BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26666_g1_i1 len=1356 path=[1:0-1355]

Length=1356
                                                                      Score     E

ref|XP_009793810.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     431   3e-145   
ref|XP_011074972.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     431   4e-145   
ref|XP_010100104.1|  GDSL esterase/lipase                               430   2e-143   
ref|XP_009605870.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     426   5e-143   
ref|XP_011031552.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    425   7e-143   
ref|XP_011031551.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    425   9e-143   
ref|XP_009773145.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     426   9e-143   
ref|XP_009597060.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     425   1e-142   
ref|XP_002278219.2|  PREDICTED: GDSL esterase/lipase At1g71691          424   2e-142   Vitis vinifera
ref|XP_011095918.1|  PREDICTED: GDSL esterase/lipase At1g71691          424   3e-142   
ref|XP_010064853.1|  PREDICTED: GDSL esterase/lipase At1g71691          427   1e-141   
ref|XP_009357251.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     423   1e-141   
gb|KHN20549.1|  GDSL esterase/lipase                                    421   2e-141   
ref|XP_010683198.1|  PREDICTED: GDSL esterase/lipase At1g71691          421   5e-141   
ref|XP_007223318.1|  hypothetical protein PRUPE_ppa007324mg             421   5e-141   
ref|XP_002325955.1|  GDSL-motif lipase/hydrolase family protein         421   6e-141   Populus trichocarpa [western balsam poplar]
ref|XP_008219080.1|  PREDICTED: GDSL esterase/lipase At1g71691          421   8e-141   
ref|XP_006582440.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     420   9e-141   
ref|XP_010265554.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     420   1e-140   
ref|XP_008361601.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    420   2e-140   
gb|KHN47078.1|  GDSL esterase/lipase                                    418   3e-140   
ref|XP_006376145.1|  GDSL-motif lipase/hydrolase family protein         419   4e-140   
emb|CBI39225.3|  unnamed protein product                                417   7e-140   
gb|EYU28214.1|  hypothetical protein MIMGU_mgv1a008192mg                418   1e-139   
gb|KHG24758.1|  hypothetical protein F383_07589                         417   2e-139   
ref|NP_001242345.1|  uncharacterized protein LOC100779380 precursor     415   6e-139   
ref|XP_004301466.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     414   6e-139   
ref|XP_011005437.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    415   6e-139   
ref|XP_008339092.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    414   8e-139   
ref|XP_011005436.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    415   1e-138   
ref|XP_004499570.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     413   3e-138   
ref|XP_007019795.1|  Zinc finger protein, putative isoform 1            413   5e-138   
ref|XP_007148613.1|  hypothetical protein PHAVU_005G001100g             412   1e-137   
ref|XP_006339389.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     410   5e-137   
ref|XP_006478220.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     410   5e-137   
ref|XP_004250678.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     409   1e-136   
ref|XP_006441600.1|  hypothetical protein CICLE_v10024521mg             406   5e-136   
ref|XP_003598045.1|  GDSL esterase/lipase                               406   1e-135   
ref|XP_004241911.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     406   2e-135   
ref|XP_006356515.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     406   2e-135   
ref|XP_009333996.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     407   2e-135   
ref|XP_008441153.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     406   3e-135   
emb|CDP18864.1|  unnamed protein product                                403   8e-135   
ref|XP_004158530.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     402   3e-134   
gb|KGN63057.1|  hypothetical protein Csa_2G396190                       404   4e-134   
ref|XP_004138671.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     401   6e-134   
ref|XP_002526412.1|  zinc finger protein, putative                      403   3e-133   Ricinus communis
emb|CDX68306.1|  BnaA07g23460D                                          399   3e-132   
ref|XP_009802347.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     400   3e-132   
ref|XP_009104909.1|  PREDICTED: GDSL esterase/lipase At1g71691          399   4e-132   
gb|EPS67957.1|  hypothetical protein M569_06816                         395   7e-131   
ref|XP_009399303.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     395   2e-130   
ref|XP_008788334.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     394   3e-130   
ref|XP_006301319.1|  hypothetical protein CARUB_v10021728mg             394   3e-130   
ref|XP_010908040.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     393   4e-130   
emb|CDY36687.1|  BnaCnng07890D                                          393   6e-130   
ref|XP_010471167.1|  PREDICTED: GDSL esterase/lipase At1g71691          393   8e-130   
ref|XP_010427992.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     392   1e-129   
ref|XP_004141644.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     391   1e-129   
ref|XP_006390758.1|  hypothetical protein EUTSA_v10019478mg             392   4e-129   
ref|XP_008459639.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     390   5e-129   
ref|XP_010415867.1|  PREDICTED: GDSL esterase/lipase At1g71691          390   5e-129   
ref|XP_009761478.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     391   6e-129   
ref|NP_974125.1|  GDSL esterase/lipase                                  390   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631479.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     390   3e-128   
emb|CDX96333.1|  BnaA07g29440D                                          389   3e-128   
ref|XP_002888840.1|  GDSL-motif lipase/hydrolase family protein         387   1e-127   
ref|XP_009105822.1|  PREDICTED: GDSL esterase/lipase At1g71691          389   3e-127   
ref|XP_010521103.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    385   7e-127   
ref|XP_004962048.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     380   4e-125   
ref|XP_002439816.1|  hypothetical protein SORBIDRAFT_09g020670          380   7e-125   Sorghum bicolor [broomcorn]
gb|KCW69515.1|  hypothetical protein EUGRSUZ_F02957                     377   3e-124   
gb|KFK41586.1|  hypothetical protein AALP_AA2G148200                    377   2e-123   
ref|XP_006339345.1|  PREDICTED: formin-2-like                           384   1e-122   
ref|XP_010312984.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     373   9e-122   
ref|XP_003568429.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     370   7e-121   
ref|XP_004973035.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     367   3e-120   
ref|NP_001150393.1|  anther-specific proline-rich protein APG pre...    366   2e-119   Zea mays [maize]
ref|NP_001147753.1|  anther-specific proline-rich protein APG pre...    366   2e-119   Zea mays [maize]
gb|EEC82803.1|  hypothetical protein OsI_27577                          365   4e-119   Oryza sativa Indica Group [Indian rice]
ref|NP_001060835.1|  Os08g0112900                                       365   4e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006441602.1|  hypothetical protein CICLE_v10023728mg             361   8e-119   
dbj|BAJ92238.1|  predicted protein                                      364   1e-118   
gb|AFW74302.1|  hypothetical protein ZEAMMB73_454294                    358   2e-116   
ref|NP_001055574.1|  Os05g0419800                                       357   1e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008648378.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    353   1e-114   
ref|XP_002443746.1|  hypothetical protein SORBIDRAFT_07g001270          352   4e-114   Sorghum bicolor [broomcorn]
ref|XP_006659756.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     346   7e-112   
ref|XP_003571310.2|  PREDICTED: GDSL esterase/lipase At1g71691-like     340   8e-110   
gb|KDP45642.1|  hypothetical protein JCGZ_17249                         333   3e-108   
gb|EAY98084.1|  hypothetical protein OsI_20002                          338   4e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_008381690.1|  PREDICTED: GDSL esterase/lipase At1g71250          327   1e-104   
ref|XP_008237811.1|  PREDICTED: GDSL esterase/lipase At1g71250          325   1e-103   
ref|XP_010252444.1|  PREDICTED: GDSL esterase/lipase At1g71250          321   3e-102   
ref|XP_009804132.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     321   3e-102   
ref|XP_004233002.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     319   3e-101   
ref|XP_007025248.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    317   7e-101   
gb|ACJ85846.1|  unknown                                                 317   3e-100   Medicago truncatula
gb|KEH33152.1|  GDSL-like lipase/acylhydrolase                          317   3e-100   
gb|KDP21169.1|  hypothetical protein JCGZ_21640                         316   3e-100   
gb|AAZ23955.1|  GDSL-lipase 1                                           315   4e-100   Capsicum annuum
gb|KHG24391.1|  hypothetical protein F383_02353                         314   2e-99    
ref|XP_004290271.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     314   3e-99    
ref|XP_006355559.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     313   4e-99    
ref|XP_007200393.1|  hypothetical protein PRUPE_ppa008473mg             312   4e-99    
ref|XP_004504253.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     311   2e-98    
ref|XP_009612510.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     311   2e-98    
ref|XP_002522292.1|  zinc finger protein, putative                      311   3e-98    Ricinus communis
gb|EYU43295.1|  hypothetical protein MIMGU_mgv1a008614mg                311   4e-98    
ref|XP_009769554.1|  PREDICTED: GDSL esterase/lipase At1g29670 is...    310   5e-98    
ref|XP_008443704.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     310   8e-98    
ref|XP_004147394.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     310   8e-98    
ref|XP_010687162.1|  PREDICTED: GDSL esterase/lipase At5g45670          309   1e-97    
gb|KHG06516.1|  hypothetical protein F383_33590                         309   1e-97    
ref|NP_001242366.1|  uncharacterized protein LOC100800635 precursor     309   2e-97    
ref|XP_011085304.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     309   2e-97    
ref|XP_007147964.1|  hypothetical protein PHAVU_006G169100g             308   3e-97    
ref|XP_010930550.1|  PREDICTED: GDSL esterase/lipase At1g71250          308   3e-97    
ref|XP_004497726.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     308   4e-97    
ref|XP_002266118.1|  PREDICTED: GDSL esterase/lipase At5g45670          308   5e-97    Vitis vinifera
gb|KGN65589.1|  hypothetical protein Csa_1G467090                       309   5e-97    
ref|XP_007019796.1|  Zinc finger protein, putative isoform 2            304   5e-97    
gb|KHN06446.1|  GDSL esterase/lipase                                    308   5e-97    
ref|XP_007159508.1|  hypothetical protein PHAVU_002G243500g             307   8e-97    
ref|XP_003629880.1|  GDSL esterase/lipase                               305   3e-96    
ref|XP_006422361.1|  hypothetical protein CICLE_v10018420mg             303   4e-96    
ref|NP_565021.2|  GDSL esterase/lipase                                  303   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858605.1|  hypothetical protein AMTR_s00071p00200630          305   5e-96    
emb|CBI16986.3|  unnamed protein product                                305   6e-96    
ref|XP_008439698.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     305   7e-96    
ref|XP_006852691.1|  hypothetical protein AMTR_s00021p00254410          307   7e-96    
ref|XP_002266194.2|  PREDICTED: GDSL esterase/lipase At1g71250          305   7e-96    Vitis vinifera
ref|XP_002871328.1|  GDSL-motif lipase/hydrolase family protein         305   8e-96    
emb|CDY35296.1|  BnaC03g59270D                                          305   8e-96    
gb|AAX20033.1|  GDSL-lipase protein                                     305   1e-95    Capsicum annuum
ref|XP_004134596.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     305   1e-95    
gb|KHN48037.1|  GDSL esterase/lipase                                    303   2e-95    
ref|XP_006655493.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     303   2e-95    
ref|XP_008786569.1|  PREDICTED: GDSL esterase/lipase At1g71250          303   3e-95    
emb|CDY35297.1|  BnaC03g59260D                                          303   3e-95    
emb|CDX90202.1|  BnaA08g17820D                                          303   3e-95    
ref|XP_011095134.1|  PREDICTED: GDSL esterase/lipase At1g71250          304   4e-95    
dbj|BAB56037.1|  putative proline-rich protein                          303   4e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009612511.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     303   5e-95    
ref|XP_010499477.1|  PREDICTED: GDSL esterase/lipase At1g29670          302   6e-95    
ref|XP_002871339.1|  predicted protein                                  303   6e-95    
ref|XP_009351953.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    302   6e-95    
ref|XP_008371536.1|  PREDICTED: GDSL esterase/lipase At5g45670          302   6e-95    
ref|XP_006305157.1|  hypothetical protein CARUB_v10009525mg             302   7e-95    
emb|CDM83980.1|  unnamed protein product                                302   8e-95    
dbj|BAJ85694.1|  predicted protein                                      302   9e-95    
ref|XP_006399344.1|  hypothetical protein EUTSA_v10016068mg             302   9e-95    
ref|NP_001242353.1|  uncharacterized protein LOC100777335 precursor     302   9e-95    
gb|ABY59947.1|  nectar protein 1                                        301   1e-94    Jacaranda mimosifolia
ref|XP_002456353.1|  hypothetical protein SORBIDRAFT_03g034560          301   1e-94    Sorghum bicolor [broomcorn]
ref|XP_009109655.1|  PREDICTED: GDSL esterase/lipase At1g29670          301   1e-94    
ref|XP_003546057.1|  PREDICTED: GDSL esterase/lipase At1g29670          301   1e-94    
ref|XP_009769556.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     301   2e-94    
ref|NP_001149080.1|  anther-specific proline-rich protein APG pre...    301   2e-94    Zea mays [maize]
ref|XP_010025680.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     301   2e-94    
ref|XP_002890825.1|  GDSL-motif lipase/hydrolase family protein         301   2e-94    
ref|XP_006449582.1|  hypothetical protein CICLE_v10015686mg             301   3e-94    
ref|XP_011102152.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     300   3e-94    
ref|XP_006355561.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     301   3e-94    
ref|XP_002305046.1|  GDSL-motif lipase/hydrolase family protein         301   3e-94    Populus trichocarpa [western balsam poplar]
emb|CDY62118.1|  BnaCnng39210D                                          301   3e-94    
ref|XP_006471326.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     300   3e-94    
ref|NP_196463.1|  GDSL esterase/lipase                                  301   4e-94    Arabidopsis thaliana [mouse-ear cress]
gb|EYU28141.1|  hypothetical protein MIMGU_mgv1a008629mg                300   4e-94    
ref|XP_006467574.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     300   4e-94    
ref|XP_009102833.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     300   4e-94    
ref|XP_006441809.1|  hypothetical protein CICLE_v10023910mg             300   4e-94    
ref|XP_004969944.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     300   4e-94    
ref|XP_006289976.1|  hypothetical protein CARUB_v10003606mg             300   5e-94    
ref|XP_009787100.1|  PREDICTED: GDSL esterase/lipase At1g71250          300   5e-94    
ref|XP_004485963.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     300   7e-94    
ref|XP_009122453.1|  PREDICTED: GDSL esterase/lipase At5g08460          300   7e-94    
gb|AGJ83937.1|  GLIP                                                    300   8e-94    
ref|XP_004154173.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     298   1e-93    
gb|KDO51376.1|  hypothetical protein CISIN_1g036887mg                   299   1e-93    
ref|XP_004250819.1|  PREDICTED: GDSL esterase/lipase At1g71250          299   1e-93    
ref|XP_003569805.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     299   1e-93    
gb|KFK44794.1|  hypothetical protein AALP_AA1G304300                    298   2e-93    
ref|XP_010924691.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     299   2e-93    
ref|XP_008440329.1|  PREDICTED: GDSL esterase/lipase At1g71250          299   2e-93    
ref|XP_004145208.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     298   2e-93    
ref|XP_006478360.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     299   2e-93    
ref|XP_003566036.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     298   2e-93    
ref|XP_006415558.1|  hypothetical protein EUTSA_v10007994mg             298   2e-93    
ref|XP_010054297.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     298   3e-93    
gb|AAM64368.1|  lipase/hydrolase, putative                              298   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232990.1|  PREDICTED: GDSL esterase/lipase At5g45670          298   3e-93    
ref|XP_010452841.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     298   3e-93    
emb|CDX90201.1|  BnaA08g17830D                                          298   4e-93    
ref|NP_174260.1|  GDSL esterase/lipase                                  298   4e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009599586.1|  PREDICTED: GDSL esterase/lipase At1g71250          298   5e-93    
ref|XP_006836894.1|  hypothetical protein AMTR_s00099p00119900          297   6e-93    
gb|ACN29259.1|  unknown                                                 297   7e-93    Zea mays [maize]
ref|XP_004961487.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     297   7e-93    
ref|XP_009109657.1|  PREDICTED: GDSL esterase/lipase At1g29660          297   7e-93    
gb|KEH15769.1|  GDSL-like lipase/acylhydrolase                          297   7e-93    
ref|NP_001149980.1|  anther-specific proline-rich protein APG pre...    297   8e-93    Zea mays [maize]
ref|XP_004293650.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     297   8e-93    
ref|XP_010273430.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     297   9e-93    
ref|XP_008366024.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     296   1e-92    
ref|XP_010112067.1|  GDSL esterase/lipase                               297   1e-92    
ref|XP_009596154.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    296   2e-92    
gb|EPS68861.1|  hypothetical protein M569_05905                         296   2e-92    
ref|XP_010273431.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     296   2e-92    
ref|XP_002456282.1|  hypothetical protein SORBIDRAFT_03g033460          296   2e-92    Sorghum bicolor [broomcorn]
ref|XP_010521634.1|  PREDICTED: GDSL esterase/lipase At5g08460          296   3e-92    
ref|XP_011095907.1|  PREDICTED: GDSL esterase/lipase At1g33811          296   3e-92    
ref|XP_004969823.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     295   4e-92    
ref|XP_007148614.1|  hypothetical protein PHAVU_005G001200g             295   4e-92    
gb|KFK44793.1|  hypothetical protein AALP_AA1G304100                    295   4e-92    
ref|XP_011035467.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     295   5e-92    
ref|XP_008786406.1|  PREDICTED: GDSL esterase/lipase At1g33811          295   7e-92    
gb|EAY75691.1|  hypothetical protein OsI_03598                          295   7e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_011010176.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     295   7e-92    
gb|EYU28213.1|  hypothetical protein MIMGU_mgv1a008354mg                295   8e-92    
ref|XP_010549444.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     294   8e-92    
ref|XP_010549442.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     294   8e-92    
ref|XP_002267889.1|  PREDICTED: GDSL esterase/lipase At5g08460          295   8e-92    Vitis vinifera
ref|XP_010460737.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     294   9e-92    
ref|XP_003526398.2|  PREDICTED: GDSL esterase/lipase At1g33811-like     295   9e-92    
ref|XP_010423079.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     295   9e-92    
gb|KHN20550.1|  GDSL esterase/lipase                                    295   1e-91    
ref|XP_011102202.1|  PREDICTED: uncharacterized protein LOC105180227    305   1e-91    
ref|XP_010911116.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     294   1e-91    
emb|CAN77693.1|  hypothetical protein VITISV_030206                     294   2e-91    Vitis vinifera
ref|XP_010491482.1|  PREDICTED: GDSL esterase/lipase At5g08460          293   2e-91    
ref|XP_006362723.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     293   2e-91    
ref|XP_011074971.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     293   3e-91    
ref|XP_010478329.1|  PREDICTED: GDSL esterase/lipase At1g29660          293   4e-91    
ref|XP_010499475.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    292   4e-91    
ref|XP_009105797.1|  PREDICTED: GDSL esterase/lipase At1g71250          292   5e-91    
ref|XP_010100103.1|  GDSL esterase/lipase                               292   7e-91    
ref|XP_010415834.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     292   9e-91    
ref|XP_010471141.1|  PREDICTED: GDSL esterase/lipase At1g71250          292   9e-91    
gb|ABF72016.1|  GDSL-motif lipase/hydrolase family protein              291   9e-91    Musa acuminata [banana]
ref|XP_006415557.1|  hypothetical protein EUTSA_v10008016mg             291   9e-91    
ref|XP_002441391.1|  hypothetical protein SORBIDRAFT_09g025780          291   9e-91    Sorghum bicolor [broomcorn]
ref|XP_002316749.2|  GDSL-motif lipase/hydrolase family protein         291   1e-90    Populus trichocarpa [western balsam poplar]
gb|KHN47079.1|  GDSL esterase/lipase                                    291   1e-90    
ref|XP_008792294.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     291   1e-90    
emb|CDO96914.1|  unnamed protein product                                291   1e-90    
ref|XP_002865231.1|  GDSL-motif lipase/hydrolase family protein         291   1e-90    
ref|XP_003522601.2|  PREDICTED: GDSL esterase/lipase At1g33811-like     291   1e-90    
emb|CDX94689.1|  BnaC07g09690D                                          291   1e-90    
ref|XP_009770266.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    291   1e-90    
ref|XP_009406156.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     291   1e-90    
ref|XP_010683187.1|  PREDICTED: GDSL esterase/lipase At1g33811          291   1e-90    
gb|KEH29338.1|  GDSL-like lipase/acylhydrolase                          291   2e-90    
gb|KDP45644.1|  hypothetical protein JCGZ_17251                         291   2e-90    
ref|XP_009392443.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     290   3e-90    
ref|NP_199379.1|  GDSL esterase/lipase                                  290   3e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAM63021.1|  GDSL-motif lipase/hydrolase-like protein                290   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102834.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     290   3e-90    
ref|XP_010538583.1|  PREDICTED: GDSL esterase/lipase At5g45670          291   4e-90    
gb|KHG17696.1|  hypothetical protein F383_20601                         290   5e-90    
gb|KFK31532.1|  hypothetical protein AALP_AA6G124800                    289   6e-90    
ref|XP_006305152.1|  hypothetical protein CARUB_v10009519mg             289   7e-90    
ref|XP_008225405.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     289   7e-90    
emb|CDY39440.1|  BnaAnng05710D                                          288   8e-90    
ref|XP_004250650.1|  PREDICTED: GDSL esterase/lipase At1g33811          289   9e-90    
ref|XP_010057187.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     289   1e-89    
ref|XP_006339350.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     289   1e-89    
ref|XP_009101579.1|  PREDICTED: GDSL esterase/lipase At5g45670          288   1e-89    
ref|XP_006415056.1|  hypothetical protein EUTSA_v10007976mg             289   1e-89    
ref|NP_001056057.1|  Os05g0518300                                       289   1e-89    Oryza sativa Japonica Group [Japonica rice]
gb|AES72967.2|  GDSL-like lipase/acylhydrolase                          289   1e-89    
ref|XP_010095110.1|  GDSL esterase/lipase                               289   2e-89    
ref|XP_010540543.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     288   2e-89    
ref|XP_002890824.1|  GDSL-motif lipase/hydrolase family protein         288   2e-89    
ref|XP_010065073.1|  PREDICTED: GDSL esterase/lipase At1g71250          288   2e-89    
ref|XP_003602716.1|  GDSL esterase/lipase                               289   2e-89    
ref|XP_010427953.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     288   3e-89    
ref|XP_006280692.1|  hypothetical protein CARUB_v10026655mg             288   3e-89    
ref|XP_010542848.1|  PREDICTED: GDSL esterase/lipase At1g33811          288   3e-89    
emb|CDY59325.1|  BnaCnng34700D                                          287   3e-89    
ref|XP_002891066.1|  GDSL-motif lipase/hydrolase family protein         287   4e-89    
ref|NP_177281.1|  GDSL esterase/lipase                                  288   5e-89    
ref|XP_004234068.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     287   5e-89    
ref|XP_010518837.1|  PREDICTED: GDSL esterase/lipase At5g45670-li...    288   5e-89    
ref|XP_004499571.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     287   7e-89    
ref|XP_010461207.1|  PREDICTED: GDSL esterase/lipase At1g33811          287   7e-89    
ref|XP_011083216.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     287   7e-89    
ref|XP_010478804.1|  PREDICTED: GDSL esterase/lipase At1g33811-li...    287   7e-89    
gb|KFK31816.1|  hypothetical protein AALP_AA6G162300                    287   8e-89    
gb|EYU22692.1|  hypothetical protein MIMGU_mgv1a007347mg                288   8e-89    
ref|XP_007211471.1|  hypothetical protein PRUPE_ppa007546mg             286   9e-89    
gb|KDP24218.1|  hypothetical protein JCGZ_25875                         286   9e-89    
gb|EYU31208.1|  hypothetical protein MIMGU_mgv1a026796mg                286   1e-88    
ref|XP_010518836.1|  PREDICTED: GDSL esterase/lipase At5g45670-li...    288   1e-88    
ref|XP_004141643.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     286   2e-88    
gb|KGN52691.1|  hypothetical protein Csa_5G650560                       286   2e-88    
ref|XP_008459640.1|  PREDICTED: GDSL esterase/lipase At1g33811          286   2e-88    
ref|XP_010499923.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     287   2e-88    
ref|XP_006398248.1|  hypothetical protein EUTSA_v10000937mg             285   3e-88    
ref|XP_010534848.1|  PREDICTED: GDSL esterase/lipase At1g71250 is...    285   3e-88    
ref|XP_006305078.1|  hypothetical protein CARUB_v10009448mg             286   3e-88    
ref|XP_003569720.1|  PREDICTED: GDSL esterase/lipase At5g45670          285   3e-88    
ref|NP_564430.1|  GDSL esterase/lipase                                  285   4e-88    
emb|CDM84214.1|  unnamed protein product                                285   4e-88    
ref|XP_010441685.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     285   4e-88    
ref|XP_010494685.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     285   4e-88    
gb|AAM65973.1|  lipase/hydrolase, putative                              285   4e-88    
ref|XP_002518015.1|  zinc finger protein, putative                      285   4e-88    
gb|EPS71849.1|  hypothetical protein M569_02907                         285   5e-88    
ref|XP_010481545.1|  PREDICTED: GDSL esterase/lipase At5g45670          285   5e-88    
emb|CDY13043.1|  BnaA09g17740D                                          284   5e-88    
ref|XP_009114398.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     284   6e-88    
ref|XP_006646284.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     285   6e-88    
ref|XP_011004908.1|  PREDICTED: GDSL esterase/lipase At1g71250          284   7e-88    
emb|CDX73285.1|  BnaC05g28210D                                          284   9e-88    
ref|NP_174259.1|  GDSL esterase/lipase                                  284   1e-87    
ref|XP_002278481.1|  PREDICTED: GDSL esterase/lipase 7-like             284   1e-87    
ref|XP_006371372.1|  GDSL-motif lipase/hydrolase family protein         284   1e-87    
gb|KFK28567.1|  hypothetical protein AALP_AA7G013200                    283   1e-87    
ref|NP_567570.1|  GDSL esterase/lipase                                  283   1e-87    
ref|XP_003526907.1|  PREDICTED: GDSL esterase/lipase At5g08460          284   1e-87    
gb|ABD96893.1|  hypothetical protein                                    283   1e-87    
gb|AFK40262.1|  unknown                                                 283   2e-87    
emb|CDP15726.1|  unnamed protein product                                283   2e-87    
ref|XP_009379054.1|  PREDICTED: GDSL esterase/lipase At1g33811          283   2e-87    
ref|XP_006356087.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     283   2e-87    
emb|CDO96915.1|  unnamed protein product                                283   3e-87    
ref|XP_010558516.1|  PREDICTED: GDSL esterase/lipase 7                  284   3e-87    
ref|XP_010062377.1|  PREDICTED: GDSL esterase/lipase At1g33811          283   3e-87    
gb|KCW70983.1|  hypothetical protein EUGRSUZ_F04092                     281   4e-87    
dbj|BAJ85725.1|  predicted protein                                      282   4e-87    
ref|XP_006300432.1|  hypothetical protein CARUB_v10022173mg             282   5e-87    
ref|XP_010439787.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     282   5e-87    
ref|XP_009596155.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    282   5e-87    
gb|KHN09688.1|  GDSL esterase/lipase                                    281   5e-87    
ref|XP_009145171.1|  PREDICTED: GDSL esterase/lipase At1g33811          282   6e-87    
ref|XP_007131319.1|  hypothetical protein PHAVU_011G003600g             282   6e-87    
ref|XP_008803727.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     281   9e-87    
ref|NP_001190767.1|  GDSL esterase/lipase                               283   1e-86    
gb|KHN11641.1|  GDSL esterase/lipase                                    281   1e-86    
ref|XP_010434476.1|  PREDICTED: GDSL esterase/lipase At4g18970          281   1e-86    
ref|XP_002867968.1|  GDSL-motif lipase/hydrolase family protein         281   1e-86    
ref|XP_010449440.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     281   1e-86    
ref|XP_010930423.1|  PREDICTED: GDSL esterase/lipase At1g33811          281   1e-86    
ref|XP_002278194.1|  PREDICTED: GDSL esterase/lipase At1g33811          281   2e-86    
ref|XP_006414032.1|  hypothetical protein EUTSA_v10025529mg             280   2e-86    
emb|CDY23109.1|  BnaC09g18630D                                          280   2e-86    
emb|CDY01575.1|  BnaC07g35650D                                          280   3e-86    
emb|CDO96913.1|  unnamed protein product                                280   4e-86    
ref|XP_011005438.1|  PREDICTED: GDSL esterase/lipase At1g33811          280   4e-86    
ref|XP_007226475.1|  hypothetical protein PRUPE_ppa027202mg             279   4e-86    
gb|AAM67249.1|  GDSL-motif lipase/hydrolase-like protein                280   4e-86    
ref|XP_006441595.1|  hypothetical protein CICLE_v100203321mg            275   5e-86    
ref|XP_003534425.2|  PREDICTED: GDSL esterase/lipase At1g71250          282   6e-86    
ref|XP_002887358.1|  predicted protein                                  279   7e-86    
ref|XP_006494856.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     279   8e-86    
ref|XP_008219130.1|  PREDICTED: GDSL esterase/lipase At1g33811          279   9e-86    
ref|XP_007048633.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    279   1e-85    
ref|XP_006390789.1|  hypothetical protein EUTSA_v10019503mg             278   2e-85    
gb|ABF70089.1|  GDSL-motif lipase/hydrolase family protein              278   4e-85    
emb|CDX68319.1|  BnaA07g23590D                                          277   4e-85    
ref|XP_009770267.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    277   4e-85    
emb|CBI16914.3|  unnamed protein product                                276   4e-85    
ref|XP_004506365.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     277   4e-85    
ref|XP_007019704.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    277   4e-85    
ref|XP_009104921.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     277   4e-85    
emb|CAA16754.1|  putative protein                                       285   5e-85    
ref|XP_006441609.1|  hypothetical protein CICLE_v10020729mg             277   5e-85    
ref|XP_010540541.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...    276   6e-85    
emb|CDX72790.1|  BnaC06g32380D                                          293   7e-85    
ref|XP_007019797.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    276   8e-85    
ref|XP_003605652.1|  GDSL esterase/lipase                               291   9e-85    
ref|XP_002521611.1|  zinc finger protein, putative                      276   1e-84    
gb|KHG10246.1|  hypothetical protein F383_10927                         276   1e-84    
ref|XP_010272684.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     275   2e-84    
ref|XP_006441598.1|  hypothetical protein CICLE_v10023256mg             271   3e-84    
ref|XP_010694356.1|  PREDICTED: GDSL esterase/lipase 7-like             275   3e-84    
ref|XP_008378723.1|  PREDICTED: GDSL esterase/lipase At1g33811          275   3e-84    
ref|XP_002526411.1|  zinc finger protein, putative                      274   3e-84    
ref|XP_009136981.1|  PREDICTED: GDSL esterase/lipase At4g18970          275   4e-84    
emb|CDX98598.1|  BnaA03g43830D                                          275   4e-84    
gb|KFK45101.1|  hypothetical protein AALP_AA1G343700                    275   4e-84    
ref|XP_010677280.1|  PREDICTED: GDSL esterase/lipase At1g71250          275   4e-84    
ref|XP_010669494.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     275   4e-84    
gb|ABF72017.1|  GDSL-motif lipase/hydrolase family protein              275   5e-84    
emb|CDX96311.1|  BnaA07g29220D                                          291   5e-84    
gb|EMT08946.1|  GDSL esterase/lipase                                    272   6e-84    
ref|XP_006844094.1|  hypothetical protein AMTR_s00006p00253020          273   7e-84    
ref|XP_004301465.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     274   8e-84    
ref|XP_006376146.1|  GDSL-motif lipase/hydrolase family protein         273   8e-84    
gb|KDP31296.1|  hypothetical protein JCGZ_11672                         273   1e-83    
ref|XP_003598046.1|  GDSL esterase/lipase                               273   2e-83    
ref|XP_010492414.1|  PREDICTED: GDSL esterase/lipase 7-like isofo...    272   2e-83    
ref|XP_009767072.1|  PREDICTED: GDSL esterase/lipase At5g08460          272   3e-83    
emb|CDY49215.1|  BnaCnng17040D                                          272   3e-83    
ref|XP_010492413.1|  PREDICTED: GDSL esterase/lipase 7-like isofo...    271   8e-83    
ref|XP_006288000.1|  hypothetical protein CARUB_v10001233mg             270   1e-82    
ref|XP_010453711.1|  PREDICTED: GDSL esterase/lipase 7                  270   2e-82    
ref|XP_004166340.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     266   2e-82    
gb|EMT18311.1|  hypothetical protein F775_52607                         270   2e-82    
ref|XP_006400092.1|  hypothetical protein EUTSA_v10015627mg             270   2e-82    
ref|XP_009407058.1|  PREDICTED: GDSL esterase/lipase At1g33811          272   3e-82    
gb|AAF97292.1|AC010164_14  Hypothetical protein                         270   3e-82    
ref|XP_009407589.1|  PREDICTED: GDSL esterase/lipase 7                  269   7e-82    
ref|XP_002873738.1|  GDSL-motif lipase 7                                268   1e-81    
ref|XP_010674288.1|  PREDICTED: GDSL esterase/lipase At5g08460          268   2e-81    
gb|KHN47367.1|  GDSL esterase/lipase                                    267   2e-81    
ref|XP_010540540.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     266   7e-81    
ref|XP_006426401.1|  hypothetical protein CICLE_v10027519mg             266   7e-81    
ref|XP_010522212.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     265   2e-80    
emb|CDX78649.1|  BnaA03g05610D                                          265   2e-80    
ref|XP_007147963.1|  hypothetical protein PHAVU_006G169000g             264   4e-80    
ref|NP_568318.1|  GDSL esterase/lipase 7                                263   7e-80    
ref|XP_008649890.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     262   9e-80    
ref|XP_010261380.1|  PREDICTED: GDSL esterase/lipase 7                  263   1e-79    
emb|CAN83203.1|  hypothetical protein VITISV_035686                     264   2e-79    
ref|XP_009370610.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     262   2e-79    
emb|CDX85537.1|  BnaA02g02760D                                          262   2e-79    
ref|XP_006828510.1|  hypothetical protein AMTR_s00060p00187780          262   2e-79    
ref|XP_003565364.2|  PREDICTED: GDSL esterase/lipase At1g33811-like     264   2e-79    
emb|CDX90976.1|  BnaC02g06210D                                          262   2e-79    
ref|XP_009126065.1|  PREDICTED: GDSL esterase/lipase 7-like             263   3e-79    
ref|XP_006286004.1|  hypothetical protein CARUB_v10007532mg             265   1e-78    
ref|XP_002994082.1|  hypothetical protein SELMODRAFT_45524              259   1e-78    
emb|CAC01771.1|  putative protein                                       260   2e-78    
ref|XP_007141917.1|  hypothetical protein PHAVU_008G236800g             260   2e-78    
ref|XP_006466217.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     260   2e-78    
ref|XP_003519329.1|  PREDICTED: GDSL esterase/lipase At5g37690-li...    258   4e-78    
ref|XP_010258913.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     258   6e-78    
ref|XP_009131491.1|  PREDICTED: GDSL esterase/lipase 7                  260   7e-78    
ref|XP_008343129.1|  PREDICTED: GDSL esterase/lipase At5g37690          256   2e-77    
ref|XP_009416437.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     256   3e-77    
ref|XP_002989121.1|  hypothetical protein SELMODRAFT_129215             255   9e-77    
ref|XP_010661322.1|  PREDICTED: GDSL esterase/lipase At1g71250-li...    253   2e-76    
emb|CBI16594.3|  unnamed protein product                                253   4e-76    
emb|CDY70134.1|  BnaCnng66890D                                          249   4e-76    
ref|XP_010661319.1|  PREDICTED: GDSL esterase/lipase At1g71250-li...    253   5e-76    
ref|XP_002275448.3|  PREDICTED: GDSL esterase/lipase At1g71250-li...    252   2e-75    
ref|XP_010661323.1|  PREDICTED: GDSL esterase/lipase At1g71250-li...    251   2e-75    
gb|KHN39466.1|  GDSL esterase/lipase                                    251   3e-75    
ref|XP_010661321.1|  PREDICTED: GDSL esterase/lipase At1g71250-li...    251   3e-75    
ref|XP_002459135.1|  hypothetical protein SORBIDRAFT_03g046440          251   4e-75    
emb|CBI30761.3|  unnamed protein product                                250   7e-75    
ref|XP_011083333.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     250   8e-75    
ref|XP_002967217.1|  hypothetical protein SELMODRAFT_87116              249   2e-74    
gb|AES99241.2|  GDSL-like lipase/acylhydrolase                          248   3e-74    
ref|XP_009367135.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     248   4e-74    
ref|XP_007216510.1|  hypothetical protein PRUPE_ppa025674mg             248   4e-74    
ref|XP_011007241.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     248   4e-74    
ref|XP_009757859.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     248   5e-74    
ref|XP_008809415.1|  PREDICTED: GDSL esterase/lipase At5g37690          248   9e-74    
ref|XP_011001569.1|  PREDICTED: GDSL esterase/lipase At5g37690          247   1e-73    
ref|XP_010534856.1|  PREDICTED: GDSL esterase/lipase At1g71250 is...    246   2e-73    
ref|XP_001781861.1|  predicted protein                                  248   2e-73    
ref|XP_002960505.1|  hypothetical protein SELMODRAFT_73430              247   2e-73    
gb|ABK26965.1|  unknown                                                 247   2e-73    
ref|XP_002968205.1|  hypothetical protein SELMODRAFT_89823              247   2e-73    
ref|XP_010095107.1|  GDSL esterase/lipase                               247   3e-73    
ref|XP_001759235.1|  predicted protein                                  245   4e-73    
ref|XP_002976172.1|  hypothetical protein SELMODRAFT_104120             244   1e-72    
ref|XP_010265525.1|  PREDICTED: GDSL esterase/lipase 7-like             244   1e-72    
ref|XP_006384153.1|  hypothetical protein POPTR_0004s08520g             244   1e-72    
gb|KDO50801.1|  hypothetical protein CISIN_1g041889mg                   244   1e-72    
gb|KFK25215.1|  hypothetical protein AALP_AA8G082100                    260   1e-72    
ref|XP_006482381.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     244   2e-72    
ref|XP_008381376.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     244   2e-72    
ref|XP_002266915.1|  PREDICTED: GDSL esterase/lipase At1g29670          244   3e-72    
ref|XP_010046960.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     243   3e-72    
ref|XP_007158589.1|  hypothetical protein PHAVU_002G165200g             243   3e-72    
ref|XP_008228044.1|  PREDICTED: GDSL esterase/lipase At5g37690          243   4e-72    
emb|CAN71483.1|  hypothetical protein VITISV_004374                     243   4e-72    
ref|XP_002262696.2|  PREDICTED: uncharacterized protein LOC100266969    259   4e-72    
ref|XP_002263997.1|  PREDICTED: GDSL esterase/lipase At5g45670          243   5e-72    
gb|ABK95330.1|  unknown                                                 243   5e-72    
ref|XP_010906926.1|  PREDICTED: GDSL esterase/lipase At5g37690          243   6e-72    
ref|XP_002973831.1|  hypothetical protein SELMODRAFT_100257             243   6e-72    
ref|XP_007212968.1|  hypothetical protein PRUPE_ppa021115mg             242   7e-72    
ref|XP_006430582.1|  hypothetical protein CICLE_v10013564mg             242   8e-72    
ref|XP_010676275.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     243   1e-71    
ref|XP_004490816.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     242   1e-71    
ref|XP_006389045.1|  hypothetical protein POPTR_0053s00200g             241   1e-71    
ref|XP_009613021.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     242   1e-71    
ref|XP_002983559.1|  hypothetical protein SELMODRAFT_118578             241   3e-71    
ref|XP_006388931.1|  hypothetical protein POPTR_0073s00220g             241   3e-71    
ref|XP_003616283.1|  GDSL esterase/lipase                               241   3e-71    
emb|CBI30762.3|  unnamed protein product                                242   4e-71    
ref|XP_010108989.1|  GDSL esterase/lipase                               240   4e-71    
ref|XP_001757546.1|  predicted protein                                  241   6e-71    
ref|XP_010528545.1|  PREDICTED: GDSL esterase/lipase At5g37690          240   7e-71    
ref|XP_010271296.1|  PREDICTED: GDSL esterase/lipase At5g37690          240   7e-71    
ref|XP_009789284.1|  PREDICTED: GDSL esterase/lipase At5g37690          239   9e-71    
ref|XP_004289592.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     239   9e-71    
ref|XP_002324947.2|  hypothetical protein POPTR_0018s03490g             239   1e-70    
ref|XP_006372567.1|  hypothetical protein POPTR_0017s02870g             239   2e-70    
gb|AFW74307.1|  hypothetical protein ZEAMMB73_324265                    238   3e-70    
gb|ABK25389.1|  unknown                                                 239   3e-70    
ref|XP_002518038.1|  zinc finger protein, putative                      237   3e-70    
gb|KHN25636.1|  GDSL esterase/lipase                                    239   3e-70    
gb|ABK27121.1|  unknown                                                 239   3e-70    
ref|XP_006364625.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     239   3e-70    



