  GQ+F++EV TIGRIHH NVV+LIGFCVEGSK
Sbjct  342   NGGYGTVFKGKLRSDRLVAVKLLDKAKTNGQDFVNEVTTIGRIHHVNVVQLIGFCVEGSK  401

Query  379   RALLYEFMPNGSLEKYIFPK-EESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             RAL+YEFMPNGSLEKYIF   EES SLS +K++ ISLGVARGI YLH GC+M+ILHFDIK
Sbjct  402   RALIYEFMPNGSLEKYIFSLIEESNSLSCKKLYAISLGVARGIAYLHNGCNMKILHFDIK  461

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PKVSDFGLA++ P + S+VSLTAARGT+GYMAPEL YRN+G ISHKADV
Sbjct  462   PHNILLDENFNPKVSDFGLARVSPTDKSIVSLTAARGTIGYMAPELFYRNVGTISHKADV  521

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKNLNP  EQ  QIYFP W+Y QL DG ++ + + T+EE K++KKM+
Sbjct  522   YSFGMLLMEMASRRKNLNPLAEQSCQIYFPFWIYGQLHDGSEVTIENDTDEEMKLAKKMM  581

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             IVALWCIQ  P +RPSM KVI  + EE+   L+M  KP+L P ++P ++
Sbjct  582   IVALWCIQTKPGDRPSMDKVI-EMLEEEDGDLQMPNKPYLYPQDLPAED  629



>ref|XP_008347207.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=425

 Score =   454 bits (1168),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 231/354 (65%), Positives = 279/354 (79%), Gaps = 4/354 (1%)
 Frame = +1

Query  40    FLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTV  219
             F+ + ++Y  +RRHLS Y++IE +L G  N +PIRYSY  IK+M+N FK KLGEGGYG+V
Sbjct  65    FVTAFLIYTWKRRHLSMYNSIEEFLHGEKNFVPIRYSYSNIKKMSNKFKEKLGEGGYGSV  124

Query  220   FKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEF  399
             FK  LRSG F A+KM+ K K  GQ+FISEV TIGRIHH NVV+L+G+CVEG K AL+Y+F
Sbjct  125   FKARLRSGRFXAIKMLDKPKGNGQDFISEVNTIGRIHHVNVVQLVGYCVEGXKHALVYDF  184

Query  400   MPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDE  579
             M NGSL+KYI+ KE SI LS +  ++I LGVARGI YLH GCDM+ILHFDIKPHNILLDE
Sbjct  185   MLNGSLDKYIYCKEGSIPLSCKTTYEIXLGVARGIKYLHEGCDMQILHFDIKPHNILLDE  244

Query  580   NFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLM  759
             NF PK+SDFGLAKLYPV++S+VSLTAARGTMGYMAPEL Y+NIGG+S KADVYSFGMLLM
Sbjct  245   NFVPKISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADVYSFGMLLM  304

Query  760   EMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQ  939
             EM  RRKNLN   E  SQ+YFPSWVY Q  +GKD ++G+  EEEK + +KMII ALWCIQ
Sbjct  305   EMASRRKNLNALAEHSSQLYFPSWVYNQYNEGKDFEVGEVXEEEKXLIRKMIITALWCIQ  364

Query  940   MNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT---DENSFPNAQNVE  1092
             + PS+RPSMK+V+  + E DVELL M P+P L P E+P    ++N  P    VE
Sbjct  365   LKPSDRPSMKEVL-QMLEGDVELLRMPPEPLLYPQEMPVGAPNDNPNPXYSKVE  417



>ref|XP_011047641.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X6 [Populus euphratica]
Length=700

 Score =   464 bits (1193),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 280/340 (82%), Gaps = 2/340 (1%)
 Frame = +1

Query  46    ISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVF  222
             I++++YK RRRHLS Y  IE +L S  +NL  IRYSY EIK++T+ F  KLGEGGYG+V+
Sbjct  335   ITLLIYKWRRRHLSMYGNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVY  394

Query  223   KGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFM  402
             KG LRSG F AVK++ K KA GQ+FI+EVATIGRIHH NVV+LIGF VEGSKRAL+Y+FM
Sbjct  395   KGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHRNVVQLIGFTVEGSKRALIYDFM  454

Query  403   PNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDEN  582
             PNGSLEKYIF ++ SI LS++K+++ISLGVA GI+YLH GCDM+ILHFDIKPHNILLDEN
Sbjct  455   PNGSLEKYIFSRQGSIPLSNQKIYEISLGVALGIEYLHEGCDMQILHFDIKPHNILLDEN  514

Query  583   FSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLME  762
             F+PK+SDFGLAKLYP  +S+VSLT ARGT+GYMAPEL Y++IGG+S+KADVYSFGMLLME
Sbjct  515   FTPKISDFGLAKLYPTNNSIVSLTMARGTIGYMAPELFYKSIGGVSYKADVYSFGMLLME  574

Query  763   MVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQM  942
             MVGRRKNLN      SQ+YFPSW+Y+Q+ +G+DI    ATE+EK   KKM IVALWCIQ+
Sbjct  575   MVGRRKNLNTLANHSSQMYFPSWIYDQVNEGRDILEDQATEQEKNTIKKMTIVALWCIQL  634

Query  943   NPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
              P +RPSM +V+  + + ++E L+M PKPFL P +   D+
Sbjct  635   KPIDRPSMHRVV-QMLQANIESLQMPPKPFLVPQQTSNDD  673



>gb|KDP42824.1| hypothetical protein JCGZ_23766 [Jatropha curcas]
Length=590

 Score =   460 bits (1183),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 225/345 (65%), Positives = 278/345 (81%), Gaps = 3/345 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R   G  F+ +  +YK RRRHLS Y+TIE +L   NNLMPIRY+Y +IK+MT  FK KL
Sbjct  226   ARCLCGTPFVTAFFIYKWRRRHLSGYNTIEEFLQSHNNLMPIRYAYSDIKKMTGGFKEKL  285

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGG G V+KG LRS  F AVKM+GKSKA GQ+FI+EVATIGRIHH NVV+LIGFCVEG+
Sbjct  286   GEGGLGCVYKGKLRSSQFAAVKMLGKSKANGQDFINEVATIGRIHHANVVKLIGFCVEGT  345

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             KRAL+YEF+ NGSL+KYIF ++  +SL  EK++ IS GVARGI+YLHRGC+M+ILHFDIK
Sbjct  346   KRALVYEFLSNGSLDKYIFSRQGYVSLCWEKLYQISQGVARGIEYLHRGCEMQILHFDIK  405

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PK+SDFGLAKLYP + S+ SLTAARGT+GYMAPEL Y+NIG +S+KADV
Sbjct  406   PHNILLDENFTPKISDFGLAKLYPTKGSIASLTAARGTIGYMAPELFYKNIGRVSYKADV  465

Query  736   YSFGMLLMEMVGRRKNLNP-FVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             YSFGMLL+EM GRRK LN      LS++Y+P WVY++L +G ++++ DATEEE K+++KM
Sbjct  466   YSFGMLLLEMTGRRKKLNAKATADLSEVYYPFWVYDRLSNG-ELEVEDATEEENKIARKM  524

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDE  1047
             II  LWCIQM PS+RP M KVI  + E D+E L++ P+P L P E
Sbjct  525   IITGLWCIQMKPSDRPPMNKVI-EMLEGDLENLQLPPRPVLYPAE  568



>ref|XP_011047640.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X5 [Populus euphratica]
Length=710

 Score =   464 bits (1193),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 280/340 (82%), Gaps = 2/340 (1%)
 Frame = +1

Query  46    ISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVF  222
             I++++YK RRRHLS Y  IE +L S  +NL  IRYSY EIK++T+ F  KLGEGGYG+V+
Sbjct  345   ITLLIYKWRRRHLSMYGNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVY  404

Query  223   KGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFM  402
             KG LRSG F AVK++ K KA GQ+FI+EVATIGRIHH NVV+LIGF VEGSKRAL+Y+FM
Sbjct  405   KGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHRNVVQLIGFTVEGSKRALIYDFM  464

Query  403   PNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDEN  582
             PNGSLEKYIF ++ SI LS++K+++ISLGVA GI+YLH GCDM+ILHFDIKPHNILLDEN
Sbjct  465   PNGSLEKYIFSRQGSIPLSNQKIYEISLGVALGIEYLHEGCDMQILHFDIKPHNILLDEN  524

Query  583   FSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLME  762
             F+PK+SDFGLAKLYP  +S+VSLT ARGT+GYMAPEL Y++IGG+S+KADVYSFGMLLME
Sbjct  525   FTPKISDFGLAKLYPTNNSIVSLTMARGTIGYMAPELFYKSIGGVSYKADVYSFGMLLME  584

Query  763   MVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQM  942
             MVGRRKNLN      SQ+YFPSW+Y+Q+ +G+DI    ATE+EK   KKM IVALWCIQ+
Sbjct  585   MVGRRKNLNTLANHSSQMYFPSWIYDQVNEGRDILEDQATEQEKNTIKKMTIVALWCIQL  644

Query  943   NPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
              P +RPSM +V+  + + ++E L+M PKPFL P +   D+
Sbjct  645   KPIDRPSMHRVV-QMLQANIESLQMPPKPFLVPQQTSNDD  683



>ref|XP_011015079.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Populus euphratica]
Length=705

 Score =   464 bits (1193),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 238/357 (67%), Positives = 291/357 (82%), Gaps = 4/357 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTN  177
             + Y +  F  GLL L+++++YK RRRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN
Sbjct  328   VIYHVLLFPCGLLCLLTLLIYKWRRRHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITN  387

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGG+G+V+KG LRSG F AVK++G SKA GQ+FI EVATIGRIHH NVV+LIG
Sbjct  388   GFKDKLGEGGFGSVYKGKLRSGRFAAVKLLGNSKANGQDFIHEVATIGRIHHVNVVQLIG  447

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             F VEGSKRAL+YEFMPNGSLEKYIF K+  +  S EK+++ISLGVARGI+YLH+GCD++I
Sbjct  448   FTVEGSKRALIYEFMPNGSLEKYIFSKQGIVPRS-EKIYEISLGVARGIEYLHQGCDIQI  506

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILL++ F PK+SDFGLAKLYP  ++ V LTAARGT+GYMAPEL Y+NIGG+
Sbjct  507   LHFDIKPHNILLNDKFVPKISDFGLAKLYPTNNNTVPLTAARGTIGYMAPELFYKNIGGV  566

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             S+KADVYSFGMLLMEMVGRRKNLN      SQIYFPSW ++Q+  GKDI++  DATE EK
Sbjct  567   SYKADVYSFGMLLMEMVGRRKNLNALANHSSQIYFPSWAHDQVSAGKDIEVQEDATEHEK  626

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             K +KKMIIVALWCIQ+ P +RPSM K    + E DVE L M PKPFL+P ++  D++
Sbjct  627   KTTKKMIIVALWCIQLKPVDRPSMHKA-AEMLESDVESLRMPPKPFLTPHQMSGDDD  682



>gb|AES59896.2| stress-induced receptor-like kinase [Medicago truncatula]
Length=636

 Score =   461 bits (1186),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/349 (66%), Positives = 281/349 (81%), Gaps = 4/349 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F LG+   I +++YK R++HLS YD IE +L   N++MPIRYSY +IK++T  FK KLG
Sbjct  267   KFVLGVP--IVLLIYKWRQKHLSVYDGIEDFLRSDNSIMPIRYSYKDIKKITEQFKIKLG  324

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
              GGYGTVFKG LRS   VAVK++ K+K  GQ+F++EV TIGRIHH NVV+LIGFCVEGSK
Sbjct  325   NGGYGTVFKGKLRSDRLVAVKLLDKAKTNGQDFVNEVTTIGRIHHVNVVQLIGFCVEGSK  384

Query  379   RALLYEFMPNGSLEKYIFPK-EESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             RAL+YEFMPNGSLEKYIF   EES SLS +K++ ISLGVARGI YLH GC+M+ILHFDIK
Sbjct  385   RALIYEFMPNGSLEKYIFSLIEESNSLSCKKLYAISLGVARGIAYLHNGCNMKILHFDIK  444

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF+PKVSDFGLA++ P + S+VSLTAARGT+GYMAPEL YRN+G ISHKADV
Sbjct  445   PHNILLDENFNPKVSDFGLARVSPTDKSIVSLTAARGTIGYMAPELFYRNVGTISHKADV  504

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             YSFGMLLMEM  RRKNLNP  EQ  QIYFP W+Y QL DG ++ + + T+EE K++KKM+
Sbjct  505   YSFGMLLMEMASRRKNLNPLAEQSCQIYFPFWIYGQLHDGSEVTIENDTDEEMKLAKKMM  564

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             IVALWCIQ  P +RPSM KVI  + EE+   L+M  KP+L P ++P ++
Sbjct  565   IVALWCIQTKPGDRPSMDKVI-EMLEEEDGDLQMPNKPYLYPQDLPAED  612



>ref|XP_011015081.1| PREDICTED: L-type lectin-domain containing receptor kinase V.4-like 
isoform X3 [Populus euphratica]
Length=698

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 238/357 (67%), Positives = 291/357 (82%), Gaps = 4/357 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTN  177
             + Y +  F  GLL L+++++YK RRRHLS Y+ IE +L S  N+LMPIRY+Y EIK++TN
Sbjct  321   VIYHVLLFPCGLLCLLTLLIYKWRRRHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITN  380

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGG+G+V+KG LRSG F AVK++G SKA GQ+FI EVATIGRIHH NVV+LIG
Sbjct  381   GFKDKLGEGGFGSVYKGKLRSGRFAAVKLLGNSKANGQDFIHEVATIGRIHHVNVVQLIG  440

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             F VEGSKRAL+YEFMPNGSLEKYIF K+  +  S EK+++ISLGVARGI+YLH+GCD++I
Sbjct  441   FTVEGSKRALIYEFMPNGSLEKYIFSKQGIVPRS-EKIYEISLGVARGIEYLHQGCDIQI  499

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILL++ F PK+SDFGLAKLYP  ++ V LTAARGT+GYMAPEL Y+NIGG+
Sbjct  500   LHFDIKPHNILLNDKFVPKISDFGLAKLYPTNNNTVPLTAARGTIGYMAPELFYKNIGGV  559

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             S+KADVYSFGMLLMEMVGRRKNLN      SQIYFPSW ++Q+  GKDI++  DATE EK
Sbjct  560   SYKADVYSFGMLLMEMVGRRKNLNALANHSSQIYFPSWAHDQVSAGKDIEVQEDATEHEK  619

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             K +KKMIIVALWCIQ+ P +RPSM K    + E DVE L M PKPFL+P ++  D++
Sbjct  620   KTTKKMIIVALWCIQLKPVDRPSMHKA-AEMLESDVESLRMPPKPFLTPHQMSGDDD  675



>ref|XP_002513567.1| kinase, putative [Ricinus communis]
 gb|EEF48970.1| kinase, putative [Ricinus communis]
Length=601

 Score =   460 bits (1183),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 279/341 (82%), Gaps = 2/341 (1%)
 Frame = +1