>ref|XP_009793810.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=364

 Score =   431 bits (1109),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/328 (67%), Positives = 262/328 (80%), Gaps = 1/328 (0%)
 Frame = +1

Query  151   NALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQL  330
             NALVPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ L
Sbjct  32    NALVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDVIAQLL  91

Query  331   GLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
             GLP+I  Y E+ S DQMR+G+NYASAAAGILD TG++F+GRIPFN+QI NFE T NQ+ +
Sbjct  92    GLPLIPPYTEA-SGDQMRFGINYASAAAGILDITGRNFVGRIPFNQQITNFESTVNQIRS  150

Query  511   NLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrl  690
             NL    V + L KSIFFVGMGSNDYLNNY MP Y T   Y+  QFAS LVQQY QQL RL
Sbjct  151   NLGVSDVGEALAKSIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQFASLLVQQYNQQLMRL  210

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
             Y LGARKFV+ G+G MGCIP++LA++ NGEC E VNQ VLPF+ NV+ M+N F+T  P +
Sbjct  211   YNLGARKFVIGGVGLMGCIPSILAQSQNGECSEEVNQLVLPFHNNVRSMLNNFNTNLPGS  270

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             KFV+ID   MFQ ++ N ++YGFS  + GCCGVG+N G++TCLPF+TPC NR++++FWDA
Sbjct  271   KFVYIDIRNMFQDLLTNYRQYGFSEINNGCCGVGRNRGQITCLPFQTPCQNREQFIFWDA  330

Query  1051  FHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FHPT AVN+L G  AFNG   +VYP+ I
Sbjct  331   FHPTEAVNILFGRKAFNGGPDVVYPINI  358



>ref|XP_011074972.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Sesamum indicum]
Length=374

 Score =   431 bits (1109),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 231/371 (62%), Positives = 277/371 (75%), Gaps = 8/371 (2%)
 Frame = +1

Query  31    NNPSVFSALFILALVFVSAITEPVPVLAQAPTLGFSGEGNN---ALVPAMFIFGDSLIDN  201
             +N S F  L ++ LV  +  T     L +     F+ EG+     LVPAMFIFGDSLIDN
Sbjct  3     DNKSSFCGLCLIFLVLSANNTS----LGRGQEDAFAPEGSQRRRELVPAMFIFGDSLIDN  58

Query  202   GNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQM  381
             GNNNNL SFAKANYLPYGIDFN  PTGRFSNGYT+VD+IA+ LGLP+I AY E+ S DQM
Sbjct  59    GNNNNLPSFAKANYLPYGIDFNGGPTGRFSNGYTMVDTIAELLGLPLIPAYSEA-SGDQM  117

Query  382   RYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFF  561
             RYGVNYASAAAGILD TG++F+ RIPFN+QI NFE T +Q++ +L A  VA+ L K IFF
Sbjct  118   RYGVNYASAAAGILDITGRNFVSRIPFNQQIKNFENTLDQITDSLGAPDVAQALAKCIFF  177

Query  562   VGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMG  741
             VGMGSNDYLNNY MP Y T + Y+  Q+A  LVQQY+QQLTRLY LGARKFV+ G+G MG
Sbjct  178   VGMGSNDYLNNYLMPNYDTKYQYNAQQYADLLVQQYSQQLTRLYNLGARKFVIAGLGLMG  237

Query  742   CIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNN  921
             CIP++LA++ NG C E VNQ VLPFN N K MIN  S   P A+F +ID   MF+ ++ N
Sbjct  238   CIPSILAQSSNGICSEEVNQLVLPFNTNTKAMINNLSANLPGARFSYIDIRNMFRDLLAN  297

Query  922   NKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFN  1101
                YGFSV +RGCCG+G+N G++TCLPF+TPC  R +Y+FWDAFHPT AVNVL G  AFN
Sbjct  298   AGSYGFSVLNRGCCGIGRNRGQITCLPFQTPCPERNQYIFWDAFHPTEAVNVLFGQKAFN  357

Query  1102  GSNYLVYPMTI  1134
             G+  LVYP+ I
Sbjct  358   GNTELVYPINI  368



>ref|XP_010100104.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB81487.1| GDSL esterase/lipase [Morus notabilis]
Length=449

 Score =   430 bits (1105),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/331 (65%), Positives = 263/331 (79%), Gaps = 1/331 (0%)
 Frame = +1

Query  142   EGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIA  321
             E    +VPAMF+FGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYTIVD IA
Sbjct  109   EAGRGVVPAMFVFGDSLIDNGNNNNLASFAKANYFPYGIDFNGGPTGRFSNGYTIVDEIA  168

Query  322   KQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQ  501
               LGLP+I  Y ++ S DQ  +GVNYASAAAGILD TG++F+GRIPFN+QI NFE T +Q
Sbjct  169   DLLGLPLIPPYSDA-SGDQALHGVNYASAAAGILDNTGRNFVGRIPFNQQIKNFENTLDQ  227

Query  502   LSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqql  681
             ++ NL AD VA+DL + IFFVGMGSNDYLNNY MP YPT   Y+P Q+A+ LVQQYTQQL
Sbjct  228   ITGNLEADDVARDLARCIFFVGMGSNDYLNNYLMPNYPTRNQYNPQQYANLLVQQYTQQL  287

Query  682   trlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             TRLY LGARKF + G+G MGCIP++LA++  G C + VNQ V+PFNANVK M+N  +   
Sbjct  288   TRLYNLGARKFAIAGLGLMGCIPSILAQSSTGSCSQEVNQLVMPFNANVKTMLNNLNANL  347

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             P +KF+F+D  +MFQ I+ N++ YGF V +RGCCG+G+N G++TCLPF+TPC NRQEY+F
Sbjct  348   PGSKFIFVDIARMFQDILTNSRSYGFGVINRGCCGIGRNRGQITCLPFQTPCQNRQEYVF  407

Query  1042  WDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             WDAFHPT+AVN+++G  A  G+  + YP+ I
Sbjct  408   WDAFHPTAAVNIIMGREAVRGNLRVAYPINI  438


 Score =   103 bits (258),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +1

Query  142  EGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIA  321
            E    +VPAMF+FGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYTIVD IA
Sbjct  34   EAGRGVVPAMFVFGDSLIDNGNNNNLASFAKANYFPYGIDFNGGPTGRFSNGYTIVDEIA  93

Query  322  KQLGL  336
               G+
Sbjct  94   LAAGV  98



>ref|XP_009605870.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana tomentosiformis]
Length=377

 Score =   426 bits (1096),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 223/367 (61%), Positives = 275/367 (75%), Gaps = 5/367 (1%)
 Frame = +1

Query  43    VFSALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLF  222
             +FS    +  V V++ T      A AP  G  G    ALVPAMFIFGDSLIDNGNNNNL 
Sbjct  7     IFSCTLFVVFVLVNSATCQEVDDALAPEAG--GGRRRALVPAMFIFGDSLIDNGNNNNLP  64

Query  223   SFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLES---PSIDQMRYGV  393
             SFAKANY PYGIDF+  PTGRFSNGYT+VD IA+ LGLP+I AY E+    S D+MR+GV
Sbjct  65    SFAKANYFPYGIDFDGGPTGRFSNGYTMVDEIAELLGLPLIPAYTEASADASGDKMRFGV  124

Query  394   NYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMG  573
             NYASAAAGILD TG++F+GRIPFN+QI NFE T +Q++ NL A  VA+ L K +FFVGMG
Sbjct  125   NYASAAAGILDITGRNFVGRIPFNQQIKNFENTLDQITDNLGAPDVAQALAKCMFFVGMG  184

Query  574   SNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPT  753
             SNDYLNNY MP Y T   Y+P Q+A+ LVQQY+QQL+RLY LGARKFV+ G+G MGCIP+
Sbjct  185   SNDYLNNYLMPNYDTKNRYNPQQYANLLVQQYSQQLSRLYNLGARKFVIGGLGLMGCIPS  244

Query  754   MLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRY  933
             +LA+ +   C E VNQ VLPF+ NVK M++  +   P +KF++ID   MFQ ++ N +RY
Sbjct  245   ILAQGNGNVCSEEVNQLVLPFSNNVKSMLSNLNANLPGSKFIYIDIKNMFQDLLTNYRRY  304

Query  934   GFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNY  1113
             GFSV DRGCCG+G+N G++TCLP +TPC NR +Y+FWDAFHPT AVN+L G  AF+G   
Sbjct  305   GFSVIDRGCCGIGRNRGQITCLPLQTPCPNRDQYIFWDAFHPTEAVNILFGRRAFSGGPD  364

Query  1114  LVYPMTI  1134
             +VYP+ I
Sbjct  365   VVYPINI  371



>ref|XP_011031552.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X2 [Populus 
euphratica]
Length=360

 Score =   425 bits (1093),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 218/333 (65%), Positives = 266/333 (80%), Gaps = 3/333 (1%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G G N +VPAMFIFGDSLIDNGNNNNL SFAKANYLPYGIDFN  PTGRFSNGYT+VD I
Sbjct  19    GLGQN-MVPAMFIFGDSLIDNGNNNNLPSFAKANYLPYGIDFNGGPTGRFSNGYTMVDEI  77

Query  319   AKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKN  498
             A+QLGLP+I AY E+ S DQ+  GVNYASAAAGILD TG++F+GRIPF++QI NF  T +
Sbjct  78    AEQLGLPLIPAYSEA-SGDQVLNGVNYASAAAGILDITGRNFVGRIPFDQQIRNFHNTLD  136

Query  499   QLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqq  678
             Q++ NL AD VA+ + +SIFFVGMGSNDYLNNY MP YPT   Y+  Q+A  L Q+Y++Q
Sbjct  137   QITNNLGADDVARQVGRSIFFVGMGSNDYLNNYLMPNYPTRNQYNGRQYADLLTQEYSRQ  196

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTT  858
             LT LY LGARKFV+ G+G MGCIP++LA++  G C +SVNQ V PFN NVK M++ F+  
Sbjct  197   LTTLYNLGARKFVIAGLGVMGCIPSILAQSPAGICSDSVNQLVQPFNENVKAMLSNFNAN  256

Query  859   H-PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEY  1035
               P AKF+FID  +MF+ I+ N+  YGFSV +RGCCG+G+N G++TCLPF+TPC NR++Y
Sbjct  257   QLPGAKFIFIDVARMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQY  316

Query  1036  LFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +FWDAFHPT AVNVL+G  AFNG   +VYPM I
Sbjct  317   VFWDAFHPTEAVNVLMGRKAFNGDLSMVYPMNI  349



>ref|XP_011031551.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X1 [Populus 
euphratica]
Length=373

 Score =   425 bits (1093),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 222/362 (61%), Positives = 276/362 (76%), Gaps = 8/362 (2%)
 Frame = +1

Query  52    ALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFA  231
              + ++ LVF   + + V      P +G   E    +VPAMFIFGDSLIDNGNNNNL SFA
Sbjct  8     CMLVIFLVFGVGLGQNVDPFG--PVVGRRRE----MVPAMFIFGDSLIDNGNNNNLPSFA  61

Query  232   KANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAA  411
             KANYLPYGIDFN  PTGRFSNGYT+VD IA+QLGLP+I AY E+ S DQ+  GVNYASAA
Sbjct  62    KANYLPYGIDFNGGPTGRFSNGYTMVDEIAEQLGLPLIPAYSEA-SGDQVLNGVNYASAA  120

Query  412   AGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLN  591
             AGILD TG++F+GRIPF++QI NF  T +Q++ NL AD VA+ + +SIFFVGMGSNDYLN
Sbjct  121   AGILDITGRNFVGRIPFDQQIRNFHNTLDQITNNLGADDVARQVGRSIFFVGMGSNDYLN  180

Query  592   NYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARAD  771
             NY MP YPT   Y+  Q+A  L Q+Y++QLT LY LGARKFV+ G+G MGCIP++LA++ 
Sbjct  181   NYLMPNYPTRNQYNGRQYADLLTQEYSRQLTTLYNLGARKFVIAGLGVMGCIPSILAQSP  240

Query  772   NGECLESVNQAVLPFNANVKQMINKFSTTH-PDAKFVFIDTDKMFQHIMNNNKRYGFSVF  948
              G C +SVNQ V PFN NVK M++ F+    P AKF+FID  +MF+ I+ N+  YGFSV 
Sbjct  241   AGICSDSVNQLVQPFNENVKAMLSNFNANQLPGAKFIFIDVARMFREILTNSPAYGFSVI  300

Query  949   DRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPM  1128
             +RGCCG+G+N G++TCLPF+TPC NR++Y+FWDAFHPT AVNVL+G  AFNG   +VYPM
Sbjct  301   NRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAFHPTEAVNVLMGRKAFNGDLSMVYPM  360

Query  1129  TI  1134
              I
Sbjct  361   NI  362



>ref|XP_009773145.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=379

 Score =   426 bits (1094),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 227/368 (62%), Positives = 279/368 (76%), Gaps = 7/368 (2%)
 Frame = +1

Query  43    VFSA-LFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNL  219
             +FS  LF++ ++  SAI + V   A AP  G  G    ALVPAMFIFGDSLIDNGNNNNL
Sbjct  9     IFSCTLFVVFVLVNSAICQEVDD-ALAPEAG--GGRGRALVPAMFIFGDSLIDNGNNNNL  65

Query  220   FSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESP---SIDQMRYG  390
              SFAKANY PYGIDF+  PTGRFSNGYT+VD IA+ LGLP+I AY E+    S D+MRYG
Sbjct  66    PSFAKANYFPYGIDFDGGPTGRFSNGYTMVDEIAELLGLPLIPAYTEASADTSGDKMRYG  125

Query  391   VNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGM  570
             VNYASAAAGILD TG++F+GRIPFN+QI NFE T +Q++ NL A  VA+ L   +FFVGM
Sbjct  126   VNYASAAAGILDITGRNFVGRIPFNQQIKNFENTLDQITDNLGAPDVAQALAICMFFVGM  185

Query  571   GSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIP  750
             GSNDYLNNY MP Y T   Y+P Q+AS LVQQY+QQLTRLY LGARKFV+ G+G MGCIP
Sbjct  186   GSNDYLNNYLMPNYDTKNRYNPQQYASLLVQQYSQQLTRLYNLGARKFVIGGVGLMGCIP  245

Query  751   TMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKR  930
             ++LA+ +   C E VNQ VLPF+ NVK M++  +   P +KF+++D   MFQ ++ N +R
Sbjct  246   SILAQGNGNVCSEEVNQLVLPFSNNVKSMLSNLNANLPGSKFIYVDIKNMFQDLLANYRR  305

Query  931   YGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSN  1110
             YGFSV DRGCCG+G+N G++TCLP +TPC NR +Y+FWDAFHPT AVN+L G  AF+G  
Sbjct  306   YGFSVIDRGCCGIGRNRGQITCLPLQTPCPNRDQYIFWDAFHPTEAVNILFGRRAFSGGP  365

Query  1111  YLVYPMTI  1134
              +VYP+ I
Sbjct  366   DVVYPINI  373



>ref|XP_009597060.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana tomentosiformis]
Length=363

 Score =   425 bits (1092),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 215/328 (66%), Positives = 262/328 (80%), Gaps = 1/328 (0%)
 Frame = +1

Query  151   NALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQL  330
             NALVPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ L
Sbjct  31    NALVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDVIAQLL  90

Query  331   GLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
             GLP+I  Y E+ S DQMR+G+NYASAAAGILD TG++F+GRIPFN+QI NFE T NQ+ +
Sbjct  91    GLPLIPPYTEA-SGDQMRFGINYASAAAGILDITGRNFVGRIPFNQQITNFESTVNQIRS  149

Query  511   NLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrl  690
             NL    V + L KSIFFVGMGSNDYLNNY MP Y T   Y+  +FAS LVQQY QQL RL
Sbjct  150   NLGVSDVGEALAKSIFFVGMGSNDYLNNYLMPNYNTKNQYNAQEFASLLVQQYNQQLMRL  209

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
             Y LGARKFV+ G+G MGCIP++LA++ NG C + V+Q VLPF+ NV+ M+N F+T  P +
Sbjct  210   YNLGARKFVIGGVGLMGCIPSILAQSQNGACSDEVDQLVLPFHNNVRSMLNNFNTNLPGS  269

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             KFV+ID   MFQ ++ N ++YGFS  + GCCGVG+N G++TCLPF+TPC NR++++FWDA
Sbjct  270   KFVYIDIRNMFQDLLTNYRQYGFSEINNGCCGVGRNRGQITCLPFQTPCQNREQFIFWDA  329

Query  1051  FHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FHPT AVN+L G  AF+G + +VYP+ I
Sbjct  330   FHPTEAVNILFGRKAFSGGSDVVYPINI  357



>ref|XP_002278219.2| PREDICTED: GDSL esterase/lipase At1g71691 [Vitis vinifera]
Length=374

 Score =   424 bits (1091),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/332 (63%), Positives = 264/332 (80%), Gaps = 1/332 (0%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G     +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDF   PTGRFSNGYT+VD I
Sbjct  29    GGAKREMVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFEGGPTGRFSNGYTMVDEI  88

Query  319   AKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKN  498
             A+QLGLP+  AY E+ S +++ +GVN+ASAAAGILD TG++F+GRIPFN+QI NFE T +
Sbjct  89    AEQLGLPLTPAYSEA-SGEEVLHGVNFASAAAGILDITGRNFVGRIPFNQQIRNFENTLD  147

Query  499   QLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqq  678
             Q++ NL AD VA+ + K IFFVGMGSNDYLNNY MP Y T   Y+  QFA+ L+QQY +Q
Sbjct  148   QITDNLGADNVAEAIAKCIFFVGMGSNDYLNNYLMPNYATRNQYNGQQFANLLIQQYNRQ  207

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTT  858
             L  LY LGAR+FVL G+G MGCIP++LA++    C + VN  +LPFNANV+ M+N+ ++ 
Sbjct  208   LNTLYNLGARRFVLAGLGIMGCIPSILAQSPTSRCSDDVNHLILPFNANVRAMVNRLNSN  267

Query  859   HPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P AKF++ID  +MFQ I++N++ YGFSV +RGCCG+G+NSG++TCLPF+TPCSNR++Y+
Sbjct  268   LPGAKFIYIDVYRMFQDILSNSRNYGFSVINRGCCGIGRNSGQITCLPFQTPCSNREQYV  327

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT AVN+++G  AFNG    VYPM I
Sbjct  328   FWDAFHPTEAVNIIMGRKAFNGDKSAVYPMNI  359



>ref|XP_011095918.1| PREDICTED: GDSL esterase/lipase At1g71691 [Sesamum indicum]
Length=372

 Score =   424 bits (1090),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/333 (65%), Positives = 260/333 (78%), Gaps = 1/333 (0%)
 Frame = +1

Query  136   SGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDS  315
             +GE   ALVPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDF   PTGRFSNGYT+VD+
Sbjct  35    AGEMRRALVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFKGGPTGRFSNGYTMVDT  94

Query  316   IAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTK  495
             IA+ LGLP+I AY E+ S DQMRYGVNYASAA+GILD TG++F+ RIPF +QI NFE T 
Sbjct  95    IAELLGLPLIPAYSEA-SGDQMRYGVNYASAASGILDITGRNFVSRIPFGQQIRNFENTL  153

Query  496   NQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytq  675
             +Q++ NL A  VA+ L K IFFVGMGSNDYLNNY MP Y T   Y+  Q++  LVQQY+Q
Sbjct  154   DQITDNLGAPDVAQALAKCIFFVGMGSNDYLNNYLMPNYNTRNQYNAQQYSDLLVQQYSQ  213

Query  676   qltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFST  855
             QLTRLY LGARKFV+ G+G MGCIP++LA+++NG C E VNQ VLPFN   K MIN  S 
Sbjct  214   QLTRLYNLGARKFVIAGLGLMGCIPSILAQSNNGVCSEEVNQLVLPFNTKTKAMINNLSA  273

Query  856   THPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEY  1035
               P A+F +ID   MFQ ++ N + YGF+V +RGCCG+G+N G++TCLPF+TPC NR +Y
Sbjct  274   NLPGARFSYIDIRHMFQDLLANARSYGFTVVNRGCCGIGRNRGQITCLPFQTPCPNRNQY  333

Query  1036  LFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +FWDAFHPT AVNVL G  AF G+  +VYPM I
Sbjct  334   IFWDAFHPTEAVNVLFGRRAFYGNRDVVYPMNI  366



>ref|XP_010064853.1| PREDICTED: GDSL esterase/lipase At1g71691 [Eucalyptus grandis]
Length=502

 Score =   427 bits (1098),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/326 (66%), Positives = 262/326 (80%), Gaps = 1/326 (0%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             LVPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRF NGYT+VD IA+ +GL
Sbjct  172   LVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNRGPTGRFCNGYTMVDEIAELVGL  231

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P+I AY E+ S  Q+ +GVNYASAAAGILD TG++F+GRIPF++QI NF+ T +Q++ NL
Sbjct  232   PLIPAYSEA-SGQQLLHGVNYASAAAGILDITGRNFVGRIPFDQQITNFQSTLDQITDNL  290

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              AD VA+ L + +FFVGMGSNDYLNNY MP Y T   Y+  QFA  LVQQYT+QLT LY 
Sbjct  291   GADDVARALARCLFFVGMGSNDYLNNYLMPNYDTKNQYNGQQFADLLVQQYTRQLTTLYN  350

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
             LGARKF++ GIG+MGCIP++LA+ + G C E VN+ V PFNANVK MIN  +   P AKF
Sbjct  351   LGARKFIIAGIGEMGCIPSILAQNEAGICSEEVNRLVQPFNANVKTMINNLNVNLPGAKF  410

Query  877   VFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFH  1056
             ++ID  +MFQ I+ N + YGFSV DRGCCG+G+NSG++TCLPF+TPC+NR++Y+FWDAFH
Sbjct  411   IYIDIARMFQDIVTNARSYGFSVVDRGCCGIGRNSGQITCLPFQTPCANRKQYVFWDAFH  470

Query  1057  PTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PT AVNV++G  AFNG   +VYP+ I
Sbjct  471   PTEAVNVIMGRKAFNGDPSIVYPINI  496



>ref|XP_009357251.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Pyrus x bretschneideri]
 ref|XP_009362505.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Pyrus x bretschneideri]
Length=389

 Score =   423 bits (1087),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/325 (65%), Positives = 262/325 (81%), Gaps = 1/325 (0%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMFIFGDSLIDNGNNN++ SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGLP
Sbjct  54    VPAMFIFGDSLIDNGNNNDIPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLP  113

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             +I A+ E+ S DQMR+GVNYASAAAGILD TG++F+GRIPF+EQI NF+ T +Q++ NL 
Sbjct  114   LIPAHSEA-SGDQMRHGVNYASAAAGILDDTGRNFVGRIPFSEQIRNFQNTLDQITGNLG  172

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytl  699
             AD  A+ + K IFFVGMGSNDYLNNY MP YPT   Y+  Q+A  L Q+YTQQLTRLY L
Sbjct  173   ADDAARSIAKCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLAQEYTQQLTRLYNL  232

Query  700   GARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFV  879
             GARKFV+ G+G+MGCIP++LA+  +G C + VN+ VLPFN NVK MIN  +   P +KF+
Sbjct  233   GARKFVIAGLGRMGCIPSILAQNPSGTCSDEVNRLVLPFNTNVKTMINNLNANLPSSKFI  292

Query  880   FIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHP  1059
             +ID  +MF+ ++ N++ YGFSV +RGCCG+G+N G+VTCLPF+TPC NR +Y+FWDAFHP
Sbjct  293   YIDIARMFEDMLLNSRSYGFSVANRGCCGIGRNRGQVTCLPFQTPCPNRDQYIFWDAFHP  352

Query  1060  TSAVNVLLGNLAFNGSNYLVYPMTI  1134
             TSAVN+++G  AF+G    VYPM I
Sbjct  353   TSAVNIIIGRKAFSGDRTEVYPMNI  377



>gb|KHN20549.1| GDSL esterase/lipase [Glycine soja]
Length=342

 Score =   421 bits (1082),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/331 (64%), Positives = 262/331 (79%), Gaps = 1/331 (0%)
 Frame = +1

Query  142   EGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIA  321
              G   +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA
Sbjct  7     RGQREMVPAMFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIA  66

Query  322   KQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQ  501
             + LGLP+I AY E+ S +Q+ +GVNYASAAAGILD TG++F+GRIPF++Q+ NFE T NQ
Sbjct  67    ELLGLPLIPAYTEA-SGNQVLHGVNYASAAAGILDATGRNFVGRIPFDQQLRNFENTLNQ  125

Query  502   LSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqql  681
             ++ NL AD +A  L + IFFVGMGSNDYLNNY MP YPT   Y+  Q+A  LVQ Y+QQL
Sbjct  126   ITGNLGADYMATALARCIFFVGMGSNDYLNNYLMPNYPTRNQYNGQQYADLLVQTYSQQL  185

Query  682   trlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             TRLY LGARKFV+ G+G+MGCIP++LA++  G C E VN  V PFN NVK M+  F+   
Sbjct  186   TRLYNLGARKFVIAGLGEMGCIPSILAQSTTGTCSEEVNLLVQPFNENVKTMLGNFNNNL  245

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             P A+F+F D+ +MFQ I+ N + YGF+V +RGCCG+G+N G++TCLPF+TPC NR++Y+F
Sbjct  246   PGARFIFADSSRMFQDILLNARSYGFAVVNRGCCGIGRNRGQITCLPFQTPCPNRRQYVF  305

Query  1042  WDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             WDAFHPT AVN+L+G +AFNG+   VYP+ I
Sbjct  306   WDAFHPTEAVNILMGRMAFNGNPNFVYPINI  336



>ref|XP_010683198.1| PREDICTED: GDSL esterase/lipase At1g71691 [Beta vulgaris subsp. 
vulgaris]
Length=377

 Score =   421 bits (1082),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 213/329 (65%), Positives = 260/329 (79%), Gaps = 1/329 (0%)
 Frame = +1

Query  148   NNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQ  327
             N ALVPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSN YTIVD+IA  
Sbjct  39    NKALVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNAGPTGRFSNAYTIVDAIADS  98

Query  328   LGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLS  507
             LGLP+I AY E+   +QM +G+NYASAAAGILD TG++F+GRIPFN+Q+ NFE T + ++
Sbjct  99    LGLPLIPAYSEARG-EQMLHGINYASAAAGILDVTGRNFVGRIPFNQQVRNFESTLDAIT  157

Query  508   ANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltr  687
             ANL AD V + + + +FFVGMGSNDYLNNY MP YPT   Y+  QFA+ LVQQYT QLTR
Sbjct  158   ANLGADDVGRSIAQCLFFVGMGSNDYLNNYLMPNYPTRNQYNAQQFANLLVQQYTTQLTR  217

Query  688   lytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             LY LG RKF + G+GKMGCIP++LA++  G C ++VN  V PFNANVK+MIN  ++  P 
Sbjct  218   LYNLGGRKFAIAGLGKMGCIPSILAQSPTGNCSDAVNNLVQPFNANVKKMINNLNSKLPA  277

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             +KF++I+ D MF+ I+ +   YGF V DRGCCG+G+N G++TCLPF+TPC NR+EY+FWD
Sbjct  278   SKFIYINIDNMFRDILASPADYGFRVIDRGCCGIGRNQGQITCLPFQTPCMNREEYVFWD  337

Query  1048  AFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             AFHP+S VNVLLG  AFNG   + YPM I
Sbjct  338   AFHPSSHVNVLLGKKAFNGGLDVAYPMNI  366



>ref|XP_007223318.1| hypothetical protein PRUPE_ppa007324mg [Prunus persica]
 gb|EMJ24517.1| hypothetical protein PRUPE_ppa007324mg [Prunus persica]
Length=373

 Score =   421 bits (1082),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 216/339 (64%), Positives = 266/339 (78%), Gaps = 2/339 (1%)
 Frame = +1

Query  121   PTLGFSGEGNNA-LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNG  297
             P     G G +A +VPAMF+FGDSLIDNGNNNN+ SFAKANY PYGIDFN  PTGRFSNG
Sbjct  24    PQGQVGGGGRSAEMVPAMFVFGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFSNG  83

Query  298   YTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQID  477
             YT+VD IA+ LGLP+I  + E+ S DQ+ +GVNYASAAAGILD TG++F+GRIPF EQI 
Sbjct  84    YTMVDEIAELLGLPLIPPFSEA-SGDQVLHGVNYASAAAGILDITGRNFVGRIPFGEQIR  142

Query  478   NFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStl  657
             NF+ T +Q++ NL AD VA  +   IFFVGMGSNDYLNNY MP YPT   Y+  QFA  L
Sbjct  143   NFQSTLDQITDNLGADDVAGAIADCIFFVGMGSNDYLNNYLMPNYPTRTQYNAPQFADLL  202

Query  658   vqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQM  837
              QQYTQQLTRLY LGARKFV+ G+G+MGCIP++LA++ +G C E VN+ VLPFNANVK M
Sbjct  203   TQQYTQQLTRLYNLGARKFVVAGLGRMGCIPSILAQSPSGRCNEEVNRLVLPFNANVKTM  262

Query  838   INKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPC  1017
             INK +T  P AKF++ID  ++F+ I+NN + YGF+V +RGCCG+G+N G++TCLP +TPC
Sbjct  263   INKLNTNLPGAKFIYIDIARIFEDIVNNARSYGFTVANRGCCGIGRNRGQITCLPLQTPC  322

Query  1018  SNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
              NR +Y+FWDAFHPT+A N+++G  AFNG    VYPM I
Sbjct  323   PNRDQYIFWDAFHPTAAANIIIGRKAFNGDLSQVYPMNI  361



>ref|XP_002325955.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEF00337.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=373

 Score =   421 bits (1081),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 213/327 (65%), Positives = 262/327 (80%), Gaps = 2/327 (1%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+QLGL
Sbjct  37    MVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAEQLGL  96

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P+I AY E+ S DQ+  GVNYASAAAGILD TG++F+GRIPF++QI NF+ T +Q++ NL
Sbjct  97    PLIPAYSEA-SGDQVLNGVNYASAAAGILDITGRNFVGRIPFDQQIRNFQNTLDQITNNL  155

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              AD VA+ + +SIFFVGMGSNDYLNNY MP YPT   Y+  Q+A  L Q+Y++QLT LY 
Sbjct  156   GADDVARQVGRSIFFVGMGSNDYLNNYLMPNYPTRNQYNGRQYADLLTQEYSRQLTSLYN  215

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH-PDAK  873
             LGARKFV+ G+G MGCIP++LA++  G C +SVNQ V PFN NVK M++ F+    P AK
Sbjct  216   LGARKFVIAGLGVMGCIPSILAQSPAGICSDSVNQLVQPFNENVKAMLSNFNANQLPGAK  275

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
              +FID  +MF+ I+ N+  YGFSV +RGCCG+G+N G++TCLPF+TPC NR++Y+FWDAF
Sbjct  276   SIFIDVARMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAF  335

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT AVNVL+G  AFNG   +VYPM I
Sbjct  336   HPTEAVNVLMGRKAFNGDLSMVYPMNI  362



>ref|XP_008219080.1| PREDICTED: GDSL esterase/lipase At1g71691 [Prunus mume]
Length=389

 Score =   421 bits (1082),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 211/326 (65%), Positives = 262/326 (80%), Gaps = 1/326 (0%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPAMF+FGDSLIDNGNNNN+ SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGL
Sbjct  53    MVPAMFVFGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGL  112

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P+I  + E+ S DQ+ +GVNYASAAAGILD TG++F+GRIPF EQI NF+ T +Q++ NL
Sbjct  113   PLIPPFSEA-SGDQVLHGVNYASAAAGILDITGRNFVGRIPFGEQISNFQSTLDQITDNL  171

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              AD VA+ +   IFFVGMGSNDYLNNY MP YPT   Y+  QFA  L QQYTQQLTRLY 
Sbjct  172   GADDVARAIADCIFFVGMGSNDYLNNYLMPNYPTRTQYNAPQFADLLTQQYTQQLTRLYN  231

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
             LGARKFV+ G+G+MGCIP++LA++ +G C E VN+ VLPFNANVK MINK +T  P AKF
Sbjct  232   LGARKFVVAGLGRMGCIPSILAQSPSGRCNEEVNRLVLPFNANVKTMINKLNTNLPGAKF  291

Query  877   VFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFH  1056
             ++ID  ++F+ I+NN + YGF+V +RGCCG+G+N G++TCLP +TPC NR +Y+FWDAFH
Sbjct  292   IYIDIARIFEDIVNNARSYGFTVANRGCCGIGRNRGQITCLPLQTPCPNRDQYIFWDAFH  351

Query  1057  PTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PT+A N+++G  AFNG    VYP+ I
Sbjct  352   PTAAANIIIGRKAFNGDLSQVYPVNI  377



>ref|XP_006582440.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Glycine max]
Length=360

 Score =   420 bits (1079),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 210/331 (63%), Positives = 262/331 (79%), Gaps = 1/331 (0%)
 Frame = +1

Query  142   EGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIA  321
              G   +VPA+FIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA
Sbjct  25    RGQREMVPALFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIA  84

Query  322   KQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQ  501
             + LGLP+I AY E+ S +Q+ +GVNYASAAAGILD TG++F+GRIPF++Q+ NFE T NQ
Sbjct  85    ELLGLPLIPAYTEA-SGNQVLHGVNYASAAAGILDATGRNFVGRIPFDQQLRNFENTLNQ  143

Query  502   LSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqql  681
             ++ NL AD +A  L + IFFVGMGSNDYLNNY MP YPT   Y+  Q+A  LVQ Y+QQL
Sbjct  144   ITGNLGADYMATALARCIFFVGMGSNDYLNNYLMPNYPTRNQYNGQQYADLLVQTYSQQL  203

Query  682   trlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             TRLY LGARKFV+ G+G+MGCIP++LA++  G C E VN  V PFN NVK M+  F+   
Sbjct  204   TRLYNLGARKFVIAGLGEMGCIPSILAQSTTGTCSEEVNLLVQPFNENVKTMLGNFNNNL  263

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             P A+F+F D+ +MFQ I+ N + YGF+V +RGCCG+G+N G++TCLPF+TPC NR++Y+F
Sbjct  264   PGARFIFADSSRMFQDILLNARSYGFAVVNRGCCGIGRNRGQITCLPFQTPCPNRRQYVF  323

Query  1042  WDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             WDAFHPT AVN+L+G +AFNG+   VYP+ I
Sbjct  324   WDAFHPTEAVNILMGRMAFNGNPNFVYPINI  354



>ref|XP_010265554.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nelumbo nucifera]
Length=382

 Score =   420 bits (1080),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 216/333 (65%), Positives = 259/333 (78%), Gaps = 1/333 (0%)
 Frame = +1

Query  136   SGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDS  315
             +G     LVPA+FIFGDSLIDNGNNNNL SFAKANY PYGIDF    TGRFSNGYT+VD 
Sbjct  40    AGGTRRELVPALFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFQGGATGRFSNGYTMVDE  99

Query  316   IAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTK  495
             IA+ LGLP+I AY E+ S ++M +GVNYASAAAGILD TG++F+GRIPFN+QI N+E T 
Sbjct  100   IAELLGLPLIPAYSEA-SGEEMLHGVNYASAAAGILDITGRNFVGRIPFNQQIRNYENTL  158

Query  496   NQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytq  675
             +Q++ NL AD  A+ + + IFFVGMGSNDYLNNY MP YPT   Y   QFA  LVQQYT 
Sbjct  159   DQITDNLGADDAARSIARCIFFVGMGSNDYLNNYLMPNYPTQNQYSSQQFADLLVQQYTT  218

Query  676   qltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFST  855
             QLTRLY LGARKFV+ G+G MGCIP +LA+  NG C ++VNQ VLPFN+NVK MIN  + 
Sbjct  219   QLTRLYNLGARKFVVAGLGLMGCIPNILAQDQNGRCSDTVNQLVLPFNSNVKTMINNLNA  278

Query  856   THPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEY  1035
               P AKF++ID  +MF  I+     YGFSV DRGCCGVG+NSG++TCLPFETPCSNR +Y
Sbjct  279   DLPGAKFIYIDVYRMFYDILTRPTNYGFSVIDRGCCGVGRNSGQITCLPFETPCSNRNQY  338

Query  1036  LFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +FWDAFHPT  VNV++G  +F+G++  VYPM I
Sbjct  339   VFWDAFHPTERVNVIMGRESFSGNSKYVYPMNI  371



>ref|XP_008361601.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g71691-like 
[Malus domestica]
Length=391

 Score =   420 bits (1080),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 209/325 (64%), Positives = 262/325 (81%), Gaps = 1/325 (0%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMFIFGDSLIDNGNNN+L SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGLP
Sbjct  56    VPAMFIFGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLP  115

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             +I A+ E+ S DQMR+GVNYASAAAGILD TG++F+GRIPF+EQI NF+ T +Q++ NL 
Sbjct  116   LIPAHSEA-SGDQMRHGVNYASAAAGILDDTGRNFVGRIPFSEQIRNFQNTLDQITDNLG  174

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytl  699
             AD  A+ + K I+FVGMGSNDYLNNY MP YPT   Y+  Q+A  L Q+YTQQLTRLY L
Sbjct  175   ADDAARSIAKCIYFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLAQEYTQQLTRLYNL  234

Query  700   GARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFV  879
             GARKFV+ G+G+ GCIP++LA+  +G C + VN+ VLPFN NVK MIN  +T  P +KF+
Sbjct  235   GARKFVIAGLGEXGCIPSILAQNPSGTCSDEVNRLVLPFNTNVKTMINNLNTNLPGSKFI  294

Query  880   FIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHP  1059
             ++D  +MF+ ++ N++ YGFSV +RGCCG+G+N G+VTCLPF+TPC NR +Y+FWDAFHP
Sbjct  295   YVDIARMFEDMLLNSRSYGFSVANRGCCGIGRNRGQVTCLPFQTPCPNRDQYIFWDAFHP  354

Query  1060  TSAVNVLLGNLAFNGSNYLVYPMTI  1134
             TSAVN+++G  AF+G    VYPM +
Sbjct  355   TSAVNIIIGRKAFSGDRTEVYPMNV  379



>gb|KHN47078.1| GDSL esterase/lipase [Glycine soja]
Length=358

 Score =   418 bits (1075),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 213/347 (61%), Positives = 266/347 (77%), Gaps = 1/347 (0%)
 Frame = +1

Query  94    EPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNN  273
              P+ VL      G    G   +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  
Sbjct  7     SPILVLFMLLMSGGIVRGQREMVPAMFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFNGG  66

Query  274   PTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGR  453
             PTGRFSNGYT+VD IA+ LGLP+I AY E+ S +Q+ +GVNYASAAAGILD TG++F+GR
Sbjct  67    PTGRFSNGYTMVDEIAELLGLPLIPAYTEA-SGNQVLHGVNYASAAAGILDATGRNFVGR  125

Query  454   IPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYD  633
             IPF++Q+ NFE T NQ++ NL AD +   L + IFFVGMGSNDYLNNY MP YPT   Y+
Sbjct  126   IPFDQQLSNFENTLNQITGNLGADYMGTALARCIFFVGMGSNDYLNNYLMPNYPTRNQYN  185

Query  634   PNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLP  813
               Q+A  LVQ Y+QQLTRLY LGARKFV+ G+G+MGCIP++LA++  G C + VN  V P
Sbjct  186   GQQYADLLVQTYSQQLTRLYNLGARKFVIAGLGQMGCIPSILAQSMTGTCSKEVNLLVKP  245

Query  814   FNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVT  993
             FN NVK M+  F+   P A+F+F D+ +MFQ I+ N + YGF+V +RGCCG+G+N G++T
Sbjct  246   FNENVKTMLGNFNNNLPGARFIFADSSRMFQDILLNARSYGFTVVNRGCCGIGRNRGQIT  305

Query  994   CLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             CLPF+TPC NR++Y+FWDAFHPT AVN+L+G +AFNG+   VYP+ I
Sbjct  306   CLPFQTPCPNRRQYVFWDAFHPTEAVNILMGRMAFNGNPNFVYPINI  352



>ref|XP_006376145.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|ERP53942.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=373

 Score =   419 bits (1076),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 212/327 (65%), Positives = 260/327 (80%), Gaps = 2/327 (1%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+QLGL
Sbjct  37    MVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAEQLGL  96

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P+I AY E+ S DQ+  G+NYASAAAGILD TG++F+GRIPF+EQI NF+ T +Q++  L
Sbjct  97    PLIPAYSEA-SGDQVLNGINYASAAAGILDVTGRNFVGRIPFDEQIRNFQNTLDQITDTL  155

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              AD VA+ + +S+FFVGMGSNDYLNNY MP YPT   Y+  QFA  L Q+Y++QLT+LY 
Sbjct  156   GADDVARQVGRSLFFVGMGSNDYLNNYLMPNYPTRNRYNGRQFADLLTQEYSRQLTKLYN  215

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH-PDAK  873
             LGARKFV+ G+G MGCIP++LA++  G C +SVN+ V PFN NVK M+  F+    P AK
Sbjct  216   LGARKFVIAGLGVMGCIPSILAQSPAGNCSDSVNKLVQPFNENVKAMLKNFNANQLPGAK  275

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
             F+FID   MF+ I+ N+  YGFSV +RGCCG+G+N G++TCLPF+TPC NR++Y+FWDAF
Sbjct  276   FIFIDVAHMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAF  335

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT AVNVL+G  AFNG    VYPM I
Sbjct  336   HPTEAVNVLMGRKAFNGDLSKVYPMNI  362



>emb|CBI39225.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   417 bits (1071),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 259/322 (80%), Gaps = 1/322 (0%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIA  348
             MFIFGDSLIDNGNNNNL SFAKANY PYGIDF   PTGRFSNGYT+VD IA+QLGLP+  
Sbjct  1     MFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFEGGPTGRFSNGYTMVDEIAEQLGLPLTP  60

Query  349   AYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV  528
             AY E+ S +++ +GVN+ASAAAGILD TG++F+GRIPFN+QI NFE T +Q++ NL AD 
Sbjct  61    AYSEA-SGEEVLHGVNFASAAAGILDITGRNFVGRIPFNQQIRNFENTLDQITDNLGADN  119

Query  529   VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGAR  708
             VA+ + K IFFVGMGSNDYLNNY MP Y T   Y+  QFA+ L+QQY +QL  LY LGAR
Sbjct  120   VAEAIAKCIFFVGMGSNDYLNNYLMPNYATRNQYNGQQFANLLIQQYNRQLNTLYNLGAR  179

Query  709   KFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFID  888
             +FVL G+G MGCIP++LA++    C + VN  +LPFNANV+ M+N+ ++  P AKF++ID
Sbjct  180   RFVLAGLGIMGCIPSILAQSPTSRCSDDVNHLILPFNANVRAMVNRLNSNLPGAKFIYID  239

Query  889   TDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSA  1068
               +MFQ I++N++ YGFSV +RGCCG+G+NSG++TCLPF+TPCSNR++Y+FWDAFHPT A
Sbjct  240   VYRMFQDILSNSRNYGFSVINRGCCGIGRNSGQITCLPFQTPCSNREQYVFWDAFHPTEA  299

Query  1069  VNVLLGNLAFNGSNYLVYPMTI  1134
             VN+++G  AFNG    VYPM I
Sbjct  300   VNIIMGRKAFNGDKSAVYPMNI  321



>gb|EYU28214.1| hypothetical protein MIMGU_mgv1a008192mg [Erythranthe guttata]
Length=381

 Score =   418 bits (1074),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 216/338 (64%), Positives = 259/338 (77%), Gaps = 7/338 (2%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G G+  LVPAMFIFGDSLIDNGNNNNL S AKANY PYGIDFN  PTGRFSNGYT+VD+I
Sbjct  39    GSGSQELVPAMFIFGDSLIDNGNNNNLASLAKANYFPYGIDFNGGPTGRFSNGYTMVDTI  98

Query  319   AKQLGLPMIAAYLE-SPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTK  495
             A+ LGLP+I AY E S S DQMRYGVNYASAAAGILD TG++F+ RIPFN+QI NFE + 
Sbjct  99    AESLGLPLIPAYSEASSSPDQMRYGVNYASAAAGILDITGRNFVSRIPFNQQIKNFENSL  158

Query  496   NQLSANL-----SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlv  660
             +Q++ ++      ADV A+ L+K IFFVGMGSNDYLNNY MP Y T   Y+P Q+A  L 
Sbjct  159   DQITNSIVGAPPPADV-AQALSKCIFFVGMGSNDYLNNYLMPNYDTKNHYNPQQYADLLA  217

Query  661   qqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMI  840
             +QY+QQLTRLY LGARKFV+ G+G MGCIP++LA+  NG C E VNQ VLPFN N   ++
Sbjct  218   EQYSQQLTRLYNLGARKFVIAGLGLMGCIPSILAQNSNGICSEEVNQLVLPFNTNTMSIM  277

Query  841   NKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCS  1020
             N  +T  P AKF +ID   +FQ ++ N   YGF V +RGCCG+G+N G++TCLPF+TPC 
Sbjct  278   NNLTTNLPGAKFSYIDIRNLFQDLIANAGSYGFGVLNRGCCGIGRNRGQITCLPFQTPCP  337

Query  1021  NRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
              R +Y+FWDAFHPT AVNVL G  AFNGS + VYP+ I
Sbjct  338   ERNQYIFWDAFHPTEAVNVLFGQRAFNGSTHFVYPINI  375



>gb|KHG24758.1| hypothetical protein F383_07589 [Gossypium arboreum]
Length=373

 Score =   417 bits (1071),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/332 (63%), Positives = 257/332 (77%), Gaps = 1/332 (0%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G     +VPAMFIFGDSLIDNGNNN+L SFAKANY PYGIDFN  PTGRFSNGYT+VD I
Sbjct  37    GGRRREMVPAMFIFGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEI  96

Query  319   AKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKN  498
             A+ LGLP+I AY E+ S DQ+ +GVNYASAAAGILD TG++F+GRIPF++QI NF+ T +
Sbjct  97    AELLGLPLIPAYSEA-SGDQVLHGVNYASAAAGILDITGRNFVGRIPFDQQIQNFQTTLD  155

Query  499   QLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqq  678
             QL+ NL A   A+ L K IFFVGMGSNDYLNNY MP +PT   YD  Q+A  LVQ+Y QQ
Sbjct  156   QLADNLGAIEAAEALGKCIFFVGMGSNDYLNNYLMPNFPTRNQYDGQQYADLLVQKYNQQ  215

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTT  858
             L  LY LGARKFVL G+G+MGCIP++LA++  G C E VNQ VLPFNANVK M+N  +  
Sbjct  216   LRTLYNLGARKFVLAGLGRMGCIPSILAQSTAGSCSEEVNQLVLPFNANVKTMMNSLNAN  275

Query  859   HPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P A+F+++D   +F+ I+ N + YGFSV +RGCCG+G+N G++TCLPF+TPC NR EY+
Sbjct  276   LPGARFIYVDIAHLFEDIVANARTYGFSVVNRGCCGIGRNRGQITCLPFQTPCENRDEYV  335

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT  VN+++   AFNG   +VYP+ I
Sbjct  336   FWDAFHPTEKVNIIMARKAFNGDPSIVYPINI  367



>ref|NP_001242345.1| uncharacterized protein LOC100779380 precursor [Glycine max]
 gb|ACU17689.1| unknown [Glycine max]
Length=358

 Score =   415 bits (1067),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 212/347 (61%), Positives = 265/347 (76%), Gaps = 1/347 (0%)
 Frame = +1

Query  94    EPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNN  273
              P+ VL      G    G   +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  
Sbjct  7     SPILVLFMLLMSGGIVRGQREMVPAMFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFNGG  66

Query  274   PTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGR  453
             PTGRFSNGYT+VD IA+ LGLP+I AY E+ S +Q+ +GVNYASAAAGILD TG++F+GR
Sbjct  67    PTGRFSNGYTMVDEIAELLGLPLIPAYTEA-SGNQVLHGVNYASAAAGILDATGRNFVGR  125

Query  454   IPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYD  633
             IPF++Q+ NFE T NQ++ NL AD +     + IFFVGMGSNDYLNNY MP YPT   Y+
Sbjct  126   IPFDQQLSNFENTLNQITGNLGADYMGTAPARCIFFVGMGSNDYLNNYLMPNYPTRNQYN  185

Query  634   PNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLP  813
               Q+A  LVQ Y+QQLTRLY LGARKFV+ G+G+MGCIP++LA++  G C + VN  V P
Sbjct  186   GQQYADLLVQTYSQQLTRLYNLGARKFVIAGLGQMGCIPSILAQSMTGTCSKEVNLLVKP  245

Query  814   FNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVT  993
             FN NVK M+  F+   P A+F+F D+ +MFQ I+ N + YGF+V +RGCCG+G+N G++T
Sbjct  246   FNENVKTMLGNFNNNLPGARFIFADSSRMFQDILLNARSYGFTVVNRGCCGIGRNRGQIT  305

Query  994   CLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             CLPF+TPC NR++Y+FWDAFHPT AVN+L+G +AFNG+   VYP+ I
Sbjct  306   CLPFQTPCPNRRQYVFWDAFHPTEAVNILMGRMAFNGNPNFVYPINI  352



>ref|XP_004301466.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Fragaria vesca 
subsp. vesca]
Length=336

 Score =   414 bits (1065),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 209/326 (64%), Positives = 257/326 (79%), Gaps = 1/326 (0%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDF+  PTGRFSNGYT+VD IA+ LGL
Sbjct  1     MVPAMFIFGDSLIDNGNNNNLPSFAKANYPPYGIDFSGGPTGRFSNGYTMVDEIAELLGL  60

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P+I A+ E+   DQ+ +GVNYASAAAGILD TG++F+GRIPF +QI NF+ T +Q++ NL
Sbjct  61    PLIPAFSEATG-DQVLHGVNYASAAAGILDITGRNFVGRIPFGQQIKNFQTTLDQITENL  119

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              AD VA+ + K IFFVGMGSNDYLNNY MP Y T   Y+  QFA  L QQYT  LTRLY 
Sbjct  120   GADDVARAIGKCIFFVGMGSNDYLNNYLMPNYDTKNQYNAQQFADLLAQQYTHHLTRLYN  179

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
             LGARKFV+ G+G+MGCIP++LA++ NG C E VN  VLPFNANVK MIN  +T  P +KF
Sbjct  180   LGARKFVIAGVGRMGCIPSILAQSPNGSCSEDVNLLVLPFNANVKAMINNLNTNLPGSKF  239

Query  877   VFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFH  1056
             ++ID  +MF+ I+ N + YG SV +RGCCG+G+N G++TCLP +TPC NR +Y+FWDAFH
Sbjct  240   IYIDIAQMFEDIVTNARVYGLSVANRGCCGIGRNRGQITCLPMQTPCPNRDQYVFWDAFH  299

Query  1057  PTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PT+AVN+++G  AF+G    VYPM I
Sbjct  300   PTAAVNIIIGRKAFSGDFSQVYPMNI  325



>ref|XP_011005437.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X2 [Populus 
euphratica]
Length=360

 Score =   415 bits (1067),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 213/333 (64%), Positives = 262/333 (79%), Gaps = 3/333 (1%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G G N +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD I
Sbjct  19    GLGQN-MVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEI  77

Query  319   AKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKN  498
             A+QLGLP+I AY E+ S DQ+   +NYASAAAGILD TG++F+GRIPF+EQI NF+ T +
Sbjct  78    AEQLGLPLIPAYSEA-SGDQVLNAINYASAAAGILDVTGRNFVGRIPFDEQIRNFQNTLD  136

Query  499   QLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqq  678
             Q++  L AD VA+ + +S+FFVGMGSNDYLNNY MP YPT   Y+  QFA  L Q+Y++Q
Sbjct  137   QITDTLGADDVARQVLRSLFFVGMGSNDYLNNYLMPNYPTRNRYNGRQFADLLTQEYSRQ  196

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTT  858
             LT+LY LGARKFV+ G+G MGCIP++LA++  G C +SVN+ V PFN NVK M+  F+  
Sbjct  197   LTKLYNLGARKFVIAGLGVMGCIPSILAQSPAGNCSDSVNKLVQPFNENVKAMLKNFNAN  256

Query  859   H-PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEY  1035
                 AKF+FID  +MF+ I+ N+  YGFSV +RGCCG+G+N G++TCLPF+TPC NR++Y
Sbjct  257   QLSGAKFIFIDVAQMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQY  316

Query  1036  LFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +FWDAFHPT AVNVL+G  AFNG    VYPM I
Sbjct  317   VFWDAFHPTEAVNVLMGRKAFNGDLSKVYPMNI  349



>ref|XP_008339092.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g71691, 
partial [Malus domestica]
Length=337

 Score =   414 bits (1064),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 259/323 (80%), Gaps = 1/323 (0%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMFIFGDSLIDNGNNN+L SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGLP
Sbjct  2     VPAMFIFGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLP  61

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             +I A+ E+ S DQMR+GVNYASAAAGILD TG +F+GRIPF+EQI NF+ T +Q++ NL 
Sbjct  62    LIPAHSEA-SGDQMRHGVNYASAAAGILDDTGGNFVGRIPFSEQIRNFQNTLDQITDNLG  120

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytl  699
             AD  A+ + K I+FVGMGSNDYLNNY MP Y T   Y+  Q+A  L Q+YTQQLTRLY L
Sbjct  121   ADDAARSIAKCIYFVGMGSNDYLNNYLMPNYXTRNQYNAQQYADLLAQEYTQQLTRLYNL  180

Query  700   GARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFV  879
             GARKFV+ G+G+MGCIP++LA+  +G C + VN+ VLPFN NVK MIN  +T  P +KF+
Sbjct  181   GARKFVIAGLGRMGCIPSILAQNPSGTCSDEVNRLVLPFNTNVKTMINNLNTNLPGSKFI  240

Query  880   FIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHP  1059
             ++D  +MF+ ++ N++ YGFS  +RGCCG+G+N G+VTCLPF+TPC NR +Y+FWDAFHP
Sbjct  241   YVDIARMFEDMLLNSRSYGFSXANRGCCGIGRNRGQVTCLPFQTPCPNRDQYIFWDAFHP  300

Query  1060  TSAVNVLLGNLAFNGSNYLVYPM  1128
             TSAVN+++G  AF+G    VYPM
Sbjct  301   TSAVNIIIGRKAFSGDRTEVYPM  323



>ref|XP_011005436.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X1 [Populus 
euphratica]
Length=373

 Score =   415 bits (1067),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/327 (64%), Positives = 259/327 (79%), Gaps = 2/327 (1%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+QLGL
Sbjct  37    MVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAEQLGL  96

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P+I AY E+ S DQ+   +NYASAAAGILD TG++F+GRIPF+EQI NF+ T +Q++  L
Sbjct  97    PLIPAYSEA-SGDQVLNAINYASAAAGILDVTGRNFVGRIPFDEQIRNFQNTLDQITDTL  155

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              AD VA+ + +S+FFVGMGSNDYLNNY MP YPT   Y+  QFA  L Q+Y++QLT+LY 
Sbjct  156   GADDVARQVLRSLFFVGMGSNDYLNNYLMPNYPTRNRYNGRQFADLLTQEYSRQLTKLYN  215

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH-PDAK  873
             LGARKFV+ G+G MGCIP++LA++  G C +SVN+ V PFN NVK M+  F+      AK
Sbjct  216   LGARKFVIAGLGVMGCIPSILAQSPAGNCSDSVNKLVQPFNENVKAMLKNFNANQLSGAK  275

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
             F+FID  +MF+ I+ N+  YGFSV +RGCCG+G+N G++TCLPF+TPC NR++Y+FWDAF
Sbjct  276   FIFIDVAQMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAF  335

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT AVNVL+G  AFNG    VYPM I
Sbjct  336   HPTEAVNVLMGRKAFNGDLSKVYPMNI  362



>ref|XP_004499570.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cicer arietinum]
Length=360

 Score =   413 bits (1062),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/337 (62%), Positives = 262/337 (78%), Gaps = 1/337 (0%)
 Frame = +1

Query  124   TLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYT  303
              +G +G   + LVPAMFIFGDSLIDNGNNNN+ S AKANY PYGIDFN  PTGRFSNGYT
Sbjct  19    VIGQNGGRGDELVPAMFIFGDSLIDNGNNNNMASLAKANYFPYGIDFNGGPTGRFSNGYT  78

Query  304   IVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNF  483
             IVD IA+ LGLP+I AY    + +Q+ +GVNYASAAAGILD TG++F+GRIPF++Q+ NF
Sbjct  79    IVDEIAELLGLPLIPAY-NGAARNQVFHGVNYASAAAGILDATGRNFVGRIPFDQQLRNF  137

Query  484   EKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvq  663
             E T NQ+S NL AD +A  L++ IFFVGMGSNDYLNNY MP Y T   Y+  Q+A  LVQ
Sbjct  138   ENTLNQISGNLGADNMATQLSRCIFFVGMGSNDYLNNYLMPNYNTRNQYNGQQYADLLVQ  197

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMIN  843
              Y  QLTRLY LGARKFV+ G+G MGCIP++LA++ +G+C + VN  V PFN NVK M++
Sbjct  198   TYNHQLTRLYNLGARKFVIAGLGLMGCIPSILAQSMSGKCSQEVNLLVQPFNENVKTMLS  257

Query  844   KFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSN  1023
               +T  P ++F F+DT +MFQ I+ N + YGF+V +RGCCG+G+N G++TCLPF+TPC N
Sbjct  258   NLNTNLPGSRFTFLDTSRMFQEILLNARTYGFTVVNRGCCGLGRNRGQITCLPFQTPCPN  317

Query  1024  RQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             R +Y+FWDAFHPT AVNVL+G +AF+GS   +YP+ I
Sbjct  318   RNQYVFWDAFHPTEAVNVLMGRIAFSGSTNFIYPINI  354



>ref|XP_007019795.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY17020.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=375

 Score =   413 bits (1062),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 213/362 (59%), Positives = 269/362 (74%), Gaps = 3/362 (1%)
 Frame = +1

Query  55    LFILALVFVSAITEPVPVLAQAPTLGFSGEG--NNALVPAMFIFGDSLIDNGNNNNLFSF  228
             L+I  L+ VS +     V++      F  +G     +VPAMF+FGDSLIDNGNNN+L SF
Sbjct  4     LWIFCLLVVSGLGMAFNVVSGQGEDPFGPDGGRRKEMVPAMFVFGDSLIDNGNNNDLPSF  63

Query  229   AKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASA  408
             AKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGLP+I AY E+ S DQ+ +GVNYASA
Sbjct  64    AKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYSEA-SGDQVLHGVNYASA  122

Query  409   AAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYL  588
             AAGILD TG++F+ RIPF++QI NF+ T +Q++ NL A   A  + + IFFVGMGSNDYL
Sbjct  123   AAGILDITGRNFVSRIPFDQQIRNFQSTLDQITDNLGAVDAADAIARCIFFVGMGSNDYL  182

Query  589   NNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARA  768
             NNY MP YPT   Y+  QFA  LVQQYT+QL  LY LGARKFVL G+G+MGCIP++LA++
Sbjct  183   NNYLMPNYPTRNQYNAQQFADLLVQQYTRQLRTLYNLGARKFVLAGLGRMGCIPSILAQS  242

Query  769   DNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVF  948
               G C E VNQ VLPFNANVK M+N  +   P A+F++ID   +F+ I+ N+  YGFSV 
Sbjct  243   TVGSCSEEVNQLVLPFNANVKTMMNNLNANLPGARFIYIDVAHLFEDIVANSGTYGFSVV  302

Query  949   DRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPM  1128
             +RGCCG+G+N G++TCLPF+TPC NR +Y+FWDAFHPT  VN+++   AFNG   +VYP+
Sbjct  303   NRGCCGIGRNRGQITCLPFQTPCPNRDQYVFWDAFHPTEKVNIIMARKAFNGDTSIVYPI  362

Query  1129  TI  1134
              I
Sbjct  363   NI  364



>ref|XP_007148613.1| hypothetical protein PHAVU_005G001100g [Phaseolus vulgaris]
 gb|ESW20607.1| hypothetical protein PHAVU_005G001100g [Phaseolus vulgaris]
Length=359

 Score =   412 bits (1059),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 206/339 (61%), Positives = 265/339 (78%), Gaps = 2/339 (1%)
 Frame = +1

Query  118   APTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNG  297
             +  +G +G G   +VPAMFIFGDSLIDNGNNNN+ S AKANY PYGIDFN  PTGRFSNG
Sbjct  17    SAVIGQNGSGR-EMVPAMFIFGDSLIDNGNNNNIPSLAKANYYPYGIDFNGGPTGRFSNG  75

Query  298   YTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQID  477
             YT+VD IA+ LGLP+I AY E+ S +Q+ +GVNYASAAAGILD TG++F+GRIPF++QI+
Sbjct  76    YTMVDEIAELLGLPLIPAYSEA-SGNQVLHGVNYASAAAGILDATGRNFVGRIPFDQQIN  134

Query  478   NFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStl  657
             NF+ T NQ++ N+  D +A +L + IFFVGMGSNDYLNNY MP YPT   Y+  Q+A  L
Sbjct  135   NFQNTLNQITGNIGPDNMATELARCIFFVGMGSNDYLNNYLMPNYPTRNQYNGQQYADLL  194

Query  658   vqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQM  837
             VQ Y+ QLTRLY LGARKFV+ G+GKMGCIP++LA++  G C E VN  V PFN N+K +
Sbjct  195   VQTYSHQLTRLYNLGARKFVIAGLGKMGCIPSILAQSTTGSCSEEVNMLVQPFNENLKTI  254

Query  838   INKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPC  1017
             +  F+   P A+F+F D+ +MFQ I+ N + YGFSV +RGCCG+G+N G++TCLPF+TPC
Sbjct  255   LGNFNANLPGARFIFADSSRMFQDILLNARSYGFSVVNRGCCGIGRNRGQITCLPFQTPC  314

Query  1018  SNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
              NR +Y+FWDAFHPT AVN+L+G +AF+G+   VYP+ +
Sbjct  315   PNRNQYVFWDAFHPTEAVNILMGRMAFDGNLNFVYPINV  353



>ref|XP_006339389.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum tuberosum]
Length=359

 Score =   410 bits (1054),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 259/328 (79%), Gaps = 1/328 (0%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
              L+PAMFIFGDSLIDNGNNNNL SFAKANY PYGIDF+  PTGRFSNGYT+VD IA+QLG
Sbjct  26    GLIPAMFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFDGGPTGRFSNGYTMVDEIAEQLG  85

Query  334   LPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
             LP+I A+ E+ S +QMR+GVNYASAAAGILD TG++F+GRIPFN+QI NFE T ++++ N
Sbjct  86    LPLIPAHSEASSGEQMRFGVNYASAAAGILDDTGRNFVGRIPFNQQIKNFEDTLDEITDN  145

Query  514   LSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrly  693
             L A  VA+ L K IFFVGMGSNDYLNNY MP Y T   Y+P Q+A+ LVQQYTQQLTRLY
Sbjct  146   LGAPDVAQALAKCIFFVGMGSNDYLNNYLMPNYDTKNHYNPQQYANLLVQQYTQQLTRLY  205

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQM-INKFSTTHPDA  870
              LG RKFV+ G+G MGCIP++LA++++  C E VN+ +LPF  NVK M +   +   P +
Sbjct  206   NLGGRKFVIGGVGLMGCIPSILAKSNSNVCSEEVNELILPFTNNVKSMLLTNLNVNLPGS  265

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             KF++ID   MFQ ++ N ++YGFSV +RGCCG+G+N G++TCLP +TPC NR +Y+FWDA
Sbjct  266   KFIYIDIKNMFQDLLTNYRQYGFSVINRGCCGIGRNRGQITCLPMQTPCPNRDQYIFWDA  325

Query  1051  FHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FHPT AVN+L    AFNG   +VYP+ I
Sbjct  326   FHPTEAVNILFARKAFNGGPDVVYPINI  353



>ref|XP_006478220.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Citrus sinensis]
Length=377

 Score =   410 bits (1055),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 207/338 (61%), Positives = 256/338 (76%), Gaps = 1/338 (0%)
 Frame = +1

Query  121   PTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGY  300
             P     G G   +VPA+FIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGY
Sbjct  35    PVGSTQGGGGREMVPALFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGY  94

Query  301   TIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDN  480
             T+VD IA+ LGLP+I AY E+ S  Q+ +GVNYASAAAGILD TG++F+G IPF++QI N
Sbjct  95    TMVDEIAELLGLPLIPAYSEA-SGAQVLHGVNYASAAAGILDITGRNFVGCIPFDQQIRN  153

Query  481   FEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlv  660
             F+ T +Q++ NL A  V+  + + IFFVGMGSNDYLNNY MP Y T   Y+  Q+A  LV
Sbjct  154   FQNTLDQVTDNLGASDVSNAIARCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQYADLLV  213

Query  661   qqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMI  840
              +Y++QLT LY LGARKFVL G+G+MGCIP +LA+     C E VNQ V+PFNANVK MI
Sbjct  214   SEYSRQLTTLYNLGARKFVLAGLGRMGCIPRILAQYQMDRCSEEVNQLVMPFNANVKTMI  273

Query  841   NKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCS  1020
             N  +   P A+F FID  +MF+ ++ N + YGFSV DRGCCG+G+N G++TCLPF+TPC+
Sbjct  274   NNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCA  333

Query  1021  NRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             NR++Y+FWDAFHPT AVN++ G  AF G   +VYPM I
Sbjct  334   NREQYVFWDAFHPTEAVNIMFGRKAFYGDQSVVYPMNI  371



>ref|XP_004250678.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum lycopersicum]
Length=360

 Score =   409 bits (1051),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 208/335 (62%), Positives = 260/335 (78%), Gaps = 3/335 (1%)
 Frame = +1

Query  139   GEG--NNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             GEG     L+PAMFIFGDSLIDNGNNNNL SFAKANY PYGIDF+  PTGRFSNGYT+VD
Sbjct  20    GEGGRRRGLIPAMFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFDGGPTGRFSNGYTMVD  79

Query  313   SIAKQLGLPMIAAYLE-SPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEK  489
              IA+QLGLP+I A+ E S S +QMR+GVNYASAA+GILD TG++F+ RIPFN+QI NFE 
Sbjct  80    EIAEQLGLPLIPAHSEASSSGEQMRFGVNYASAASGILDDTGRNFVERIPFNQQIKNFED  139

Query  490   TKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqy  669
             T ++++ NL A  VA+ L K IFFVGMGSNDYLNNY MP Y T   Y+P Q+A+ LVQ Y
Sbjct  140   TLDEITDNLGAPDVAQALAKCIFFVGMGSNDYLNNYLMPNYDTKNHYNPQQYANLLVQHY  199

Query  670   tqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKF  849
             T+QLTRLY LG RKFV+ G+G MGCIP++LA++++  C E VN+ +LPF  NVK M+   
Sbjct  200   TEQLTRLYNLGGRKFVIGGVGLMGCIPSILAKSNSNVCSEEVNELILPFTNNVKSMLTNL  259

Query  850   STTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQ  1029
             +   P +KF++ID   MFQ ++ N ++YGFSV +RGCCG+G+N G++TCLP +TPC NR 
Sbjct  260   NVNLPGSKFIYIDIKNMFQDLLTNYRQYGFSVINRGCCGIGRNRGQITCLPMQTPCPNRN  319

Query  1030  EYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +Y+FWDAFHPT AVN+L    AFNG   +VYP+ I
Sbjct  320   QYIFWDAFHPTEAVNILFARKAFNGGTDVVYPINI  354