Query  43    LISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVF  222
             ++  +VY   RRH+S YD+IE +L   NNL P+RYSY +I++MT+ FK KLGEGGYG+V 
Sbjct  238   VLVFLVYTWSRRHVSMYDSIEEFLQSQNNLTPVRYSYSDIRKMTSAFKDKLGEGGYGSVC  297

Query  223   KGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFM  402
             K  LRSG F AVKM+GKSKA GQEFI+EVA+IG++HH NVV+LIGFC EGSKRAL+Y+FM
Sbjct  298   KAKLRSGRFAAVKMLGKSKANGQEFINEVASIGQVHHVNVVQLIGFCAEGSKRALVYDFM  357

Query  403   PNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDEN  582
             PNGSL+KY+F +E +  LS +KM +ISLGVARGIDYLHRGC M+ILHFDIKPHNILLDEN
Sbjct  358   PNGSLDKYVFSREGNTHLSWKKMHEISLGVARGIDYLHRGCKMQILHFDIKPHNILLDEN  417

Query  583   FSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLME  762
             F PKVSDFGLAKL    DS V+LTAARGT+GY+APEL Y+NIGG+S+KADVYSFGMLLME
Sbjct  418   FIPKVSDFGLAKLQATSDSTVTLTAARGTIGYIAPELFYKNIGGVSYKADVYSFGMLLME  477

Query  763   MVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQM  942
             MVG++KNLN   +  SQ YFP WVY ++ DGK +++ + TE+E+ V+KKMI VALWCIQM
Sbjct  478   MVGKKKNLNAEADHSSQTYFPDWVYNEVIDGK-VEIRNGTEDEEMVAKKMITVALWCIQM  536

Query  943   NPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
              PS+RPSM+KV+  + E+++E L + PKP L P+E   +E+
Sbjct  537   KPSDRPSMQKVV-EMLEDNLESLPLPPKPTLWPEEPLVEED  576



>ref|XP_006593814.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
isoform X5 [Glycine max]
Length=684

 Score =   462 bits (1190),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 226/366 (62%), Positives = 292/366 (80%), Gaps = 3/366 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F  G+   I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   FK KLG
Sbjct  305   KFLFGMTLFIVLLIYKWRKRHLSIYENIENYLE-QNNLMPIGYSYKEIKKMARGFKEKLG  363

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
              GGYG VFKG LRSGP VA+KM+ K+K  GQ+FISE+ATIGRIHH NVV+LIG+CVEGSK
Sbjct  364   GGGYGFVFKGKLRSGPSVAIKMLHKAKGNGQDFISEIATIGRIHHQNVVQLIGYCVEGSK  423

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFMPNGSL+K+IFPK+ +I L+++++++I++GVARGI YLH GC+M+ILHFDIKP
Sbjct  424   RALVYEFMPNGSLDKFIFPKDGNIHLTYDEIYNIAIGVARGIAYLHHGCEMKILHFDIKP  483

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDE F+PKVSDFGLAKLYP+++S+V+ T ARGT+GYMAPEL Y NIGGISHKADVY
Sbjct  484   HNILLDETFTPKVSDFGLAKLYPIDNSIVTRTEARGTIGYMAPELFYGNIGGISHKADVY  543

Query  739   SFGMLLMEMVGRRKNLNPFV-EQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             SFGMLL++M  +RKN NP   +  SQ+YFP+W+Y QL+   DI+M   TEEE K++KKMI
Sbjct  544   SFGMLLIDMTNKRKNPNPHADDHSSQLYFPTWIYNQLEKETDIEMEGVTEEENKIAKKMI  603

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             IV+LWCIQ+ P++R SM KV+  + E D+E LE+ PKP L P E   ++ S  ++Q + +
Sbjct  604   IVSLWCIQLKPTDRLSMNKVV-EMLEGDIESLEIPPKPSLYPHETMENDQSIYSSQTMST  662

Query  1096  PLLSDN  1113
               +S +
Sbjct  663   DFISSS  668



>ref|XP_006593812.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
isoform X3 [Glycine max]
Length=695

 Score =   463 bits (1191),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 226/366 (62%), Positives = 292/366 (80%), Gaps = 3/366 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F  G+   I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   FK KLG
Sbjct  316   KFLFGMTLFIVLLIYKWRKRHLSIYENIENYLE-QNNLMPIGYSYKEIKKMARGFKEKLG  374

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
              GGYG VFKG LRSGP VA+KM+ K+K  GQ+FISE+ATIGRIHH NVV+LIG+CVEGSK
Sbjct  375   GGGYGFVFKGKLRSGPSVAIKMLHKAKGNGQDFISEIATIGRIHHQNVVQLIGYCVEGSK  434

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             RAL+YEFMPNGSL+K+IFPK+ +I L+++++++I++GVARGI YLH GC+M+ILHFDIKP
Sbjct  435   RALVYEFMPNGSLDKFIFPKDGNIHLTYDEIYNIAIGVARGIAYLHHGCEMKILHFDIKP  494

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDE F+PKVSDFGLAKLYP+++S+V+ T ARGT+GYMAPEL Y NIGGISHKADVY
Sbjct  495   HNILLDETFTPKVSDFGLAKLYPIDNSIVTRTEARGTIGYMAPELFYGNIGGISHKADVY  554

Query  739   SFGMLLMEMVGRRKNLNPFV-EQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMI  915
             SFGMLL++M  +RKN NP   +  SQ+YFP+W+Y QL+   DI+M   TEEE K++KKMI
Sbjct  555   SFGMLLIDMTNKRKNPNPHADDHSSQLYFPTWIYNQLEKETDIEMEGVTEEENKIAKKMI  614

Query  916   IVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVES  1095
             IV+LWCIQ+ P++R SM KV+  + E D+E LE+ PKP L P E   ++ S  ++Q + +
Sbjct  615   IVSLWCIQLKPTDRLSMNKVV-EMLEGDIESLEIPPKPSLYPHETMENDQSIYSSQTMST  673

Query  1096  PLLSDN  1113
               +S +
Sbjct  674   DFISSS  679



>ref|XP_002309734.2| hypothetical protein POPTR_0007s00780g [Populus trichocarpa]
 gb|EEE90184.2| hypothetical protein POPTR_0007s00780g [Populus trichocarpa]
Length=362

 Score =   451 bits (1159),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 221/325 (68%), Positives = 268/325 (82%), Gaps = 2/325 (1%)
 Frame = +1

Query  91    YDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMM  267
             +  IE +L S  +NL  IRYSY EIK++T+ F  KLGEGGYG+V+KG LRSG F AVK++
Sbjct  2     FGNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVYKGKLRSGRFAAVKIL  61

Query  268   GKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEES  447
              K KA GQEFI+EVATIGRIHH NVV+LIGF VEGSKRAL+YEFMPNGSLEKYIF ++  
Sbjct  62    RKEKANGQEFINEVATIGRIHHCNVVQLIGFTVEGSKRALIYEFMPNGSLEKYIFSRQGC  121

Query  448   ISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYP  627
             I LS++K+++ISLGVARGI+YLH GCDM+ILHFDIKPHNILLDENF+PKVSDFGLAKLYP
Sbjct  122   IPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYP  181

Query  628   VEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQL  807
               +S+VSLT ARGTMGYMAPEL Y++IGG+S+KADVYSFGMLLMEMVGRRKNLN   +  
Sbjct  182   TNNSVVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALADHS  241

Query  808   SQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIeml  987
             SQ+YFPSW+Y+Q+ +G+DI    ATE+EK   KKM IVALWCIQ+ P +RPSM +V+  +
Sbjct  242   SQMYFPSWIYDQVNEGRDILEDQATEQEKNTIKKMTIVALWCIQLKPIDRPSMHRVV-QM  300

Query  988   eeedvellemAPKPFLSPDEVPTDE  1062
              E D+E L++ PKPFL P +   D+
Sbjct  301   LEADIESLQIPPKPFLVPQQTSNDD  325



>ref|XP_010646996.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=656

 Score =   461 bits (1187),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 273/323 (85%), Gaps = 1/323 (0%)
 Frame = +1

Query  13   LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
            +GR  +G+L L + ++YK RRRHLS  D IE +L    NL PI+Y+Y +IK+MT+NFKHK
Sbjct  287  IGRAVIGILCLFAYLIYKFRRRHLSLDDDIEEFLHNYQNLRPIKYTYSDIKKMTHNFKHK  346

Query  193  LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
            LG+GG+G+V+KG LRSG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVVRL+GFC++ 
Sbjct  347  LGQGGFGSVYKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQR  406

Query  373  SKRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
            SK AL+Y++MPNGSL+K++F  +  +I LS E+++ I+LGV RGI+YLH+GCDM+ILHFD
Sbjct  407  SKWALIYDYMPNGSLDKFVFLDQGNNIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFD  466

Query  550  IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
            IKPHNILLDE+F+PKVSDFGLAKLY  ++S+VS+TAARGT+GY+APEL Y+N+GG+S KA
Sbjct  467  IKPHNILLDEDFTPKVSDFGLAKLYSTDESIVSVTAARGTLGYIAPELFYKNVGGVSFKA  526

Query  730  DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
            DVYSFGMLL+EMVG+RKN+N F E  SQIYFPSW+Y++   G+D++MGDATE+EKK  +K
Sbjct  527  DVYSFGMLLLEMVGKRKNVNAFAEHSSQIYFPSWIYDRYDQGEDMEMGDATEDEKKYVRK  586

Query  910  MIIVALWCIQMNPSERPSMKKVI  978
            M+IVALWC+QM P +RPSM K +
Sbjct  587  MVIVALWCVQMKPVDRPSMSKTL  609



>ref|XP_010646999.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
Length=699

 Score =   462 bits (1190),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 229/365 (63%), Positives = 298/365 (82%), Gaps = 5/365 (1%)
 Frame = +1

Query  10    ALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKH  189
              +GR  LG+L L + ++YK  RRHLS  D+IE +L    NL PI+YSY +IK+MT+NF +
Sbjct  325   VIGRTMLGMLCLFAYLIYKFHRRHLSLDDSIEEFLRSQKNLQPIKYSYSDIKKMTHNFAN  384

Query  190   KLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             KLG+GG+G+V+KG LRSG  VAVK++  SKA GQ+FI+EVATIGRIHH NVVRL+GFCV+
Sbjct  385   KLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQ  444

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             GSK AL+Y+FMPNGSL+K+IF KEE+ + LS E+++ ++LGV RGI+YLH+GCDM+ILHF
Sbjct  445   GSKWALIYDFMPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHF  504

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  505   DIKPHNILLDEDFTPKVSDFGLAKLYSTDESMVSLTAARGTLGYIAPELFYKNIGGVSYK  564

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEMVGRRKN+N      SQIYFPSW+Y++   G +ID+GDATE+E K+ +
Sbjct  565   ADVYSFGMLLMEMVGRRKNVNANAAHSSQIYFPSWIYDRYDQGDNIDLGDATEDENKLVR  624

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQN  1086
             KM+IVALWCIQM P +RPSM K +  + E +VELLEM PKP L  +E+  +++    +  
Sbjct  625   KMVIVALWCIQMKPIDRPSMSKAL-EMLEGEVELLEMPPKPTLYSEEMLVEDHM---SNP  680

Query  1087  VESPL  1101
             +E+P+
Sbjct  681   IEAPI  685



>ref|XP_007163974.1| hypothetical protein PHAVU_L000900g, partial [Phaseolus vulgaris]
 gb|ESW35968.1| hypothetical protein PHAVU_L000900g, partial [Phaseolus vulgaris]
Length=399

 Score =   452 bits (1163),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 219/348 (63%), Positives = 279/348 (80%), Gaps = 2/348 (1%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             Y + R+ +G +  I+++ YK RRRH S  + IE YL   N+LMPIRY Y EIK+MT  F 
Sbjct  32    YLIVRYVVGTILFIALMTYKWRRRHSSQSENIESYLE-QNSLMPIRYIYKEIKKMTTGFN  90

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
              KLGEGGYG+VFKG LRSGP VA+K++ KSK  GQ+FI+EVATIG IHH NVV LIG+C 
Sbjct  91    EKLGEGGYGSVFKGKLRSGPSVAIKVLRKSKGNGQDFINEVATIGTIHHQNVVHLIGYCA  150

Query  367   EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             EGSKRAL+YEFMPNGSL+K+IF +EE++ L+++ +++I++GVARGI YLH GC+M+ILHF
Sbjct  151   EGSKRALVYEFMPNGSLDKFIFSREENLHLTYDTIYNIAIGVARGISYLHHGCEMQILHF  210

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDE F PKVSDFGLAKLYP++ S+V++T ARGT+GYMAPEL Y NIG IS K
Sbjct  211   DIKPHNILLDEKFIPKVSDFGLAKLYPIDKSVVTMTPARGTIGYMAPELFYTNIGRISDK  270

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
              DVYSFGM L+E+  +RKNLNP  E+ SQ+YFP W+Y+QL   KDI+M D TE+EKK++K
Sbjct  271   FDVYSFGMFLIEIACKRKNLNPHAERSSQLYFPFWIYDQLDKEKDIEMEDVTEDEKKIAK  330

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             KM+IV+LWCIQ+ P++RPSM KV+  + E D+E L++ PKP L P E 
Sbjct  331   KMMIVSLWCIQLKPNDRPSMNKVV-EMLEGDIENLKIPPKPSLYPRET  377



>ref|XP_006601165.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
isoform X3 [Glycine max]
Length=627

 Score =   460 bits (1184),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 232/343 (68%), Positives = 287/343 (84%), Gaps = 2/343 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             L +   I I+  K R+RHLS +++IE+YL   NNLMPIRYSY E+K+M   FK KLGEGG
Sbjct  285   LTVPLFIVILTCKWRKRHLSMFESIENYLE-QNNLMPIRYSYKEVKKMAGGFKDKLGEGG  343

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+VFKG LRSG  VA+KM+GKSK  GQ+FISEVATIGR +H N+V+LIGFCV GSKRAL
Sbjct  344   YGSVFKGKLRSGSCVAIKMLGKSKGNGQDFISEVATIGRTYHQNIVQLIGFCVHGSKRAL  403

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF K+ESI LS++++++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  404   VYEFMPNGSLDKFIFSKDESIHLSYDRIYNISIGVARGIAYLHYGCEMQILHFDIKPHNI  463

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF+PKVSDFGLAKLYP+++S+V  TAARGT+GYMAPEL Y NIGGISHKADVYS+G
Sbjct  464   LLDENFTPKVSDFGLAKLYPIDNSIVPRTAARGTIGYMAPELFYNNIGGISHKADVYSYG  523

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM G+RKNLNP  E+ SQ++FP W+Y  ++DG+DI+M D T+EEKK+ KKMIIVAL
Sbjct  524   MLLMEMAGKRKNLNPHAERSSQLFFPFWIYNHIRDGEDIEMEDVTKEEKKMVKKMIIVAL  583

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             WCIQ+ P++RPSM +V+  + E D+E LE+ PKP L P E  T
Sbjct  584   WCIQLKPNDRPSMNEVV-EMLEGDIENLEIPPKPTLYPSETIT  625