>ref|XP_006441600.1| hypothetical protein CICLE_v10024521mg [Citrus clementina]
 gb|ESR54840.1| hypothetical protein CICLE_v10024521mg [Citrus clementina]
Length=331

 Score =   406 bits (1044),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 202/326 (62%), Positives = 254/326 (78%), Gaps = 1/326 (0%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPA+FIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFS+GYT+VD IA+ LGL
Sbjct  1     MVPALFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSSGYTMVDEIAELLGL  60

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P+I AY E+ S  Q+ +GVNYASAAAGILD TG++F+GRIPF++QI NF+ T +Q++ NL
Sbjct  61    PLIPAYSEA-SGAQVLHGVNYASAAAGILDITGRNFVGRIPFDQQIRNFQNTLDQVTDNL  119

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              A  V+  + + IFFVGMGSNDYLNNY MP Y T   Y+  Q+A  LV +Y++QLT LY 
Sbjct  120   GASDVSNAIARCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQYADLLVSEYSRQLTTLYN  179

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
             LGARKFVL G+G++GCIP +LA+     C E VNQ V+PFNANVK +IN  +   P A+F
Sbjct  180   LGARKFVLAGLGRIGCIPRILAQNQMDRCSEEVNQLVMPFNANVKTVINNLNANLPGARF  239

Query  877   VFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFH  1056
              FID  +MF+ ++ N + YGFSV DRGCCG+G+N G++TCLPF+TPC+NR++Y+FWDAFH
Sbjct  240   TFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFH  299

Query  1057  PTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PT AVN++ G  AF G   +VYPM I
Sbjct  300   PTEAVNIMFGRKAFYGDQSVVYPMNI  325



>ref|XP_003598045.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES68296.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=357

 Score =   406 bits (1044),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/325 (63%), Positives = 252/325 (78%), Gaps = 1/325 (0%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMFIFGDSLIDNGNNNN+ S AKANY PYGIDFN  PTGRFSNGYTIVD IA+ LGLP
Sbjct  28    VPAMFIFGDSLIDNGNNNNMASLAKANYFPYGIDFNGGPTGRFSNGYTIVDEIAELLGLP  87

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             +I AY    + DQM +GVNYASAAAGILD TG++F+GRIPF+EQ+ NFE T NQL+ NL 
Sbjct  88    LIPAY-NGATGDQMLHGVNYASAAAGILDDTGRNFVGRIPFDEQLRNFENTLNQLTGNLG  146

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytl  699
             AD +A  L++ IFFVGMGSNDYLNNY MP Y T   Y+  Q+A  LVQ Y  QLTRLY L
Sbjct  147   ADNMATQLSRCIFFVGMGSNDYLNNYLMPNYNTKNQYNGQQYADLLVQTYNHQLTRLYNL  206

Query  700   GARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFV  879
             GARKFV+ G+G +GC P++L+++ +G C E VN  V PFN NVK M++  +   P ++F+
Sbjct  207   GARKFVIAGLGLLGCTPSILSQSMSGSCSEQVNMLVQPFNENVKVMLSNLNNNLPGSRFI  266

Query  880   FIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHP  1059
             FID+ +MFQ I+ N + YGF+  +RGCCG+G+N G++TCLPF+TPC NR  Y+FWDAFHP
Sbjct  267   FIDSSRMFQEILFNARSYGFTDVNRGCCGLGRNRGQITCLPFQTPCPNRNRYVFWDAFHP  326

Query  1060  TSAVNVLLGNLAFNGSNYLVYPMTI  1134
             T AVN+L+G +AFNG+   VYP+ I
Sbjct  327   TEAVNILMGRMAFNGNTNFVYPINI  351



>ref|XP_004241911.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum lycopersicum]
Length=365

 Score =   406 bits (1044),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 213/327 (65%), Positives = 252/327 (77%), Gaps = 4/327 (1%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             ALVPAMFIFGDSLIDNGNNNNL S AKANY PYGIDFN  PTGRFSNG T+VD IA+ LG
Sbjct  37    ALVPAMFIFGDSLIDNGNNNNLASLAKANYFPYGIDFNGGPTGRFSNGLTMVDVIAELLG  96

Query  334   LPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
             LP+  AY +  S DQMR+GVNYASAAAGILD TG++F+GRIPFN+QI NFE T NQL  N
Sbjct  97    LPLTPAYSQV-SGDQMRFGVNYASAAAGILDNTGRNFVGRIPFNQQITNFESTLNQLRNN  155

Query  514   LSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrly  693
                  V + L KSIFFVGMGSNDYLNNY MP Y T   Y+P ++A+ L QQY QQL RLY
Sbjct  156   ---GDVEEALAKSIFFVGMGSNDYLNNYLMPNYNTKNQYNPQEYATLLTQQYNQQLIRLY  212

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAK  873
              LGARKFV+ G+G MGCIP++LA++ NG C E VNQ VLPF+ NV+ M+   +T  P  K
Sbjct  213   NLGARKFVIGGVGLMGCIPSILAQSQNGACSEEVNQLVLPFHNNVRSMLTSLNTNFPGFK  272

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
             F +ID   MFQ ++ N++ YGFS  + GCCGVG+N G++TCLPF+TPCSNR++Y+FWDAF
Sbjct  273   FSYIDIRNMFQDLLANSRHYGFSEVNLGCCGVGRNRGQITCLPFQTPCSNREQYIFWDAF  332

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT AVNVL G  AF+G   +VYPM I
Sbjct  333   HPTEAVNVLFGRKAFSGGPDVVYPMNI  359



>ref|XP_006356515.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum tuberosum]
Length=368

 Score =   406 bits (1044),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/327 (64%), Positives = 254/327 (78%), Gaps = 2/327 (1%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             ALVPAMFIFGDSLIDNGNNNNL S AKANYLPYGIDFN  PTGRFSNG T+VD  A+ LG
Sbjct  38    ALVPAMFIFGDSLIDNGNNNNLASLAKANYLPYGIDFNGGPTGRFSNGLTMVDVFAELLG  97

Query  334   LPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
             LP+   Y ++ S DQMR+G+NYASAAAGILD TG++F+GRIPFN+QI NFE T NQL  N
Sbjct  98    LPLTPPYSQA-SGDQMRFGINYASAAAGILDNTGRNFVGRIPFNQQITNFESTLNQLR-N  155

Query  514   LSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrly  693
               A  V + L KSIFFVGMGSNDYLNNY MP Y T   Y+P ++A+ L QQY QQL RLY
Sbjct  156   TGAGDVEEALAKSIFFVGMGSNDYLNNYLMPNYNTKNQYNPQEYATLLTQQYNQQLIRLY  215

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAK  873
              LGARKFV+ G+G MGCIP++LA++ NG C E VNQ VLPF+ NV+ M+   ++  P  +
Sbjct  216   NLGARKFVIGGVGLMGCIPSILAQSQNGACSEEVNQLVLPFHNNVRSMLTSLNSNLPGFR  275

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
             F +ID   MFQ ++ N+++YGFS  + GCCGVG+N G++TCLPF+TPCSNR++Y+FWDAF
Sbjct  276   FSYIDIRNMFQDLLANSRQYGFSEVNLGCCGVGRNRGQITCLPFQTPCSNREQYIFWDAF  335

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT AVN+L G  AF+G   +VYPM I
Sbjct  336   HPTEAVNILFGRKAFSGGPDVVYPMNI  362



>ref|XP_009333996.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Pyrus x bretschneideri]
Length=391

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/325 (63%), Positives = 255/325 (78%), Gaps = 1/325 (0%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMF+FGDSLIDNGNNN+L SFAKANY PYGIDFN  PTGRFSNGYT+VD IA  LGLP
Sbjct  56    VPAMFVFGDSLIDNGNNNDLPSFAKANYFPYGIDFNCGPTGRFSNGYTMVDEIADLLGLP  115

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             +I A+ E+ S DQM +GVNYASAAAGI D TG++F+GRIPF +QI NF+ T +Q++ NL 
Sbjct  116   LIPAHSEA-SGDQMLHGVNYASAAAGIFDATGRNFVGRIPFGQQIRNFQNTLDQITDNLG  174

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytl  699
             AD  A+ + K IFFVGMGSNDYLNNY MP YPT   Y+  Q+A  L Q+YT+QLTRLY L
Sbjct  175   ADDAARSIAKCIFFVGMGSNDYLNNYLMPNYPTMNHYNAQQYADLLAQEYTRQLTRLYNL  234

Query  700   GARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFV  879
             GARKFV+ G+G++GCIP++LAR  +G C + VN  VLPFNANVK MIN  +T  P +KF+
Sbjct  235   GARKFVIAGLGRLGCIPSILARNPSGTCSDEVNCLVLPFNANVKTMINNQNTNLPGSKFI  294

Query  880   FIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHP  1059
             +ID  +MF+ ++ + + YGF V +RGCCG+G+N G+VTCLP +TPC NR +Y+FWDAFHP
Sbjct  295   YIDIARMFEDMLLDPRTYGFIVANRGCCGLGRNRGQVTCLPLQTPCRNRDQYIFWDAFHP  354

Query  1060  TSAVNVLLGNLAFNGSNYLVYPMTI  1134
             T+AVN+++G  AF G    VYPM I
Sbjct  355   TAAVNIIIGRKAFTGDRTEVYPMNI  379



>ref|XP_008441153.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis melo]
Length=378

 Score =   406 bits (1044),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 211/373 (57%), Positives = 265/373 (71%), Gaps = 5/373 (1%)
 Frame = +1

Query  28    MNNPSVFSALFILALVFVSAITEPVPVLAQAPTLGFSGEGN----NALVPAMFIFGDSLI  195
             M N  V+S   ++ +V               P     G G     N +VPAMFIFGDSLI
Sbjct  1     MGNVKVYSVAVVMGMVLFGVSLGQFEGGGNGPFTRGDGSGRRRPENEMVPAMFIFGDSLI  60

Query  196   DNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSID  375
             DNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGLP++ A+ +  S  
Sbjct  61    DNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLVPAFSQV-SGP  119

Query  376   QMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSI  555
             Q  +GVNYASAAAGILD TG++F+ RIPFN+QI NFE T +Q+S NL A  V + + + +
Sbjct  120   QSLHGVNYASAAAGILDVTGRNFVSRIPFNQQIRNFENTLDQISNNLGAASVGQSIGRCM  179

Query  556   FFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGK  735
             FFVGMGSNDYLNNY MP YPT   Y+  Q+A  LV QY QQLTRLY LG R+FV+ G+G 
Sbjct  180   FFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLVSQYAQQLTRLYNLGGRRFVIAGLGL  239

Query  736   MGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIM  915
             MGCIP++LA++ +G C E VNQ V PFN NVK MIN+ +   P A+F +ID ++MFQ ++
Sbjct  240   MGCIPSILAQSPSGSCSEEVNQLVRPFNVNVKSMINQLNNNLPGARFSYIDIERMFQDLL  299

Query  916   NNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLA  1095
              N++ YG SV +RGCCG+G+N G++TCLPF+TPC+NR +Y+FWDAFHPT AVNVL+   A
Sbjct  300   VNSRFYGLSVLNRGCCGIGRNRGQITCLPFQTPCTNRDQYIFWDAFHPTEAVNVLMARKA  359

Query  1096  FNGSNYLVYPMTI  1134
             FNG   ++ P  I
Sbjct  360   FNGDQSVISPFNI  372



>emb|CDP18864.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   403 bits (1036),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 206/322 (64%), Positives = 249/322 (77%), Gaps = 1/322 (0%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIA  348
             MFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGLP+I 
Sbjct  1     MFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIP  60

Query  349   AYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV  528
              + E+ S DQ+RYGVNYASAAAGILD TG++F+GRIPFN+QI NFE T +Q++ +L A  
Sbjct  61    PFSEA-SGDQVRYGVNYASAAAGILDETGRNFVGRIPFNQQIRNFENTLDQITNSLGAPD  119

Query  529   VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGAR  708
             VA+ L++ IFFVGMGSNDYLNNY MP Y T   Y+  QFA  L  QY QQLTRLY LGAR
Sbjct  120   VAQALSRCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQFADLLTSQYAQQLTRLYNLGAR  179

Query  709   KFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFID  888
             KFV+ GIG MGCIP++LA++  G C E VNQ V+PF+ N K MINK ST  P ++F +ID
Sbjct  180   KFVIAGIGLMGCIPSILAQSGAGLCSEPVNQLVVPFSTNSKAMINKLSTNLPGSRFAYID  239

Query  889   TDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSA  1068
                MFQ ++ N+  YGF + +RGCCG+G+N G++TCLPF+ PC  R  Y+FWDAFHPT+A
Sbjct  240   VRNMFQDLLTNHDSYGFDIVNRGCCGIGRNRGQITCLPFQVPCPERDRYIFWDAFHPTAA  299

Query  1069  VNVLLGNLAFNGSNYLVYPMTI  1134
             VN+L G  AF+G   LVYP+ I
Sbjct  300   VNILFGKSAFSGGPQLVYPINI  321



>ref|XP_004158530.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis sativus]
Length=331

 Score =   402 bits (1033),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 201/326 (62%), Positives = 252/326 (77%), Gaps = 1/326 (0%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPAMF+FGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGL
Sbjct  1     MVPAMFVFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGL  60

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P++ A+ +  S  Q  +GVNYASAAAGILD TG++F+ RIPFN+QI NFE T +Q+S NL
Sbjct  61    PLVPAFSQV-SGPQSLHGVNYASAAAGILDVTGRNFVSRIPFNQQIRNFENTLDQISNNL  119

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              A  V + + + IFFVGMGSNDYLNNY MP YPT   Y+  Q+A  LV QY QQLTRLY 
Sbjct  120   GAANVGQSIGRCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLVSQYMQQLTRLYN  179

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
             LG R+FV+ G+G MGCIP++LA++ +G C E VNQ V PFN NVK MIN+ +   P A+F
Sbjct  180   LGGRRFVIAGLGLMGCIPSILAQSPSGSCSEEVNQLVRPFNVNVKSMINQLNNNLPGARF  239

Query  877   VFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFH  1056
              +ID ++MFQ ++ N++ YG SV +RGCCG+G+N G++TCLPF+TPC+NR +Y+FWDAFH
Sbjct  240   SYIDIERMFQDLLVNSRFYGLSVLNRGCCGIGRNRGQITCLPFQTPCTNRDQYIFWDAFH  299

Query  1057  PTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PT AVN+L+   AFNG   ++ P  I
Sbjct  300   PTEAVNILMARKAFNGDQSVISPFNI  325



>gb|KGN63057.1| hypothetical protein Csa_2G396190 [Cucumis sativus]
Length=379

 Score =   404 bits (1037),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 202/328 (62%), Positives = 253/328 (77%), Gaps = 1/328 (0%)
 Frame = +1

Query  151   NALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQL  330
             N +VPAMF+FGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ L
Sbjct  47    NEMVPAMFVFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELL  106

Query  331   GLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
             GLP++ A+ +  S  Q  +GVNYASAAAGILD TG++F+ RIPFN+QI NFE T +Q+S 
Sbjct  107   GLPLVPAFSQV-SGPQSLHGVNYASAAAGILDVTGRNFVSRIPFNQQIRNFENTLDQISN  165

Query  511   NLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrl  690
             NL A  V + + + IFFVGMGSNDYLNNY MP YPT   Y+  Q+A  LV QY QQLTRL
Sbjct  166   NLGAVNVGQSIGRCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLVSQYMQQLTRL  225

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
             Y LG R+FV+ G+G MGCIP++LA++ +G C E VNQ V PFN NVK MIN+ +   P A
Sbjct  226   YNLGGRRFVIAGLGLMGCIPSILAQSPSGSCSEEVNQLVRPFNVNVKSMINQLNNNLPGA  285

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             +F +ID ++MFQ ++ N++ YG SV +RGCCG+G+N G++TCLPF+TPC+NR +Y+FWDA
Sbjct  286   RFSYIDIERMFQDLLVNSRFYGLSVLNRGCCGIGRNRGQITCLPFQTPCTNRDQYIFWDA  345

Query  1051  FHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FHPT AVN+L+   AFNG   ++ P  I
Sbjct  346   FHPTEAVNILMARKAFNGDQSVISPFNI  373



>ref|XP_004138671.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis sativus]
Length=331

 Score =   401 bits (1031),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 201/326 (62%), Positives = 252/326 (77%), Gaps = 1/326 (0%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPAMF+FGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGL
Sbjct  1     MVPAMFVFGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGL  60

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P++ A+ +  S  Q  +GVNYASAAAGILD TG++F+ RIPFN+QI NFE T +Q+S NL
Sbjct  61    PLVPAFSQV-SGPQSLHGVNYASAAAGILDVTGRNFVSRIPFNQQIRNFENTLDQISNNL  119

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              A  V + + + IFFVGMGSNDYLNNY MP YPT   Y+  Q+A  LV QY QQLTRLY 
Sbjct  120   GAVNVGQSIGRCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLVSQYMQQLTRLYN  179

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
             LG R+FV+ G+G MGCIP++LA++ +G C E VNQ V PFN NVK MIN+ +   P A+F
Sbjct  180   LGGRRFVIAGLGLMGCIPSILAQSPSGSCSEEVNQLVRPFNVNVKSMINQLNNNLPGARF  239

Query  877   VFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFH  1056
              +ID ++MFQ ++ N++ YG SV +RGCCG+G+N G++TCLPF+TPC+NR +Y+FWDAFH
Sbjct  240   SYIDIERMFQDLLVNSRFYGLSVLNRGCCGIGRNRGQITCLPFQTPCTNRDQYIFWDAFH  299

Query  1057  PTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PT AVN+L+   AFNG   ++ P  I
Sbjct  300   PTEAVNILMARKAFNGDQSVISPFNI  325



>ref|XP_002526412.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF35988.1| zinc finger protein, putative [Ricinus communis]
Length=422

 Score =   403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 224/409 (55%), Positives = 274/409 (67%), Gaps = 50/409 (12%)
 Frame = +1

Query  46    FSALFI-LALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLF  222
             FS L + L +V +  +     V    P  GF       +VPAMFIFGDSLIDNGNNNNL 
Sbjct  7     FSWLVVSLVMVLIMEVGLGQNVDPFGPVGGFR---RREMVPAMFIFGDSLIDNGNNNNLP  63

Query  223   SFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYA  402
             SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGLP+I AY E+ S D + +GVNYA
Sbjct  64    SFAKANYFPYGIDFNGGPTGRFSNGYTMVDQIAEMLGLPLIPAYSEA-SGDDVLHGVNYA  122

Query  403   SAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSND  582
             SAAAGILD TG++F+GRIPFN+QI NF+ T +Q++ NL A  VA+ + KS+FFVGMGSND
Sbjct  123   SAAAGILDITGRNFVGRIPFNQQIRNFQNTLDQITDNLGAVDVARAIGKSMFFVGMGSND  182

Query  583   YLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLA  762
             YLNNY MP YPT   Y+  Q+A+ LVQQYTQQL  LY LGARKF+L G+G MGCIP++LA
Sbjct  183   YLNNYLMPNYPTKNQYNGPQYANLLVQQYTQQLNTLYNLGARKFILAGLGVMGCIPSILA  242

Query  763   RADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRY---  933
             ++  G C E VNQ V+PFN NVK M+N F+   P AKF+F+D  +MF+ I+ N   Y   
Sbjct  243   QSPAGLCSEEVNQLVMPFNENVKTMMNNFNNNLPGAKFIFLDVARMFRDILTNAPAYGAI  302

Query  934   ------------------------------------------GFSVFDRGCCGVGKNSGE  987
                                                       GFSV +RGCCG+G+N G+
Sbjct  303   CIPVEHRLTLDSLALPGRWSGWVSGVVKKLVINHWLHYEIYAGFSVINRGCCGIGRNRGQ  362

Query  988   VTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             VTCLPF+TPC NR++Y+FWDAFHPT AVN+L+G  AFNG   +VYPM I
Sbjct  363   VTCLPFQTPCPNREQYIFWDAFHPTEAVNILMGKRAFNGDTSIVYPMNI  411



>emb|CDX68306.1| BnaA07g23460D [Brassica napus]
Length=384

 Score =   399 bits (1025),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 206/368 (56%), Positives = 266/368 (72%), Gaps = 8/368 (2%)
 Frame = +1

Query  49    SALFILALVFVSAITEPV-----PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNN  213
             SAL ++ L  +  ++  +     PV A  P L    +G++ +VPA+F+FGDSLIDNGNNN
Sbjct  12    SALLVVVLQILHGVSGQLVVVEDPVSASPPPL-VEQDGSDGIVPALFVFGDSLIDNGNNN  70

Query  214   NLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGV  393
             N+ SFAKANY PYGIDFN  PTGRF NG T+VD IA+ LGLP+I AY E+   DQ+  GV
Sbjct  71    NIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGV  129

Query  394   NYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGM  570
             NYASAAAGIL  TG +F+GRIPF++QI NFE T NQ+++     V +A  + +S+FF+GM
Sbjct  130   NYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLNQVASKSGGAVTIADSVARSLFFIGM  189

Query  571   GSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIP  750
             GSNDYLNNY MP +PT   Y+  QF   LVQQYT QLTRLY LG RKF+++G+G+MGCIP
Sbjct  190   GSNDYLNNYLMPNFPTRNQYNAQQFGDLLVQQYTNQLTRLYNLGGRKFIVSGLGRMGCIP  249

Query  751   TMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKR  930
             ++LA+  +G+C E VNQ VLPFN NVK MI   +   PDAKF+++DT  M Q I  N   
Sbjct  250   SILAQGSDGKCSEEVNQLVLPFNTNVKTMITNLNQNLPDAKFIYLDTANMVQDITTNPAV  309

Query  931   YGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSN  1110
             YGF+  D+GCCG+G+N G++TCLPFETPC NR++YLFWDAFHPT  VN+++   AF G  
Sbjct  310   YGFTTLDKGCCGIGRNRGQITCLPFETPCPNREQYLFWDAFHPTEKVNLIMAKKAFAGDR  369

Query  1111  YLVYPMTI  1134
              + +P+ I
Sbjct  370   TVAFPINI  377



>ref|XP_009802347.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=409

 Score =   400 bits (1027),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 216/347 (62%), Positives = 255/347 (73%), Gaps = 5/347 (1%)
 Frame = +1

Query  97    PVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNP  276
             P PV   AP+   SGE   ALVPA+F FGDSLID+GNNN LFSFAKANYLPYGIDF   P
Sbjct  61    PAPVTEAAPS---SGEERRALVPALFAFGDSLIDSGNNNRLFSFAKANYLPYGIDFGG-P  116

Query  277   TGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRI  456
             TGRFSN YTI+D I   LGLP++  Y +  ++D+MR+GVNYASAAAGILD TG HF+ RI
Sbjct  117   TGRFSNAYTILDQIGDLLGLPLLPPYSKIFNVDKMRFGVNYASAAAGILDITGFHFVERI  176

Query  457   PFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDP  636
             PF+ QI NFE T   L  N+SA +V + + K IFFVGMGSNDYLNNY MP Y T   Y P
Sbjct  177   PFSYQIKNFENTLVSLIKNMSAPIVEEAIPKCIFFVGMGSNDYLNNYIMPAYFTQDEYTP  236

Query  637   NQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPF  816
              +FA  LV QY +QL +LY LGARKF++ GIG+MGCIP +LA + NGEC E VNQ V PF
Sbjct  237   QKFAELLVHQYKEQLIKLYDLGARKFIIAGIGQMGCIPFLLAESSNGECSEIVNQMVHPF  296

Query  817   NANVKQMINKFSTTH-PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVT  993
             NA +K MI K + +  P A F+F+D + MF+ I  N K YGFSV DRGCCG GKN GEVT
Sbjct  297   NAKLKTMIMKLNKSELPGAHFIFLDMENMFKDIFTNYKSYGFSVTDRGCCGSGKNKGEVT  356

Query  994   CLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             CLP +TPC NR +YLFWDA+HPTSAVN+LLG++AF G     +PM I
Sbjct  357   CLPMQTPCPNRDDYLFWDAYHPTSAVNLLLGDMAFYGGPNFTFPMNI  403



>ref|XP_009104909.1| PREDICTED: GDSL esterase/lipase At1g71691 [Brassica rapa]
Length=384

 Score =   399 bits (1024),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 206/368 (56%), Positives = 266/368 (72%), Gaps = 8/368 (2%)
 Frame = +1

Query  49    SALFILALVFVSAITEPV-----PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNN  213
             SAL ++ L  +  ++  +     PV A  P L    +G++ +VPA+F+FGDSLIDNGNNN
Sbjct  12    SALLVVVLQILHGVSGQLVVVEDPVSASPPPL-VEQDGSDGIVPALFVFGDSLIDNGNNN  70

Query  214   NLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGV  393
             N+ SFAKANY PYGIDFN  PTGRF NG T+VD IA+ LGLP+I AY E+   DQ+  GV
Sbjct  71    NIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGV  129

Query  394   NYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGM  570
             NYASAAAGIL  TG +F+GRIPF++QI NFE T NQ+++     V +A  + +S+FF+GM
Sbjct  130   NYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLNQVASKSGGAVTIADSVARSLFFIGM  189

Query  571   GSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIP  750
             GSNDYLNNY MP +PT   Y+  QF   LVQQYT QLTRLY LG RKF+++G+G+MGCIP
Sbjct  190   GSNDYLNNYLMPNFPTRNQYNAQQFGDLLVQQYTNQLTRLYNLGGRKFIVSGLGRMGCIP  249

Query  751   TMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKR  930
             ++LA+  +G+C E VNQ VLPFN NVK MI   +   PDAKF+++DT  M Q I  N   
Sbjct  250   SILAQGTDGKCSEEVNQLVLPFNTNVKTMITNLNQNLPDAKFIYLDTANMVQDITTNPAV  309

Query  931   YGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSN  1110
             YGF+  D+GCCG+G+N G++TCLPFETPC NR++YLFWDAFHPT  VN+++   AF G  
Sbjct  310   YGFTTLDKGCCGIGRNRGQITCLPFETPCPNREQYLFWDAFHPTEKVNLIMAKKAFAGDR  369

Query  1111  YLVYPMTI  1134
              + +P+ I
Sbjct  370   TVAFPINI  377



>gb|EPS67957.1| hypothetical protein M569_06816 [Genlisea aurea]
Length=369

 Score =   395 bits (1014),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 248/329 (75%), Gaps = 2/329 (1%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A+VPA+FIFGDSLIDNGNNNNL S AKANY PYGIDF   PTGRFSNGYT+VD+IA+ LG
Sbjct  35    AIVPALFIFGDSLIDNGNNNNLASLAKANYFPYGIDFRGGPTGRFSNGYTMVDTIAELLG  94

Query  334   LPMIAAYLESP--SIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLS  507
             LP+I AY ++   S  QMRYGVN+ASAAAGILD TG +F+GRIPFN+QI NFE + +QL+
Sbjct  95    LPLIPAYSQAAESSTAQMRYGVNFASAAAGILDNTGNNFVGRIPFNQQIKNFENSLDQLA  154

Query  508   ANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltr  687
                    +++ L+KSIFFVGMGSNDYLNNY MP Y T   Y+P Q+A  LV QYTQQLTR
Sbjct  155   TLTGNADLSQGLSKSIFFVGMGSNDYLNNYLMPNYDTKNQYNPQQYADLLVHQYTQQLTR  214

Query  688   lytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             LY LGAR+F + G+G+MGCIP++LA++    C + VNQ V PFN NVK M+       P 
Sbjct  215   LYNLGARRFAIAGLGRMGCIPSILAQSGANTCSDQVNQLVEPFNNNVKMMVENLGAKLPG  274

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
              KF +ID + MFQ ++ N   YGF+V +RGCCG+G+N G+VTCLPF+TPC++R  Y+FWD
Sbjct  275   VKFSYIDINNMFQDLVANAPAYGFTVLNRGCCGLGRNRGQVTCLPFQTPCADRNRYVFWD  334

Query  1048  AFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             AFHPT AVNVL G  AF+G     YP+ I
Sbjct  335   AFHPTEAVNVLFGQKAFSGETDFAYPINI  363



>ref|XP_009399303.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 205/336 (61%), Positives = 251/336 (75%), Gaps = 2/336 (1%)
 Frame = +1

Query  127   LGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTI  306
             +G SG G    VPAMF+FGDSL DNGNNN L SFAKANY PYGIDF   PTGRFSNGYTI
Sbjct  69    VGDSG-GQKESVPAMFVFGDSLTDNGNNNGLASFAKANYYPYGIDFAGGPTGRFSNGYTI  127

Query  307   VDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFE  486
             VD IA+ LGLP+I  Y ++ S +   +GVNYASAAAGILD TG++F+GRIPFN+QI NFE
Sbjct  128   VDEIAELLGLPLIPPYSQA-SGEAALHGVNYASAAAGILDITGRNFVGRIPFNQQIKNFE  186

Query  487   KTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqq  666
              T +Q++ NL AD VA      IFFVGMGSNDYLNNY MP Y T   Y   QFA  LVQ 
Sbjct  187   STLDQIAGNLGADAVANATAHCIFFVGMGSNDYLNNYLMPNYNTRSQYTGEQFADLLVQD  246

Query  667   ytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINK  846
             YT QLT LY LGARKFV+TG+G MGCIP++LA+     C   V++ V+PFN NVK MIN 
Sbjct  247   YTHQLTSLYNLGARKFVITGVGSMGCIPSILAQNLLSHCSLEVDKLVMPFNNNVKAMINA  306

Query  847   FSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNR  1026
              +   P +KF+++DT  MF  I++N   YGFSV +RGCCG+G+NSG++TCLPF+TPC+NR
Sbjct  307   LNVNLPHSKFIYVDTYHMFMDILSNPGTYGFSVINRGCCGIGRNSGQITCLPFQTPCANR  366

Query  1027  QEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
              +Y+FWDAFHPT+AVN++L   A++G+   V+PM I
Sbjct  367   DQYVFWDAFHPTAAVNIILARKAYDGNTNAVFPMNI  402



>ref|XP_008788334.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Phoenix dactylifera]
Length=375

 Score =   394 bits (1011),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 203/358 (57%), Positives = 259/358 (72%), Gaps = 3/358 (1%)
 Frame = +1

Query  61    ILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKAN  240
             +LAL  VS  +  +   A  P     G G   LVPAMF+FGDSLIDNGNNNN+ SFAKAN
Sbjct  10    LLALSIVSNFS--IAQEAVGPVARDGGNGRRELVPAMFVFGDSLIDNGNNNNIPSFAKAN  67

Query  241   YLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGI  420
             Y PYGIDF   PTGRFSNGYTIVD IA  LGLP+I  Y ++ S + + +GVNYASAAAGI
Sbjct  68    YYPYGIDFAGGPTGRFSNGYTIVDEIAVLLGLPLIPPYSQA-SGEDLLHGVNYASAAAGI  126

Query  421   LDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYF  600
             LD TG++F+GRIPFN+QI NFE T ++++ NL AD VAK + + IFFVGMGSNDYLNNY 
Sbjct  127   LDITGRNFVGRIPFNQQIRNFESTLDRITGNLGADHVAKAIARCIFFVGMGSNDYLNNYL  186

Query  601   MPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGE  780
             MP Y T   Y+  QFA  LV+QY++QL  LY +GAR+FV+ G+G M CIP++LA+  +  
Sbjct  187   MPNYNTRNVYNAEQFAELLVRQYSRQLASLYNVGARRFVIAGVGSMACIPSILAQNPSSH  246

Query  781   CLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGC  960
             C   V+  ++PFN  VK M++  +   P AKF++ID   M + I+ +   YGFSV DRGC
Sbjct  247   CSPEVDNLLIPFNNKVKSMVDNLNANLPGAKFIYIDNFGMIRDILIHPTSYGFSVIDRGC  306

Query  961   CGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             CG+G+NSG++TCLPF+TPCS+R +Y+FWDAFHPT+AVNV+L   AF+G   + Y M I
Sbjct  307   CGIGRNSGQITCLPFQTPCSDRNKYVFWDAFHPTAAVNVILAKKAFSGGTDVAYRMNI  364



>ref|XP_006301319.1| hypothetical protein CARUB_v10021728mg [Capsella rubella]
 gb|EOA34217.1| hypothetical protein CARUB_v10021728mg [Capsella rubella]
Length=381

 Score =   394 bits (1011),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 207/366 (57%), Positives = 261/366 (71%), Gaps = 5/366 (1%)
 Frame = +1

Query  46    FSALFILALVFVSA--ITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNL  219
              SA+ I  L  VS   +    PV A  P L     G + +VPA+F+FGDSLIDNGNNNN+
Sbjct  11    LSAVVIQLLHGVSGQLVVVEEPVSAPPPPL-VDLNGGDGVVPALFVFGDSLIDNGNNNNI  69

Query  220   FSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNY  399
              SFAKANY PYGIDFN  PTGRF NG T+VD IA+ LGLP+I AY E+   DQ+  GVNY
Sbjct  70    PSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGVNY  128

Query  400   ASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGMGS  576
             ASAAAGIL  TG +F+GRIPF+EQI NFE T +Q++      V +A  +T+S+FF+GMGS
Sbjct  129   ASAAAGILPDTGGNFVGRIPFDEQIHNFETTLDQVAGKSGGAVAIADSVTRSLFFIGMGS  188

Query  577   NDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTM  756
             NDYLNNY MP +PT   ++  QF   LVQ YT QLTRLY LG RKFV+ G+G+MGCIP++
Sbjct  189   NDYLNNYLMPNFPTRNQFNSQQFGDLLVQHYTNQLTRLYNLGGRKFVVAGLGRMGCIPSI  248

Query  757   LARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYG  936
             LA+  +G+C E VNQ VLPFN NVK MI+  +   PDAKF+++D   M++ I+ N   YG
Sbjct  249   LAQGSDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDIAHMYEDIIANQAAYG  308

Query  937   FSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYL  1116
             F+  D+GCCG+GKN G++TCLPFETPC NR +Y+FWDAFHPT  VN+++   AF G   +
Sbjct  309   FTTMDKGCCGIGKNRGQITCLPFETPCDNRDQYIFWDAFHPTEKVNLIMAKKAFAGDRTV  368

Query  1117  VYPMTI  1134
              YP+ I
Sbjct  369   AYPINI  374



>ref|XP_010908040.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Elaeis guineensis]
Length=383

 Score =   393 bits (1010),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 210/366 (57%), Positives = 267/366 (73%), Gaps = 4/366 (1%)
 Frame = +1

Query  40    SVFSALFILALVFVSAITEPVPVLAQ-APTLGFSGEGNNALVPAMFIFGDSLIDNGNNNN  216
             S+F    +LAL  VS  +    V+   AP  G  G G   LVPAMF+FGDSLIDNGNNNN
Sbjct  10    SMFFFYVVLALSTVSNFSIAQRVVGPVAP--GDGGNGRRELVPAMFVFGDSLIDNGNNNN  67

Query  217   LFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVN  396
             + SFAKANY PYGIDF   PTGRFSNGYTIVD IA  LGLP+I  Y ++ S + + +GVN
Sbjct  68    IPSFAKANYYPYGIDFAGGPTGRFSNGYTIVDEIADLLGLPLIPPYSQA-SGEGLLHGVN  126

Query  397   YASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGS  576
             YASAAAGILD TG++F+GRIPFN+QI NFE T +Q++ NL AD VA  +   IFFVGMGS
Sbjct  127   YASAAAGILDITGRNFVGRIPFNQQIRNFESTLDQITRNLGADHVANAIAHCIFFVGMGS  186

Query  577   NDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTM  756
             NDYLNNY MP Y T   Y+ +QFA  LV+QYT+QLTRLY +GAR+FV+ G+G M CIP++
Sbjct  187   NDYLNNYLMPNYNTRNVYNADQFADLLVRQYTRQLTRLYNIGARRFVIAGVGSMACIPSI  246

Query  757   LARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYG  936
             LA+  +  C   V+  V+PFN NVK M++  +     AKF +ID  ++ + I++N   YG
Sbjct  247   LAQNPSSHCSPEVDNLVIPFNNNVKLMVDNLNVNLRGAKFTYIDNFRLIKDILSNPTSYG  306

Query  937   FSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYL  1116
             FSV DRGCCG+G+NSG++TCLPF+TPCS+R +Y+FWDAFHPT+AVN++L   AF G+  +
Sbjct  307   FSVVDRGCCGIGRNSGQITCLPFQTPCSDRDQYVFWDAFHPTAAVNIILAREAFRGNTDV  366

Query  1117  VYPMTI  1134
              +PM I
Sbjct  367   AHPMNI  372



>emb|CDY36687.1| BnaCnng07890D [Brassica napus]
Length=384

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 201/345 (58%), Positives = 256/345 (74%), Gaps = 3/345 (1%)
 Frame = +1

Query  103   PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTG  282
             PV A  P L    +G++ +VPA+F+FGDSLIDNGNNNN+ SFAKANY PYGIDF+  PTG
Sbjct  35    PVSAPPPPL-VEQDGSDGIVPALFVFGDSLIDNGNNNNIPSFAKANYFPYGIDFSGGPTG  93

Query  283   RFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPF  462
             RF NG T+VD IA+ LGLP+I AY E+   DQ+  GVNYASAAAGIL  TG +F+GRIPF
Sbjct  94    RFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGVNYASAAAGILPDTGGNFVGRIPF  152

Query  463   NEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPN  639
             ++QI NFE T +Q+++     V +A  + +S+FF+GMGSNDYLNNY MP +PT   Y+  
Sbjct  153   DQQIHNFETTLDQVASKSGGAVTIADSVARSLFFIGMGSNDYLNNYLMPNFPTRNQYNAQ  212

Query  640   QFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFN  819
             QF   LVQQYT QLTRLY LG RKF+++G+G+MGCIP++LA+  +G+C E VNQ VLPFN
Sbjct  213   QFGDLLVQQYTNQLTRLYNLGGRKFIVSGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFN  272

Query  820   ANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCL  999
              NVK MIN  +   PDAKF+++DT  M Q I  N   YGF+  D+GCCG+G+N G++TCL
Sbjct  273   TNVKTMINNLNQNLPDAKFIYLDTANMVQDITTNPAVYGFTTLDKGCCGIGRNRGQITCL  332

Query  1000  PFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PFETPC NR +YLFWDAFHPT  VN+++   AF G   + +P+ I
Sbjct  333   PFETPCPNRDQYLFWDAFHPTEKVNLIMAKRAFAGDRTVAFPINI  377



>ref|XP_010471167.1| PREDICTED: GDSL esterase/lipase At1g71691 [Camelina sativa]
Length=384

 Score =   393 bits (1009),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 204/368 (55%), Positives = 264/368 (72%), Gaps = 8/368 (2%)
 Frame = +1

Query  49    SALFILALVFVSAITEPV-----PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNN  213
             SAL  + +  +  ++  +     P+ A  P L     G + +VPA+FIFGDSLIDNGNNN
Sbjct  12    SALLAVVIQLLHGVSGQLVVVEEPISAPPPPL-VDLNGGDGIVPALFIFGDSLIDNGNNN  70

Query  214   NLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGV  393
             N+ SFAKANY PYGIDFN  PTGRF NG T+VD IA+ LGLP+I AY E+   DQ+  GV
Sbjct  71    NIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGV  129

Query  394   NYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGM  570
             NYASAAAGIL  TG +F+GRIPF++QI NFE T +Q++      V VA  + +S+FF+GM
Sbjct  130   NYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLDQIAGKSGGAVAVADSVARSLFFIGM  189

Query  571   GSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIP  750
             GSNDYLNNY MP +PT   ++  QF   LVQQYT QLTRLY LG RKFV+ G+G+MGCIP
Sbjct  190   GSNDYLNNYLMPNFPTRSQFNSQQFGDLLVQQYTNQLTRLYNLGGRKFVVAGLGRMGCIP  249

Query  751   TMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKR  930
             ++LA+ ++G+C E VNQ VLPFN NVK MI+  +   PDAKF+++D  +M + I+ N   
Sbjct  250   SILAQGNDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDIAQMLEDIVANQAA  309

Query  931   YGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSN  1110
             YGF+  D+GCCG+GKN G++TCLPFETPC+NR +Y+FWDAFHPT  VN+++   AF G  
Sbjct  310   YGFTTMDKGCCGIGKNRGQITCLPFETPCANRDQYVFWDAFHPTEKVNLIMAKKAFAGDR  369

Query  1111  YLVYPMTI  1134
              + YP+ I
Sbjct  370   TVAYPINI  377



>ref|XP_010427992.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Camelina sativa]
Length=384

 Score =   392 bits (1007),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/345 (58%), Positives = 254/345 (74%), Gaps = 3/345 (1%)
 Frame = +1

Query  103   PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTG  282
             P+ A  P L     G + +VPA+FIFGDSLIDNGNNNN+ SFAKANY PYGIDFN  PTG
Sbjct  35    PISAPPPPL-VDLNGGDGIVPALFIFGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTG  93

Query  283   RFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPF  462
             RF NG T+VD IA+ LGLP+I AY E+   DQ+  GVNYASAAAGIL  TG +F+GRIPF
Sbjct  94    RFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGVNYASAAAGILPDTGGNFVGRIPF  152

Query  463   NEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPN  639
             ++QI NFE T +Q++      V VA  + +S+FF+GMGSNDYLNNY MP +PT   ++  
Sbjct  153   DQQIHNFETTLDQIAGKSGGAVAVADSVARSLFFIGMGSNDYLNNYLMPNFPTRSQFNSQ  212

Query  640   QFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFN  819
             QF   LVQQYT QLTRLY LG RKFV+ G+G+MGCIP++LA+  +G+C E VNQ VLPFN
Sbjct  213   QFGDLLVQQYTNQLTRLYNLGGRKFVVAGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFN  272

Query  820   ANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCL  999
              NVK MI+  +   PDAKF+++D  +M + I+ N   YGF+  D+GCCG+GKN G++TCL
Sbjct  273   TNVKTMISNLNQNLPDAKFIYLDIAQMLEDIVANQAAYGFTTMDKGCCGIGKNRGQITCL  332

Query  1000  PFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PFETPC+NR +Y+FWDAFHPT  VN+++   AF G   + YP+ I
Sbjct  333   PFETPCANRDQYVFWDAFHPTEKVNLIMAKKAFAGDRTVAYPINI  377



>ref|XP_004141644.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis sativus]
 gb|KGN52692.1| hypothetical protein Csa_5G650570 [Cucumis sativus]
Length=366

 Score =   391 bits (1005),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 209/358 (58%), Positives = 254/358 (71%), Gaps = 3/358 (1%)
 Frame = +1

Query  64    LALVFVSAITEPVPVLAQ-APTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKAN  240
             L  V V  IT    V  Q   T      G   +VPAMFIFGDSLIDNGNNNNL +FAKAN
Sbjct  3     LGGVLVVLITAAAAVSGQNGSTYEGKWMGGIGMVPAMFIFGDSLIDNGNNNNLPTFAKAN  62

Query  241   YLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGI  420
             Y PYGIDF   PTGRFSNGYTIVD IA+ LGLP+I     SP+   MR G+NYASAA+GI
Sbjct  63    YFPYGIDFPQGPTGRFSNGYTIVDEIAELLGLPLIPPS-TSPATGAMR-GLNYASAASGI  120

Query  421   LDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYF  600
             LD TG++F+GRIPFN+QI NFE T +Q++ NL A  VA  + + IFFVGMGSNDYLNNY 
Sbjct  121   LDITGRNFIGRIPFNQQIRNFENTLDQITGNLGAATVAPLVARCIFFVGMGSNDYLNNYL  180

Query  601   MPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGE  780
             MP YPT   Y+  QFA+ L+QQYTQQLTRLY LG RKF++ GIG MGCIP +LAR+ +G 
Sbjct  181   MPNYPTRSQYNSPQFANLLIQQYTQQLTRLYNLGGRKFIIPGIGTMGCIPNILARSSDGR  240

Query  781   CLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGC  960
             C E VNQ    FNAN++ MI+  +   P ++F ++D  +M Q I+ N   YGF V DRGC
Sbjct  241   CSEEVNQLSRDFNANLRTMISNLNANLPGSRFTYLDISRMNQDILANPAAYGFRVVDRGC  300

Query  961   CGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             CG+G+N G++TCLPF+ PC NR+EY+FWDAFHPT  VN+++   AFNG   + YP  I
Sbjct  301   CGIGRNRGQITCLPFQMPCLNREEYVFWDAFHPTQRVNIIMARRAFNGDLSVAYPFNI  358



>ref|XP_006390758.1| hypothetical protein EUTSA_v10019478mg [Eutrema salsugineum]
 gb|ESQ28044.1| hypothetical protein EUTSA_v10019478mg [Eutrema salsugineum]
Length=398

 Score =   392 bits (1006),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 200/345 (58%), Positives = 254/345 (74%), Gaps = 3/345 (1%)
 Frame = +1

Query  103   PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTG  282
             PV A  P L   G G++ +VPA+F+FGDSLIDNGNNNN+ SFAKANY PYGIDFN  PTG
Sbjct  49    PVFAPPPPLVDQG-GSDGVVPALFVFGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTG  107

Query  283   RFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPF  462
             RF NG T+VD IA+ LGLP+I AY E+   DQM  GVNYASAAAGIL  TG +F+GRIPF
Sbjct  108   RFCNGLTMVDGIAQLLGLPLIPAYSEAIG-DQMLRGVNYASAAAGILPDTGGNFVGRIPF  166

Query  463   NEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPN  639
             ++QI NFE T NQ+++     V +A  + +S+FF+GMGSNDYLNNY MP +PT   ++  
Sbjct  167   DQQIHNFETTLNQVASKSGGAVAIADSVARSLFFIGMGSNDYLNNYLMPNFPTRNQFNAQ  226

Query  640   QFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFN  819
             QF   LVQ Y  QLTRLY LG RKFV+ G+G+MGCIP++LA+  +G+C + VNQ VLPFN
Sbjct  227   QFGDLLVQNYANQLTRLYNLGGRKFVVAGVGRMGCIPSILAQGTDGKCSDEVNQLVLPFN  286

Query  820   ANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCL  999
              NVK MI+  +   PDAKF+++D   MF+ I+ N   YGF+  D+GCCG+G+N G++TCL
Sbjct  287   TNVKTMISNLNQNLPDAKFIYLDIAHMFEDIIANKASYGFTTLDKGCCGIGRNRGQITCL  346

Query  1000  PFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PFETPC NR +YLFWDAFHPT  VN+++   AF G   + +P+ I
Sbjct  347   PFETPCPNRDQYLFWDAFHPTEKVNLIMAKKAFAGDPTVAFPINI  391



>ref|XP_008459639.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis melo]
Length=378

 Score =   390 bits (1003),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 201/331 (61%), Positives = 246/331 (74%), Gaps = 2/331 (1%)
 Frame = +1

Query  142   EGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIA  321
              G   +VPAMFIFGDSLIDNGNNNNL +FA+ANY PYGIDF   PTGRFSNGYTIVD IA
Sbjct  42    RGGIGMVPAMFIFGDSLIDNGNNNNLPTFARANYFPYGIDFPQGPTGRFSNGYTIVDEIA  101

Query  322   KQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQ  501
             + LGLP+I     SP+   MR G+NYASAA+GILD TG++F+GRIPFN+QI NFE T +Q
Sbjct  102   ELLGLPLIPPS-TSPATGAMR-GLNYASAASGILDITGRNFIGRIPFNQQIRNFENTLDQ  159

Query  502   LSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqql  681
             ++ NL A +VA  + + IFFVGMGSNDYLNNY MP YPT   Y+  QFA+ L+QQYTQQL
Sbjct  160   ITGNLGAAMVAPVVARCIFFVGMGSNDYLNNYLMPNYPTRSQYNSRQFANLLIQQYTQQL  219

Query  682   trlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             TRLY LG RKF++ GIG MGCIP +LAR+ +G C E VNQ    FNANV+ MI   +   
Sbjct  220   TRLYNLGGRKFIIPGIGTMGCIPNILARSSDGRCSEEVNQLSRDFNANVRTMIANLNANL  279

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             P ++F ++D  +M Q I+ N   YGF V DRGCCG+G+N G++TCLPF+ PC NR+EY+F
Sbjct  280   PGSRFTYLDIARMNQDILANPAAYGFRVVDRGCCGIGRNRGQITCLPFQMPCLNREEYVF  339

Query  1042  WDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             WDAFHPT  VN+++   AFNG   + YP  I
Sbjct  340   WDAFHPTQRVNIIMARRAFNGDFSVAYPFNI  370



>ref|XP_010415867.1| PREDICTED: GDSL esterase/lipase At1g71691 [Camelina sativa]
Length=386

 Score =   390 bits (1003),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 201/369 (54%), Positives = 263/369 (71%), Gaps = 8/369 (2%)
 Frame = +1

Query  49    SALFILALVFVSAITEPVPVLAQA------PTLGFSGEGNNALVPAMFIFGDSLIDNGNN  210
             SAL  + +  +  ++  + V+ +       P +  +G     +VPA+FIFGDSLIDNGNN
Sbjct  12    SALLAVVIQLLHGVSSQLVVVEEPISAPPPPLVDLNGGPGYGIVPALFIFGDSLIDNGNN  71

Query  211   NNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYG  390
             NN+ SFAKANY PYGIDFN  PTGRF NG T+VD IA+ LGLP+I AY E+   DQ+  G
Sbjct  72    NNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRG  130

Query  391   VNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVG  567
             VNYASAAAGIL  TG +F+GRIPF++QI NFE T +Q++      V VA  + +S+FF+G
Sbjct  131   VNYASAAAGILPDTGGNFVGRIPFDQQIHNFEATLDQIAGKSGGAVAVADSVARSLFFIG  190

Query  568   MGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCI  747
             MGSNDYLNNY MP +PT   ++  QF   LVQQYT QLTRLY LG RKFV+ G+G+MGCI
Sbjct  191   MGSNDYLNNYLMPNFPTRNQFNSQQFGDHLVQQYTNQLTRLYNLGGRKFVVAGLGRMGCI  250

Query  748   PTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNK  927
             P++LA+ ++G+C E VNQ V+PFN NVK MI   +   PDAKF+++D  +M + I+ N  
Sbjct  251   PSILAQGNDGKCSEEVNQLVVPFNTNVKTMITNLNQNLPDAKFIYLDIAQMLEDIVANQA  310

Query  928   RYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGS  1107
              YGF+  D+GCCG+GKN G++TCLPFETPC+NR +Y+FWDAFHPT  VN+++   AF G 
Sbjct  311   AYGFTTMDKGCCGIGKNRGQITCLPFETPCANRDQYVFWDAFHPTEKVNLIMAKKAFAGD  370

Query  1108  NYLVYPMTI  1134
               + YP+ I
Sbjct  371   RTVAYPINI  379



>ref|XP_009761478.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=406

 Score =   391 bits (1005),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 209/334 (63%), Positives = 247/334 (74%), Gaps = 2/334 (1%)
 Frame = +1

Query  136   SGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDS  315
             SGE   ALVPA+F FGDSLID+GNNN LFSFAKANYLPYGIDF   PTGRFSN YTI+D 
Sbjct  68    SGEERRALVPALFAFGDSLIDSGNNNRLFSFAKANYLPYGIDFGG-PTGRFSNAYTILDQ  126

Query  316   IAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTK  495
             I   LGLP++  Y E  ++D+MR+GVNYASAAAGILD TG HF+ RIPF+ QI NFE T 
Sbjct  127   IGDLLGLPLLPPYSEIFNVDKMRFGVNYASAAAGILDITGFHFVERIPFSYQIKNFENTL  186

Query  496   NQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytq  675
               L  N+SA +V + + K IFFVGMGSNDYLNNY MP Y T   Y P ++A  LV QY +
Sbjct  187   VSLIKNMSAPIVEEAIPKCIFFVGMGSNDYLNNYIMPAYFTQDEYTPQKYAELLVHQYKE  246

Query  676   qltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFST  855
             QL +LY LGARKF++ GIG+MGCIP +LA + NGEC E VNQ V PFNA +K M  K + 
Sbjct  247   QLIKLYDLGARKFIIAGIGQMGCIPFLLAESSNGECSEMVNQMVHPFNAKLKTMTMKLNK  306

Query  856   TH-PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
             +  P   F+F+D + MF+ I  N K YGFSV DRGCCG GKN GEVTCLP +TPC NR +
Sbjct  307   SELPGGHFIFLDMENMFKDIFTNYKSYGFSVTDRGCCGSGKNKGEVTCLPMQTPCPNRDD  366

Query  1033  YLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             YLFWDA+HPTSAVN+LLG++AF G     +PM I
Sbjct  367   YLFWDAYHPTSAVNLLLGDMAFYGGPNFTFPMNI  400



>ref|NP_974125.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SF78.1|GDL29_ARATH RecName: Full=GDSL esterase/lipase At1g71691; AltName: Full=Extracellular 
lipase At1g71691; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF43219.1|AC012654_3 Strong similarity to the putative GDSL-motif containing lipase/hydrolase 
F26A9.7 from A. thaliana on BAC gb|AC016163 [Arabidopsis 
thaliana]
 gb|AAG51812.1|AC016163_1 putative GDSL-motif lipase/hydrolase; 24593-26678 [Arabidopsis 
thaliana]
 gb|AEE35214.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=384

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 203/356 (57%), Positives = 258/356 (72%), Gaps = 9/356 (3%)
 Frame = +1

Query  70    LVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLP  249
             +V    I+ P P L    T    G+G   +VPA+F+FGDSLIDNGNNNN+ SFAKANY P
Sbjct  30    VVVEEPISAPPPPLVDLNT----GDG---IVPALFVFGDSLIDNGNNNNIPSFAKANYFP  82

Query  250   YGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDF  429
             YGIDFN  PTGRF NG T+VD IA+ LGLP+I AY E+   DQ+  GVNYASAAAGIL  
Sbjct  83    YGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGVNYASAAAGILPD  141

Query  430   TGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGMGSNDYLNNYFMP  606
             TG +F+GRIPF++QI NFE T +Q+++     V +A  +T+S+FF+GMGSNDYLNNY MP
Sbjct  142   TGGNFVGRIPFDQQIHNFETTLDQVASKSGGAVAIADSVTRSLFFIGMGSNDYLNNYLMP  201

Query  607   GYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECL  786
              +PT   Y+  QF   LVQ YT QLTRLY LG RKFV+ G+G+MGCIP++LA+ ++G+C 
Sbjct  202   NFPTRNQYNSQQFGDLLVQHYTDQLTRLYNLGGRKFVVAGLGRMGCIPSILAQGNDGKCS  261

Query  787   ESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCG  966
             E VNQ VLPFN NVK MI+  +   PDAKF+++D   MF+ I+ N   YG +  D+GCCG
Sbjct  262   EEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDIAHMFEDIVANQAAYGLTTMDKGCCG  321

Query  967   VGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +GKN G++TCLPFETPC NR +Y+FWDAFHPT  VN+++   AF G   + YP+ I
Sbjct  322   IGKNRGQITCLPFETPCPNRDQYVFWDAFHPTEKVNLIMAKKAFAGDRTVAYPINI  377



>ref|XP_009631479.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana tomentosiformis]
Length=409

 Score =   390 bits (1001),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 209/334 (63%), Positives = 248/334 (74%), Gaps = 2/334 (1%)
 Frame = +1

Query  136   SGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDS  315
             SG     LVPA+F FGDSLID+GNNN LFSFAKANY PYGIDF   PTGRFSNGYTI+D 
Sbjct  69    SGGERRGLVPALFAFGDSLIDSGNNNRLFSFAKANYFPYGIDFGG-PTGRFSNGYTILDQ  127

Query  316   IAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTK  495
             I   LGLP++  Y E  ++D+MR+GVNYASAAAGILD TG HF+ RIPF+ QI NFE T 
Sbjct  128   IGDLLGLPLLPPYSEIFNVDKMRFGVNYASAAAGILDITGFHFVERIPFSYQIKNFESTL  187

Query  496   NQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytq  675
               L  N+SA +V + + K IFFVGMGSNDYLNNY MP Y T   Y P +FA  LV QY +
Sbjct  188   VSLVKNMSAPIVEEAIPKCIFFVGMGSNDYLNNYIMPAYFTQDEYTPQKFAELLVHQYKE  247

Query  676   qltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFST  855
             QL +LY LGARKF++ GIG+MGCIP +LA + NGEC E VNQ V PFNA +K MI K + 
Sbjct  248   QLIKLYDLGARKFIIAGIGQMGCIPFLLAESSNGECSEMVNQMVRPFNAKLKTMIMKLNK  307

Query  856   TH-PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
             +  P A F+F+D + MF+ I  N K YGFSV +RGCCG GKN GEVTCLP +TPC NR +
Sbjct  308   SELPGAHFIFLDMENMFKDIFINYKSYGFSVKNRGCCGSGKNKGEVTCLPMQTPCPNRDD  367

Query  1033  YLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             YLFWDA+HPTSAVN+LLG++AF G +   +PM I
Sbjct  368   YLFWDAYHPTSAVNLLLGDMAFYGGSNFTFPMNI  401



>emb|CDX96333.1| BnaA07g29440D [Brassica napus]
Length=382

 Score =   389 bits (998),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 196/367 (53%), Positives = 262/367 (71%), Gaps = 6/367 (2%)
 Frame = +1

Query  46    FSALFILALVFVSAITEPV---PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNN  216
             F AL ++ +  +  +   +   P+ A  P L    +GN+A+VPA+F+FGDSLIDNGNNNN
Sbjct  11    FPALLLVVIQLLHGVCGQLVVEPISAPPPPL-VKQDGNDAIVPALFVFGDSLIDNGNNNN  69

Query  217   LFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVN  396
             + SFAKANY PYGIDFN  PTGRF NG T+VD IA+ LGLP+I AY E+   DQ+  GVN
Sbjct  70    IPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGVN  128

Query  397   YASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGMG  573
             YASAAAGIL  TG +FMGRIPF++QI NF+ T +Q+++     V +A  + + +FF+GMG
Sbjct  129   YASAAAGILPDTGGNFMGRIPFDQQIHNFQTTLDQMASKSGGPVAIADSVARGLFFIGMG  188

Query  574   SNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPT  753
             SNDYLNNY +P +PT   ++ +QF   LVQ Y   LTRLY LG RKF++ G+G+MGCIP+
Sbjct  189   SNDYLNNYLLPNFPTRNQFNAHQFGDLLVQHYANHLTRLYNLGGRKFIVAGLGRMGCIPS  248

Query  754   MLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRY  933
             +LA+  +G+C E VNQ VLPFN NVK MI+  +   PDAKF+++D  +M + I+ N   Y
Sbjct  249   ILAQGTDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDITQMLEDIIANPAVY  308

Query  934   GFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNY  1113
             G +  D+GCCG+G+N G++TCLPFETPC NR +YLFWDAFHPT  VN+++   AF G   
Sbjct  309   GVTTLDKGCCGIGRNRGQITCLPFETPCPNRDQYLFWDAFHPTEKVNLIMARKAFAGDRT  368

Query  1114  LVYPMTI  1134
             + +P+ I
Sbjct  369   VAFPINI  375



>ref|XP_002888840.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65099.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=384

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 253/345 (73%), Gaps = 3/345 (1%)
 Frame = +1

Query  103   PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTG  282
             P+ A  P L     G+  +VPA+F+FGDSLIDNGNNNN+ SFAKANY PYGIDFN  PTG
Sbjct  35    PISAPPPPLVDLNSGD-GIVPALFVFGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTG  93

Query  283   RFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPF  462
             RF NG T+VD IA+ LGLP+I AY E+   DQ+  GVNYASAAAGIL  TG +F+GRIPF
Sbjct  94    RFCNGLTMVDGIAQLLGLPLIPAYSEATG-DQVLRGVNYASAAAGILPDTGGNFVGRIPF  152

Query  463   NEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPN  639
             ++QI NFE T +Q+++     V +A  +T+S+FF+GMGSNDYLNNY MP +PT   Y+  
Sbjct  153   DQQIHNFETTLDQVASKSGGAVAIADSVTRSLFFIGMGSNDYLNNYLMPNFPTRNQYNSQ  212

Query  640   QFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFN  819
             QF   LVQ YT QLTRLY LG RKFV+ G+G+MGCIP++LA+ ++G+C E VNQ VLPFN
Sbjct  213   QFGDLLVQHYTNQLTRLYNLGGRKFVVAGLGRMGCIPSILAQGNDGKCSEEVNQLVLPFN  272

Query  820   ANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCL  999
              NVK MI+  +   P AKF+++D   MF+ I+ N   YG +  D+GCCG+GKN G++TCL
Sbjct  273   TNVKTMISNLNQNLPAAKFIYLDIAHMFEDIVANQAAYGLTTMDKGCCGIGKNRGQITCL  332

Query  1000  PFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PFETPC NR +Y+FWDAFHPT  VN+++   AF G   + YP+ I
Sbjct  333   PFETPCPNRDQYVFWDAFHPTEKVNLIMAKKAFAGDRTVAYPINI  377



>ref|XP_009105822.1| PREDICTED: GDSL esterase/lipase At1g71691 [Brassica rapa]
Length=454

 Score =   389 bits (998),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/345 (56%), Positives = 254/345 (74%), Gaps = 3/345 (1%)
 Frame = +1

Query  103   PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTG  282
             P+ A  P L    +GN+A+VPA+F+FGDSLIDNGNNNN+ SFAKANY PYGIDFN  PTG
Sbjct  105   PISAPPPPL-VKQDGNDAIVPALFVFGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTG  163

Query  283   RFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPF  462
             RF NG T+VD IA+ LGLP+I AY E+ + DQ+  GVNYASAAAGIL  TG +FMGRIPF
Sbjct  164   RFCNGLTMVDGIAQLLGLPLIPAYSEA-TGDQVLRGVNYASAAAGILPDTGGNFMGRIPF  222

Query  463   NEQIDNFEKTKNQLSANLSADV-VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPN  639
             ++QI NF+ T +Q+++     V +A  + + +FF+GMGSNDYLNNY +P +PT   ++ +
Sbjct  223   DQQIHNFQTTLDQMASKSGGPVAIADSVARGLFFIGMGSNDYLNNYLLPNFPTRNQFNAH  282

Query  640   QFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFN  819
             QF   LVQ Y   LTRLY LG RKF++ G+G+MGCIP++LA+  +G+C E VNQ VLPFN
Sbjct  283   QFGDLLVQHYANHLTRLYNLGGRKFIVAGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFN  342

Query  820   ANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCL  999
              NVK MI+  +   PDAKF+++D  +M + I+ N   YG +  D+GCCG+G+N G++TCL
Sbjct  343   TNVKTMISNLNQNLPDAKFIYLDITQMLEDIIANPAVYGVTTLDKGCCGIGRNRGQITCL  402

Query  1000  PFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PFETPC NR +YLFWDAFHPT  VN+++   AF G   + +P+ I
Sbjct  403   PFETPCPNRDQYLFWDAFHPTEKVNLIMARKAFAGDRTVAFPINI  447



>ref|XP_010521103.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g71691 
[Tarenaya hassleriana]
Length=387

 Score =   385 bits (989),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 197/337 (58%), Positives = 250/337 (74%), Gaps = 13/337 (4%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMF+FGDSLIDNGNNNNL SFAKANY PYGIDF+  PTGRFSNGYT+VD +A+ LGLP
Sbjct  44    VPAMFVFGDSLIDNGNNNNLPSFAKANYFPYGIDFSGGPTGRFSNGYTMVDELAELLGLP  103

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             +I A+ E+   DQ+  GVNYASAAAGILD TG++F+GRIPF++QI NF+ T +Q+++   
Sbjct  104   LIPAFSEATG-DQVLRGVNYASAAAGILDVTGRNFVGRIPFDQQIKNFQSTLDQVTSRGG  162

Query  520   ADV-VAKDLTKSIFFVGMGSNDYLNNYFM-----------PGYPTSFFYDPNQFAStlvq  663
             + V VA+ + +S+FFVGMGSNDYLNNY M           P  PT+       F+  LVQ
Sbjct  163   SAVEVAESVARSLFFVGMGSNDYLNNYLMFVVGXIRIIHRPHNPTTAHTRFQPFSHRLVQ  222

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMIN  843
             QYT QLT LY LGARKFVL G+G+MGCIP++LA+  +G C E+VNQ VLPFN NVK MI+
Sbjct  223   QYTTQLTNLYNLGARKFVLAGLGRMGCIPSILAQGTDGRCSEAVNQLVLPFNTNVKAMIS  282

Query  844   KFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSN  1023
               ST  P +KF ++D   MF+ I+ N   YGF+V DRGCCG+G+N G++TCLP +TPC N
Sbjct  283   NLSTNLPGSKFTYVDIAHMFEDIVTNPATYGFTVVDRGCCGIGRNRGQITCLPLQTPCEN  342

Query  1024  RQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             R +Y+FWDAFHPT  VNV++   AF+G   + +P+ I
Sbjct  343   RDQYVFWDAFHPTEKVNVIMARKAFSGDQTVAFPLNI  379



>ref|XP_004962048.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Setaria italica]
Length=383

 Score =   380 bits (977),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 194/326 (60%), Positives = 237/326 (73%), Gaps = 1/326 (0%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMF+FGDSL DNGNNN+L S AKANY PYGIDF   PTGRFSNGYT+VD IA+ LGLP
Sbjct  50    VPAMFVFGDSLTDNGNNNDLQSLAKANYPPYGIDFAGGPTGRFSNGYTMVDEIAQLLGLP  109

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             ++ ++  + S D   +GVN+ASAAAGILD TGQ+F+GRIPFN+QI NFE+T +QLS  L 
Sbjct  110   LLPSHPSASSADAALHGVNFASAAAGILDNTGQNFVGRIPFNQQIKNFEQTLDQLSRKLG  169

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              A  +A  L +SIF+VGMGSNDYLNNY MP Y T   YD +Q+++ LVQQY +QL  LY 
Sbjct  170   GAGKLAPSLARSIFYVGMGSNDYLNNYLMPNYNTRNEYDGDQYSTLLVQQYAKQLGALYK  229

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
             LGARKFV+ G+G M CIP M AR+    C   V+  ++PFN  VK M+N  +   P+AKF
Sbjct  230   LGARKFVIAGVGSMACIPNMRARSPRNVCSPDVDDLIIPFNNKVKAMVNSLNANRPNAKF  289

Query  877   VFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFH  1056
             +++D   M   ++ N   YGFSV DRGCCG+G+N G +TCLPF  PC NR  Y+FWDAFH
Sbjct  290   IYVDNYAMISEVLRNPWSYGFSVVDRGCCGIGRNRGMITCLPFLRPCLNRNTYIFWDAFH  349

Query  1057  PTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PT  VNVLLG  AFNG   +VYPM I
Sbjct  350   PTERVNVLLGRAAFNGGTDVVYPMNI  375



>ref|XP_002439816.1| hypothetical protein SORBIDRAFT_09g020670 [Sorghum bicolor]
 gb|EES18246.1| hypothetical protein SORBIDRAFT_09g020670 [Sorghum bicolor]
Length=386

 Score =   380 bits (976),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 194/327 (59%), Positives = 241/327 (74%), Gaps = 1/327 (0%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             LVPAMF+FGDSL DNGNNN+L S AKANY PYGIDF   PTGRFSNGYT+VD IA+ LGL
Sbjct  52    LVPAMFVFGDSLTDNGNNNDLNSLAKANYPPYGIDFAGGPTGRFSNGYTMVDEIAQLLGL  111

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P++ ++ ++ S D   +GVNYASAAAGILD TGQ+F+GRIPFN+QI NFE+T + LS +L
Sbjct  112   PLLPSHPDASSGDAALHGVNYASAAAGILDNTGQNFVGRIPFNQQIKNFEQTLDTLSKHL  171

Query  517   S-ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrly  693
               A  +A  L +SIF+VGMGSNDYLNNY MP Y T   Y+ +Q+++ LVQQY +QL  LY
Sbjct  172   GGASKLAPSLARSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQQYAKQLGTLY  231

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAK  873
              LGAR+FV+ G+G M CIP M AR+    C   V+  ++PFN+ VK M+N  +   P AK
Sbjct  232   NLGARRFVIAGVGSMACIPNMRARSPVNMCSPDVDDLIIPFNSKVKAMVNTLNANRPGAK  291

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
             F+++D   M   ++ N   YGFSV DRGCCG+G+N G +TCLPF  PC NRQ Y+FWDAF
Sbjct  292   FIYVDNYAMISQVLRNPWSYGFSVTDRGCCGIGRNRGMITCLPFLRPCLNRQAYIFWDAF  351

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT  VNVLLG  AF+G N +VYPM I
Sbjct  352   HPTERVNVLLGRAAFSGGNDVVYPMNI  378



>gb|KCW69515.1| hypothetical protein EUGRSUZ_F02957 [Eucalyptus grandis]
Length=350

 Score =   377 bits (968),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 196/327 (60%), Positives = 245/327 (75%), Gaps = 3/327 (1%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQ-LG  333
             LVPAMFIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRF NGYT+VD I    L 
Sbjct  20    LVPAMFIFGDSLIDNGNNNNLPSFAKANYFPYGIDFNRGPTGRFCNGYTMVDEIGPSPLA  79

Query  334   LPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
              P+  +Y    +  ++ +GV   SA +  +D   +  +GRIPF++QI NF+ T +Q++ N
Sbjct  80    FPLQCSYFCMSAAYRL-HGVASRSALSSRID-AKRLLVGRIPFDQQITNFQSTLDQITDN  137

Query  514   LSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrly  693
             L AD VA+ L + +FFVGMGSNDYLNNY MP Y T   Y+  QFA  LVQQYT+QLT LY
Sbjct  138   LGADDVARALARCLFFVGMGSNDYLNNYLMPNYDTKNQYNGQQFADLLVQQYTRQLTTLY  197

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAK  873
              LGARKF++ GIG+MGCIP++LA+ + G C E VN+ V PFNANVK MIN  +   P AK
Sbjct  198   NLGARKFIIAGIGEMGCIPSILAQNEAGICSEEVNRLVQPFNANVKTMINNLNVNLPGAK  257

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
             F++ID  +MFQ I+ N + YGFSV DRGCCG+G+NSG++TCLPF+TPC+NR++Y+FWDAF
Sbjct  258   FIYIDIARMFQDIVTNARSYGFSVVDRGCCGIGRNSGQITCLPFQTPCANRKQYVFWDAF  317

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT AVNV++G  AFNG   +VYP+ I
Sbjct  318   HPTEAVNVIMGRKAFNGDPSIVYPINI  344



>gb|KFK41586.1| hypothetical protein AALP_AA2G148200 [Arabis alpina]
Length=386

 Score =   377 bits (967),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/369 (54%), Positives = 255/369 (69%), Gaps = 7/369 (2%)
 Frame = +1

Query  46    FSALFILALVFVSAITEPV-----PVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNN  210
             F AL  + L  +  I+        P+ A  P L     G +  VPA+F+FGDSLID+GNN
Sbjct  12    FPALLAVVLHLMHGISGQFVGVEEPIFAPPPPLVDLDYGGDGHVPALFVFGDSLIDDGNN  71

Query  211   NNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYG  390
             NN+ SFAKANY PYGIDFN  PTGRF NG T+VD IA+ LGLP+I A  E+   DQ+  G
Sbjct  72    NNIASFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPANSEATG-DQVLRG  130

Query  391   VNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKD-LTKSIFFVG  567
             VNYASAAAGIL  TG +F+GRIPF+EQI NFE T NQ++      V   D +++S+FFVG
Sbjct  131   VNYASAAAGILPETGGNFVGRIPFDEQIKNFETTLNQVATKSGGAVAMADSVSQSLFFVG  190

Query  568   MGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCI  747
             MGSNDYLNNY MP +PT   Y+  Q+A  LVQ+YT QLTRLY  G RKFV+ G+G+MGCI
Sbjct  191   MGSNDYLNNYLMPNFPTRNQYNAQQYADLLVQRYTDQLTRLYNNGGRKFVVAGLGRMGCI  250

Query  748   PTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNK  927
             P++LA+  +G+C E VNQ VLPFN NVK MI+  +   P +KF+++D   M + I+ +  
Sbjct  251   PSILAQGTDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPGSKFIYLDIAHMLEDIVASPA  310