>gb|KCW64256.1| hypothetical protein EUGRSUZ_G01897 [Eucalyptus grandis]
Length=372

 Score =   451 bits (1160),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%), Gaps = 2/359 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + + + +F +G+ F+   ++   RRRHL+    IE +L   NN +PIRYSY  IK++T N
Sbjct  14    VYFCVAKFVIGMPFVGISLICIYRRRHLAMDKNIEEFLQSHNNFLPIRYSYSNIKKITTN  73

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FKHKLGEGGYG V+KGTLRSG  VA+K++ +SK  GQ+FI+EVATIGRI+H NVV+LIGF
Sbjct  74    FKHKLGEGGYGYVYKGTLRSGKEVAIKILKQSKFQGQDFINEVATIGRIYHVNVVQLIGF  133

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGSK+AL+Y+ M NGSL+K IF +E +  L ++K+++I+LGVARGI+YLHRGCDM+IL
Sbjct  134   CFEGSKQALVYDLMSNGSLDKQIFTEEGNKFLDYKKIYEIALGVARGIEYLHRGCDMQIL  193

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLD+NF+PKVSDFGLAKLYP  +S+VSLTAARGT+GYMAPEL YRNIGG+S
Sbjct  194   HFDIKPHNILLDKNFTPKVSDFGLAKLYPANNSIVSLTAARGTLGYMAPELFYRNIGGVS  253

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KADVYSFGMLLMEM GRRKN+N   E  SQIYFP WVY+Q+ + K +++ +   +E+ V
Sbjct  254   YKADVYSFGMLLMEMAGRRKNINANAEHSSQIYFPLWVYDQVNEEKSVEI-EIVADERMV  312

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN  1077
              +KMIIVALWCIQ+NP  RPSM KV+  + E D++ L+M PKP + P +VP + + + N
Sbjct  313   IRKMIIVALWCIQLNPDHRPSMSKVL-EMLEGDIDELQMPPKPLIYPHDVPVNNDEYSN  370



>ref|XP_010662989.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
 ref|XP_010662990.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
Length=664

 Score =   461 bits (1187),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 215/322 (67%), Positives = 270/322 (84%), Gaps = 1/322 (0%)
 Frame = +1

Query  16   GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
            GR  LG+L L + V+Y+ RRRHLS  D+IE +L    NL PIRYSY EIK++TN FK KL
Sbjct  292  GRTVLGILCLSAYVIYRFRRRHLSLDDSIEDFLQNHRNLQPIRYSYSEIKKITNGFKDKL  351

Query  196  GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
            G+GG+G+V+KG LRSG  VAVKM+  SK  GQ+FI+EVATIGRIHH NVVRLIGFCVEG 
Sbjct  352  GQGGFGSVYKGKLRSGCIVAVKMLVMSKTNGQDFINEVATIGRIHHVNVVRLIGFCVEGP  411

Query  376  KRALLYEFMPNGSLEKYIFP-KEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
            K AL+Y+FMPNGSL+KYIFP ++ S+ LS E ++ I+LGV RGI+YLH+GCDM+ILHFDI
Sbjct  412  KWALIYDFMPNGSLDKYIFPERKNSVPLSWEILYKIALGVGRGIEYLHQGCDMQILHFDI  471

Query  553  KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
            KPHNILLD+ F+PKVSDFGLAKLY V  S+VSLTAARGT+GY+APEL Y+NIGG+S+KAD
Sbjct  472  KPHNILLDKTFAPKVSDFGLAKLYSVNQSIVSLTAARGTLGYIAPELFYKNIGGVSYKAD  531

Query  733  VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
            VYSFGMLLMEMVG+++ +N   +  S++YFPSW+Y+++  G+D++MGDATE+EKK  +KM
Sbjct  532  VYSFGMLLMEMVGKKRYVNAHKDDSSEMYFPSWIYDRINKGEDMEMGDATEDEKKCVRKM  591

Query  913  IIVALWCIQMNPSERPSMKKVI  978
            +IVALWCIQM P++RPSM K +
Sbjct  592  VIVALWCIQMKPTDRPSMSKAL  613



>ref|XP_006601164.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
isoform X2 [Glycine max]
Length=635

 Score =   460 bits (1184),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 232/343 (68%), Positives = 287/343 (84%), Gaps = 2/343 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             L +   I I+  K R+RHLS +++IE+YL   NNLMPIRYSY E+K+M   FK KLGEGG
Sbjct  293   LTVPLFIVILTCKWRKRHLSMFESIENYLE-QNNLMPIRYSYKEVKKMAGGFKDKLGEGG  351

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+VFKG LRSG  VA+KM+GKSK  GQ+FISEVATIGR +H N+V+LIGFCV GSKRAL
Sbjct  352   YGSVFKGKLRSGSCVAIKMLGKSKGNGQDFISEVATIGRTYHQNIVQLIGFCVHGSKRAL  411

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF K+ESI LS++++++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  412   VYEFMPNGSLDKFIFSKDESIHLSYDRIYNISIGVARGIAYLHYGCEMQILHFDIKPHNI  471

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF+PKVSDFGLAKLYP+++S+V  TAARGT+GYMAPEL Y NIGGISHKADVYS+G
Sbjct  472   LLDENFTPKVSDFGLAKLYPIDNSIVPRTAARGTIGYMAPELFYNNIGGISHKADVYSYG  531

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM G+RKNLNP  E+ SQ++FP W+Y  ++DG+DI+M D T+EEKK+ KKMIIVAL
Sbjct  532   MLLMEMAGKRKNLNPHAERSSQLFFPFWIYNHIRDGEDIEMEDVTKEEKKMVKKMIIVAL  591

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             WCIQ+ P++RPSM +V+  + E D+E LE+ PKP L P E  T
Sbjct  592   WCIQLKPNDRPSMNEVV-EMLEGDIENLEIPPKPTLYPSETIT  633



>ref|XP_002309858.2| hypothetical protein POPTR_0007s00820g [Populus trichocarpa]
 gb|EEE90308.2| hypothetical protein POPTR_0007s00820g [Populus trichocarpa]
Length=352

 Score =   450 bits (1157),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 220/325 (68%), Positives = 269/325 (83%), Gaps = 2/325 (1%)
 Frame = +1

Query  91    YDTIEHYL-SGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMM  267
             +  IE +L S  +NL  IRYSY EIK++T+ F  KLGEGGYG+V+KG LRSG F AVK++
Sbjct  2     FGNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVYKGKLRSGRFAAVKIL  61

Query  268   GKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEES  447
              K KA GQ+FI+EVATIGRIHH NVV+LIGF VEGSKRAL+YEFMPNGSLEKYIF ++ S
Sbjct  62    RKEKANGQDFINEVATIGRIHHCNVVQLIGFTVEGSKRALIYEFMPNGSLEKYIFSRQGS  121

Query  448   ISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYP  627
             I LS++K+++ISLGVARGI+YLH GCDM+ILHFDIKPHNILLDENF+PKVSDFGLAKLYP
Sbjct  122   IPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYP  181

Query  628   VEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQL  807
               +S+VSLT ARGTMGYMAPEL Y++IGG+S+KADVYSFGMLLMEMVGRRKNLN   +  
Sbjct  182   TNNSVVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALTDHS  241

Query  808   SQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIeml  987
             SQ+YFPSW+Y+Q+ +G++I    ATE+EK   KKM IVALWCIQ+ P +RPSM +V+  +
Sbjct  242   SQMYFPSWIYDQVNEGRNILEDQATEQEKNTIKKMTIVALWCIQLKPIDRPSMHRVV-QM  300

Query  988   eeedvellemAPKPFLSPDEVPTDE  1062
              + D+E L+M PKPFL P +   D+
Sbjct  301   LQADIESLQMPPKPFLVPQQTSNDD  325



>ref|XP_006601163.1| PREDICTED: probable receptor-like protein kinase At5g39030-like 
isoform X1 [Glycine max]
Length=644

 Score =   461 bits (1185),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 232/343 (68%), Positives = 287/343 (84%), Gaps = 2/343 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             L +   I I+  K R+RHLS +++IE+YL   NNLMPIRYSY E+K+M   FK KLGEGG
Sbjct  302   LTVPLFIVILTCKWRKRHLSMFESIENYLE-QNNLMPIRYSYKEVKKMAGGFKDKLGEGG  360

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+VFKG LRSG  VA+KM+GKSK  GQ+FISEVATIGR +H N+V+LIGFCV GSKRAL
Sbjct  361   YGSVFKGKLRSGSCVAIKMLGKSKGNGQDFISEVATIGRTYHQNIVQLIGFCVHGSKRAL  420

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +YEFMPNGSL+K+IF K+ESI LS++++++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  421   VYEFMPNGSLDKFIFSKDESIHLSYDRIYNISIGVARGIAYLHYGCEMQILHFDIKPHNI  480

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLDENF+PKVSDFGLAKLYP+++S+V  TAARGT+GYMAPEL Y NIGGISHKADVYS+G
Sbjct  481   LLDENFTPKVSDFGLAKLYPIDNSIVPRTAARGTIGYMAPELFYNNIGGISHKADVYSYG  540

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM G+RKNLNP  E+ SQ++FP W+Y  ++DG+DI+M D T+EEKK+ KKMIIVAL
Sbjct  541   MLLMEMAGKRKNLNPHAERSSQLFFPFWIYNHIRDGEDIEMEDVTKEEKKMVKKMIIVAL  600

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPT  1056
             WCIQ+ P++RPSM +V+  + E D+E LE+ PKP L P E  T
Sbjct  601   WCIQLKPNDRPSMNEVV-EMLEGDIENLEIPPKPTLYPSETIT  642



>ref|XP_010111693.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC31507.1| putative receptor-like protein kinase [Morus notabilis]
Length=374

 Score =   451 bits (1159),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 213/325 (66%), Positives = 266/325 (82%), Gaps = 2/325 (1%)
 Frame = +1

Query  7    YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
            Y+  +F++   F+++ ++Y  RR HLS +  IE +L   NNLMPIRYSY +IK+MT NFK
Sbjct  2    YSGAKFTVVAPFVVAFLIYMWRRHHLSTF-AIEEFLYNHNNLMPIRYSYSDIKKMTKNFK  60

Query  187  HKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCV  366
            +KLGEGGYG+VFKG LRSG  VA+KM+   K  GQ+FI+E+ATIGRIHH NVV+L+GFC 
Sbjct  61   NKLGEGGYGSVFKGKLRSGRLVAIKMLSNPKGHGQDFINEIATIGRIHHVNVVQLVGFCF  120

Query  367  EGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
            +GSKRAL+Y+FM NGSL+ +IF KEE+ S+S   +F+ISLGVARGI+YLH GC M+ILHF
Sbjct  121  QGSKRALVYDFMANGSLDNHIFSKEETDSISCGTIFEISLGVARGIEYLHGGCCMQILHF  180

Query  547  DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
            DIKPHNILLDENF+PKVSDFGLA+L P+E+S+VSLTAARGT+GY+APEL Y+NIGG+S+K
Sbjct  181  DIKPHNILLDENFAPKVSDFGLARLCPLENSIVSLTAARGTLGYIAPELFYKNIGGVSYK  240

Query  727  ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDI-DMGDATEEEKKVS  903
            ADVYSFGMLLMEM  +RKNLN   E  SQIYFP+W Y++L +GK I +  D  EE+ K  
Sbjct  241  ADVYSFGMLLMEMASKRKNLNAVAEHSSQIYFPTWAYDKLSEGKRIEETEDIVEEDSKAI  300

Query  904  KKMIIVALWCIQMNPSERPSMKKVI  978
            KKM+IVALWCIQ+ PS+RPSM KVI
Sbjct  301  KKMLIVALWCIQLKPSDRPSMSKVI  325



>ref|XP_006388285.1| hypothetical protein POPTR_0247s00220g [Populus trichocarpa]
 gb|ERP47199.1| hypothetical protein POPTR_0247s00220g [Populus trichocarpa]
Length=390

 Score =   451 bits (1161),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 231/368 (63%), Positives = 286/368 (78%), Gaps = 13/368 (4%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y +  F   L  L+++++YK R+  L ++D         N+LMPI+Y+Y EIK++TN 
Sbjct  23    VIYHVLLFPCELPCLLTLLIYKWRK-FLQSHD---------NDLMPIKYTYLEIKKITNG  72

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEG +G+V+KG LRSG F AVK+ GKSKA GQ+FI+EVATIGRIHH NVV+LIG+
Sbjct  73    FKDKLGEGSFGSVYKGKLRSGRFAAVKLFGKSKANGQDFINEVATIGRIHHVNVVQLIGY  132

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
              VEGSK A +YEFMPNGSLEKYIF +E S+ LS+EKM++ISLGVA GI YLH+GCDM+IL
Sbjct  133   TVEGSKHAFIYEFMPNGSLEKYIFSREGSVPLSNEKMYEISLGVAHGIQYLHQGCDMQIL  192

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILL++ F PKVSDFGLAKLYP  +++VSLTAARGTMGYMAPELCY+NIG +S
Sbjct  193   HFDIKPHNILLNDKFVPKVSDFGLAKLYPTNNNIVSLTAARGTMGYMAPELCYKNIGDVS  252

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEKK  897
              KADVYS+GMLLMEMVGRRKNLN      SQIYFPSWVY+Q+ +GKDI++  DA E  KK
Sbjct  253   FKADVYSYGMLLMEMVGRRKNLNALANHSSQIYFPSWVYDQVSEGKDIEVQEDALEHGKK  312

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN  1077
              +KKMIIVAL CIQ+   +RPSM KV+  + E DVE L M PKPFL+P ++  D++   N
Sbjct  313   TTKKMIIVALCCIQLKHVDRPSMHKVV-EMLESDVESLRMPPKPFLTPHQILEDDDR-TN  370

Query  1078  AQNVESPL  1101
                +  PL
Sbjct  371   HAKLSDPL  378



>emb|CDP12540.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   459 bits (1182),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 213/347 (61%), Positives = 279/347 (80%), Gaps = 2/347 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
              R  +G + L++ + YK +RRHLS YD IE +L   NNL+PIRYSY +IK+MTNNFK KL
Sbjct  258   ARAIIGAVLLVAFLFYKCQRRHLSIYDAIEEFLQSRNNLIPIRYSYKQIKKMTNNFKEKL  317

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             GEGGYG V+KG LRSG  VA+KM+ KSKA GQEFI+EVA +GRIHH NVVRL+GFCV  S
Sbjct  318   GEGGYGCVYKGKLRSGKLVAIKMLSKSKANGQEFINEVAALGRIHHVNVVRLVGFCVTAS  377

Query  376   KRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
             K AL+Y++MPNGSLEK+IF +  +   LS +K  +I++GVARGI+YLH+GC M+ILHFDI
Sbjct  378   KHALVYDYMPNGSLEKFIFSERLDGNPLSWKKATEIAMGVARGIEYLHQGCSMQILHFDI  437