Query  928   RYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGS  1107
              YG +  D+GCCG+G+N G++TCLPFETPC NR +YLFWDAFHPT  VN+++   A+ G 
Sbjct  311   TYGITTLDKGCCGIGRNRGQITCLPFETPCPNRDQYLFWDAFHPTEKVNLIMAKKAYAGD  370

Query  1108  NYLVYPMTI  1134
                 +P+ I
Sbjct  371   RTDAFPINI  379



>ref|XP_006339345.1| PREDICTED: formin-2-like [Solanum tuberosum]
Length=692

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 204/323 (63%), Positives = 243/323 (75%), Gaps = 3/323 (1%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIA  348
             +F FGDSLID+GNNN LFSFAKANYLPYGID    PTGRFSNGYTI+D I   LGLP++ 
Sbjct  366   LFAFGDSLIDSGNNNQLFSFAKANYLPYGIDVGG-PTGRFSNGYTILDQIGVLLGLPLLP  424

Query  349   AYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV  528
             +Y E  ++D M +GVNYASAAAGILD TG HF+ RIPF+ QI NFE T   L  N+SA +
Sbjct  425   SYSEEFNVDTMCFGVNYASAAAGILDVTGFHFVERIPFSYQIKNFENTLVNLIKNMSAPI  484

Query  529   VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGAR  708
             V + + K IFFVGMG+NDYLNNY MP Y T   Y P +FA  LV QY  QLT+LY LGAR
Sbjct  485   VKEAIPKCIFFVGMGNNDYLNNYIMPVYFTQDQYSPQKFAELLVHQYKAQLTKLYDLGAR  544

Query  709   KFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFID  888
             KF++TGIG+MGCIP+MLA    G C ESVN+ V PFN+ ++ MI K +     A F+F+D
Sbjct  545   KFIITGIGQMGCIPSMLAETSGGGCSESVNEMVHPFNSKLRTMIMKLNKDLAGAHFIFLD  604

Query  889   TDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSA  1068
              + MF+ I  N+K YGFSV DRGCCG+GKN GEVTCLPFE PC+NR EYLFWDA+HPTSA
Sbjct  605   MEYMFKDIFKNHKAYGFSVIDRGCCGLGKNQGEVTCLPFEIPCANRDEYLFWDAYHPTSA  664

Query  1069  VNVLLGNLAF-NGSNYLVYPMTI  1134
             VN+LLG +AF N +NY  YP+ I
Sbjct  665   VNLLLGRMAFYNDANY-SYPINI  686



>ref|XP_010312984.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum lycopersicum]
Length=407

 Score =   373 bits (957),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 242/324 (75%), Gaps = 4/324 (1%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIA  348
             +F FGDSLID+GNNN LFSFAKANYLPYGID    PTGRFSNGYTI+D I   LGLP++ 
Sbjct  80    LFAFGDSLIDSGNNNQLFSFAKANYLPYGIDVGG-PTGRFSNGYTILDQIGVLLGLPLLP  138

Query  349   AYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV  528
             +Y E  ++D MRYGVNYASAAAGILD TG HF+ RIPF+ QI NFE T   L  NLSA V
Sbjct  139   SYSEEFNVDTMRYGVNYASAAAGILDVTGFHFVERIPFSYQIKNFENTLVNLIKNLSAPV  198

Query  529   VAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGA  705
             V + + + IFFVGMG+NDYLNNY MP  Y +   Y P +FA  LV QY  QL +LY LGA
Sbjct  199   VKEAIPQCIFFVGMGNNDYLNNYIMPAVYFSQDQYSPQKFAELLVHQYKAQLLKLYDLGA  258

Query  706   RKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFI  885
             RKF+++GIG+MGCIP+MLA    G C E+VN+ V PFN+ ++ MI K +     A  +F+
Sbjct  259   RKFIISGIGQMGCIPSMLAETSGGGCSETVNEMVHPFNSKLRTMIIKLNKDLAGAHLIFL  318

Query  886   DTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTS  1065
             D + MF+ I  N+K YGFSV DRGCCG+GKN GEVTCLPFE PC+NR EYLFWDA+HPTS
Sbjct  319   DMEYMFKDIFKNHKAYGFSVIDRGCCGLGKNQGEVTCLPFEIPCANRDEYLFWDAYHPTS  378

Query  1066  AVNVLLGNLAF-NGSNYLVYPMTI  1134
             AVN+LLG +AF N +NY  YP+ I
Sbjct  379   AVNLLLGRMAFYNDANY-SYPINI  401



>ref|XP_003568429.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Brachypodium 
distachyon]
Length=389

 Score =   370 bits (949),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 190/328 (58%), Positives = 237/328 (72%), Gaps = 3/328 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMF+FGDSL DNGNNN+L S AKANYLPYGIDF   PTGRFSNGYT+VD+IA+ LGLP
Sbjct  54    VPAMFVFGDSLTDNGNNNDLTSLAKANYLPYGIDFAGGPTGRFSNGYTMVDAIAELLGLP  113

Query  340   MIAAYLESPSIDQ---MRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
             ++ +  E  S D      +GVNYASAAAGILD TGQ+F+GRIPFNEQI NF+ T +++  
Sbjct  114   LLPSNNEVSSADGNDGALHGVNYASAAAGILDNTGQNFVGRIPFNEQIKNFQGTLDKIKG  173

Query  511   NLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrl  690
              L A  ++  L +SIF+VGMGSNDYLNNY MP Y T   Y+ +Q+++ LVQ YT+QLT L
Sbjct  174   RLGASKLSGSLGRSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQHYTKQLTSL  233

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
             Y LGAR+FV+ G+G M CIP M AR     C   V+  ++PFN+ VK M+N  +   P A
Sbjct  234   YNLGARRFVIAGVGSMACIPNMRARNPRNMCSPDVDDLIVPFNSKVKGMVNTLNVNLPRA  293

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             +F+++DT +M   ++ N   YGFSV DRGCCG+G+N G +TCLPF  PC NR  Y+FWDA
Sbjct  294   RFIYVDTFEMISEVLRNPLNYGFSVVDRGCCGIGRNRGVITCLPFLRPCPNRSTYIFWDA  353

Query  1051  FHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FHPT  VNVLLG  A++G   L YPM I
Sbjct  354   FHPTERVNVLLGKAAYSGGTDLAYPMNI  381



>ref|XP_004973035.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Setaria italica]
Length=368

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 238/325 (73%), Gaps = 0/325 (0%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
              PA+F+FGDSLID+GNNNNL S AKANY PYGIDF   PTGRFSNGYTIVD +A+ LGLP
Sbjct  38    APALFVFGDSLIDSGNNNNLASLAKANYFPYGIDFTAGPTGRFSNGYTIVDELAELLGLP  97

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             ++  Y ++ S+ ++  G NYASAAAGILD +G +F GRIPFN+QI NFE T  Q++A   
Sbjct  98    LVPPYSQTSSVQEVLQGANYASAAAGILDDSGGNFAGRIPFNQQIRNFESTVAQIAAAAG  157

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytl  699
                 A  + +SI FVGMGSNDYLNNY  P Y T   YDP+QFA  L +Q+  QLTRLY  
Sbjct  158   DAAAADRVARSILFVGMGSNDYLNNYLAPNYDTRRRYDPHQFAGLLARQFASQLTRLYKA  217

Query  700   GARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFV  879
             GARKFV+ G+G MGCIPT+LA++  G C   V+  VLPFNANV+ M++  +   P A+F 
Sbjct  218   GARKFVVAGVGSMGCIPTVLAQSLAGRCSPEVDGLVLPFNANVRAMLDGLNADLPGARFT  277

Query  880   FIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHP  1059
             ++D  ++F+ I+ N   +GFSV DRGCCG+G+N G++TCLPF  PC++R+ YLFWDA+HP
Sbjct  278   YLDNFRIFKAILANPAAFGFSVVDRGCCGIGRNGGQITCLPFMPPCADRERYLFWDAYHP  337

Query  1060  TSAVNVLLGNLAFNGSNYLVYPMTI  1134
             T+AVNV++   AF+G   ++ P+ +
Sbjct  338   TAAVNVMIAREAFHGGADVMAPINV  362



>ref|NP_001150393.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG38924.1| anther-specific proline-rich protein APG [Zea mays]
Length=389

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 235/331 (71%), Gaps = 6/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMF+FGDSL DNGNNN+L S AKANY PYGIDF   PTGRFSNGYT+VD IA+ LGLP
Sbjct  51    VPAMFVFGDSLTDNGNNNDLNSLAKANYPPYGIDFAGGPTGRFSNGYTMVDEIAQLLGLP  110

Query  340   MIAAYLESPSI---DQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
             ++ ++ ++ S    D   +GVNYASAAAGILD TGQ+F+GRIPFN+QI NFE+T  QL  
Sbjct  111   LLPSHTDAASSGGGDAALHGVNYASAAAGILDNTGQNFVGRIPFNQQIKNFEQTLEQLRR  170

Query  511   NLSA---DVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqql  681
               +       A  L +SIF+VGMGSNDYLNNY MP Y T   Y+ +Q+++ LV+QY +QL
Sbjct  171   RTTTTRPGAGAGGLARSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVRQYARQL  230

Query  682   trlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
               LY LGAR+FV+ G+G M CIP M AR+    C   V+  ++PFN  VK M+   +   
Sbjct  231   DALYGLGARRFVIAGVGSMACIPNMRARSPVNMCSPDVDDLIIPFNTKVKAMVTSLNANR  290

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             PDAKF+++D   M   I++N   YGFSV DRGCCG+G+N G +TCLPF  PC NR  Y+F
Sbjct  291   PDAKFIYVDNYAMISQILSNPWSYGFSVADRGCCGIGRNRGMITCLPFLRPCLNRNSYIF  350

Query  1042  WDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             WDAFHPT  VNVLLG  AF+G N +VYPM I
Sbjct  351   WDAFHPTERVNVLLGRAAFSGGNDVVYPMNI  381



>ref|NP_001147753.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG28564.1| anther-specific proline-rich protein APG [Zea mays]
 gb|AFW78046.1| anther-specific proline-rich protein APG [Zea mays]
Length=391

 Score =   366 bits (940),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/331 (57%), Positives = 235/331 (71%), Gaps = 6/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMF+FGDSL DNGNNN+L S AKANY PYGIDF   PTGRFSNGYT+VD IA+ LGLP
Sbjct  53    VPAMFVFGDSLTDNGNNNDLNSLAKANYPPYGIDFAGGPTGRFSNGYTMVDEIAQLLGLP  112

Query  340   MIAAYLESPSI---DQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
             ++ ++ ++ S    D   +GVNYASAAAGILD TGQ+F+GRIPFN+QI NFE+T  QL  
Sbjct  113   LLPSHTDAASSGGGDAALHGVNYASAAAGILDNTGQNFVGRIPFNQQIKNFEQTLEQLRR  172

Query  511   NLSA---DVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqql  681
               +       A  L +SIF+VGMGSNDYLNNY MP Y T   Y+ +Q+++ LV+QY +QL
Sbjct  173   RTTTTRPGAGAGGLARSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVRQYARQL  232

Query  682   trlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
               LY LGAR+FV+ G+G M CIP M AR+    C   V+  ++PFN  VK M+   +   
Sbjct  233   DALYGLGARRFVIAGVGSMACIPNMRARSPVNMCSPDVDDLIIPFNTKVKAMVTSLNANR  292

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             PDAKF+++D   M   I++N   YGFSV DRGCCG+G+N G +TCLPF  PC NR  Y+F
Sbjct  293   PDAKFIYVDNYAMISQILSNPWSYGFSVADRGCCGIGRNRGMITCLPFLRPCLNRNSYIF  352

Query  1042  WDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             WDAFHPT  VNVLLG  AF+G N +VYPM I
Sbjct  353   WDAFHPTERVNVLLGRAAFSGGNDVVYPMNI  383



>gb|EEC82803.1| hypothetical protein OsI_27577 [Oryza sativa Indica Group]
Length=381

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 235/333 (71%), Gaps = 3/333 (1%)
 Frame = +1

Query  145   GNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAK  324
             G  A+VPA+F+FGDSLIDNGNNNNL SFAKANY PYGIDF   PTGRF NGYTIVD +A+
Sbjct  43    GKAAMVPALFVFGDSLIDNGNNNNLASFAKANYYPYGIDFAAGPTGRFCNGYTIVDELAE  102

Query  325   QLGLPMIAAYLE-SPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQ  501
              LGLP++  Y + S  + Q+  GVN+ASAAAGILD +G +F+GRIPFN+QIDNFE T  Q
Sbjct  103   LLGLPLVPPYSQASGHVQQLLQGVNFASAAAGILDESGGNFVGRIPFNQQIDNFEATVEQ  162

Query  502   LSANLSA-DVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqq  678
             ++  +   +  A  + +SI FVG+GSNDYLNNY MP Y T   Y P QFA  L  +Y  Q
Sbjct  163   IAGAVGGKEAAASMVARSILFVGLGSNDYLNNYLMPNYNTRRRYTPRQFADLLADRYAAQ  222

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTT  858
             LTRLY  GARKFV+ G+G MGCIP +LA++    C   V+  V+PFNANV+ M+ +    
Sbjct  223   LTRLYKAGARKFVVAGVGSMGCIPNVLAQSVESRCSPEVDALVVPFNANVRAMLGRLDGG  282

Query  859   H-PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEY  1035
               P A  VF+D   +F+ I+ +   +GF+V DRGCCG+G+N+G+VTCLPF  PC  R  Y
Sbjct  283   GLPGASLVFLDNYGVFKAILGDPAAHGFAVVDRGCCGIGRNAGQVTCLPFMPPCDGRDRY  342

Query  1036  LFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +FWDAFHPT+AVNVL+   AF G   +V P+ +
Sbjct  343   VFWDAFHPTAAVNVLIAREAFYGGADVVSPINV  375



>ref|NP_001060835.1| Os08g0112900 [Oryza sativa Japonica Group]
 dbj|BAD09513.1| putative GDSL-motif lipase/hydrolase protein [Oryza sativa Japonica 
Group]
 dbj|BAF22749.1| Os08g0112900 [Oryza sativa Japonica Group]
 gb|EEE67926.1| hypothetical protein OsJ_25801 [Oryza sativa Japonica Group]
Length=381

 Score =   365 bits (937),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 185/333 (56%), Positives = 235/333 (71%), Gaps = 3/333 (1%)
 Frame = +1

Query  145   GNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAK  324
             G  A+VPA+F+FGDSLIDNGNNNNL SFAKANY PYGIDF   PTGRF NGYTIVD +A+
Sbjct  43    GKAAMVPALFVFGDSLIDNGNNNNLASFAKANYYPYGIDFAAGPTGRFCNGYTIVDELAE  102

Query  325   QLGLPMIAAYLE-SPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQ  501
              LGLP++  Y + S  + Q+  GVN+ASAAAGILD +G +F+GRIPFN+QIDNFE T  Q
Sbjct  103   LLGLPLVPPYSQASGHVQQLLQGVNFASAAAGILDESGGNFVGRIPFNQQIDNFEATVEQ  162

Query  502   LSANLSA-DVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqq  678
             ++  +   +  A  + +SI FVG+GSNDYLNNY MP Y T   Y P QFA  L  +Y  Q
Sbjct  163   IAGAVGGKEAAASMVARSILFVGLGSNDYLNNYLMPNYNTRRRYTPRQFADLLADRYAAQ  222

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTT  858
             LTRLY  GARKFV+ G+G MGCIP +LA++    C   V+  V+PFNANV+ M+ +    
Sbjct  223   LTRLYKAGARKFVVAGVGSMGCIPNVLAQSVESRCSPEVDALVVPFNANVRAMLGRLDGG  282

Query  859   H-PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEY  1035
               P A  VF+D   +F+ I+ +   +GF+V DRGCCG+G+N+G+VTCLPF  PC  R  Y
Sbjct  283   GLPGASLVFLDNYGVFKAILGDPAAHGFAVVDRGCCGIGRNAGQVTCLPFMPPCDGRDRY  342

Query  1036  LFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +FWDAFHPT+AVNVL+   AF G   +V P+ +
Sbjct  343   VFWDAFHPTAAVNVLIAREAFYGGADVVSPINV  375



>ref|XP_006441602.1| hypothetical protein CICLE_v10023728mg, partial [Citrus clementina]
 gb|ESR54842.1| hypothetical protein CICLE_v10023728mg, partial [Citrus clementina]
Length=300

 Score =   361 bits (927),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/293 (62%), Positives = 229/293 (78%), Gaps = 1/293 (0%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             +VPA+FIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGL
Sbjct  1     MVPALFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIAELLGL  60

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             P+I AY E+ S  Q+ +GV+YASAAAGILD TG++F+GRIPF++QI NF+ T +Q++ NL
Sbjct  61    PLIPAYSEA-SGAQVLHGVSYASAAAGILDITGRNFVGRIPFDQQIRNFQNTLDQVTDNL  119

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
              A  V+  + + IFFVGMGSNDYLNNY MP Y T   Y+  Q+A  LV +Y++QLT LY 
Sbjct  120   GASDVSNAIARCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQYADLLVSEYSRQLTTLYN  179

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
             LGARKFVL G+G++GCIP +LA+     C E VNQ V+PFNANVK MIN  +   P A+F
Sbjct  180   LGARKFVLAGLGRIGCIPRILAQNQMDRCSEEVNQLVMPFNANVKTMINNLNANLPGARF  239

Query  877   VFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEY  1035
              FID  +MF+ ++ N + YGFSV DRGCCG+G+N G++TCLPF+ PC+NR++Y
Sbjct  240   TFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQIPCANREQY  292



>dbj|BAJ92238.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   364 bits (935),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 188/328 (57%), Positives = 234/328 (71%), Gaps = 3/328 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMF+FGDSL DNGNNN+L S AKANYLPYGIDF   PTGRFSNGYT+VD+IA+ LGLP
Sbjct  59    VPAMFVFGDSLTDNGNNNDLTSLAKANYLPYGIDFAGGPTGRFSNGYTMVDAIAELLGLP  118

Query  340   MIAAYLESPSIDQ---MRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
             ++ +  ++ + D       GVNYASAAAGILD TGQ+F+GRIPFN+QI NF+ T NQ+  
Sbjct  119   LLPSNNDASNADSDGGALQGVNYASAAAGILDNTGQNFVGRIPFNQQIKNFQATLNQIKG  178

Query  511   NLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrl  690
              L A  +A  L +SIF+VGMGSNDYLNNY MP Y T   Y+ +Q+++ LVQ YT+QLT L
Sbjct  179   RLGASKLASSLGRSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQHYTKQLTSL  238

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
             Y LGAR+FV+ G+G M CIP M AR     C   V++ + PFN  VK M++  +   P A
Sbjct  239   YNLGARRFVIAGVGSMACIPNMRARNPANMCSPDVDELIAPFNGKVKGMVDTLNLNLPRA  298

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             K ++ID  +M   ++ +   YGFSV DRGCCG+G+N G +TCLPF  PC NR  Y+FWDA
Sbjct  299   KLIYIDNFEMISEVLRSPWNYGFSVVDRGCCGIGRNRGVITCLPFLRPCPNRNTYIFWDA  358

Query  1051  FHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FHPT  VNVLLG  A++G   L YPM I
Sbjct  359   FHPTERVNVLLGKAAYSGGTDLAYPMNI  386



>gb|AFW74302.1| hypothetical protein ZEAMMB73_454294 [Zea mays]
Length=366

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 234/334 (70%), Gaps = 4/334 (1%)
 Frame = +1

Query  145   GNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAK  324
             G     PA+F+FGDSLID+GNNNNL S AKANY PYGIDF   PTGRF NGYTIVD +A+
Sbjct  27    GGEGRAPALFVFGDSLIDSGNNNNLASLAKANYFPYGIDFAGGPTGRFCNGYTIVDELAE  86

Query  325   QLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
              LGLP++  Y E+ S+  +  GVNYASAAAGILD +G +F+GRIPFN+QI NFE T  ++
Sbjct  87    LLGLPLVPPYSEASSVQHVLQGVNYASAAAGILDDSGGNFVGRIPFNQQIQNFETTVARI  146

Query  505   SANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqlt  684
             +    A   A  + +S+ FVGMGSNDYLNNY MP Y T   Y P QFA  L +Q   QL 
Sbjct  147   AGAAGAAAAADLVARSVLFVGMGSNDYLNNYLMPNYDTRRRYGPQQFADLLARQLAAQLA  206

Query  685   rlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKF----S  852
             RL+  G R+FV+ G+G +GCIP++ A++  G C  +V+  VLPFNANV+ ++++     +
Sbjct  207   RLHGAGGRRFVVAGVGSVGCIPSVRAQSLAGRCSRAVDDLVLPFNANVRALVDRLNGNAA  266

Query  853   TTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
                P A   ++D   +F+ I+ +   +GF+V DRGCCG+G+N+G+VTCLPF  PC +R+ 
Sbjct  267   AGLPGASLTYLDNFAVFRAILTDPAAFGFAVVDRGCCGIGRNAGQVTCLPFMPPCDHRER  326

Query  1033  YLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             Y+FWDA+HPT+AVNV++  LAF+G   +V P+ +
Sbjct  327   YVFWDAYHPTAAVNVIVARLAFHGGADVVSPVNV  360



>ref|NP_001055574.1| Os05g0419800 [Oryza sativa Japonica Group]
 gb|AAV25648.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17488.1| Os05g0419800 [Oryza sativa Japonica Group]
 dbj|BAG94851.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 234/325 (72%), Gaps = 4/325 (1%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIA  348
             MF+FGDSL DNGNNN++ S AKANYLPYGIDF   PTGRFSNGYT+VD IA+ LGLP++ 
Sbjct  62    MFVFGDSLTDNGNNNDMTSLAKANYLPYGIDFAGGPTGRFSNGYTMVDEIAELLGLPLLP  121

Query  349   AYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV  528
             ++ ++   D   +GVNYASAAAGILD TGQ+F+GR PFN+QI NFE T  Q+S  L    
Sbjct  122   SHNDATG-DAALHGVNYASAAAGILDNTGQNFVGRSPFNQQIKNFEATLQQISGKLGGGA  180

Query  529   VAK---DLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytl  699
               K    L +SIF+VGMGSNDYLNNY MP Y T   Y+ +Q+++ LVQQYT+QLTRLY L
Sbjct  181   AGKLAPSLARSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQQYTKQLTRLYNL  240

Query  700   GARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFV  879
             GAR+FV+ G+G M CIP M AR     C   V+  ++PFN+ VK M+N  +   P AKF+
Sbjct  241   GARRFVIAGVGSMACIPNMRARNPANMCSPDVDDLIIPFNSKVKSMVNTLNVNLPRAKFI  300

Query  880   FIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHP  1059
             F+DT  M   ++ N   YGFSV DRGCCG+G+N G +TCLPF+ PC NR  Y+FWDAFHP
Sbjct  301   FVDTYAMISEVLRNPWSYGFSVVDRGCCGIGRNRGMITCLPFQRPCLNRNTYIFWDAFHP  360

Query  1060  TSAVNVLLGNLAFNGSNYLVYPMTI  1134
             T  VN+LLG  A++G   LV+PM I
Sbjct  361   TERVNILLGKAAYSGGADLVHPMNI  385



>ref|XP_008648378.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g71691-like 
[Zea mays]
Length=366

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/334 (51%), Positives = 231/334 (69%), Gaps = 4/334 (1%)
 Frame = +1

Query  145   GNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAK  324
             G     PA+F+FGDSLID+GNNNNL S AKANY PYGIDF   PTGRF NGYTIVD +A+
Sbjct  27    GGEGRAPALFVFGDSLIDSGNNNNLASLAKANYFPYGIDFAGGPTGRFCNGYTIVDELAE  86

Query  325   QLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
              LGLP++  Y E+ S+  +  GVNYASAAAGILD +G +F+GRIPFN+QI NFE T  ++
Sbjct  87    LLGLPLVPPYSEASSVQHVLQGVNYASAAAGILDDSGGNFVGRIPFNQQIQNFETTVARI  146

Query  505   SANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqlt  684
             +    A   A  + +S+ FVGMGSNDYLNNY MP Y T   Y P QFA  L +Q   QL 
Sbjct  147   AGAAGAAAAADLVARSVLFVGMGSNDYLNNYLMPNYDTRRRYGPQQFADLLARQLAAQLA  206

Query  685   rlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKF----S  852
             RL+  G R+FV+ G+G +GCIP++ A++  G C  +VN  VLPFNANV+ ++++     +
Sbjct  207   RLHGAGGRRFVVAGVGSVGCIPSVRAQSLAGRCSRAVNDLVLPFNANVRALVDRLNGNAA  266

Query  853   TTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
                P A   ++D   +F+ I+ +   +GF+V DRGCCG+G+N+G+VTC PF  PC +R+ 
Sbjct  267   AGLPGASLTYLDNFAVFRAILADPAAFGFAVVDRGCCGIGRNAGQVTCQPFMPPCDHREH  326

Query  1033  YLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             Y+FWDA+HPT+AVNV++  L  +G   +V P+ +
Sbjct  327   YVFWDAYHPTAAVNVIVARLVLHGGADVVSPVNV  360



>ref|XP_002443746.1| hypothetical protein SORBIDRAFT_07g001270 [Sorghum bicolor]
 gb|EES13241.1| hypothetical protein SORBIDRAFT_07g001270 [Sorghum bicolor]
Length=376

 Score =   352 bits (903),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/330 (53%), Positives = 236/330 (72%), Gaps = 8/330 (2%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIA  348
             +F+FGDSLID+GNNNNL S AKANY PYGIDF + PTGRF NGYTIVD +A+ LGLP++ 
Sbjct  41    LFVFGDSLIDSGNNNNLASLAKANYFPYGIDFADGPTGRFCNGYTIVDELAELLGLPLVP  100

Query  349   AYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADV  528
              Y E+ S+ Q+  G NYASAAAGILD +G +F+GRIPFN+QI NFE T  +++A + A  
Sbjct  101   PYSEASSVQQVLQGTNYASAAAGILDDSGGNFVGRIPFNQQIKNFESTMAEITAAMGASA  160

Query  529   VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlytlGAR  708
              A  +++SI FVGMGSNDYLNNY MP Y T   Y P QFA  L +Q   QLTRLY  G R
Sbjct  161   AADLMSRSILFVGMGSNDYLNNYLMPNYDTRRRYSPQQFADLLARQLAAQLTRLYNAGGR  220

Query  709   KFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMIN--------KFSTTHP  864
             +FV+ G+G MGCIP++LA++  G C + V+  VLPFNANV+ +++              P
Sbjct  221   RFVVAGVGSMGCIPSVLAQSVAGRCSQEVDDLVLPFNANVRALLDGLNAAAGGAGGGGLP  280

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
              A+  ++D  ++F+ I+ +   +GF+V DRGCCG+G+N G+VTCLPF  PC +R+ Y+FW
Sbjct  281   GARLTYLDNFRIFRAILGDPAAFGFTVVDRGCCGIGRNGGQVTCLPFMAPCDDRERYVFW  340

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             DA+HPT+AVN+++  LAF+G   ++ P+ +
Sbjct  341   DAYHPTAAVNIIIARLAFHGGTDVISPINV  370



>ref|XP_006659756.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Oryza brachyantha]
Length=366

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 234/332 (70%), Gaps = 7/332 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPA+F+FGDSLIDNGNNNNL S AKANY PYGIDF    TGRF NGYTIVD +A+ LGLP
Sbjct  29    VPALFVFGDSLIDNGNNNNLASLAKANYYPYGIDFAGGATGRFCNGYTIVDELAELLGLP  88

Query  340   MIAAYLE-SPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
             ++  Y + S +  Q+ +GVN+ASAAAGILD TG +F+GRIPFN+QIDNFE    Q++  +
Sbjct  89    LLPPYSQASGNGKQLLHGVNFASAAAGILDDTGGNFVGRIPFNQQIDNFEAAVEQIAGAV  148

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
               +  A  + +SI FVG+GSNDYLNNY MP Y T   Y P QFA  L  +Y  QLTRLY 
Sbjct  149   GKEAAAAMVARSILFVGLGSNDYLNNYLMPNYNTRRQYSPAQFADLLAARYAAQLTRLYE  208

Query  697   lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA--  870
              GARKFV+ G+G MGCIP +LA++    C   V+  VLPFNANV+ MI++ +        
Sbjct  209   AGARKFVVAGVGSMGCIPNVLAQSVESLCSPEVDGLVLPFNANVRAMIDRLNGGAGAGGG  268

Query  871   ----KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
                 + VF+D   +F+ I+ +   +GF V DRGCCG+G+NSG+VTCLPF  PC +R+ Y+
Sbjct  269   LAGARLVFLDNYGVFKGILGDPAAHGFRVVDRGCCGIGRNSGQVTCLPFMPPCDDRRGYV  328

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT+AVNVL+  LAF GS  +V P+ +
Sbjct  329   FWDAFHPTAAVNVLVARLAFYGSADVVSPINV  360



>ref|XP_003571310.2| PREDICTED: GDSL esterase/lipase At1g71691-like [Brachypodium 
distachyon]
Length=354

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 239/347 (69%), Gaps = 18/347 (5%)
 Frame = +1

Query  136   SGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDF-----NNNPTGRFSNGY  300
             + E    LVPA+F+FGDSL+DNGNNN L S AKANYLPYG+DF       +PTGRF NGY
Sbjct  6     AAEKKEPLVPALFVFGDSLVDNGNNNGLPSLAKANYLPYGVDFGPAGGEGSPTGRFCNGY  65

Query  301   TIVDSIAKQLGLPMIAAY---LESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQ  471
             TIVD +A+ LGLP++  Y   L S S+     G NYASAAAGILD +G +F GRIPF+EQ
Sbjct  66    TIVDYLAELLGLPLVPPYSQLLSSGSVPT--NGANYASAAAGILDDSGANFAGRIPFDEQ  123

Query  472   IDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAS  651
             I NFE+T   + A  S+  +   + +S+ FVGMGSNDYLNNY MP Y T   + P QFA 
Sbjct  124   ISNFERTVAAMGAAGSSTNLV--VGRSMVFVGMGSNDYLNNYLMPNYDTRRHHTPAQFAD  181

Query  652   tlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQ-AVLPFNANV  828
              L+ +Y  QLTRLY  GAR+FV+ G+G +GCIPT+LAR   G C E V++  V PFNA V
Sbjct  182   LLLSRYAAQLTRLYRAGARRFVVAGLGSLGCIPTILARTTEGRCDEPVDRDLVAPFNAGV  241

Query  829   KQMINKFSTTH-----PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVT  993
             K M+++ +        P A+F F+D  ++ + ++ +   YGFSV DRGCCGVG N+G++T
Sbjct  242   KAMLDRLNDDDDDGELPGARFAFLDNYRIVRLMLADPAAYGFSVVDRGCCGVGLNAGQMT  301

Query  994   CLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             CLPF  PC++R  YLFWDA+HPT+AVN ++   AF+G + +V+P+ +
Sbjct  302   CLPFMEPCADRGRYLFWDAYHPTAAVNEVIARAAFDGGDDVVFPVNV  348



>gb|KDP45642.1| hypothetical protein JCGZ_17249 [Jatropha curcas]
Length=280

 Score =   333 bits (855),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/272 (63%), Positives = 213/272 (78%), Gaps = 1/272 (0%)
 Frame = +1

Query  319   AKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKN  498
             A+ LGLP+I AY E+ S D + +GVNYASAAAGILD TG++F+GRIPFN+QI NF+ T +
Sbjct  4     AELLGLPLIPAYSEA-SGDDVLHGVNYASAAAGILDITGRNFVGRIPFNQQIKNFQNTLD  62

Query  499   QLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqq  678
             Q++ NL A  VA  + +SIFFVGMGSNDYLNNY MP YPT   YD  Q+A+ LVQQYTQQ
Sbjct  63    QITDNLGAIDVASAIARSIFFVGMGSNDYLNNYLMPNYPTKNQYDGPQYANLLVQQYTQQ  122

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTT  858
             LT LY LGARKF+L G+G MGCIP++LA++  G C E VNQ VLPFN NVK M+N  ++ 
Sbjct  123   LTTLYNLGARKFILAGLGVMGCIPSILAQSPAGLCSEEVNQLVLPFNENVKTMMNNLNSN  182

Query  859   HPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P AKF++ID  +MF+ I+ N+  YGFSV +RGCCG+G+N G+VTCLPF+TPC NR++Y+
Sbjct  183   LPGAKFIYIDVHRMFRDILTNSPAYGFSVINRGCCGIGRNRGQVTCLPFQTPCQNREQYI  242

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT AVN+L+G  AFNG   +VYPM I
Sbjct  243   FWDAFHPTEAVNILMGRKAFNGDTSIVYPMNI  274



>gb|EAY98084.1| hypothetical protein OsI_20002 [Oryza sativa Indica Group]
 gb|EEE63762.1| hypothetical protein OsJ_18581 [Oryza sativa Japonica Group]
Length=425

 Score =   338 bits (868),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 233/357 (65%), Gaps = 36/357 (10%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI----------  318
             MF+FGDSL DNGNNN++ S AKANYLPYGIDF   PTGRFSNGYT+VD I          
Sbjct  62    MFVFGDSLTDNGNNNDMTSLAKANYLPYGIDFAGGPTGRFSNGYTMVDEIENLTGINEDF  121

Query  319   ----------------------AKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFT  432
                                    + LGLP++ ++ ++   D   +GVNYASAAAGILD T
Sbjct  122   PNQVESKAHNNSYNGLLEMGVVTELLGLPLLPSHNDATG-DAALHGVNYASAAAGILDNT  180

Query  433   GQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAK---DLTKSIFFVGMGSNDYLNNYFM  603
             GQ+F+GR PFN+QI NFE T  Q+S  L      K    L +SIF+VGMGSNDYLNNY M
Sbjct  181   GQNFVGRSPFNQQIKNFEATLQQISGKLGGGAAGKLAPSLARSIFYVGMGSNDYLNNYLM  240

Query  604   PGYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGEC  783
             P Y T   Y+ +Q+++ LVQQYT+QLTRLY LGAR+FV+ G+G M CIP M AR     C
Sbjct  241   PNYNTRNEYNGDQYSTLLVQQYTKQLTRLYNLGARRFVIAGVGSMACIPNMRARNPANMC  300

Query  784   LESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCC  963
                V+  ++PFN+ VK M+N  +   P AKF+F+DT  M   ++ N   YGFSV DRGCC
Sbjct  301   SPDVDDLIIPFNSKVKSMVNTLNVNLPRAKFIFVDTYAMISEVLRNPWSYGFSVVDRGCC  360

Query  964   GVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             G+G+N G +TCLPF+ PC NR  Y+FWDAFHPT  VN+LLG  A++G   LV+PM I
Sbjct  361   GIGRNRGMITCLPFQRPCLNRNTYIFWDAFHPTERVNILLGKAAYSGGADLVHPMNI  417



>ref|XP_008381690.1| PREDICTED: GDSL esterase/lipase At1g71250 [Malus domestica]
Length=371

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/341 (51%), Positives = 230/341 (67%), Gaps = 5/341 (1%)
 Frame = +1

Query  124   TLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYT  303
             T+  S    +A VPAMF+FGDSLID GNNN L S AK+NY PYG DF   PTGRF+NG T
Sbjct  26    TMTTSSSVGSAQVPAMFVFGDSLIDVGNNNFLNSLAKSNYYPYGCDFRAGPTGRFTNGRT  85

Query  304   IVDSIAKQLGLPMIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQID  477
              VD +   LGLP + A+ + P+    R   GVNYASAAAGILD TGQH+  R   ++Q+ 
Sbjct  86    FVDLLGNLLGLPYVPAFAD-PNTKGTRMLGGVNYASAAAGILDETGQHYGERYXLSQQVL  144

Query  478   NFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFASt  654
             NFE T NQL + +S   + + L KSI  +  GSNDY+NNY +P  Y +S++Y P  FA+ 
Sbjct  145   NFESTLNQLRSMMSGTNLTQMLAKSIAVLAFGSNDYINNYLLPSLYTSSYYYTPPAFANL  204

Query  655   lvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVK  831
             L+ +YT+Q+  L+++G RKFVL GIG +GCIP   A A   E CL+ VNQ +  +N  ++
Sbjct  205   LLNRYTRQILALHSVGLRKFVLAGIGPLGCIPNQRASAAQPERCLDYVNQILGTYNEGLR  264