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLDENF+PKVSDFGLAKL+PV+++ VSLTA RGT+GYMAPEL Y+ +G +S KAD
Sbjct  438   KPHNILLDENFTPKVSDFGLAKLHPVQNNTVSLTAVRGTLGYMAPELFYKRVGKVSSKAD  497

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLME+VGRR+NLN   E  SQ+YFPSW+Y++   G+++++ DATE+E + ++K+
Sbjct  498   VYSFGMLLMELVGRRRNLNAHAEHSSQMYFPSWIYDKFDHGENLEIEDATEDENRTARKL  557

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
             I++ALWCIQM P +RPSM++V+  + + D+  L++ PKP   P + P
Sbjct  558   ILIALWCIQMTPDDRPSMREVV-EMLQGDLTALQLPPKPLFYPADSP  603



>gb|KHN02025.1| Putative receptor-like protein kinase [Glycine soja]
Length=329

 Score =   449 bits (1154),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 218/310 (70%), Positives = 263/310 (85%), Gaps = 1/310 (0%)
 Frame = +1

Query  133   MPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVA  312
             MPIRYSY EIK+MT  FK KLGEGGYG+VFKG L SG  VA+KM+GKSK  GQ+FISEVA
Sbjct  1     MPIRYSYKEIKKMTGGFKEKLGEGGYGSVFKGKLCSGSCVAIKMLGKSKGNGQDFISEVA  60

Query  313   TIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGV  492
             T GRIHH NVV+LIGFCV+GSKRAL+YEFMPNGSL+K IF K+ SI LS++K+++IS+GV
Sbjct  61    TAGRIHHQNVVQLIGFCVQGSKRALVYEFMPNGSLDKLIFSKDGSIHLSYDKIYNISIGV  120

Query  493   ARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTM  672
             ARGI YLH GC+M+ILHFDIKPHNILLDENF+PKVSDFGLAKLYP+++S+V++T  RGT+
Sbjct  121   ARGIAYLHHGCEMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPIDNSIVTMTTTRGTI  180

Query  673   GYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKD  852
             GYMAPEL Y NIGGISHKADVYS+GMLLMEM  +RKNLNP  E+ SQ++FP W+Y  + D
Sbjct  181   GYMAPELFYNNIGGISHKADVYSYGMLLMEMASKRKNLNPHAERSSQLFFPFWIYNHIGD  240

Query  853   GKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPF  1032
              +DI+M D TEEEKK++KKMIIVALWCIQ+ P++RPSM KVI  + E D+E LE+ PKP 
Sbjct  241   EEDIEMEDVTEEEKKIAKKMIIVALWCIQLKPNDRPSMNKVI-EMLEGDIENLEIPPKPS  299

Query  1033  LSPDEVPTDE  1062
             L P E+ T +
Sbjct  300   LYPGEMITKD  309



>gb|KHN05177.1| Putative receptor-like protein kinase [Glycine soja]
Length=647

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 228/372 (61%), Positives = 292/372 (78%), Gaps = 7/372 (2%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + +  G+F  G+   I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   
Sbjct  281   LPFLAGKFLFGMTLFIVLLIYKWRKRHLSIYENIENYLE-QNNLMPIGYSYKEIKKMARG  339

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLG GGYG VFKG L SGP VA+KM+ K+K +GQ+FISE+ATIGRIHH NVV+LIG+
Sbjct  340   FKEKLGGGGYGIVFKGKLHSGPSVAIKMLHKAKGSGQDFISEIATIGRIHHQNVVQLIGY  399

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             CVEGSKRAL+YEFMPNGSL+K+IF K+ +I L+++K+++I++GVARGI YLH GC+M+IL
Sbjct  400   CVEGSKRALVYEFMPNGSLDKFIFTKDGNIQLTYDKIYNIAIGVARGIAYLHHGCEMKIL  459

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PKVSDFGLAKLYP+++S+V+ T ARGT+GYMAPEL Y NIGGIS
Sbjct  460   HFDIKPHNILLDETFTPKVSDFGLAKLYPIDNSIVTRTEARGTIGYMAPELFYGNIGGIS  519

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQL-KDGKDIDMGDATEEEKK  897
             HKADVYSFGMLL+EM  +RKNLNP  +  SQ+YFP W+Y QL  +  DI+M   TEEE  
Sbjct  520   HKADVYSFGMLLIEMASKRKNLNPHADHSSQLYFPFWIYNQLIGEETDIEMEGVTEEE--  577

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN  1077
               KKMIIV+LWCIQ+ PS+RPSM KV+  + E D+E LE+ PKP L P +   ++ S  +
Sbjct  578   --KKMIIVSLWCIQLKPSDRPSMNKVV-EMLEGDIESLEIPPKPSLYPHDTMENDQSIYS  634

Query  1078  AQNVESPLLSDN  1113
             +Q + +  +S +
Sbjct  635   SQTMSTDFISSS  646



>ref|NP_001237957.1| stress-induced receptor-like kinase precursor [Glycine max]
 gb|ACJ37406.1| stress-induced receptor-like kinase [Glycine max]
Length=606

 Score =   458 bits (1179),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 231/355 (65%), Positives = 284/355 (80%), Gaps = 7/355 (2%)
 Frame = +1

Query  1     ISYALGRFSLGLLFL-ISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTN  177
             + Y     S G + L I I+  K R+RHLS +++IE+YL   NNLMPIRYSY E+K+M  
Sbjct  258   VHYWNWETSWGWMSLFIVILTCKWRKRHLSMFESIENYLE-QNNLMPIRYSYKEVKKMAG  316

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGGYG+VFKG L SG  VA+KM+GKSK  GQ+FISEVATIGR +H N+V+LIG
Sbjct  317   GFKDKLGEGGYGSVFKGKLGSGSCVAIKMLGKSKGNGQDFISEVATIGRTYHQNIVQLIG  376

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             FCV GSKRAL+YEFMPNGSL+K+IF K+ESI LS++++++IS+ VARGI YLH GC+M+I
Sbjct  377   FCVHGSKRALVYEFMPNGSLDKFIFSKDESIHLSYDRIYNISIEVARGIAYLHYGCEMQI  436

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILLDENF+PKVSDFGLAKLYP+++S+V  TAARGT+GYMAPEL Y NIGGI
Sbjct  437   LHFDIKPHNILLDENFTPKVSDFGLAKLYPIDNSIVPRTAARGTIGYMAPELFYNNIGGI  496

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
             SHKADVYS+GMLLMEM  +RKNLNP  E+ SQ++FP W+Y  + D +DI+M D TEEE  
Sbjct  497   SHKADVYSYGMLLMEMASKRKNLNPHAERSSQLFFPFWIYNHIGDEEDIEMEDVTEEE--  554

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
               KKMIIVALWCIQ+ P++RPSM KV+  + E D+E LE+ PKP L P E  T +
Sbjct  555   --KKMIIVALWCIQLKPNDRPSMNKVV-EMLEGDIENLEIPPKPTLYPSETITKD  606



>ref|XP_008373799.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=363

 Score =   449 bits (1155),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/345 (66%), Positives = 275/345 (80%), Gaps = 1/345 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F  G  F+ + ++Y  +RRHLS Y++IE +L G   L+PIRYSY  IK+M+N FK KLG
Sbjct  20    KFLFGAPFVTAFLIYTWKRRHLSMYNSIEEFLHGEKTLVPIRYSYSNIKKMSNKFKEKLG  79

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGGYG+VFK  LRSG F A+KM+ K K  GQ+FISEV TIGRIHH NVV+L+G+CVEG+K
Sbjct  80    EGGYGSVFKARLRSGRFGAIKMLDKPKGNGQDFISEVNTIGRIHHVNVVQLVGYCVEGTK  139

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
              AL+Y+FM NGSL+KYI+ KE SI LS +  ++ISLGVARGI YLH  CDM+ILHFDIKP
Sbjct  140   HALVYDFMLNGSLDKYIYCKEGSIPLSCKTTYEISLGVARGIKYLHEDCDMQILHFDIKP  199

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF PK+SDFGLAKLYPV++S+VSLTAARGTMGYMAPEL Y+NIGG+S KADVY
Sbjct  200   HNILLDENFIPKISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADVY  259

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM  RRKNLN   E  SQ+YFPSWVY Q  +GKD ++G+  EEEK + +KMII
Sbjct  260   SFGMLLMEMASRRKNLNALAEHSSQLYFPSWVYNQYNEGKDFEVGEVVEEEKPLIRKMII  319

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
              ALWCIQ+ PS+RPSMK+V+  + E DVELL M P+P L P   P
Sbjct  320   TALWCIQLKPSDRPSMKEVL-QMLEGDVELLRMPPEPLLYPKRCP  363



>ref|XP_007161439.1| hypothetical protein PHAVU_001G068800g [Phaseolus vulgaris]
 gb|ESW33433.1| hypothetical protein PHAVU_001G068800g [Phaseolus vulgaris]
Length=415

 Score =   451 bits (1160),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 216/350 (62%), Positives = 280/350 (80%), Gaps = 2/350 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             I Y + R+ +G +  I+++ YK RRRH S Y+ IE YL   N+LM IRY+Y EIK+M   
Sbjct  34    IPYFIVRYVVGTILFIALLTYKWRRRHSSEYENIESYLE-QNSLMSIRYTYKEIKKMATG  92

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             F  KLGEGGYG+VFKG LRSGP VA+K++ KSK  GQ+FI+EVATIGRIHH NVV+LIG+
Sbjct  93    FNEKLGEGGYGSVFKGKLRSGPSVAIKVLRKSKGNGQDFINEVATIGRIHHQNVVQLIGY  152

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C E SKRAL+ EFMPNGSL+K+IF  E ++ L+++ +++I++GVA GI YLH GC+M+IL
Sbjct  153   CAESSKRALVCEFMPNGSLDKFIFSSEGNMHLTYDTIYNIAMGVAHGITYLHHGCEMQIL  212

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PK+SDFGLAKLYP++ S+V++TAARGT+GYMAPEL Y NIG IS
Sbjct  213   HFDIKPHNILLDEKFTPKISDFGLAKLYPIDKSVVTMTAARGTIGYMAPELFYTNIGKIS  272

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
              K+DVYSFGMLLME+  +RKNLNP  E+ SQ+YFP W+Y+QL   KDI+M D  E+EKK+
Sbjct  273   DKSDVYSFGMLLMELASKRKNLNPHAERSSQLYFPFWIYDQLDKEKDIEMEDVIEDEKKI  332

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             +KK++IV+LWCIQ+ P++RPSM KV+  + E D+E L++ PKP L P E 
Sbjct  333   AKKIMIVSLWCIQLKPNDRPSMNKVV-EMLEGDIENLKIPPKPSLYPRET  381



>emb|CAN66613.1| hypothetical protein VITISV_023171 [Vitis vinifera]
Length=456

 Score =   452 bits (1163),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 264/314 (84%), Gaps = 1/314 (0%)
 Frame = +1

Query  40   FLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTV  219
            + I +++YK RRRHLS  D IE +L    +L  I+YSY++IK+MTN+FK KLG+GG+G+V
Sbjct  92   YFIRLLIYKFRRRHLSLDDNIEEFLQNHKSLQLIKYSYYDIKKMTNSFKDKLGQGGFGSV  151

Query  220  FKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEF  399
            +KG L+SG  VAVK++  SKA GQ+FI+EVATIGRIHH NVV+L+GFC+EGSK AL+Y+F
Sbjct  152  YKGKLKSGRVVAVKVLVMSKADGQDFINEVATIGRIHHINVVKLVGFCIEGSKWALIYDF  211

Query  400  MPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLD  576
            MPNGSL+K+IFPK E+ + LS E+++ I+LGV  GI+YLH+GCDM+ILHFDIKPHNILLD
Sbjct  212  MPNGSLDKFIFPKHENNTPLSWERLYKIALGVGHGIEYLHQGCDMKILHFDIKPHNILLD  271

Query  577  ENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLL  756
            E+F+PKVSDFGLAKLY  ++S+VSLT ARGTMGY+APEL Y+NIG IS+KADVYSFGMLL
Sbjct  272  EDFTPKVSDFGLAKLYSTDESIVSLTKARGTMGYIAPELFYKNIGCISNKADVYSFGMLL  331

Query  757  MEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCI  936
            MEMVG+RKNLN   +  SQIYFP W+Y++   G+DI+MGDAT+ EK   KKM+IVALWCI
Sbjct  332  MEMVGKRKNLNALADHSSQIYFPLWIYDKFDQGEDIEMGDATDNEKISVKKMVIVALWCI  391

Query  937  QMNPSERPSMKKVI  978
            QM P++RPSM K +
Sbjct  392  QMKPTDRPSMSKAL  405



>gb|KEH40387.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=439

 Score =   451 bits (1161),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 237/379 (63%), Positives = 287/379 (76%), Gaps = 10/379 (3%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R  LG++   ++++YK RRRH S Y+ IE +L   N LMPIRYSY EIK+M   FK KLG
Sbjct  65    RIMLGIILFSALLIYKYRRRHASIYENIEDFLQN-NTLMPIRYSYKEIKQMAKGFKVKLG  123

Query  199   EGGYGTVFKGTLRSGPFVAVKMMG-KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             EGGYG V+KG L SGPF+A+KM+  KSK  GQ+FISEVATIGRI+H+NVVRLIGFCVEGS
Sbjct  124   EGGYGDVYKGNLISGPFIAIKMLKIKSKTNGQDFISEVATIGRIYHSNVVRLIGFCVEGS  183

Query  376   KRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIK  555
             KRAL+YE+MP GSL+KYIF KE  ISL+++++++ISLGVARGI YLH+GCDM+ILHFDIK
Sbjct  184   KRALVYEYMPKGSLDKYIFNKEGVISLTNDQIYEISLGVARGISYLHQGCDMQILHFDIK  243

Query  556   PHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADV  735
             PHNILLDENF PKVSDFGLAKLYP+++S+V+LTAARGT+GYMAPEL Y+NIG ISHKADV
Sbjct  244   PHNILLDENFIPKVSDFGLAKLYPIDNSIVALTAARGTIGYMAPELFYQNIGRISHKADV  303

Query  736   YSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEE-KKVSKKM  912
             YSFGMLL+E+  R +NLN   E  SQ+Y P W+Y+QL      +M D   EE   V KKM
Sbjct  304   YSFGMLLIEIASRSRNLNSHAEHSSQLYIPFWIYDQLVKNTVTEMEDVIMEEINDVLKKM  363

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVE  1092
              IV LWCIQ+ P +RPSMKKV+  + E D+E +EM PKP L P E    EN   N+   E
Sbjct  364   FIVGLWCIQLKPIDRPSMKKVV-EMLEGDIENMEMPPKPLLYPHET-IQENLDSNSNETE  421

Query  1093  SPLLSDNPVRSSSFEVCEN  1149
                 SD P  S S E+  N
Sbjct  422   ----SDWPT-SYSEEIVTN  435



>ref|XP_010040879.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Eucalyptus 
grandis]
Length=490

 Score =   453 bits (1166),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 221/380 (58%), Positives = 295/380 (78%), Gaps = 4/380 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + +   +F  G   ++ +++Y+  RRH +    IE +L   NN +PIRYSY +IK++T N
Sbjct  101   VHFLAAKFIFGAPCVLILLLYRWMRRHQAIDPNIEEFLRAHNNFLPIRYSYSDIKKITKN  160

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FKHKLGEGGYG+V++G LRSG  VA+K++ KSK+ GQ+FISEVATIGRIHH NVV+L+GF
Sbjct  161   FKHKLGEGGYGSVYRGILRSGNEVAIKILNKSKSDGQDFISEVATIGRIHHINVVQLVGF  220

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C + SK+AL+Y+FMPNGSL+K+I  K+   SL ++KM++ISLG+ARGI+YLHRGCDM+IL
Sbjct  221   CFDYSKQALVYDFMPNGSLDKHISYKDGDNSLDYKKMYEISLGIARGIEYLHRGCDMQIL  280

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLD +F+PKVSDFGLAKLYP + S+VSLT ARGT+GYMAPEL Y++IGGIS
Sbjct  281   HFDIKPHNILLDRSFTPKVSDFGLAKLYPTDHSIVSLTTARGTLGYMAPELFYKDIGGIS  340

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KADVYSFGM+LMEM GRR+NLN   E  SQ+YFP WVY+QL    ++      EEE++ 
Sbjct  341   YKADVYSFGMMLMEMAGRRRNLNAHAEHSSQVYFPLWVYDQLGKENEVGTVGVLEEERET  400

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE-NSFPN  1077
             ++KMIIVALWCIQ++P+ERPSMK+V+  + E D++ L++ PKP L P E P D+ +    
Sbjct  401   TRKMIIVALWCIQLSPNERPSMKRVL-DMLEGDMDKLQLPPKPLLYPRETPIDDVDDEIE  459

Query  1078  AQNVESPLLSDNPVRSSSFE  1137
              + V S  LS  P+ SS+++
Sbjct  460   LETVSS--LSSTPIISSNYQ  477



>ref|XP_011001829.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Populus euphratica]
Length=681

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 230/349 (66%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTN  177
             + Y +  F  GL   ++ ++YK RR+HLS Y+ IE +L S  N+LMPIRY+Y EIK++TN
Sbjct  307   VIYHVLLFPCGLPCFLAFLIYKWRRQHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITN  366

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGG G+V+KG LRSG F  VK++ K K  GQ+F++EVATIGRIH+ NVV+LIG
Sbjct  367   GFKDKLGEGGSGSVYKGKLRSGRFAVVKILDKLKDNGQDFMNEVATIGRIHNVNVVQLIG  426

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             F VEGSKRAL+YEFMPNGSLEKYIF +E SI LS+EKM++ISLG+ARGI+YLH+GCDM+I
Sbjct  427   FTVEGSKRALIYEFMPNGSLEKYIFSREGSIPLSNEKMYEISLGIARGIEYLHQGCDMQI  486

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILL++ F PK+SDFGLAKLYP  +++VSL+AARGT+GYMAPEL Y+NIG +
Sbjct  487   LHFDIKPHNILLNDKFVPKISDFGLAKLYPANNNIVSLSAARGTIGYMAPELFYKNIGHV  546

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             S K DVYS+GMLLMEMVGRRKNLN      SQIYFPSWVY+Q+ +GKDI++  DA E E+
Sbjct  547   SDKTDVYSYGMLLMEMVGRRKNLNVSASHSSQIYFPSWVYDQVSEGKDIEVQEDAIEHEE  606

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSP  1041
             K  KKMIIVALWCIQ+ P +RPSM KV+  + + DVE L M PKPFL+P
Sbjct  607   KTKKKMIIVALWCIQLKPIDRPSMHKVV-EMLKSDVESLRMPPKPFLTP  654



>ref|XP_007161453.1| hypothetical protein PHAVU_001G070200g [Phaseolus vulgaris]
 gb|ESW33447.1| hypothetical protein PHAVU_001G070200g [Phaseolus vulgaris]
Length=428

 Score =   451 bits (1159),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 214/344 (62%), Positives = 278/344 (81%), Gaps = 2/344 (1%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             R+ +G +  I+++ YK RRRH S Y+ IE YL   N+LMPIRY+Y EIK+M   F  KLG
Sbjct  53    RYVVGTILFIALLTYKWRRRHSSQYENIESYLE-QNSLMPIRYTYKEIKKMATGFNEKLG  111

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGGYG+VFKG L SG  VA+K++ KSK  GQ+FI+EVATIG IHH NVV+LIG+C EGSK
Sbjct  112   EGGYGSVFKGKLCSGSCVAIKILRKSKGNGQDFINEVATIGTIHHQNVVQLIGYCAEGSK  171

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
              AL+YEFMPNGSL+K+IF +EE++ L+++ +++I++G+A GI YLH GC+M+ILHFDIKP
Sbjct  172   HALVYEFMPNGSLDKFIFSREENLHLTYDTIYNIAIGIAHGISYLHHGCEMQILHFDIKP  231

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDE F+PKVSDFGLAKLYP++ S+V++TAARGT+GYMAPEL Y NIG IS K+DVY
Sbjct  232   HNILLDEKFTPKVSDFGLAKLYPIDKSVVTMTAARGTIGYMAPELFYTNIGRISDKSDVY  291

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLME+  +RKNLNP  E+ SQ+YFP W+Y+QL   KDI+M D  EEEKK++KKM+I
Sbjct  292   SFGMLLMEIASKRKNLNPNAERSSQLYFPFWIYDQLDKEKDIEMEDVIEEEKKIAKKMMI  351

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEV  1050
             ++LWCIQ+ P++RPS+ KV+  + E D+E L++ PKP L P E 
Sbjct  352   ISLWCIQLKPNDRPSINKVV-EMLEGDIENLKIPPKPSLYPHET  394



>ref|XP_002265870.3| PREDICTED: lectin-domain containing receptor kinase VI.3-like 
[Vitis vinifera]
Length=736

 Score =   461 bits (1187),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 226/352 (64%), Positives = 290/352 (82%), Gaps = 2/352 (1%)
 Frame = +1

Query  10    ALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKH  189
              +GR  LG+L L + ++YK  RRHLS  D+IE +L    NL PI+YSY  IK+MT+NF +
Sbjct  362   VIGRTMLGMLCLFAYLIYKFHRRHLSLDDSIEEFLRSHKNLQPIKYSYSNIKKMTHNFAN  421

Query  190   KLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVE  369
             KLG+GG+G+V+KG LRSG  VAVK++  SKA GQ+FI+EVATIGRIHH NVV+L+GFCV+
Sbjct  422   KLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVKLVGFCVQ  481

Query  370   GSKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHF  546
             GSK AL+Y+FMPNGSL+K+IF KEE+ + LS E+++ ++LGV RGI+YLH+GCDM+ILHF
Sbjct  482   GSKWALIYDFMPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHF  541

Query  547   DIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHK  726
             DIKPHNILLDE+F+PKVSDFGLAKLY  ++S+VSLT ARGT+GY+APEL Y+NIGG+S+K
Sbjct  542   DIKPHNILLDEDFTPKVSDFGLAKLYSTDESMVSLTTARGTLGYIAPELFYKNIGGVSYK  601

Query  727   ADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSK  906
             ADVYSFGMLLMEMVGRRKN+N      SQIYFPSW+Y++   G +ID+GDATE+EKK+ +
Sbjct  602   ADVYSFGMLLMEMVGRRKNVNANAAHSSQIYFPSWIYDRYDQGDNIDLGDATEDEKKLVR  661

Query  907   KMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             KM+IVALWCIQM P +RPSM K +  + E +VELLEM PKP L  +E+  ++
Sbjct  662   KMVIVALWCIQMKPIDRPSMSKAL-EMLEGEVELLEMPPKPTLYSEEMLVED  712



>ref|XP_010035321.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Eucalyptus 
grandis]
Length=424

 Score =   450 bits (1158),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 216/351 (62%), Positives = 279/351 (79%), Gaps = 1/351 (0%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             I + + +F +G+ F+   ++YK RRRHL+    IE +L   NN +PIRYSY  IK++T N
Sbjct  41    IPFCVVKFVIGMPFVAIFLIYKYRRRHLAMDKNIEEFLQTHNNFLPIRYSYSNIKKITRN  100

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FKHKLGEGGYG V+KGTLRSG  VA+K++ +SKA GQ+FISEVATIGRIHH N+V+LIGF
Sbjct  101   FKHKLGEGGYGYVYKGTLRSGNEVAIKILKQSKAHGQDFISEVATIGRIHHVNIVQLIGF  160

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGSK+AL+YEF+ NGSL+K IF KE    L ++K+++I+LGVARGI+YLHRGCD +IL
Sbjct  161   CFEGSKQALVYEFLSNGSLDKRIFTKECDKFLDYKKIYEIALGVARGIEYLHRGCDRQIL  220

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLD+NF+PKVSDFGLAKLYP++ S+VS+T+ARGT+GYMAPEL Y+N+GG+S
Sbjct  221   HFDIKPHNILLDKNFTPKVSDFGLAKLYPIDHSIVSMTSARGTLGYMAPELFYKNLGGVS  280

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KADVYSFGMLLMEM  RRKNLN   E  SQIYFP WVY+ + +G+ +++ +   EE++V
Sbjct  281   YKADVYSFGMLLMEMASRRKNLNANAEHSSQIYFPLWVYDHINEGESVEIDEIVGEEREV  340

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
              KKMIIVALWCIQ+ P  RP M KV+  + E D+  +++ PKP + P   P
Sbjct  341   MKKMIIVALWCIQLIPDHRPPMNKVL-EMLERDIGNIQIPPKPLIYPPNEP  390



>ref|XP_010646612.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=646

 Score =   458 bits (1178),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 210/323 (65%), Positives = 271/323 (84%), Gaps = 1/323 (0%)
 Frame = +1

Query  13   LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
            +GR  +G+L L + ++ K RRRHLS  D IE +L    NL PI+Y+Y +IK+MT NFKHK
Sbjct  277  IGRAVIGILCLFAYLINKFRRRHLSLDDDIEEFLHNYQNLRPIKYTYSDIKKMTYNFKHK  336

Query  193  LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
            LG+GG+G+V+KG LRSG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVVRL+GFC++ 
Sbjct  337  LGQGGFGSVYKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQR  396

Query  373  SKRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
            SK AL+Y++MPNGSL+K++F  +  +I LS E+++ I+LGV RGI+YLH+GCDM+ILHFD
Sbjct  397  SKWALIYDYMPNGSLDKFVFLDQGNNIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFD  456

Query  550  IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
            IKPHNILLDE+F+PKVSDFGLAKLY  ++S+VS+TAARGT+GY+APEL Y+NIGG+S KA
Sbjct  457  IKPHNILLDEDFTPKVSDFGLAKLYSTDESIVSVTAARGTLGYIAPELFYKNIGGVSFKA  516

Query  730  DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
            DVYSFGMLL+EMVG+RKN+N F E  SQIYFPSW+Y++   G+D++MGDATE+EKK  +K
Sbjct  517  DVYSFGMLLLEMVGKRKNVNAFAEHSSQIYFPSWIYDRYDQGEDMEMGDATEDEKKYVRK  576

Query  910  MIIVALWCIQMNPSERPSMKKVI  978
            M+IVALWC+QM P +RPSM K +
Sbjct  577  MVIVALWCVQMKPMDRPSMSKTL  599



>gb|KEH40381.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=412

 Score =   449 bits (1156),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 231/367 (63%), Positives = 281/367 (77%), Gaps = 5/367 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + Y   R  LG++   ++++Y  RRRH S Y+ IE +L   N LMPIRYSY EIK+MT  
Sbjct  32    LPYIAVRIMLGIILFSALLIYTYRRRHASIYENIEDFLQS-NTLMPIRYSYKEIKQMTKG  90

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMG-KSKATGQEFISEVATIGRIHHTNVVRLIG  357
              K KLGEGGYG V++G L SGPFVA+KM+  KSK  GQ+FISEVATIGRI+H+NVVRL+G
Sbjct  91    LKVKLGEGGYGDVYRGNLISGPFVAIKMLKIKSKTNGQDFISEVATIGRIYHSNVVRLVG  150

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             FCVEGSKRAL+YE+MPNGSL+KYIF KE  ISLS++++++ISLGVA GI YLH+GCDM+I
Sbjct  151   FCVEGSKRALVYEYMPNGSLDKYIFNKEGVISLSNDQIYEISLGVALGISYLHQGCDMQI  210

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILLDENF PKVSDFGLAKLYP++ S+ +LTAARGT+GYMAPEL Y+NIG I
Sbjct  211   LHFDIKPHNILLDENFIPKVSDFGLAKLYPIDKSIATLTAARGTIGYMAPELFYQNIGRI  270

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEE-K  894
             SHKADVYSFGMLL+E+  RR+NLN   E  SQ+YFP W+Y+QL      +M D   EE  
Sbjct  271   SHKADVYSFGMLLIEIASRRRNLNSHAEHSSQLYFPFWIYDQLVKSTVREMEDVIMEEIN  330

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFP  1074
              V KK+ IVALWCIQ+ P +RPSM KV+  + E D+E +EM PKP L P E   D N   
Sbjct  331   DVLKKIFIVALWCIQLKPVDRPSMNKVV-EMLEGDIENIEMPPKPLLYPHETNQD-NLDS  388

Query  1075  NAQNVES  1095
             N+   ES
Sbjct  389   NSNETES  395



>emb|CBI23151.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   455 bits (1170),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 211/322 (66%), Positives = 271/322 (84%), Gaps = 2/322 (1%)
 Frame = +1

Query  16   GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
            GR  +G+L L + ++YK +RRHLS  DT+E +L   NNL PIRYSY EIK+MTNNF+ KL
Sbjct  181  GRAVIGMLCLCAFLIYKFQRRHLSMDDTLEEFLQSHNNLQPIRYSYSEIKKMTNNFQDKL  240

Query  196  GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
            G+GG+G+V+KG LRSG  VAVKM+  SK+ GQ+FI+EVATIGRIHH NVVRL+GFC E S
Sbjct  241  GQGGFGSVYKGKLRSGQIVAVKMLVVSKSNGQDFINEVATIGRIHHVNVVRLVGFCTEKS  300

Query  376  KRALLYEFMPNGSLEKYIF-PKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
            K AL+Y+FM NGSL+KY+F  +E SI LS E++++I+LGVA GI+YLHRGC+M+ILHFDI
Sbjct  301  KYALVYDFMANGSLDKYVFLERENSIPLSWERLYNIALGVAHGIEYLHRGCEMQILHFDI  360

Query  553  KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
            KPHNILLDENF+PKVSDFGLAKLY  + + V+LTAARGT+GY+APEL Y+NIG +S+KAD
Sbjct  361  KPHNILLDENFTPKVSDFGLAKLYSSDQNAVTLTAARGTLGYIAPELFYKNIGDVSYKAD  420