Query  832   QMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFET  1011
              ++N+F+T HPDA FV+ +T   F  ++NN   YGFSV DRGCCG+G+N G++TCLP+  
Sbjct  265   SLVNQFNTNHPDAIFVYANTYGAFGDMLNNPAPYGFSVIDRGCCGIGRNRGQITCLPYAV  324

Query  1012  PCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             PCSNR +Y+FWDAFHPT A N +L   A+NG     YP+ +
Sbjct  325   PCSNRNQYMFWDAFHPTEAANAILAWRAYNGPPSDSYPINV  365



>ref|XP_008237811.1| PREDICTED: GDSL esterase/lipase At1g71250 [Prunus mume]
Length=382

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 171/330 (52%), Positives = 222/330 (67%), Gaps = 4/330 (1%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A VPAMFIFGDSLID GNNN L SFAK+NY PYG DF   PTGRFSNG T+VD +   LG
Sbjct  48    AQVPAMFIFGDSLIDVGNNNYLSSFAKSNYYPYGCDFRAGPTGRFSNGRTVVDMLGNLLG  107

Query  334   LPMIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLS  507
             LP +  + + P+    +   GVNYASAAAGILD TGQHF  R   ++Q+ NFE T +QL 
Sbjct  108   LPYVPPFAD-PNTKGTKILGGVNYASAAAGILDETGQHFGQRYSLSQQVLNFESTLDQLR  166

Query  508   ANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqlt  684
               +S   + K L KSI  +  GSNDY+NNY +P  Y +S+ Y P  FA+ L+ +YTQQ+ 
Sbjct  167   PMMSGANMTKYLAKSIAVLEFGSNDYINNYLLPSLYSSSYIYTPPAFANLLLNRYTQQIL  226

Query  685   rlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
              L+++G RKFVL GIG +GCIP   A A  G C++ VNQ +  FN  ++ + N+ +T HP
Sbjct  227   ALHSVGLRKFVLAGIGPLGCIPNQRALAQPGRCVDYVNQILGSFNEGLRSLANQLNTNHP  286

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
              A FV+ +T   F  ++NN   YGFSV DRGCCG+G+N G++TCLP+  PC+NR +Y+FW
Sbjct  287   GAIFVYANTYAAFGDMLNNPALYGFSVIDRGCCGIGRNRGQITCLPYSVPCANRNQYIFW  346

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             DA+HPT A N +L   AFNG     YP+ +
Sbjct  347   DAYHPTEAANAVLAWRAFNGPPSDCYPINV  376



>ref|XP_010252444.1| PREDICTED: GDSL esterase/lipase At1g71250 [Nelumbo nucifera]
Length=369

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/334 (50%), Positives = 228/334 (68%), Gaps = 4/334 (1%)
 Frame = +1

Query  145   GNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAK  324
             G  A +PAMF+FGDSL+D+GNNN L S AKANY+PYGIDFN  PTGRFSNG T++D + +
Sbjct  30    GQPAQIPAMFVFGDSLVDDGNNNYLRSIAKANYIPYGIDFNQGPTGRFSNGRTVIDMLGE  89

Query  325   QLGLPMIAAYLESPSID-QMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQ  501
              LGLP   A+ +  +   +M  GVNYASAAAGILD TG+H+  R   ++Q+ NFE T NQ
Sbjct  90    MLGLPYPPAFADPNTAGPRMLRGVNYASAAAGILDETGRHYGERFTLSQQVLNFETTLNQ  149

Query  502   LSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqq  678
             L        + + L+KS+  +  GSNDY+NNY +P  Y +S+ YDP  FA+ L+  YT+Q
Sbjct  150   LRQYTGGSNLTQYLSKSLAVLVFGSNDYINNYLLPSLYSSSYNYDPPAFANLLLNHYTRQ  209

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMINKFS  852
             +  LY LG RKF+++G+G +GCIP  +A  +A  G C++ VNQ +  FN  +K ++++ +
Sbjct  210   ILALYNLGLRKFLISGVGPLGCIPNQIATGQAPPGRCVDKVNQMLGTFNQGLKTIVDQLN  269

Query  853   TTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
               H  A FV+ +T      I+NN  RYGFSV ++GCCG+G+N G++TCLP+  PC NR  
Sbjct  270   ANHRGAIFVYANTYGAMGDILNNPARYGFSVLNQGCCGLGRNQGQITCLPYSIPCQNRNR  329

Query  1033  YLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             Y+FWDAFHPT AVN +L   AF+GS   VYP+ +
Sbjct  330   YVFWDAFHPTQAVNAILAQKAFSGSPDDVYPINV  363



>ref|XP_009804132.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=372

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/272 (61%), Positives = 207/272 (76%), Gaps = 3/272 (1%)
 Frame = +1

Query  328   LGLPMIAAYLESP---SIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKN  498
             LGLP+I AY E+    S D+MRYGVNYASAAAGILD TG++F+GRIPFN QI NFE T +
Sbjct  95    LGLPLIPAYTEASADTSGDKMRYGVNYASAAAGILDITGRNFVGRIPFNRQIKNFENTLD  154

Query  499   QLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqq  678
             Q++ NL A  VA+ L K +FFVGMGSNDYLNNY MP Y T   Y+P Q+A+ LVQQY+QQ
Sbjct  155   QITDNLGAPDVAQALAKCMFFVGMGSNDYLNNYLMPNYDTKNRYNPQQYANLLVQQYSQQ  214

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTT  858
             LTRLY LGARKFV+ G+G MGCIP++LA+ +   C E VNQ VLPF+ NVK M++  +  
Sbjct  215   LTRLYNLGARKFVIGGVGLMGCIPSILAQGNGNVCSEEVNQLVLPFSNNVKSMLSNLNAN  274

Query  859   HPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P +KF++ D   MFQ ++ N +RYGFSV +RGCCG+G+N G++TCLP +TPC NR +Y+
Sbjct  275   LPGSKFIYADIKNMFQDLLTNYRRYGFSVINRGCCGIGRNRGQITCLPLQTPCPNRDQYI  334

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT AVN+L G  AFNG   LVYP+ I
Sbjct  335   FWDAFHPTEAVNILFGRRAFNGGPELVYPINI  366



>ref|XP_004233002.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum lycopersicum]
Length=365

 Score =   319 bits (817),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 227/330 (69%), Gaps = 6/330 (2%)
 Frame = +1

Query  124   TLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYT  303
             +LG   E N   VP  FIFGDSL+DNGNNNN+ S AKANYLPYGIDF+  PTGRFSNG T
Sbjct  18    SLGDYYETNAQQVPCYFIFGDSLVDNGNNNNIQSLAKANYLPYGIDFSGGPTGRFSNGKT  77

Query  304   IVDSIAKQLGL-PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDN  480
              VD IA+QLG    I  Y  +   D +R GVNYASAAAGI D TG+   GRI F+ Q++N
Sbjct  78    TVDVIAEQLGFNGNIPPYATARGRDVLR-GVNYASAAAGIRDETGRQLGGRISFSGQVNN  136

Query  481   FEKTKNQLSANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFASt  654
             +  T  Q+   L  +  A D L K I+ VG+GSNDYLNNYFMP  YPTS  + P+Q+A+ 
Sbjct  137   YRNTVQQVVQILGNENAAADYLKKCIYSVGLGSNDYLNNYFMPLYYPTSRQFTPDQYATV  196

Query  655   lvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANV  828
             L+QQYTQQL  LY+ GARKF L G+G++GC P  LA+   D   C++ +N A   FN  +
Sbjct  197   LIQQYTQQLKILYSNGARKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQLFNNKL  256

Query  829   KQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFE  1008
             K +++  +   PDAKF++ID   +FQ ++ N   +GF V + GCCGVG+N+G++TCLPF+
Sbjct  257   KALVDNLNGNTPDAKFIYIDAYGIFQDLIENPAAFGFRVTNAGCCGVGRNNGQITCLPFQ  316

Query  1009  TPCSNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
              PC NR EYLFWDAFHPT A N+++G  ++
Sbjct  317   RPCRNRNEYLFWDAFHPTEAANIVVGRRSY  346



>ref|XP_007025248.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY27870.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=361

 Score =   317 bits (813),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 172/330 (52%), Positives = 227/330 (69%), Gaps = 5/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+ANYLPYGIDF N PTGRFSNG T +D IA+ LG  
Sbjct  26    VPCYFIFGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTIDVIAELLGFD  85

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                    + S  Q+  GVNYASAAAGI + TGQ   GRI F+ Q+ N+ +T +Q+   L 
Sbjct  86    NYIPPYSTVSGRQILGGVNYASAAAGIREETGQQLGGRISFSGQVRNYRETVSQVVNLLG  145

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K I+ +G+GSNDYLNNYFMP  Y TS  Y+P Q+A  L+QQYT+QL  LY
Sbjct  146   DEDTAANYLSKCIYSIGLGSNDYLNNYFMPAFYSTSRQYNPEQYADVLIQQYTEQLQDLY  205

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKFVL G+G++GC P  LA+   D   C+E +N A   FN+ ++ ++++F+  + D
Sbjct  206   NYGARKFVLVGLGQIGCSPNELAQNSGDGRTCVERINDANRIFNSKLRALVDQFNNNNSD  265

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF++I+   +FQ I +N   YGF V + GCCGVG+N+G++TCLP++TPC NR EYLFWD
Sbjct  266   AKFIYINAYGIFQDITSNPAAYGFKVTNAGCCGVGRNNGQITCLPYQTPCQNRDEYLFWD  325

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP  A NV++G  +++  S+   YP+ I
Sbjct  326   AFHPGEAANVIIGRRSYSAQSSSDAYPIDI  355



>gb|ACJ85846.1| unknown [Medicago truncatula]
Length=370

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/329 (51%), Positives = 219/329 (67%), Gaps = 4/329 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+D+GNNNNL S AKANYLPYGIDFN  PTGRFSNG T VD IA+ LG  
Sbjct  36    VPCYFIFGDSLVDDGNNNNLNSLAKANYLPYGIDFNGGPTGRFSNGKTTVDVIAELLGFE  95

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                +   +    ++  GVNYASAAAGI + TGQ    RI F+ Q+ N++KT +Q+   L 
Sbjct  96    GYISPYSTARDQEILQGVNYASAAAGIREETGQQLGDRISFSGQVQNYQKTVSQVVNLLG  155

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
               D  +  L+K I+ +G+GSNDYLNNYFMP YP+   + P Q+A  L+Q Y QQL  LY 
Sbjct  156   DEDTASNYLSKCIYSIGLGSNDYLNNYFMPAYPSGRQFTPQQYADVLIQAYAQQLRILYN  215

Query  697   lGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
              GARK  L GIG++GC P  LA+   D   C+E +N A   FN  +K ++N+ +    DA
Sbjct  216   YGARKMTLFGIGQIGCSPNELAQNSPDGTTCVERINSANQLFNNGLKSLVNQLNNELTDA  275

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             +F++++T  +FQ I+NN   +G  V + GCCG+G+N+G++TCLP +TPCSNR EYLFWDA
Sbjct  276   RFIYVNTYGIFQDIINNPSSFGIRVTNEGCCGIGRNNGQITCLPLQTPCSNRNEYLFWDA  335

Query  1051  FHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             FHPT   N ++G  A+N  S    YP+ I
Sbjct  336   FHPTEVGNTIIGRRAYNAQSESDAYPIDI  364



>gb|KEH33152.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 167/329 (51%), Positives = 219/329 (67%), Gaps = 4/329 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+D+GNNNNL S AKANYLPYGIDFN  PTGRFSNG T VD IA+ LG  
Sbjct  36    VPCYFIFGDSLVDDGNNNNLNSLAKANYLPYGIDFNGGPTGRFSNGKTTVDVIAELLGFE  95

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                +   +    ++  GVNYASAAAGI + TGQ    RI F+ Q+ N++KT +Q+   L 
Sbjct  96    GYISPYSTARDQEILQGVNYASAAAGIREETGQQLGDRISFSGQVQNYQKTVSQVVNLLG  155

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
               D  +  L+K I+ +G+GSNDYLNNYFMP YP+   + P Q+A  L+Q Y QQL  LY 
Sbjct  156   DEDTASNYLSKCIYSIGLGSNDYLNNYFMPAYPSGRQFTPQQYADVLIQAYAQQLRILYN  215

Query  697   lGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
              GARK  L GIG++GC P  LA+   D   C+E +N A   FN  +K ++N+ +    DA
Sbjct  216   YGARKMALFGIGQIGCSPNELAQNSPDGTTCVERINSANQLFNNGLKSLVNQLNNELTDA  275

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             +F++++T  +FQ I+NN   +G  V + GCCG+G+N+G++TCLP +TPCSNR EYLFWDA
Sbjct  276   RFIYVNTYGIFQDIINNPSSFGIRVTNEGCCGIGRNNGQITCLPLQTPCSNRNEYLFWDA  335

Query  1051  FHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             FHPT   N ++G  A+N  S    YP+ I
Sbjct  336   FHPTEVGNTIIGRRAYNAQSESDAYPIDI  364



>gb|KDP21169.1| hypothetical protein JCGZ_21640 [Jatropha curcas]
Length=368

 Score =   316 bits (810),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 230/332 (69%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
              P  FIFGDSL+DNGNNN L S A+ANYLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  33    APCYFIFGDSLVDNGNNNQLTSLARANYLPYGIDFPRGPTGRFSNGKTTVDVIAESLGFN  92

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I+ Y  +   D +R GVNYASAAAGI + TGQ    RI F+ Q+ N++ T +Q+  NL
Sbjct  93    GYISPYSTARGQDILR-GVNYASAAAGIREETGQQLGQRISFSGQVKNYQNTVSQI-VNL  150

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
               D    A  L+K IF +G+GSNDYLNNYFMP  Y +S  Y P Q+A+ L+QQYTQQL  
Sbjct  151   LGDENTTANYLSKCIFSIGLGSNDYLNNYFMPQFYSSSRQYTPEQYANVLIQQYTQQLRI  210

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY  G RKFVL G+G++GC P+ LA+   D   C++ +N A   FN  ++ ++++F++  
Sbjct  211   LYDNGGRKFVLIGLGQIGCSPSELAQNSPDGRTCVQRINSANQIFNNKLRSLVSQFNSNT  270

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             PDA+F++++   MFQ I +N  RYGF+V + GCCGVG+N+G++TCLPF+TPC NR +YLF
Sbjct  271   PDARFIYVNVYGMFQDITSNPARYGFTVTNAGCCGVGRNNGQITCLPFQTPCQNRNQYLF  330

Query  1042  WDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             WDAFHPT A N+++G  +++  S+   YP  I
Sbjct  331   WDAFHPTEAANIIIGRRSYSAQSSSDAYPFDI  362



>gb|AAZ23955.1| GDSL-lipase 1 [Capsicum annuum]
Length=363

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 229/337 (68%), Gaps = 7/337 (2%)
 Frame = +1

Query  106   VLAQAPTLGF-SGEGNNAL-VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPT  279
             ++ Q   LGF S  G NA  VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGIDF   PT
Sbjct  10    LVVQLVILGFMSFYGANAQQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDFPGGPT  69

Query  280   GRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIP  459
             GRFSNG T VD IA+QLG   I  Y  +   D +R GVNYASAAAGI + TG+    RIP
Sbjct  70    GRFSNGKTTVDVIAEQLGFNNIPPYASARGRDILR-GVNYASAAAGIREETGRQLGARIP  128

Query  460   FNEQIDNFEKTKNQLSANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYD  633
             F+ Q++N+  T  Q+   L  +  A D L K I+ +G+GSNDYLNNYFMP Y  TS  + 
Sbjct  129   FSGQVNNYRNTVQQVVQILGNENAAADYLKKCIYSIGLGSNDYLNNYFMPMYYSTSRQFT  188

Query  634   PNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAV  807
             P Q+A+ L+QQYTQQL  LY  GARKF L G+G++GC P  LA+   D   C++ +N A 
Sbjct  189   PEQYANVLIQQYTQQLRILYNNGARKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVAN  248

Query  808   LPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGE  987
               FN  +K +++ F+   PDAKF++ID   +FQ ++ N   +GF V + GCCGVG+N+G+
Sbjct  249   QIFNNKLKALVDNFNGNAPDAKFIYIDAYGIFQDLIENPSAFGFRVTNAGCCGVGRNNGQ  308

Query  988   VTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
             +TCLPF+ PC NR EYLFWDAFHPT A N+++G  ++
Sbjct  309   ITCLPFQRPCPNRNEYLFWDAFHPTEAANIIVGRRSY  345



>gb|KHG24391.1| hypothetical protein F383_02353 [Gossypium arboreum]
Length=362

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 224/330 (68%), Gaps = 5/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S AKANY+PYGIDF N PTGRFSNG T VD IA+ LG  
Sbjct  27    VPCYFIFGDSLVDNGNNNRLSSLAKANYMPYGIDFPNGPTGRFSNGKTTVDVIAELLGFE  86

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    +    Q+  GVNYASAAAGI + TGQ    RI F+ Q+ N+ +T +Q+   L 
Sbjct  87    NYIPPYSAARGRQILGGVNYASAAAGIREETGQQLGARISFSGQVRNYRQTVSQVVNLLG  146

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
             ++  A + L+K I+ +G+GSNDYLNNYFMP  Y TS  Y+P Q+A+ L+QQYTQQL  LY
Sbjct  147   SEANAANYLSKCIYSIGLGSNDYLNNYFMPLFYSTSRRYNPEQYANVLIQQYTQQLQALY  206

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKFVL G+G++GC P  LA+   D   C+E +N A   FN  +K ++++F+  + D
Sbjct  207   NYGARKFVLIGLGQIGCSPNELAQNSRDGRTCVERINAANRIFNNKLKGLVDQFNNANSD  266

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF++ID   +FQ I +N   YGF V + GCCGVG+N+G++TCLP + PC NR EYLFWD
Sbjct  267   AKFIYIDVYGIFQDITSNPSAYGFRVTNAGCCGVGRNNGQITCLPLQRPCRNRNEYLFWD  326

Query  1048  AFHPTSAVNVLLGNLAFNGSN-YLVYPMTI  1134
             AFHPT A NV++G  ++N       YP+ I
Sbjct  327   AFHPTEAANVIIGRRSYNAQKPSDAYPIDI  356



>ref|XP_004290271.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Fragaria vesca 
subsp. vesca]
Length=385

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 166/339 (49%), Positives = 222/339 (65%), Gaps = 4/339 (1%)
 Frame = +1

Query  127   LGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTI  306
             +GF GE   A VPAMF FGDSLID GNNN + SFA++NY PYGIDF   P+GRF+NG T 
Sbjct  42    VGF-GESAAAQVPAMFAFGDSLIDVGNNNFISSFARSNYYPYGIDFRGGPSGRFTNGRTS  100

Query  307   VDSIAKQLGLPMIAAYLE-SPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNF  483
             +D +   LGLP   A+ + +   +++  GVNYASAAAGILD TG+H+  R   + Q+ NF
Sbjct  101   IDMLGNLLGLPYAPAFADPNTKGNRILRGVNYASAAAGILDETGRHYGDRYSLSRQVMNF  160

Query  484   EKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvq  663
             E T NQL   +    + + L KSI  +  GSNDY+NNY MP Y +S+ Y P  FA+ L+ 
Sbjct  161   ESTLNQLRTMMGGTNLTQYLAKSIAVLVFGSNDYINNYLMPFYNSSYTYSPPAFANLLLS  220

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQM  837
             +Y  Q+  L++LG RKF+L GIG +GCIP   A  RA  G C+++VNQ +  FN  ++ +
Sbjct  221   RYATQILALHSLGLRKFMLVGIGPLGCIPNQRASGRAQPGRCVDNVNQILGSFNQGLRSL  280

Query  838   INKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPC  1017
               + ++ HP A FV+ +    F  I+NN   YGF+V DR CCG+G+N G++TCLPF  PC
Sbjct  281   ATQLNSNHPGAIFVYGNAYGAFGDILNNPLSYGFTVIDRACCGIGRNQGQITCLPFAVPC  340

Query  1018  SNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             SNR +Y+FWDAFHPT A N +L   AFNG     YP+ +
Sbjct  341   SNRNQYMFWDAFHPTEAANAVLAWRAFNGPPSDSYPINV  379



>ref|XP_006355559.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum tuberosum]
Length=366

 Score =   313 bits (803),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 171/322 (53%), Positives = 222/322 (69%), Gaps = 6/322 (2%)
 Frame = +1

Query  148   NNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQ  327
             N   VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGIDF   PTGRFSNG T VD IA+Q
Sbjct  27    NAQQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDFPGGPTGRFSNGKTTVDVIAEQ  86

Query  328   LGL-PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
             LG    I  Y  +   D +R GVNYASAAAGI D TG+   GRI F+ Q++N+  T  Q+
Sbjct  87    LGFNGNIPPYASARGRDVLR-GVNYASAAAGIRDETGRQLGGRISFSGQVNNYRNTVQQV  145

Query  505   SANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqq  678
                L  +    D L K I+ VG+GSNDYLNNYFMP  YPTS  + P+Q+A+ L+QQYTQQ
Sbjct  146   VQILGNENATADYLKKCIYSVGLGSNDYLNNYFMPLTYPTSRQFTPDQYATVLIQQYTQQ  205

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFS  852
             L  LY+ GARKF L G+G++GC P  LA+   D   C++ +N A   FN  +K +++  +
Sbjct  206   LKILYSNGARKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQLFNNKLKALVDNLN  265

Query  853   TTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
                PDAKF+++D   +FQ +++N   +GF V + GCCGVG+N+G++TCLPF+TPC NR E
Sbjct  266   GNTPDAKFIYLDAYGIFQDLIDNPAAFGFRVTNAGCCGVGRNNGQITCLPFQTPCRNRGE  325

Query  1033  YLFWDAFHPTSAVNVLLGNLAF  1098
             YLFWDAFHPT A N+++G   +
Sbjct  326   YLFWDAFHPTEAANIVVGRRQY  347



>ref|XP_007200393.1| hypothetical protein PRUPE_ppa008473mg [Prunus persica]
 gb|EMJ01592.1| hypothetical protein PRUPE_ppa008473mg [Prunus persica]
Length=330

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 217/325 (67%), Gaps = 4/325 (1%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIA  348
             MFIFGDSLID GNNN L S AK+NY PYG DF   PTGRFSNG T+VD +   LGLP + 
Sbjct  1     MFIFGDSLIDVGNNNYLSSLAKSNYYPYGCDFRAGPTGRFSNGRTVVDMLGNLLGLPYVP  60

Query  349   AYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSA  522
              + + P+    +   GVNYASAAAGILD TGQHF  R   ++Q+ NFE T +QL   +S 
Sbjct  61    PFAD-PNTKGTKILGGVNYASAAAGILDETGQHFGQRYSLSQQVLNFESTLDQLRPMMSG  119

Query  523   DVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytl  699
               + + L KSI  +  GSNDY+NNY +P  Y +S+ Y P  FA+ L+ +YTQQ+  L+++
Sbjct  120   ANMTQYLAKSIAVLEFGSNDYINNYLLPSLYSSSYIYTPPAFANLLLNRYTQQILALHSV  179

Query  700   GARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFV  879
             G +KFVL GIG +GCIP   A A  G C++ VNQ +  FN  ++ + N+ +T HP A FV
Sbjct  180   GLKKFVLAGIGPLGCIPNQRALAQPGRCVDYVNQILGSFNEGLRSLANQLNTNHPGAIFV  239

Query  880   FIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHP  1059
             + +T   F  ++NN   YGFSV DRGCCG+G++ G++TCLP+  PC+NR +Y+FWDA+HP
Sbjct  240   YANTYAAFGDMLNNPALYGFSVIDRGCCGIGRDRGQITCLPYSVPCANRNQYIFWDAYHP  299

Query  1060  TSAVNVLLGNLAFNGSNYLVYPMTI  1134
             T A N +L   AFNG     YP+ +
Sbjct  300   TEAANAVLAWRAFNGPPSDCYPINV  324



>ref|XP_004504253.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=362

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 172/338 (51%), Positives = 228/338 (67%), Gaps = 5/338 (1%)
 Frame = +1

Query  136   SGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDS  315
             +G G    VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   P+GRFSNG T VD+
Sbjct  19    AGVGAAPQVPCYFIFGDSLVDNGNNNALRSLARADYLPYGIDFPGGPSGRFSNGKTTVDA  78

Query  316   IAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTK  495
             IA+ LG         S S D +  GVNYASAAAGI + TGQ   GRI F+ Q+ N++ T 
Sbjct  79    IAELLGFDDYIPPYASASDDAILKGVNYASAAAGIREETGQQLGGRISFSGQVQNYQTTV  138

Query  496   NQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqy  669
             +Q+   L + D  A  L+K I+ +G+GSNDYLNNYFMP  Y T   Y P+++A  L+Q Y
Sbjct  139   SQVVNLLGNEDQAATYLSKCIYSIGLGSNDYLNNYFMPQFYSTGSQYTPDEYADNLIQSY  198

Query  670   tqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMIN  843
             T+QL  LY  GARK VL GIG++GC P  LA+   D   C+E +N A   FN  +K +++
Sbjct  199   TEQLKTLYNYGARKMVLFGIGQIGCSPNQLAQNSPDGTTCVEKINSANEIFNNKLKSLVD  258

Query  844   KFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSN  1023
             +F+   PD++ ++I++  +FQ I++N   YGFSV + GCCGVG+N+G++TCLP +TPC N
Sbjct  259   QFNNQLPDSRVIYINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCDN  318

Query  1024  RQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             R+EYLFWDAFHPT A NV++   A+N  S    YP+ I
Sbjct  319   RREYLFWDAFHPTEAGNVVVAQRAYNAQSASDAYPIDI  356



>ref|XP_009612510.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Nicotiana tomentosiformis]
Length=369

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 222/322 (69%), Gaps = 6/322 (2%)
 Frame = +1

Query  148   NNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQ  327
             N   VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGIDF   PTGRFSNG T VD IA+Q
Sbjct  30    NAQQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDFPGGPTGRFSNGKTTVDVIAEQ  89

Query  328   LGL-PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
             LG    I  Y  +   D +R GVNYASAAAGI D TG+   GRI F+ Q++N+  T  Q+
Sbjct  90    LGFNGYIPPYATARGRDILR-GVNYASAAAGIRDETGRQLGGRISFSGQVNNYINTVQQV  148

Query  505   SANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqq  678
                L  +  A D L+K I+ VG+GSNDYLNNYFMP  YPTS  + P Q+AS L+QQYTQQ
Sbjct  149   VQILGDENAAADYLSKCIYSVGLGSNDYLNNYFMPLYYPTSRQFTPEQYASVLIQQYTQQ  208

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFS  852
             L  LY  GARKF L G+G++GC P  LA+   D   C++ +N A   FN  +K +++  +
Sbjct  209   LKILYNNGARKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQLFNNKLKALVDNLN  268

Query  853   TTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
                PDAKF++ID   +FQ +++N   +G SV + GCCGVG+N+G++TCLPF+ PC NR +
Sbjct  269   RNTPDAKFIYIDAYGIFQDLIDNPFAFGLSVTNAGCCGVGRNNGQITCLPFQRPCRNRNQ  328

Query  1033  YLFWDAFHPTSAVNVLLGNLAF  1098
             YLFWDAFHPT A N+++G  ++
Sbjct  329   YLFWDAFHPTEAANIVVGRRSY  350



>ref|XP_002522292.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40150.1| zinc finger protein, putative [Ricinus communis]
Length=365

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 224/330 (68%), Gaps = 5/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   P+GRFSNG T VD IA+ LG  
Sbjct  28    VPCYFIFGDSLVDNGNNNQLSSLARADYLPYGIDFAGGPSGRFSNGKTTVDEIAQLLGFR  87

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    +    Q+  GVNYASAAAGI + TGQ    RI F+ Q+ N+  T +Q+   L 
Sbjct  88    NYIPPYATARGRQILGGVNYASAAAGIREETGQQLGDRITFSGQVRNYRNTVSQIVNLLG  147

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L + IF +G+GSNDYLNNYFMP  Y +S  Y P Q+A  L++QYT+QLT LY
Sbjct  148   GEDAAADYLKQCIFSIGLGSNDYLNNYFMPQFYSSSRQYTPVQYADVLIRQYTEQLTNLY  207

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKF L G+G++GC P+ LA+   D   C++ +N A   FN+ ++ ++++F+   PD
Sbjct  208   NYGARKFALIGVGQIGCSPSELAQNSPDGRTCVQRINSANQIFNSRLRSLVDQFNGNTPD  267

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F++I+   +FQ ++NN  RYGF V + GCCGVG+N+G++TCLPF+TPC NR +YLFWD
Sbjct  268   ARFIYINAYGIFQDLINNPSRYGFRVTNAGCCGVGRNNGQITCLPFQTPCQNRNQYLFWD  327

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A NV++G  +++  S    YP  I
Sbjct  328   AFHPTEAANVIIGRRSYSAQSGSDAYPFDI  357



>gb|EYU43295.1| hypothetical protein MIMGU_mgv1a008614mg [Erythranthe guttata]
Length=368

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 171/349 (49%), Positives = 226/349 (65%), Gaps = 4/349 (1%)
 Frame = +1

Query  64    LALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANY  243
             +A+   S IT  +  +  A  L  +       VP  FIFGDSL+DNGNNNN+ S A+ANY
Sbjct  1     MAITVKSWITVLIVAVTLATELRHAVVSAEPQVPCFFIFGDSLVDNGNNNNIQSLARANY  60

Query  244   LPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGIL  423
             LPYGIDF   PTGRFSNG T VD +A+ LG         +   +Q+  GVNYASAAAGI 
Sbjct  61    LPYGIDFPVGPTGRFSNGKTTVDVVAELLGFEDFIRPYATARGEQVLKGVNYASAAAGIR  120

Query  424   DFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYF  600
               TGQ    RI F  Q++N++ T NQ+   L   +  +K L+K I+ +G+GSNDYLNNYF
Sbjct  121   SETGQQLGARIDFTGQVNNYKNTVNQVVNILGDQESASKYLSKCIYSIGLGSNDYLNNYF  180

Query  601   MP-GYPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--AD  771
             MP  Y TS  Y P+Q+A  L+QQYT+QL  LY  GARKF L GIG++GC P  LA+   D
Sbjct  181   MPLYYSTSRQYLPDQYADILIQQYTEQLKTLYNFGARKFALIGIGQIGCSPNALAQNSPD  240

Query  772   NGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFD  951
                C++ +N A   FN  +K +++ F+   PDAKF +ID   +FQ ++N+   +GF V +
Sbjct  241   GATCVQRINGANQIFNEKLKSLVDDFNRNTPDAKFTYIDAYGIFQDLINSPTSFGFKVTN  300

Query  952   RGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
              GCCGVG+N+G++TCLP +TPC NR EYLFWDAFHPT A N+ +G  ++
Sbjct  301   AGCCGVGRNNGQITCLPLQTPCQNRDEYLFWDAFHPTEAANIFVGKRSY  349



>ref|XP_009769554.1| PREDICTED: GDSL esterase/lipase At1g29670 isoform X1 [Nicotiana 
sylvestris]
Length=369

 Score =   310 bits (795),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 225/330 (68%), Gaps = 7/330 (2%)
 Frame = +1

Query  124   TLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYT  303
             +LG+ G  N   VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGIDF   PTGRFSNG T
Sbjct  23    SLGYYG-ANAQQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDFPGGPTGRFSNGKT  81

Query  304   IVDSIAKQLGL-PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDN  480
              VD IA+QLG    I  Y  +   D +  GVNYASAAAGI D TG+   GRI F+ Q++N
Sbjct  82    TVDVIAEQLGFNGYIPPYATARGRDILG-GVNYASAAAGIRDETGRQLGGRISFSGQVNN  140

Query  481   FEKTKNQLSANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFASt  654
             +  T  Q+   L  +  A D L+K I+ VG+GSNDYLNNYFMP  YPTS  + P Q+AS 
Sbjct  141   YRNTVQQVVQILGNENAAADYLSKCIYSVGLGSNDYLNNYFMPLYYPTSRQFTPEQYASV  200

Query  655   lvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANV  828
             L+QQYTQQL  LY  GARKF L G+G++GC P  LA+   D   C++ +N A   FN  +
Sbjct  201   LIQQYTQQLKILYNNGARKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQLFNNKL  260

Query  829   KQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFE  1008
             K +++  +   PDAKF++I+   +FQ +++N   +G SV + GCCGVG+N+G++TCLPF+
Sbjct  261   KALVDNLNGNTPDAKFIYINAYGIFQDLIDNPSAFGLSVTNAGCCGVGRNNGQITCLPFQ  320

Query  1009  TPCSNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
              PC NR +YLFWDAFHPT   NV++G  ++
Sbjct  321   RPCRNRDQYLFWDAFHPTEVANVVVGRRSY  350



>ref|XP_008443704.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Cucumis melo]
Length=374

 Score =   310 bits (794),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 172/331 (52%), Positives = 227/331 (69%), Gaps = 8/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  40    VPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFGG-PTGRFSNGKTTVDVIAELLGFD  98

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +R GVNYASAAAGI + TG+   GRI F+ Q++N++ T +Q+   L
Sbjct  99    DYIPPYATARGRDILR-GVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVDLL  157

Query  517   -SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
                D  A+ L+K I+ +G+GSNDYLNNYFMP  Y T   Y P Q++  L+QQY +QL  L
Sbjct  158   GDEDSAAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRLL  217

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKFVL GIG++GC P  LA+   D   C++ +N A   FNA +K ++++F+    
Sbjct  218   YNYGARKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQA  277

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++ID+  +FQ +++N   +GF V + GCCGVG+N+G++TCLPF+TPCSNR EYLFW
Sbjct  278   DAKFIYIDSFGIFQDVIDNPSAFGFRVVNTGCCGVGRNNGQITCLPFQTPCSNRDEYLFW  337

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             DAFHPT A N ++G  A++       YP+ I
Sbjct  338   DAFHPTEAGNTVVGRRAYSAQRPTDAYPVDI  368



>ref|XP_004147394.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
Length=366

 Score =   310 bits (794),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 172/331 (52%), Positives = 226/331 (68%), Gaps = 8/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  32    VPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFGG-PTGRFSNGKTTVDVIAELLGFD  90

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +  GVNYASAAAGI + TG+   GRI F+ Q++N++ T +Q+   L
Sbjct  91    DYIPPYATARGRDILG-GVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVELL  149

Query  517   -SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
                D  A+ L+K I+ +G+GSNDYLNNYFMP  Y T   Y P Q++  L+QQY +QL  L
Sbjct  150   GDEDSAAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRLL  209

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKFVL GIG++GC P  LA+   D   C++ +N A   FNA +K ++++F+    
Sbjct  210   YNYGARKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQA  269

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF+FID+  +FQ +++N   +GF V + GCCGVG+N+G++TCLPF+TPCSNR EYLFW
Sbjct  270   DAKFIFIDSYGIFQDVIDNPSAFGFRVVNAGCCGVGRNNGQITCLPFQTPCSNRDEYLFW  329

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             DAFHPT A N ++G  A++       YP+ I
Sbjct  330   DAFHPTEAGNAVIGRRAYSAQQQTDAYPVDI  360



>ref|XP_010687162.1| PREDICTED: GDSL esterase/lipase At5g45670 [Beta vulgaris subsp. 
vulgaris]
Length=363

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 168/342 (49%), Positives = 227/342 (66%), Gaps = 11/342 (3%)
 Frame = +1

Query  133   FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             + G   +  VP  F+FGDSL+DNGNNNN+ S A+ANYLPYGIDF   PTGRFSNG T VD
Sbjct  19    WGGVNGDPQVPCYFVFGDSLVDNGNNNNIASLARANYLPYGIDFPAGPTGRFSNGKTTVD  78

Query  313   SIAKQLGL---PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNF  483
              IA+QLG    P+  AY ++   D +R GVNYASAAAGI + TGQ   GRI F  Q+ N+
Sbjct  79    VIAEQLGFEDYPL--AYAQASGEDILR-GVNYASAAAGIREETGQQLGGRISFGGQVRNY  135