Query  733  VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
            VYSFGMLLMEM+G+RK +N   E+ S+I+FPSW+Y+++  G+D++MG+ATEEEKK  +K+
Sbjct  421  VYSFGMLLMEMMGKRKYMNARAEK-SEIFFPSWIYDRIDRGEDMEMGEATEEEKKYIRKI  479

Query  913  IIVALWCIQMNPSERPSMKKVI  978
            IIVALWC+QM P+ RPSM K +
Sbjct  480  IIVALWCVQMKPTNRPSMSKAL  501



>ref|XP_010942308.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Elaeis 
guineensis]
Length=703

 Score =   460 bits (1183),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 225/342 (66%), Positives = 283/342 (83%), Gaps = 2/342 (1%)
 Frame = +1

Query  16    GRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKL  195
             GR  +G+  L++ +VYKLRRRH S  + IE +L+   N MPIRYSY  IK+MTN FK KL
Sbjct  315   GRTIIGISCLMAYLVYKLRRRHRSMDNRIEDFLNDYRNSMPIRYSYRHIKKMTNQFKEKL  374

Query  196   GEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGS  375
             G+GGYG+VFKG L +G  VA+K++ K+K  GQEFI+EV+TIGRIHHTNVV+LIGFC EGS
Sbjct  375   GQGGYGSVFKGKLTTGRLVAIKILEKAKGNGQEFINEVSTIGRIHHTNVVQLIGFCFEGS  434

Query  376   KRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHFDI  552
              RAL+YEFM NGSL+KYIF +EE    LS EKM DI+LG+ARGI+YLHRGCDM+ILHFDI
Sbjct  435   NRALIYEFMSNGSLDKYIFSQEEEAEILSWEKMQDIALGIARGIEYLHRGCDMQILHFDI  494

Query  553   KPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKAD  732
             KPHNILLD+ F+PKVSDFGLAKL+P+E+S V +TA RGT+GYMAPEL YR +G IS+K+D
Sbjct  495   KPHNILLDDKFNPKVSDFGLAKLHPIEESKVLVTAVRGTIGYMAPELFYRKVGEISYKSD  554

Query  733   VYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKM  912
             VYSFGMLLMEM GRRKNLNP   + SQIYFPSW+Y+QL  G+D++M DAT++EK+++KK+
Sbjct  555   VYSFGMLLMEMAGRRKNLNPHAPRSSQIYFPSWIYDQLYQGRDLEMEDATDDEKEIAKKL  614

Query  913   IIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLS  1038
             +++AL CIQMNP+ERPSM +V+EMLE++  ++     KPFLS
Sbjct  615   LMIALRCIQMNPAERPSMSQVVEMLEKKIEDMQMPT-KPFLS  655



>ref|XP_011001830.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X3 [Populus euphratica]
Length=680

 Score =   459 bits (1181),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 230/349 (66%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTN  177
             + Y +  F  GL   ++ ++YK RR+HLS Y+ IE +L S  N+LMPIRY+Y EIK++TN
Sbjct  306   VIYHVLLFPCGLPCFLAFLIYKWRRQHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITN  365

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGG G+V+KG LRSG F  VK++ K K  GQ+F++EVATIGRIH+ NVV+LIG
Sbjct  366   GFKDKLGEGGSGSVYKGKLRSGRFAVVKILDKLKDNGQDFMNEVATIGRIHNVNVVQLIG  425

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             F VEGSKRAL+YEFMPNGSLEKYIF +E SI LS+EKM++ISLG+ARGI+YLH+GCDM+I
Sbjct  426   FTVEGSKRALIYEFMPNGSLEKYIFSREGSIPLSNEKMYEISLGIARGIEYLHQGCDMQI  485

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILL++ F PK+SDFGLAKLYP  +++VSL+AARGT+GYMAPEL Y+NIG +
Sbjct  486   LHFDIKPHNILLNDKFVPKISDFGLAKLYPANNNIVSLSAARGTIGYMAPELFYKNIGHV  545

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             S K DVYS+GMLLMEMVGRRKNLN      SQIYFPSWVY+Q+ +GKDI++  DA E E+
Sbjct  546   SDKTDVYSYGMLLMEMVGRRKNLNVSASHSSQIYFPSWVYDQVSEGKDIEVQEDAIEHEE  605

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSP  1041
             K  KKMIIVALWCIQ+ P +RPSM KV+  + + DVE L M PKPFL+P
Sbjct  606   KTKKKMIIVALWCIQLKPIDRPSMHKVV-EMLKSDVESLRMPPKPFLTP  653



>gb|KCW58971.1| hypothetical protein EUGRSUZ_H01601, partial [Eucalyptus grandis]
Length=355

 Score =   447 bits (1150),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 217/348 (62%), Positives = 279/348 (80%), Gaps = 1/348 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F LG   ++ +++ K  RRH +    IE +L   NN  PIRYSY +IKR+T NFK KLG
Sbjct  1     KFILGAPCVLILLILKWTRRHQATDANIEEFLRAHNNFFPIRYSYSDIKRITQNFKCKLG  60

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGGYG+V++G LRSG  VAVK++ KSK+ GQ+FISEVATIGRIHH NVV+L+GFC E SK
Sbjct  61    EGGYGSVYRGILRSGTEVAVKILNKSKSNGQDFISEVATIGRIHHVNVVQLVGFCFEYSK  120

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             +AL+Y+FMPNGSL+K+I  K+    L ++KM+ ISLG+ARGI+YLHRGCDM+ILHFDIKP
Sbjct  121   QALVYDFMPNGSLDKHISYKDGDDPLDYKKMYGISLGIARGIEYLHRGCDMQILHFDIKP  180

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLD +F+PKVSDFGLA+LYP++ ++VSLTAARGT+GYMAPEL Y+NIGGIS+KADVY
Sbjct  181   HNILLDRSFTPKVSDFGLARLYPIDCNIVSLTAARGTLGYMAPELFYKNIGGISYKADVY  240

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLME+ GRR+N+N   E  SQIYFP WVY+QL   K+++  D  EEE++ + KMII
Sbjct  241   SFGMLLMEIAGRRRNINAHAECSSQIYFPFWVYDQLSKEKELERVDVVEEERETTTKMII  300

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             VALWCIQ++P++RPSM+KVI  + E D++ L++ PKP L P E   D+
Sbjct  301   VALWCIQLSPNDRPSMRKVI-DMLEGDMDKLQLPPKPLLYPTEASVDD  347



>gb|KEH40357.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=352

 Score =   447 bits (1149),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 219/320 (68%), Positives = 270/320 (84%), Gaps = 2/320 (1%)
 Frame = +1

Query  91    YDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTLRSGPFVAVKMMG  270
             Y+ IE +L G + L+PIRYSY EIK+MT NF+ KLGEGG+G VFKG LRSGPFVA+KM+ 
Sbjct  2     YEDIEVFLQG-STLIPIRYSYKEIKKMTRNFRDKLGEGGFGAVFKGKLRSGPFVAIKMLV  60

Query  271   KSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGSLEKYIFPKEESI  450
             KSK  G +FISEVATIGRIHHTNV RLIGFCVEGSKRAL+YEFM NGSL+KYI  +E++I
Sbjct  61    KSKGNGHDFISEVATIGRIHHTNVARLIGFCVEGSKRALVYEFMSNGSLDKYISSREDTI  120

Query  451   SLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPKVSDFGLAKLYPV  630
             SLS++KM++ISLGVA GI YLH+GC+M+ILHFDIKPHNILLDENF+PKVSDFGLA+LYP 
Sbjct  121   SLSYQKMYEISLGVAHGIAYLHQGCEMQILHFDIKPHNILLDENFNPKVSDFGLAQLYPN  180

Query  631   EDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGRRKNLNPFVEQLS  810
             E S+V+LTAARGT+GYMAPEL Y+NIGG+S+KADVYSFGMLL+EM  +++NLNP  ++ S
Sbjct  181   EISIVTLTAARGTIGYMAPELFYQNIGGVSYKADVYSFGMLLIEMASKKRNLNPHADRSS  240

Query  811   QIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVALWCIQMNPSERPSMKKVIemle  990
             QI+FP W+Y+QL + K+I+M + T EE    KKM I+ALWCIQ+ P +RPSM KVI  + 
Sbjct  241   QIFFPIWIYDQLIEEKEIEMDEITYEENNNVKKMFIIALWCIQLKPCDRPSMNKVI-EML  299

Query  991   eedvellemAPKPFLSPDEV  1050
             E D+E +EM PKP L P+E+
Sbjct  300   EGDIENVEMPPKPLLYPNEM  319



>ref|XP_010662999.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=664

 Score =   458 bits (1178),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 209/323 (65%), Positives = 270/323 (84%), Gaps = 1/323 (0%)
 Frame = +1

Query  13   LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
            +GR  +G+L L + ++YK RRRHLS  D IE +L    NL PI+Y+Y +IK+MT NFKHK
Sbjct  295  IGRAVIGILCLFAYLIYKFRRRHLSLDDDIEEFLHNYQNLRPIKYTYSDIKKMTYNFKHK  354

Query  193  LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
            LG+GG+G+V+KG LRSG  VAVKM+  SKA GQ+FI+EVATIGRIHH NVVRL+GFC++ 
Sbjct  355  LGQGGFGSVYKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQR  414

Query  373  SKRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
            SK AL+Y++MPNGSL+K++F  +  +I LS E+++ I+LGV RGI+YLH+GCDM+ILHFD
Sbjct  415  SKWALIYDYMPNGSLDKFVFLDQGNNIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFD  474

Query  550  IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
            IKPHNILLDE+F+PKVSDFGLAKLY  ++S+VS+TAARGT+GY+APEL Y+NIGG+S KA
Sbjct  475  IKPHNILLDEDFTPKVSDFGLAKLYSTDESIVSVTAARGTLGYIAPELFYKNIGGVSFKA  534

Query  730  DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
            DVYSFGMLL+ MVG+RKN+N F    SQIYFPSW+Y++   G+D++MGDATE+EKK  +K
Sbjct  535  DVYSFGMLLLAMVGKRKNVNAFARHSSQIYFPSWIYDRYDQGEDMEMGDATEDEKKYVRK  594

Query  910  MIIVALWCIQMNPSERPSMKKVI  978
            M+IVALWC+QM P +RPSM K +
Sbjct  595  MVIVALWCVQMKPMDRPSMSKTL  617



>gb|KEH40313.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=760

 Score =   461 bits (1186),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 298/380 (78%), Gaps = 10/380 (3%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
             SY L RF LGL+ L   +++  R RH S Y+ IE +L G N+LMPIRYSY EIK+MT +F
Sbjct  378   SYILIRFMLGLIALFGKLIHTYRSRHTSMYENIEDFLQG-NSLMPIRYSYKEIKQMTRSF  436

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATG--QEFISEVATIGRIHHTNVVRLIG  357
             K KLGEGGYG V+KG LRSGP VA+KM+GK K  G  Q+FISEVATIG+IHHTNVVRL+G
Sbjct  437   KEKLGEGGYGKVYKGKLRSGPLVAIKMLGKLKGNGNGQDFISEVATIGKIHHTNVVRLVG  496

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             FCVE SKRAL+Y+FMPNGSL++YI  +E+ ISL++++M++ISLGVARGI YLH+GCDM+I
Sbjct  497   FCVEKSKRALVYDFMPNGSLDRYISSREDHISLTYKQMYEISLGVARGIAYLHQGCDMQI  556

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILLD++F  KVSDFGLAKLYPV++S+V+LTAARGT+GYMAPEL Y+NIG +
Sbjct  557   LHFDIKPHNILLDQDFIAKVSDFGLAKLYPVDNSIVTLTAARGTIGYMAPELFYKNIGKV  616

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDM-GDATEEEK  894
             S+KADVYSFGMLLME+  RR+NLN   +  SQI+FP W+Y +L + ++ID+ G+AT+EEK
Sbjct  617   SYKADVYSFGMLLMEIANRRRNLNSNADDSSQIFFPYWIYNELMEEREIDISGEATDEEK  676

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFP  1074
             K  KKM I+ALWCIQ+NP +RPSM +VI  + E D+E +E+ PKP   P E+  D     
Sbjct  677   KNVKKMFIIALWCIQLNPIDRPSMDRVI-EMLEGDIEDIEIPPKPSPYPTEIIQD-----  730

Query  1075  NAQNVESPLLSDNPVRSSSF  1134
             N  +    L  D+   S SF
Sbjct  731   NGVSSTESLWDDDVTGSISF  750



>gb|KCW58952.1| hypothetical protein EUGRSUZ_H01578 [Eucalyptus grandis]
Length=457

 Score =   450 bits (1158),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 218/353 (62%), Positives = 282/353 (80%), Gaps = 1/353 (0%)
 Frame = +1

Query  4     SYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNF  183
              Y   +F LG   ++ ++++K  RRH +    IE +L   NN +PIRYSY +IKR+T NF
Sbjct  69    QYLAAKFILGAPCVLILLIFKWMRRHQATDANIEEFLQAHNNFLPIRYSYSDIKRITKNF  128

Query  184   KHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFC  363
             K KLGEGGYG+V+KG LRSG  VAVK++ KSK+ GQ+FISEVATIGRIHH NVV+L+GFC
Sbjct  129   KCKLGEGGYGSVYKGILRSGNEVAVKVLTKSKSDGQDFISEVATIGRIHHVNVVQLVGFC  188

Query  364   VEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILH  543
              + SK+AL+Y+FMPNGSL+K+I  K+    L ++KM++ISLG+ARGI+YLHRGCDM+ILH
Sbjct  189   FDYSKQALVYDFMPNGSLDKHISYKDGDDPLDYKKMYEISLGIARGIEYLHRGCDMQILH  248

Query  544   FDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISH  723
             FDIKPHNILLD +F+PKVSDFGLA+LYP + S+VSLTAARGT+GYMAPEL Y++IGGIS+
Sbjct  249   FDIKPHNILLDRSFTPKVSDFGLARLYPTDRSIVSLTAARGTLGYMAPELFYKDIGGISY  308

Query  724   KADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVS  903
             KADVYSFGMLLMEM GRR+N+N   E+ SQIYFP WVY+QL   K+++  D  EEE++ +
Sbjct  309   KADVYSFGMLLMEMAGRRRNINAQAERSSQIYFPLWVYDQLAKEKELERVDVIEEERETT  368

Query  904   KKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             +KMIIVALWCIQ++P+ RPSM+KV+  + E D+  L++ PKP L P E   D+
Sbjct  369   RKMIIVALWCIQLSPNNRPSMRKVL-DMLEGDMNKLQLPPKPLLYPREALVDD  420



>ref|XP_010662822.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At5g24080 [Vitis vinifera]
Length=715

 Score =   459 bits (1181),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 225/352 (64%), Positives = 295/352 (84%), Gaps = 2/352 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             +GR++LG L ++S ++YK +RRHLS  D+IE +L    NL PI+YSY +IK+MT+NF++K
Sbjct  342   VGRYTLGGLCMLSYLIYKFQRRHLSWDDSIEEFLRIHKNLQPIKYSYSDIKKMTHNFRNK  401

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG+GG+G+V+KG LRSG  +AVK++  SK+ GQ+FI+EVATIGRIHH NVV+L+GFCV+G
Sbjct  402   LGQGGFGSVYKGKLRSGRIIAVKVLIMSKSNGQDFINEVATIGRIHHVNVVKLVGFCVQG  461

Query  373   SKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
              K AL+YEFM +GSL+K+IF K+E+ + LS E ++ I+LGV RGI+YLHRGCDM+ILHFD
Sbjct  462   PKWALIYEFMHHGSLDKFIFLKQENNTPLSWEMLYKIALGVGRGIEYLHRGCDMQILHFD  521

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
             IKPHNILLDENF+PKVSDFGLAKL  + +S+VSLTAARGT+GY+APEL Y+NIGG+S+KA
Sbjct  522   IKPHNILLDENFTPKVSDFGLAKLSSINESIVSLTAARGTLGYIAPELFYKNIGGVSYKA  581

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLLMEMVG+RKN+N   E  SQIYFPSW+Y++   G+D++MGDATE+EKK+ KK
Sbjct  582   DVYSFGMLLMEMVGKRKNVNALAEHSSQIYFPSWIYDRYGQGEDMEMGDATEDEKKLVKK  641

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             ++IVALWCIQM P +RPSM K +  + E  VELLEM PKP L  +E+ T+++
Sbjct  642   LVIVALWCIQMKPIDRPSMSKTL-EMLEGKVELLEMPPKPTLYYEEISTEDH  692



>ref|XP_007141195.1| hypothetical protein PHAVU_008G175100g [Phaseolus vulgaris]
 gb|ESW13189.1| hypothetical protein PHAVU_008G175100g [Phaseolus vulgaris]
Length=679

 Score =   458 bits (1178),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 218/323 (67%), Positives = 266/323 (82%), Gaps = 4/323 (1%)
 Frame = +1

Query  19   RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
            RF  G+  LI ++VYK R+RHLS Y+ IE+YL   NNLMPIRYSY EIK+M   FK KLG
Sbjct  312  RFLFGVTLLIVLMVYKWRKRHLSIYENIENYLEH-NNLMPIRYSYKEIKKMMKGFKEKLG  370

Query  199  EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
            EGGYG+VFKG L SG  VA+KM+ K+K  G +FISEVATIGRIHH NVV+LIGFCVEGS+
Sbjct  371  EGGYGSVFKGKLSSGSCVAIKMLSKTKGRGHDFISEVATIGRIHHQNVVQLIGFCVEGSR  430

Query  379  RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
             AL+YEFM NGSL+K IF K++SI   ++K+++I++GVARGI YLH GC+M+ILHFDIKP
Sbjct  431  HALVYEFMSNGSLDKIIFSKDKSIEFGYDKIYNIAIGVARGIAYLHHGCEMQILHFDIKP  490

Query  559  HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
            HNILLD+ F PKVSDFGLAKLYP+++S+V++T   GT+GYMAPEL Y+NIG IS+K+DVY
Sbjct  491  HNILLDDKFIPKVSDFGLAKLYPIDNSIVTMTTVGGTIGYMAPELFYKNIGRISYKSDVY  550

Query  739  SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDI---DMGDATEEEKKVSKK  909
            SFGMLLMEM  RRKNLN  VE  SQIYFPSW+Y+ +++ KDI   +MG+ TEEEKK+ KK
Sbjct  551  SFGMLLMEMASRRKNLNSHVEHSSQIYFPSWIYDYIREEKDIEMEEMGNFTEEEKKIVKK  610

Query  910  MIIVALWCIQMNPSERPSMKKVI  978
            MIIVA WCIQMNP +RPSM KV+
Sbjct  611  MIIVAFWCIQMNPDDRPSMNKVV  633



>ref|XP_008346578.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Malus domestica]
Length=349

 Score =   446 bits (1147),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 274/345 (79%), Gaps = 1/345 (0%)
 Frame = +1

Query  19    RFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLG  198
             +F  G  F+ + ++Y  +RRHLS Y++IE +L G   L+PIRYSY  IK+M+N FK KLG
Sbjct  6     KFLFGAPFVTAFLIYTWKRRHLSMYNSIEEFLHGEKTLVPIRYSYSNIKKMSNKFKEKLG  65

Query  199   EGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSK  378
             EGGYG+VFK  LRSG F A+KM+ K K  GQ+FISEV TIGRIHH NVV+L+G+CVEG+K
Sbjct  66    EGGYGSVFKARLRSGRFGAIKMLDKPKGNGQDFISEVNTIGRIHHVNVVQLVGYCVEGTK  125

Query  379   RALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKP  558
              AL+Y+FM NGSL+KYI+ KE SI LS +  ++ISLGVARGI YLH  CDM+ILHFDIKP
Sbjct  126   HALVYDFMLNGSLDKYIYCKEGSIPLSCKTTYEISLGVARGIKYLHEDCDMQILHFDIKP  185

Query  559   HNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVY  738
             HNILLDENF PK+SDFGLAKL PV++S+VSLTAARGTMGYMAPEL Y+NIGG+S KADVY
Sbjct  186   HNILLDENFIPKISDFGLAKLXPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADVY  245

Query  739   SFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMII  918
             SFGMLLMEM  RRKNLN   E  SQ+YFPSWVY Q  +GKD ++G+  EEEK + +KMII
Sbjct  246   SFGMLLMEMASRRKNLNALAEHSSQLYFPSWVYNQYNEGKDFEVGEVVEEEKPLIRKMII  305

Query  919   VALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVP  1053
              ALWCIQ+ PS+RPSMK+V+  + E DVELL M P+P L P   P
Sbjct  306   TALWCIQLKPSDRPSMKEVL-QMLEGDVELLRMPPEPLLYPKRCP  349



>ref|XP_010035323.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Eucalyptus 
grandis]
Length=399

 Score =   448 bits (1152),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 212/347 (61%), Positives = 276/347 (80%), Gaps = 1/347 (0%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + + + +F +G+ F+   ++YK RRRH++    IE +L   NN +PIRYSY  IK++T N
Sbjct  16    VVFCVVKFIIGMPFVAIFLIYKYRRRHIAMDKNIEEFLQAHNNFLPIRYSYSNIKKITRN  75

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FKHKLGEGGYG V+KGTLRSG  VA+K++ +SKA  Q+FISEVAT+GRIHH N+V+LIGF
Sbjct  76    FKHKLGEGGYGHVYKGTLRSGNEVAIKILKQSKAHAQDFISEVATVGRIHHVNIVQLIGF  135

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C EGSK+AL+Y+FM NGSL+K+IF KE    L ++K+++I+LGV RGI+YLHRGCD +IL
Sbjct  136   CFEGSKQALVYDFMSNGSLDKHIFTKEGDKFLDYKKIYEIALGVVRGIEYLHRGCDKQIL  195

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLD+NF PK+SDFGLAKLYP++ S+VS+TAARGT+GYMAPEL Y+ +GG+S
Sbjct  196   HFDIKPHNILLDKNFLPKISDFGLAKLYPIDHSIVSMTAARGTLGYMAPELFYKTLGGVS  255

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KADVYSFGMLLMEM GRRKNLN   E  SQIYFP WVY+ + +G+ ++M +   EE++V
Sbjct  256   YKADVYSFGMLLMEMAGRRKNLNANAEHSSQIYFPLWVYDHINEGESVEMDEIVGEEREV  315

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSP  1041
              KKMIIVALWCIQ+ P  RP M KV+  + E D+  ++M PKP + P
Sbjct  316   MKKMIIVALWCIQLVPDHRPPMNKVL-KMLERDIGNIQMPPKPLIYP  361



>gb|KDP42830.1| hypothetical protein JCGZ_23772 [Jatropha curcas]
Length=662

 Score =   457 bits (1176),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 220/345 (64%), Positives = 278/345 (81%), Gaps = 2/345 (1%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
              G  F+I +++YK RRRHLS Y+T+E +L   NNLMP+RYSY +IKRMT  FK+KLG+GG
Sbjct  295   CGTPFVIGLLIYKWRRRHLSGYNTVEEFLQSHNNLMPVRYSYSDIKRMTEGFKNKLGQGG  354

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             +G+V+KG LRSG   A+K++  SK  GQ+FISEVAT+GRIHH NVV+LIGFCV+GSK AL
Sbjct  355   FGSVYKGKLRSGRIAAIKILNNSKTNGQDFISEVATLGRIHHANVVQLIGFCVDGSKNAL  414

Query  388   LYEFMPNGSLEKYIFPK-EESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHN  564
             +Y+FMPNGSL  Y+F +   SISL+ EK+ +IS+G+ARGI+YLHRGCDM+ILHFDIKPHN
Sbjct  415   VYDFMPNGSLNNYVFSQGRSSISLTWEKLHEISIGIARGIEYLHRGCDMQILHFDIKPHN  474

Query  565   ILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSF  744
             ILLDENF PK+SDFGLAKLY    S+ SL+AARGT+GYMAPEL YRNIG +S+KADVYSF
Sbjct  475   ILLDENFIPKISDFGLAKLYATNGSIKSLSAARGTIGYMAPELFYRNIGHVSYKADVYSF  534

Query  745   GMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVA  924
             GMLL+E+ G+RKNLN   E  S  YFP WVY+++ + KD+ +G ATEEE K++KKM++V 
Sbjct  535   GMLLLEIAGKRKNLNVIDENSSGSYFPFWVYDEVSNEKDVGIGYATEEENKMAKKMVVVG  594

Query  925   LWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTD  1059
             LWCIQMNPS RPSM KVI  + E D+E L++ P+  +S DE P +
Sbjct  595   LWCIQMNPSNRPSMNKVI-QMLEGDLESLQLPPRSGMSADESPEN  638



>emb|CAN65252.1| hypothetical protein VITISV_011046 [Vitis vinifera]
Length=737

 Score =   459 bits (1182),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 225/352 (64%), Positives = 295/352 (84%), Gaps = 2/352 (1%)
 Frame = +1

Query  13    LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
             +GR++LG L ++S ++YK +RRHLS  D+IE +L    NL PI+YSY +IK+MT+NF++K
Sbjct  334   VGRYTLGGLCMLSYLIYKFQRRHLSWDDSIEEFLRIHKNLQPIKYSYSDIKKMTHNFRNK  393

Query  193   LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             LG+GG+G+V+KG LRSG  +AVK++  SK+ GQ+FI+EVATIGRIHH NVV+L+GFCV+G
Sbjct  394   LGQGGFGSVYKGKLRSGRIIAVKVLIMSKSNGQDFINEVATIGRIHHVNVVKLVGFCVQG  453

Query  373   SKRALLYEFMPNGSLEKYIFPKEESIS-LSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
              K AL+YEFM +GSL+K+IF K+E+ + LS E ++ I+LGV RGI+YLHRGCDM+ILHFD
Sbjct  454   PKWALIYEFMHHGSLDKFIFLKQENNTPLSWEMLYKIALGVGRGIEYLHRGCDMQILHFD  513

Query  550   IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
             IKPHNILLDENF+PKVSDFGLAKL  + +S+VSLTAARGT+GY+APEL Y+NIGG+S+KA
Sbjct  514   IKPHNILLDENFTPKVSDFGLAKLSSINESIVSLTAARGTLGYIAPELFYKNIGGVSYKA  573

Query  730   DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
             DVYSFGMLLMEMVG+RKN+N   E  SQIYFPSW+Y++   G+D++MGDATE+EKK+ KK
Sbjct  574   DVYSFGMLLMEMVGKRKNVNALAEHSSQIYFPSWIYDRYGQGEDMEMGDATEDEKKLVKK  633

Query  910   MIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDEN  1065
             ++IVALWCIQM P +RPSM K +  + E  VELLEM PKP L  +E+ T+++
Sbjct  634   LVIVALWCIQMKPIDRPSMSKTL-EMLEGKVELLEMPPKPTLYYEEISTEDH  684



>ref|XP_011001828.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X1 [Populus euphratica]
Length=691

 Score =   458 bits (1178),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 230/349 (66%), Positives = 284/349 (81%), Gaps = 3/349 (1%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYL-SGPNNLMPIRYSYFEIKRMTN  177
             + Y +  F  GL   ++ ++YK RR+HLS Y+ IE +L S  N+LMPIRY+Y EIK++TN
Sbjct  317   VIYHVLLFPCGLPCFLAFLIYKWRRQHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITN  376

Query  178   NFKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIG  357
              FK KLGEGG G+V+KG LRSG F  VK++ K K  GQ+F++EVATIGRIH+ NVV+LIG
Sbjct  377   GFKDKLGEGGSGSVYKGKLRSGRFAVVKILDKLKDNGQDFMNEVATIGRIHNVNVVQLIG  436

Query  358   FCVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRI  537
             F VEGSKRAL+YEFMPNGSLEKYIF +E SI LS+EKM++ISLG+ARGI+YLH+GCDM+I
Sbjct  437   FTVEGSKRALIYEFMPNGSLEKYIFSREGSIPLSNEKMYEISLGIARGIEYLHQGCDMQI  496

Query  538   LHFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGI  717
             LHFDIKPHNILL++ F PK+SDFGLAKLYP  +++VSL+AARGT+GYMAPEL Y+NIG +
Sbjct  497   LHFDIKPHNILLNDKFVPKISDFGLAKLYPANNNIVSLSAARGTIGYMAPELFYKNIGHV  556

Query  718   SHKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMG-DATEEEK  894
             S K DVYS+GMLLMEMVGRRKNLN      SQIYFPSWVY+Q+ +GKDI++  DA E E+
Sbjct  557   SDKTDVYSYGMLLMEMVGRRKNLNVSASHSSQIYFPSWVYDQVSEGKDIEVQEDAIEHEE  616

Query  895   KVSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSP  1041
             K  KKMIIVALWCIQ+ P +RPSM KV+  + + DVE L M PKPFL+P
Sbjct  617   KTKKKMIIVALWCIQLKPIDRPSMHKVV-EMLKSDVESLRMPPKPFLTP  664



>emb|CAN73610.1| hypothetical protein VITISV_032836 [Vitis vinifera]
Length=629

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/322 (64%), Positives = 269/322 (84%), Gaps = 1/322 (0%)
 Frame = +1

Query  13   LGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHK  192
            +GR  +G+L L + ++YK RRRHLS  D IE +L    NL PI+Y+Y +IK+MT NFKHK
Sbjct  260  IGRAVIGILCLFAYLIYKFRRRHLSLDDDIEEFLHNYQNLRPIKYTYSDIKKMTYNFKHK  319

Query  193  LGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEG  372
             G+GG+G+V+KG LRSG  VA+KM+  SKA GQ+FI+EVATIGRIHH NVVRL+GFC++ 
Sbjct  320  XGQGGFGSVYKGKLRSGRIVAIKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQR  379

Query  373  SKRALLYEFMPNGSLEKYIFPKE-ESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFD  549
            SK AL+Y++MPNGSL+K++F  +  +I LS E+++ I+LGV RGI+YLH+GCDM+ILHFD
Sbjct  380  SKWALIYDYMPNGSLDKFVFLDQGNNIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFD  439

Query  550  IKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKA  729
            IKPHNILLD++F+PKVSDFGLAKLY  ++S+VS+TAARGT+GY+APEL Y+NIGG+S KA
Sbjct  440  IKPHNILLDKDFTPKVSDFGLAKLYSTDESIVSVTAARGTLGYIAPELFYKNIGGVSFKA  499

Query  730  DVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKK  909
            DVYSFGMLL+EMVG+RKN+N F E  SQIYFPSW+Y++    +D++MGDATE+EKK  +K
Sbjct  500  DVYSFGMLLLEMVGKRKNVNAFAEHSSQIYFPSWIYDRYDQAEDMEMGDATEBEKKYXRK  559

Query  910  MIIVALWCIQMNPSERPSMKKV  975
            M+IVALWC+QM P +RPSM K 
Sbjct  560  MVIVALWCVQMKPVDRPSMSKT  581



>ref|XP_010026257.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Eucalyptus 
grandis]
Length=382

 Score =   447 bits (1149),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 221/373 (59%), Positives = 291/373 (78%), Gaps = 8/373 (2%)
 Frame = +1

Query  28    LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             LG   ++  ++ K  RRH +    IE +L   NN +PIRYSY +IKR+T NFK KLGEGG
Sbjct  2     LGAPCVLIFLILKWMRRHQATDANIEEFLQVHNNFLPIRYSYSDIKRLTKNFKCKLGEGG  61

Query  208   YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
             YG+V++G LRSG  VAVK++ KSK+ GQ+F+SEVATIGRIHH NVV+L+GFC + SK+AL
Sbjct  62    YGSVYRGILRSGNEVAVKILNKSKSNGQDFMSEVATIGRIHHVNVVQLVGFCFDYSKQAL  121

Query  388   LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
             +Y+FMPNGSL+K+I  K+    L ++KM++ISLG+ARGI+YLHRGCDM+ILHFDIKPHNI
Sbjct  122   VYDFMPNGSLDKHISYKDGDDPLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNI  181

Query  568   LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
             LLD++F+PKVSDFGLA+LYP + S+VSLT ARGT+GYMAPEL Y++IGGIS+KADVYSFG
Sbjct  182   LLDQSFTPKVSDFGLARLYPTDCSIVSLTVARGTLGYMAPELFYKDIGGISYKADVYSFG  241

Query  748   MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
             MLLMEM GRR+N+N   E+ SQIYFP WVY+QL   K+++  D  EEE++ ++KMIIVAL
Sbjct  242   MLLMEMAGRRRNINAHAERSSQIYFPLWVYDQLGKEKELERVDVIEEERETTRKMIIVAL  301

Query  928   WCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVESPLLS  1107
             WCIQ++P++RPSM+KV+  + E D + L++ PKP L P E P D+        +E   +S
Sbjct  302   WCIQLSPNDRPSMRKVL-DMLEGDTDKLQLPPKPLLYPREAPVDDVDV----EIELETIS  356

Query  1108  DN---PVRSSSFE  1137
              +   P+ SSSF+
Sbjct  357   SSPSTPIVSSSFQ  369



>ref|XP_006596681.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Glycine max]
Length=631

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 216/313 (69%), Positives = 262/313 (84%), Gaps = 5/313 (2%)
 Frame = +1

Query  28   LGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGG  207
             G+   I++ + K R+RH+S Y++IE+YL   NNLMPIRYSY EIK+MT  FK KLGEGG
Sbjct  305  FGVPLFITLFIRKWRKRHMSIYESIENYLE-QNNLMPIRYSYKEIKKMTGGFKEKLGEGG  363

Query  208  YGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRAL  387
            YG VFKG L SG  VA+KM+GKSK  GQ+FISEVAT GRIHH NVV+LIGFCV+GSKRAL
Sbjct  364  YGYVFKGKLCSGSCVAIKMLGKSKGNGQDFISEVATAGRIHHQNVVQLIGFCVQGSKRAL  423

Query  388  LYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNI  567
            +YEFMPNGSL+K IF K+ SI LS++K+++IS+GVARGI YLH GC+M+ILHFDIKPHNI
Sbjct  424  VYEFMPNGSLDKLIFSKDGSIHLSYDKIYNISIGVARGIAYLHHGCEMQILHFDIKPHNI  483

Query  568  LLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFG  747
            LLDENF+PKVSDFGLAKLYP+++S+V++T  RGT+GYMAPEL Y NIGGISHKADVYS+G
Sbjct  484  LLDENFTPKVSDFGLAKLYPIDNSIVTMTTTRGTIGYMAPELFYNNIGGISHKADVYSYG  543

Query  748  MLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKVSKKMIIVAL  927
            MLLMEM  +RKNLNP  E+ SQ++FP W+Y  + D +DI+M D TEEE    KKMIIVAL
Sbjct  544  MLLMEMASKRKNLNPHAERSSQLFFPFWIYNHIGDEEDIEMEDVTEEE----KKMIIVAL  599

Query  928  WCIQMNPSERPSM  966
            WCIQ+ P++RPSM
Sbjct  600  WCIQLKPNDRPSM  612



>gb|KEH40315.1| stress-induced receptor-like kinase [Medicago truncatula]
Length=723

 Score =   459 bits (1180),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/377 (62%), Positives = 295/377 (78%), Gaps = 11/377 (3%)
 Frame = +1

Query  7     YALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFK  186
             Y L R  LGL+   + +++K R RH S Y+ IE +L G N+LMPIRYSY EIK+MTN FK
Sbjct  342   YILVRLMLGLVVFFAKLIHKYRIRHTSMYENIEDFLQG-NSLMPIRYSYTEIKKMTNGFK  400

Query  187   HKLGEGGYGTVFKGTLRSGPFVAVKMMGK--SKATGQEFISEVATIGRIHHTNVVRLIGF  360
              KLGEGGYG V+KG LRSGP VA+KM+GK   K  GQ+FI+EVATIGRIHHTNVVRLIGF
Sbjct  401   DKLGEGGYGKVYKGKLRSGPSVAIKMLGKHKGKGNGQDFINEVATIGRIHHTNVVRLIGF  460

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             CVEGSKRAL+Y+FMPNGSL+KYI  +E+ ISL+++++++ISL VARGI YLH+GCDM+IL
Sbjct  461   CVEGSKRALVYDFMPNGSLDKYISSREDHISLTYKQIYEISLAVARGIAYLHQGCDMQIL  520

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLD++F  KVSDFGLAKLYP+E+S+V++TAARGT+GYMAPEL Y+NIG +S
Sbjct  521   HFDIKPHNILLDQDFIAKVSDFGLAKLYPIENSIVTMTAARGTIGYMAPELFYKNIGKVS  580

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDID-MGDATEEEKK  897
             +KADVYSFGMLLME+  RR+NLN   +  SQI+FP W+Y +L + ++I+ +G+ T+EEKK
Sbjct  581   YKADVYSFGMLLMEIANRRRNLNSNADDSSQIFFPYWIYNELVEEREIEILGEVTDEEKK  640

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN  1077
               KKM IVALWCIQ+ P++RPSM KVI  + E D++ +++ PKP   P E+  D     N
Sbjct  641   NVKKMFIVALWCIQLKPNDRPSMDKVI-EMLEVDIKDIKIPPKPSPYPTEIIQDNGVSSN  699

Query  1078  AQNVESPLLSDNPVRSS  1128
                     LSD+ V  S
Sbjct  700   ES------LSDDDVTGS  710



>ref|XP_006593816.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like isoform X1 [Glycine max]
Length=675

 Score =   457 bits (1176),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 230/387 (59%), Positives = 299/387 (77%), Gaps = 10/387 (3%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + +  G+F  G+   I +++YK R+RHLS Y+ IE+YL   NNLMPI YSY EIK+M   
Sbjct  294   LPFLAGKFLFGMTLFIVLLIYKWRKRHLSIYENIENYLE-QNNLMPIGYSYKEIKKMARG  352

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLG GGYG VFKG L SGP VA+KM+ K+K +GQ+FISE+ATIGRIHH NVV+LIG+
Sbjct  353   FKEKLGGGGYGIVFKGKLHSGPSVAIKMLHKAKGSGQDFISEIATIGRIHHQNVVQLIGY  412

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             CVEGSKRAL+YEFMPNGSL+K+IFPK+ +I L+++++++I++GVARGI YLH GC+M+IL
Sbjct  413   CVEGSKRALVYEFMPNGSLDKFIFPKDGNIHLTYDEIYNIAIGVARGIAYLHHGCEMKIL  472

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLDE F+PKVSDFGLAKLYP+++S+V+ T ARGT+GYMAPEL Y NIGGIS
Sbjct  473   HFDIKPHNILLDETFTPKVSDFGLAKLYPIDNSIVTRTEARGTIGYMAPELFYGNIGGIS  532

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFV-EQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKK  897
             HKADVYSFGMLL++M  +RKN NP   +  SQ+YFP+W+Y QL    DI+M   TEEE  
Sbjct  533   HKADVYSFGMLLIDMTNKRKNPNPHADDHSSQLYFPTWIYNQLGKETDIEMEGVTEEE--  590

Query  898   VSKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPN  1077
               KKMIIV+LWCIQ+ PS+RPSM KV+  + E D+E LE+ PKP L P +   ++ S  +
Sbjct  591   --KKMIIVSLWCIQLKPSDRPSMNKVV-EMLEGDIESLEIPPKPSLYPHDTMENDQSIYS  647

Query  1078  AQNVESPLLSDNPVRSSSFEVCEN*II  1158
             +Q + +  +S +   S S E+  N ++
Sbjct  648   SQTMSTDFISSS---SYSKEIVTNPLV  671



>ref|XP_010026272.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Eucalyptus 
grandis]
Length=398

 Score =   447 bits (1150),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 216/354 (61%), Positives = 284/354 (80%), Gaps = 1/354 (0%)
 Frame = +1

Query  1     ISYALGRFSLGLLFLISIVVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNN  180
             + +   +F LG   ++ +++ K  RRH +A   IE +L   NN +PIRYSY +IK++T N
Sbjct  21    VHFLAAKFILGAPCVLILLILKWMRRHQAADANIEEFLLAHNNFLPIRYSYSDIKKITKN  80

Query  181   FKHKLGEGGYGTVFKGTLRSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGF  360
             FK KLGEGGYG+V++G LRSG  VAVK++ KSK+ GQ+FISEVATIGRIHH NVV+L+GF
Sbjct  81    FKCKLGEGGYGSVYRGILRSGNEVAVKILNKSKSNGQDFISEVATIGRIHHINVVQLVGF  140

Query  361   CVEGSKRALLYEFMPNGSLEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRIL  540
             C + SK+AL+Y+FMPNGSL+K+I  K+    L+ +KM++ISLG+ARGI+YLHRGCDM+IL
Sbjct  141   CFDYSKQALVYDFMPNGSLDKHISYKDGDDPLNSKKMYEISLGIARGIEYLHRGCDMQIL  200

Query  541   HFDIKPHNILLDENFSPKVSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGIS  720
             HFDIKPHNILLD +F+PKVSDFGLA+LYP + ++VSLTAARGT+GYMAPEL Y++IGGIS
Sbjct  201   HFDIKPHNILLDRSFNPKVSDFGLARLYPTDRNIVSLTAARGTLGYMAPELFYKDIGGIS  260

Query  721   HKADVYSFGMLLMEMVGRRKNLNPFVEQLSQIYFPSWVYEQLKDGKDIDMGDATEEEKKV  900
             +KADVYSFGMLLMEM GRR+NLN   E  SQIYFP WVY+QL   K+++  D  EEE++ 
Sbjct  261   YKADVYSFGMLLMEMAGRRRNLNAHAEHSSQIYFPLWVYDQLGKEKELERVDVIEEERET  320

Query  901   SKKMIIVALWCIQMNPSERPSMKKVIemleeedvellemAPKPFLSPDEVPTDE  1062
             ++KMIIVALWCIQ++P++RP M+KV+  + E D++ L++ PKP L P E P D+
Sbjct  321   TRKMIIVALWCIQLSPNDRPLMRKVL-DMLEGDMDRLQLPPKPLLYPMEAPVDD  373



>ref|XP_007038999.1| Kinase, putative isoform 2 [Theobroma cacao]
 gb|EOY23500.1| Kinase, putative isoform 2 [Theobroma cacao]
Length=568

 Score =   453 bits (1165),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 227/353 (64%), Positives = 281/353 (80%), Gaps = 2/353 (1%)
 Frame = +1

Query  55    VVYKLRRRHLSAYDTIEHYLSGPNNLMPIRYSYFEIKRMTNNFKHKLGEGGYGTVFKGTL  234
             ++YK R+RH+S YD IE++L   NN MPIRYSY +IK+MT  FK KLGEGGYG+VFKG L
Sbjct  205   LIYKWRKRHMSMYDRIENFLQSQNNFMPIRYSYSQIKKMTEGFKDKLGEGGYGSVFKGKL  264

Query  235   RSGPFVAVKMMGKSKATGQEFISEVATIGRIHHTNVVRLIGFCVEGSKRALLYEFMPNGS  414
             RSG  VAVKM+GKSKA GQEFI+EVATIGRIHH NVV+LIGFC EG+KRAL+YEFMPNGS
Sbjct  265   RSGHLVAVKMLGKSKANGQEFINEVATIGRIHHVNVVQLIGFCAEGTKRALVYEFMPNGS  324

Query  415   LEKYIFPKEESISLSHEKMFDISLGVARGIDYLHRGCDMRILHFDIKPHNILLDENFSPK  594
             L+KY F +E + ++  EK+++ISLGVARGI+YLHRGCDM+ILHFDIKPHNILLDENF+ K
Sbjct  325   LDKYTFGREGNTTIGWEKIYEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFTAK  384

Query  595   VSDFGLAKLYPVEDSLVSLTAARGTMGYMAPELCYRNIGGISHKADVYSFGMLLMEMVGR  774
             VSDFGLAKLYP  D+ V+LTAARGT+GY+A EL Y+NIGG+S+KADVYSFGMLLMEM  +
Sbjct  385   VSDFGLAKLYPTNDTTVTLTAARGTIGYIALELFYKNIGGVSYKADVYSFGMLLMEMAAK  444

Query  775   RKNLNPFVEQLSQIYFPSWVYEQLKDGKDI-DMGDATEEEKKVSKKMIIVALWCIQMNPS  951
             R+N     EQ S+ YFP  VY+Q+  G+D  ++ +A+EEEKK+ KKMI+VALWCIQM PS
Sbjct  445   RRNSTTVTEQSSEAYFPCNVYDQIVGGRDFEEIQEASEEEKKIVKKMIMVALWCIQMKPS  504

Query  952   ERPSMKKVIemleeedvellemAPKPFLSPDEVPTDENSFPNAQNVESPLLSD  1110
             +RPSM KV+  + E +VE L++ PKP L P +     +   + Q   S   +D
Sbjct  505   DRPSMTKVV-EMLEGEVESLQVPPKPVLYPQQTLVRSSGSHSTQQESSSASTD  556



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3333114759636