Query  484   EKTKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStl  657
             + T +Q+   L   D  +  L++ I+ +G+GSNDYLNNYFMP  Y TS  Y+P Q+A  L
Sbjct  136   QSTVSQVVQILGDEDQASSYLSRCIYSIGLGSNDYLNNYFMPMYYQTSRQYNPQQYADVL  195

Query  658   vqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVK  831
             +Q+Y+Q +  LY  GARKF L GIG++GC P  LA+   D   C ++VN A   FN+ ++
Sbjct  196   IQEYSQHIRSLYNYGARKFALIGIGQIGCSPNQLAQRSPDGATCDDTVNSANRIFNSGLR  255

Query  832   QMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFET  1011
              ++ + +    DA+F +I+   MFQ ++ N   YGF V + GCCGVG+N+G++TCLP +T
Sbjct  256   SLVQQLNNELSDARFAYINVYDMFQDLIENPSNYGFRVTNAGCCGVGRNNGQITCLPLQT  315

Query  1012  PCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             PC NR EY+FWDAFHP  A NV++G  +++  S+   YP  I
Sbjct  316   PCPNRDEYVFWDAFHPGEAANVIIGRRSYSAQSSSDAYPFDI  357



>gb|KHG06516.1| hypothetical protein F383_33590 [Gossypium arboreum]
Length=361

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 171/339 (50%), Positives = 226/339 (67%), Gaps = 5/339 (1%)
 Frame = +1

Query  133   FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             F G      VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF N PTGRFSNG T VD
Sbjct  17    FCGVKGEPQVPCYFIFGDSLVDNGNNNELRSLARADYLPYGIDFANGPTGRFSNGRTTVD  76

Query  313   SIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKT  492
              IA+ LG         + S  Q+   VNYASAAAGI + TGQ    RI F+ Q+ N+++T
Sbjct  77    VIAELLGFDDYIPPYSTASGRQILGEVNYASAAAGIREETGQQLGARISFSGQVKNYQQT  136

Query  493   KNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqq  666
               Q+   L   D  A  L + I+ +G+GSNDYLNNYFMP  Y TS  Y P ++A++L+Q+
Sbjct  137   VQQVVNLLGDEDSAANYLRQCIYSIGLGSNDYLNNYFMPLYYSTSRQYSPEEYANSLIQE  196

Query  667   ytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMI  840
             YT+QL  LY  GARKFVL G+G++GC P  LA+   D   C+E +N A   FN  ++ ++
Sbjct  197   YTEQLQALYNYGARKFVLIGLGQIGCSPNELAQNSGDGRTCVERINAANRIFNNKLRGLV  256

Query  841   NKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCS  1020
             ++F+  + DAKFV+I+   +FQ I +N   YGF V + GCCGVG+N+G++TCLPF+TPC 
Sbjct  257   DQFNNANSDAKFVYINAYGIFQDITSNPAAYGFKVTNAGCCGVGRNNGQITCLPFQTPCQ  316

Query  1021  NRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             NR EYLFWDAFHP+ A NV++G  +++  S    YP+ I
Sbjct  317   NRDEYLFWDAFHPSEAANVIIGRRSYSAQSPTDAYPIDI  355



>ref|NP_001242366.1| uncharacterized protein LOC100800635 precursor [Glycine max]
 gb|ACU19711.1| unknown [Glycine max]
Length=366

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 238/360 (66%), Gaps = 8/360 (2%)
 Frame = +1

Query  79    VSAITEPVPVLAQ--APTLG-FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLP  249
             ++A+  P+ +LA     +LG +SG      VP  FIFGDSL+DNGNNN L S A+A+YLP
Sbjct  1     MAALYLPISMLALIVVVSLGLWSGVQGAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLP  60

Query  250   YGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDF  429
             YGIDF   P+GRFSNG T VD+IA+ LG           S D +  GVNYASAAAGI + 
Sbjct  61    YGIDFPGGPSGRFSNGKTTVDAIAELLGFDDYIPPYADASGDAILKGVNYASAAAGIREE  120

Query  430   TGQHFMGRIPFNEQIDNFEKTKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMP  606
             TGQ   GRI F+ Q+ N++ T +Q+   L + D  A  L+K I+ +G+GSNDYLNNYFMP
Sbjct  121   TGQQLGGRISFSGQVQNYQSTVSQVVNLLGNEDSAANYLSKCIYSIGLGSNDYLNNYFMP  180

Query  607   G-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNG  777
               Y +S  Y P+++A  L+Q YT+QL  LY  GARK VL GIG++GC P  LA+   D  
Sbjct  181   QFYSSSRQYSPDEYADVLIQAYTEQLKTLYNYGARKMVLFGIGQIGCSPNELAQNSPDGK  240

Query  778   ECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRG  957
              C+E +N A   FN  +K + ++F    PDA+ +++++  +FQ I++N   YGFSV + G
Sbjct  241   TCVEKINSANQIFNNKLKGLTDQFDNQLPDARVIYVNSYGIFQDIISNPSAYGFSVTNAG  300

Query  958   CCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             CCGVG+N+G++TCLP +TPC NR+EYLFWDAFHPT A NV++   A++  S    YP+ I
Sbjct  301   CCGVGRNNGQITCLPMQTPCQNRREYLFWDAFHPTEAGNVVVAQRAYSAQSASDAYPVDI  360



>ref|XP_011085304.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Sesamum indicum]
Length=367

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 222/331 (67%), Gaps = 7/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNNN+ S AKANYLPYGIDF   PTGRFSNG T VD +A+ LG  
Sbjct  32    VPCFFIFGDSLVDNGNNNNIQSLAKANYLPYGIDFPRGPTGRFSNGKTTVDVVAELLGFD  91

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   + ++ GVNYASAAAGI   TGQ   GRI F  Q++N++ T  Q+ + L
Sbjct  92    GYIPPYARARGQEVLK-GVNYASAAAGIRPETGQQLGGRIDFTGQVNNYKNTVAQVVSLL  150

Query  517   SA-DVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
                D  A  L+K I+ VG+GSNDYLNNYFMP  Y TS  Y P Q+A+ L+QQY QQL  L
Sbjct  151   GGQDAAATYLSKCIYSVGVGSNDYLNNYFMPLFYSTSRRYSPEQYATLLIQQYAQQLRNL  210

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKF L G+G++GC P  LA+   D   C++ +N A   FN+ ++ +++ F+    
Sbjct  211   YNYGARKFALVGVGQIGCSPNALAQNSPDGSTCVQRINNANRIFNSKLRALVDDFNRNAT  270

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++ID   +FQ +++N   +GF V + GCCGVG+N+G++TCLP +TPC NR EYLFW
Sbjct  271   DAKFIYIDAYGIFQDLIDNPSSFGFRVKNAGCCGVGRNNGQITCLPLQTPCRNRNEYLFW  330

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             DAFHPT A N+++G  +++       YP  I
Sbjct  331   DAFHPTEAANIIVGRRSYSAQKASDAYPFDI  361



>ref|XP_007147964.1| hypothetical protein PHAVU_006G169100g [Phaseolus vulgaris]
 gb|ESW19958.1| hypothetical protein PHAVU_006G169100g [Phaseolus vulgaris]
Length=365

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 170/332 (51%), Positives = 224/332 (67%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
             VP  FIFGDSL+DNGNNN L S AKANYLPYGIDF+  PTGRFSNG T VD +A+ LG  
Sbjct  30    VPCYFIFGDSLVDNGNNNRLNSLAKANYLPYGIDFSGGPTGRFSNGKTTVDVVAELLGFN  89

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I+ Y  +   D +R GVNYASAAAGI D TGQ   GRI F+ Q+ N+++T +Q+  NL
Sbjct  90    GYISPYATARGRDILR-GVNYASAAAGIRDETGQQLGGRISFSGQVQNYQRTVSQI-VNL  147

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqltr  687
               D    A  L+K I+ +G+GSNDYLNNYFMP  Y +S  Y P Q+A  L+Q YTQQL  
Sbjct  148   LGDENTAANYLSKCIYSIGLGSNDYLNNYFMPLVYSSSRRYTPQQYADLLIQAYTQQLRI  207

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY  GARK  L G+G++GC P  LA+   D   C+  +N A   FN  ++ ++++F+   
Sbjct  208   LYNNGARKMALFGVGQIGCSPNALAQNSPDGRTCVARINSANQLFNNGLRSLVDQFNNQF  267

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             PDA+ ++++   +FQ I+NN   +GF V + GCCGVG+N+G++TCLP + PC NR+EYLF
Sbjct  268   PDARVIYVNVYGIFQDIINNPASFGFRVTNAGCCGVGRNNGQITCLPLQPPCRNRREYLF  327

Query  1042  WDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             WDAFHPT + N ++G  A+N  S    YP+ I
Sbjct  328   WDAFHPTESANTVIGRRAYNAQSASDAYPIDI  359



>ref|XP_010930550.1| PREDICTED: GDSL esterase/lipase At1g71250 [Elaeis guineensis]
Length=369

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 162/331 (49%), Positives = 223/331 (67%), Gaps = 7/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPAMF+FGDSLID+GNNN L S AKANY PYGIDF   PTGRFSNG T++D +   LGLP
Sbjct  34    VPAMFVFGDSLIDDGNNNYLSSIAKANYYPYGIDFFQGPTGRFSNGKTVIDVLCDLLGLP  93

Query  340   MIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
              +  Y  SP ++  R   GVNYASAA GILD TG++   R   N+Q+ NFE   ++L   
Sbjct  94    YLPPY-TSPGLNGTRLLGGVNYASAAGGILDETGEYLGERFSLNQQVLNFENNLDELRTL  152

Query  514   LSADV-VAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
             +  +  +++ L +SI  +  GSNDY+NNY +P  YPTS+ Y P ++A+ L+  YT+Q+  
Sbjct  153   MGGERNLSQYLARSIVVMVFGSNDYINNYLLPPLYPTSYNYTPEEYANLLLNHYTRQILA  212

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY++G RKFVL+G+G +GCIP   A   A   +C++ VNQ V  FN  ++ ++ + +T H
Sbjct  213   LYSVGLRKFVLSGVGPLGCIPNQRASGFAPADQCIDQVNQMVSLFNGGLRSLVQQLNTNH  272

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             P A FV+ +T      I+NN   YGF+V +RGCCG+G+  G++TCLPF  PC NR +++F
Sbjct  273   PGAIFVYGNTYGALGDILNNPSTYGFTVVERGCCGLGRFQGQITCLPFSVPCLNRSQHIF  332

Query  1042  WDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             WDAFHPT AVN++LG  AF G    +YP+ +
Sbjct  333   WDAFHPTQAVNLILGQRAFTGPPNDMYPVNV  363



>ref|XP_004497726.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=367

 Score =   308 bits (789),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 222/338 (66%), Gaps = 8/338 (2%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G G    VP  FIFGDSL+D+GNNN L S AKANY PYGIDF   PTGRFSNG T VD I
Sbjct  26    GVGGAPQVPCYFIFGDSLVDDGNNNQLSSLAKANYFPYGIDFPGGPTGRFSNGKTTVDVI  85

Query  319   AKQLGLP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTK  495
             A+ LG    I+ Y  +   D ++ GVNYASAAAGI + TGQ    RI F+ Q+ N++KT 
Sbjct  86    AELLGFEDYISPYATARDRDILK-GVNYASAAAGIREETGQQLGDRISFSGQVQNYQKTV  144

Query  496   NQLSANLSAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqy  669
             +Q+  NL  D    A  L+K I+ +G+GSNDYLNNYFMP Y +S  Y P QFA  L+Q Y
Sbjct  145   SQM-VNLLGDENTTANYLSKYIYSIGLGSNDYLNNYFMPAYSSSRQYTPQQFADVLIQAY  203

Query  670   tqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMIN  843
              +QL  LY  GARK  L G+G++GC P  LA+   D   C+E ++ A   FN  +K +++
Sbjct  204   AEQLRILYNYGARKMALFGVGEIGCSPNELAQNSPDGRTCVERIDSANQLFNNGLKSLVD  263

Query  844   KFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSN  1023
             + +   PDA+F++++   +FQ I+NN   +G  V + GCCGVG+N+G++TCLP +TPC+N
Sbjct  264   QLNNQLPDARFIYVNVYGIFQDIINNPSSFGLRVTNEGCCGVGRNNGQITCLPLQTPCNN  323

Query  1024  RQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             R EYLFWDAFHPT   N ++G  A+N  S    YP+ I
Sbjct  324   RNEYLFWDAFHPTEIGNTIIGKRAYNAQSASDAYPIDI  361



>ref|XP_002266118.1| PREDICTED: GDSL esterase/lipase At5g45670 [Vitis vinifera]
 emb|CBI30765.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 219/330 (66%), Gaps = 5/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANYLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  30    VPCYFIFGDSLVDNGNNNGIASLARANYLPYGIDFPQGPTGRFSNGKTTVDVIAELLGFD  89

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                    S   + +  GVNYASAAAGI D TGQ   GRI  N Q+ N++ T +Q+ + L 
Sbjct  90    NYIPPYSSARGEDILKGVNYASAAAGIRDETGQQLGGRISMNGQLRNYQTTVSQVVSILG  149

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K I+ +G+GSNDYLNNYFMP  Y TS  Y P Q+A  L+QQY QQ+  LY
Sbjct  150   DEDTAANYLSKCIYSLGLGSNDYLNNYFMPQYYSTSRQYTPEQYADVLIQQYAQQIRTLY  209

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK VL G+G++GC P  LA+   D   C+E +N A   FN  +K ++ + +   PD
Sbjct  210   NYGARKVVLIGVGQIGCSPNELAQNSPDGTTCIERINYANRLFNDRLKSLVGELNNNFPD  269

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
              +F++I+   +FQ ++++   YGF V + GCCGVG+N+G++TCLPF+TPC NR EYLFWD
Sbjct  270   GRFIYINAYGIFQDLISSPSSYGFRVTNAGCCGVGRNNGQITCLPFQTPCQNRNEYLFWD  329

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP  A NV++G  +++  S+   YP+ I
Sbjct  330   AFHPGEAANVVIGRRSYSAQSSSDAYPIDI  359



>gb|KGN65589.1| hypothetical protein Csa_1G467090 [Cucumis sativus]
Length=408

 Score =   309 bits (792),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 172/331 (52%), Positives = 226/331 (68%), Gaps = 8/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  74    VPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFGG-PTGRFSNGKTTVDVIAELLGFD  132

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +  GVNYASAAAGI + TG+   GRI F+ Q++N++ T +Q+   L
Sbjct  133   DYIPPYATARGRDILG-GVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVELL  191

Query  517   -SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
                D  A+ L+K I+ +G+GSNDYLNNYFMP  Y T   Y P Q++  L+QQY +QL  L
Sbjct  192   GDEDSAAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRLL  251

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKFVL GIG++GC P  LA+   D   C++ +N A   FNA +K ++++F+    
Sbjct  252   YNYGARKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQA  311

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF+FID+  +FQ +++N   +GF V + GCCGVG+N+G++TCLPF+TPCSNR EYLFW
Sbjct  312   DAKFIFIDSYGIFQDVIDNPSAFGFRVVNAGCCGVGRNNGQITCLPFQTPCSNRDEYLFW  371

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             DAFHPT A N ++G  A++       YP+ I
Sbjct  372   DAFHPTEAGNAVIGRRAYSAQQQTDAYPVDI  402



>ref|XP_007019796.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY17021.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
Length=255

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 197/252 (78%), Gaps = 1/252 (0%)
 Frame = +1

Query  157  LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
            +VPAMF+FGDSLIDNGNNN+L SFAKANY PYGIDFN  PTGRFSNGYT+VD IA+ LGL
Sbjct  1    MVPAMFVFGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGL  60

Query  337  PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
            P+I AY E+ S DQ+ +GVNYASAAAGILD TG++F+ RIPF++QI NF+ T +Q++ NL
Sbjct  61   PLIPAYSEA-SGDQVLHGVNYASAAAGILDITGRNFVSRIPFDQQIRNFQSTLDQITDNL  119

Query  517  SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrlyt  696
             A   A  + + IFFVGMGSNDYLNNY MP YPT   Y+  QFA  LVQQYT+QL  LY 
Sbjct  120  GAVDAADAIARCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQFADLLVQQYTRQLRTLYN  179

Query  697  lGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKF  876
            LGARKFVL G+G+MGCIP++LA++  G C E VNQ VLPFNANVK M+N  +   P A+F
Sbjct  180  LGARKFVLAGLGRMGCIPSILAQSTVGSCSEEVNQLVLPFNANVKTMMNNLNANLPGARF  239

Query  877  VFIDTDKMFQHI  912
            ++ID   +F+ I
Sbjct  240  IYIDVAHLFEDI  251



>gb|KHN06446.1| GDSL esterase/lipase [Glycine soja]
Length=357

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 227/339 (67%), Gaps = 5/339 (1%)
 Frame = +1

Query  133   FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             +SG      VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   P+GRFSNG T VD
Sbjct  13    WSGVQGAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVD  72

Query  313   SIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKT  492
             +IA+ LG           S D +  GVNYASAAAGI + TGQ   GRI F+ Q+ N++ T
Sbjct  73    AIAELLGFDDYIPPYADASGDAILKGVNYASAAAGIREETGQQLGGRISFSGQVQNYQST  132

Query  493   KNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqq  666
              +Q+   L + D  A  L+K I+ +G+GSNDYLNNYFMP  Y +S  Y P+++A  L+Q 
Sbjct  133   VSQVVNLLGNEDSAANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSPDEYADVLIQA  192

Query  667   ytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMI  840
             YT+QL  LY  GARK VL GIG++GC P  LA+   D   C+E +N A   FN  +K + 
Sbjct  193   YTEQLKTLYNYGARKMVLFGIGQIGCSPNELAQNSPDGKTCVEKINSANQIFNNKLKGLT  252

Query  841   NKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCS  1020
             ++F+   PDA+ +++++  +FQ I++N   YGFSV + GCCGVG+N+G++TCLP +TPC 
Sbjct  253   DQFNNQLPDARVIYVNSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCQ  312

Query  1021  NRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             NR+EYLFWDAFHPT A NV++   A++  S    YP+ I
Sbjct  313   NRREYLFWDAFHPTEAGNVVVAQRAYSAQSASDAYPVDI  351



>ref|XP_007159508.1| hypothetical protein PHAVU_002G243500g [Phaseolus vulgaris]
 gb|AGV54372.1| GDSL esterase/lipase [Phaseolus vulgaris]
 gb|AHA84183.1| GDSL esterase/lipase [Phaseolus vulgaris]
 gb|ESW31502.1| hypothetical protein PHAVU_002G243500g [Phaseolus vulgaris]
Length=365

 Score =   307 bits (787),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 178/369 (48%), Positives = 234/369 (63%), Gaps = 21/369 (6%)
 Frame = +1

Query  46    FSALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFS  225
              +A  +LALV V  +   V    Q              VP  FIFGDSL+DNGNNN L S
Sbjct  6     LTAASMLALVLVLGLWNGVHAAPQ--------------VPCYFIFGDSLVDNGNNNQLQS  51

Query  226   FAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP-MIAAYLESPSIDQMRYGVNYA  402
              A+A+YLPYGIDF   P+GRFSNG T VD IA+ LG    I  Y E+ S D +  GVNYA
Sbjct  52    LARADYLPYGIDFPGGPSGRFSNGKTTVDGIAELLGFDDFIPPYAEA-SGDAVLKGVNYA  110

Query  403   SAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-SADVVAKDLTKSIFFVGMGSN  579
             SAAAGI + TGQ   GRI F+ Q+ N++ T +Q+   L   D  A  L+K I+ +G+GSN
Sbjct  111   SAAAGIREETGQQLGGRISFSGQVQNYQNTVSQVVNLLGDEDSAANYLSKCIYSIGLGSN  170

Query  580   DYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTM  756
             DYLNNYFMP  Y +S  Y P+QFA  L+  YT QL  LY  GARK VL G+G++GC P  
Sbjct  171   DYLNNYFMPQFYTSSREYTPDQFADVLIGAYTDQLKTLYNYGARKMVLFGLGQIGCSPNE  230

Query  757   LAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKR  930
             LAR   D   C++ +N A   FN  +K + ++F+   PDA+ ++I++  +FQ +++N   
Sbjct  231   LARNSPDGNTCVDRINNANQMFNTRLKTLTDQFNNQMPDARVIYINSFGIFQDVISNPAA  290

Query  931   YGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-S  1107
             YGFSV + GCCGVG+N+G++TCLP +TPC NR+EYLFWDAFHPT A N+++   A++  S
Sbjct  291   YGFSVINAGCCGVGRNNGQITCLPMQTPCPNRREYLFWDAFHPTEAGNLIVAQRAYSAQS  350

Query  1108  NYLVYPMTI  1134
                 YP  I
Sbjct  351   ASDAYPFDI  359



>ref|XP_003629880.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AET04356.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=363

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 171/339 (50%), Positives = 228/339 (67%), Gaps = 6/339 (2%)
 Frame = +1

Query  133   FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             +SG G +  VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGRFSNG T VD
Sbjct  20    WSGVGADPQVPCYFIFGDSLVDNGNNNGLQSLARADYLPYGIDFGG-PTGRFSNGKTTVD  78

Query  313   SIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKT  492
             +IA+ LG         S S D +  GVNYASAAAGI + TG+    R+ F+ Q+ N++ T
Sbjct  79    AIAELLGFDDYIPPYASASDDAILKGVNYASAAAGIREETGRQLGARLSFSAQVQNYQST  138

Query  493   KNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqq  666
              +Q+   L + D  A  L+K I+ +G+GSNDYLNNYFMP  Y T   Y P+++A  L+Q 
Sbjct  139   VSQVVNILGTEDQAASHLSKCIYSIGLGSNDYLNNYFMPQFYNTHDQYTPDEYADDLIQS  198

Query  667   ytqqltrlytlGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMI  840
             YT+QL  LY  GARK VL GIG++GC P  LA   AD   C+E +N A   FN  +K ++
Sbjct  199   YTEQLRTLYNNGARKMVLFGIGQIGCSPNELATRSADGVTCVEEINSANQIFNNKLKGLV  258

Query  841   NKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCS  1020
             ++F+   PD+K +++++  +FQ I++N   YGFSV + GCCGVG+N+G+ TCLP +TPC 
Sbjct  259   DQFNNQLPDSKVIYVNSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQFTCLPLQTPCE  318

Query  1021  NRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             NR+EYLFWDAFHPT A NV++   A++  S    YP+ I
Sbjct  319   NRREYLFWDAFHPTEAGNVVVAQRAYSAQSPDDAYPIDI  357



>ref|XP_006422361.1| hypothetical protein CICLE_v10018420mg, partial [Citrus clementina]
 gb|ESR35601.1| hypothetical protein CICLE_v10018420mg, partial [Citrus clementina]
Length=289

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 203/271 (75%), Gaps = 1/271 (0%)
 Frame = +1

Query  121  PTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGY  300
            P     G G   +VPA+FIFGDSLIDNGNNNNL SFAKANY PYGIDFN  PTGRFS+GY
Sbjct  20   PVGSTQGGGGREMVPALFIFGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSSGY  79

Query  301  TIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDN  480
            T+VD IA+ LGLP+I AY E+ S  Q+ +GVNYASAAAGILD TG++F+GRIPF++QI N
Sbjct  80   TMVDEIAELLGLPLIPAYSEA-SGAQVLHGVNYASAAAGILDITGRNFVGRIPFDQQIRN  138

Query  481  FEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlv  660
            F+ T +Q++ NL A  V+  + + IFFVGMGSNDYLNNY MP Y T   Y+  Q+A  LV
Sbjct  139  FQNTLDQVTDNLGASDVSNAIARCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQYADLLV  198

Query  661  qqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMI  840
             +Y++QLT LY LGARKFVL+G+G+MGCIP++LA+     C E VNQ V+PFNANVK +I
Sbjct  199  SEYSRQLTTLYNLGARKFVLSGLGRMGCIPSILAQNQMDRCSEEVNQLVMPFNANVKTVI  258

Query  841  NKFSTTHPDAKFVFIDTDKMFQHIMNNNKRY  933
            N  +   P A+F FID  +MF+ ++ N + Y
Sbjct  259  NNLNANLPGARFTFIDIARMFEDLLTNYRSY  289



>ref|NP_565021.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE35215.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=283

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 200/274 (73%), Gaps = 2/274 (1%)
 Frame = +1

Query  316   IAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTK  495
             + + LGLP+I AY E+   DQ+  GVNYASAAAGIL  TG +F+GRIPF++QI NFE T 
Sbjct  4     VTQLLGLPLIPAYSEATG-DQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTL  62

Query  496   NQLSANLSADV-VAKDLTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqyt  672
             +Q+++     V +A  +T+S+FF+GMGSNDYLNNY MP +PT   Y+  QF   LVQ YT
Sbjct  63    DQVASKSGGAVAIADSVTRSLFFIGMGSNDYLNNYLMPNFPTRNQYNSQQFGDLLVQHYT  122

Query  673   qqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFS  852
              QLTRLY LG RKFV+ G+G+MGCIP++LA+ ++G+C E VNQ VLPFN NVK MI+  +
Sbjct  123   DQLTRLYNLGGRKFVVAGLGRMGCIPSILAQGNDGKCSEEVNQLVLPFNTNVKTMISNLN  182

Query  853   TTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
                PDAKF+++D   MF+ I+ N   YG +  D+GCCG+GKN G++TCLPFETPC NR +
Sbjct  183   QNLPDAKFIYLDIAHMFEDIVANQAAYGLTTMDKGCCGIGKNRGQITCLPFETPCPNRDQ  242

Query  1033  YLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             Y+FWDAFHPT  VN+++   AF G   + YP+ I
Sbjct  243   YVFWDAFHPTEKVNLIMAKKAFAGDRTVAYPINI  276



>ref|XP_006858605.1| hypothetical protein AMTR_s00071p00200630 [Amborella trichopoda]
 gb|ERN20072.1| hypothetical protein AMTR_s00071p00200630 [Amborella trichopoda]
Length=366

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 219/335 (65%), Gaps = 11/335 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP MFIFGDSL+DNGNNN++ + A+ANYLPYG+DF    TGRF NG T VD +A  LG  
Sbjct  27    VPCMFIFGDSLVDNGNNNDILTLARANYLPYGVDFPGGVTGRFCNGRTTVDFLAAFLGFS  86

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    + S   +  GVN+AS AAGI D TG++    +  N+Q+ NF ++  ++ A LS
Sbjct  87    EYIPPYATTSGTALLRGVNFASGAAGIRDETGRNLGEHLSMNQQVANFARSVEEMRALLS  146

Query  520   AD--VVAKDLTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqqltrl  690
                  V   L K IF VGMGSNDYLNNYFMP Y  T   Y P ++AS+L+Q Y +QL  L
Sbjct  147   RSNISVTAYLRKCIFSVGMGSNDYLNNYFMPDYYNTGSQYTPREYASSLIQDYGRQLMEL  206

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADN-----GECLESVNQAVLPFNANVKQMINKFST  855
             Y LGARK  + G+G++GCIP  LAR+ N       C+  +N A++ FN+ +  ++  F++
Sbjct  207   YELGARKVAVIGVGQIGCIPYELARSTNDDANGARCVSRINNAIILFNSGLLSLVKSFNS  266

Query  856   THPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEY  1035
               P AKF +I++   FQH++ N   YGF+V D+GCCGVG+N+G+VTCLPF+ PCSNR EY
Sbjct  267   RLPGAKFTYINSYSSFQHLIANASSYGFTVVDKGCCGVGRNNGQVTCLPFQQPCSNRTEY  326

Query  1036  LFWDAFHPTSAVNVLLGNLAFNGSNYL--VYPMTI  1134
             +FWDAFHPT A N++L   A+  S Y    YP+ I
Sbjct  327   IFWDAFHPTEAANIILAQKAY-ASKYCSDAYPINI  360



>emb|CBI16986.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   305 bits (781),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 218/327 (67%), Gaps = 3/327 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPA+F FGDSLID+GNNN L S AK+NY PYGIDF   PTGRF NG TIVD +A+ LG+ 
Sbjct  32    VPAIFCFGDSLIDDGNNNFLDSIAKSNYYPYGIDFRG-PTGRFCNGKTIVDLLAEMLGVS  90

Query  340   MIAAYLESPSI-DQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
                 + +  S   ++  GVNYASAAAGILD TGQ++  R   ++Q+ NFE T +Q+    
Sbjct  91    YPQPFADPGSTGSKIFSGVNYASAAAGILDETGQNYGQRFSLSQQVLNFETTLSQMRTMA  150

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
             +   +++ L KSI  +  GSNDYLNNY MP  YP+S+ Y P  FA+ L+  Y +Q+  LY
Sbjct  151   NGTTLSRYLAKSIVIMVFGSNDYLNNYLMPSLYPSSYNYSPPDFANLLLNHYARQILALY  210

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAK  873
             +LG RKF L GIG +GC+P   A A  G CL+  NQ +  FN  ++ ++N+ +  HP + 
Sbjct  211   SLGLRKFFLAGIGPLGCMPNQRALAPPGRCLDYDNQILGTFNEGLRALVNQLNGNHPGSI  270

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
             FV+ +T  +F  I+NN   YGFSV DRGCCG+G+N G++TCLP + PC NR EY+FWDAF
Sbjct  271   FVYGNTYGIFGDILNNPATYGFSVVDRGCCGLGRNQGQITCLPMQMPCLNRNEYVFWDAF  330

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT+A NV+L   AF G     YP+ +
Sbjct  331   HPTTAANVILAQTAFYGPPSDCYPINV  357



>ref|XP_008439698.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis melo]
Length=375

 Score =   305 bits (782),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 172/330 (52%), Positives = 223/330 (68%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  41    VPCYFIFGDSLVDNGNNNRLSSLARADYLPYGIDFPRGPTGRFSNGKTTVDVIAELLGFN  100

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +R GVNYASAAAGI + TGQ   GRI F+ Q+ N +    Q+   L
Sbjct  101   GYIPPYSNTRGRDILR-GVNYASAAAGIREETGQQLGGRISFSGQVRNHQNIVRQIVNIL  159

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
                  A D L K I+ VG+GSNDYLNNYFMP  Y +S  Y P+Q+A  L+QQYTQQL+ L
Sbjct  160   GDQNAAADYLNKCIYSVGLGSNDYLNNYFMPLIYSSSRQYSPDQYAQILIQQYTQQLSIL  219

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPD  867
             Y  GARKF L G+G++GC P  LA + +G  C +  N A   FN  +K ++++ +   PD
Sbjct  220   YDNGARKFALFGVGQIGCSPNALASSPDGRSCNQRYNFANQMFNNRLKSLVDQLNRDQPD  279

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F++ID+  +FQ I+N+   +GF V + GCCG+G+N+G++TCLPF+TPCSNR+EYLFWD
Sbjct  280   ARFIYIDSYGIFQDIINSPSSFGFRVTNAGCCGIGRNNGQITCLPFQTPCSNRREYLFWD  339

Query  1048  AFHPTSAVNVLLGNLAFNGSN-YLVYPMTI  1134
             AFHPT A N ++G  A++       YP+ I
Sbjct  340   AFHPTEAGNTIVGRRAYSAQRPSDAYPIDI  369



>ref|XP_006852691.1| hypothetical protein AMTR_s00021p00254410 [Amborella trichopoda]
 gb|ERN14158.1| hypothetical protein AMTR_s00021p00254410 [Amborella trichopoda]
Length=436

 Score =   307 bits (787),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 172/377 (46%), Positives = 244/377 (65%), Gaps = 12/377 (3%)
 Frame = +1

Query  40    SVFSALFILALVFVSAITEPVPVLAQAPTLGF-------SGEGNNALVPAMFIFGDSLID  198
             + F++  +L L+  S  +  +P LAQ    G        +G  +   VP  F+FGDSL+D
Sbjct  54    AAFTSSSLLELIKASFTSSSIPELAQMGLFGVIFALFLGTGVAHGQQVPCYFVFGDSLVD  113

Query  199   NGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQ  378
             NGNNNN+ S A+ANY PYGIDF   PTGRFSNG T  D  A+ LG   +     + S  Q
Sbjct  114   NGNNNNIASLARANYPPYGIDFPQGPTGRFSNGLTTTDVTAQLLGFNQLILPYATASGRQ  173

Query  379   MRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKD-LTKSI  555
             +  GVNYASAAAGI + TGQ    RIPF  QI+N+  T NQ+ A L  +  A D L+K I
Sbjct  174   ILRGVNYASAAAGIREETGQQLGARIPFGGQIENYRNTVNQVIALLGDEDSAADYLSKCI  233

Query  556   FFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIG  732
             + VGMG+NDYLNNYFMP  Y TS  Y P  +A  L+QQYT+QLT+LY LGARK  L G+G
Sbjct  234   YSVGMGNNDYLNNYFMPALYSTSRQYTPQAYADVLIQQYTRQLTQLYNLGARKVALIGVG  293

Query  733   KMGCIPTMLAR-ADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQ  906
             ++GC P  LA+ + NG  C++ +NQ +  FN+ ++ +++ F+     A F++++   +F 
Sbjct  294   QIGCSPNALAQNSPNGATCVQRLNQPIQIFNSRLRSLVDYFNNNFQGAAFIYVNAYGIFD  353

Query  907   HIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLG  1086
              +++  + YGF+V + GCCGVG+N+G++TCLP++TPC NR++Y+FWDAFHPT A N+++ 
Sbjct  354   DLISRPRAYGFTVTNVGCCGVGRNNGQITCLPYQTPCQNRRQYVFWDAFHPTEAANIVIA  413

Query  1087  NLAFNG-SNYLVYPMTI  1134
               ++   S+   YP+ I
Sbjct  414   RRSYAAQSSSDAYPIDI  430



>ref|XP_002266194.2| PREDICTED: GDSL esterase/lipase At1g71250 [Vitis vinifera]
Length=367

 Score =   305 bits (781),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 218/327 (67%), Gaps = 3/327 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPA+F FGDSLID+GNNN L S AK+NY PYGIDF   PTGRF NG TIVD +A+ LG+ 
Sbjct  36    VPAIFCFGDSLIDDGNNNFLDSIAKSNYYPYGIDFRG-PTGRFCNGKTIVDLLAEMLGVS  94

Query  340   MIAAYLESPSI-DQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
                 + +  S   ++  GVNYASAAAGILD TGQ++  R   ++Q+ NFE T +Q+    
Sbjct  95    YPQPFADPGSTGSKIFSGVNYASAAAGILDETGQNYGQRFSLSQQVLNFETTLSQMRTMA  154

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
             +   +++ L KSI  +  GSNDYLNNY MP  YP+S+ Y P  FA+ L+  Y +Q+  LY
Sbjct  155   NGTTLSRYLAKSIVIMVFGSNDYLNNYLMPSLYPSSYNYSPPDFANLLLNHYARQILALY  214

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAK  873
             +LG RKF L GIG +GC+P   A A  G CL+  NQ +  FN  ++ ++N+ +  HP + 
Sbjct  215   SLGLRKFFLAGIGPLGCMPNQRALAPPGRCLDYDNQILGTFNEGLRALVNQLNGNHPGSI  274

Query  874   FVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAF  1053
             FV+ +T  +F  I+NN   YGFSV DRGCCG+G+N G++TCLP + PC NR EY+FWDAF
Sbjct  275   FVYGNTYGIFGDILNNPATYGFSVVDRGCCGLGRNQGQITCLPMQMPCLNRNEYVFWDAF  334

Query  1054  HPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             HPT+A NV+L   AF G     YP+ +
Sbjct  335   HPTTAANVILAQTAFYGPPSDCYPINV  361



>ref|XP_002871328.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47587.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=384

 Score =   305 bits (782),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 169/372 (45%), Positives = 234/372 (63%), Gaps = 11/372 (3%)
 Frame = +1

Query  46    FSALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFS  225
             F  + +++ +  S +  P   L  A   G     + A+ PAMF+FGDSL+DNGNNN+L S
Sbjct  9     FKDMMMMSCIVQSLVLVPW-FLVVAVLAGGEDSSDTAMFPAMFVFGDSLVDNGNNNHLNS  67

Query  226   FAKANYLPYGIDF-NNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPS--IDQMRYGVN  396
              A++NYLPYGIDF  N PTGRFSNG TIVD I + LGLP I A++++    +D ++ GVN
Sbjct  68    LARSNYLPYGIDFAGNQPTGRFSNGKTIVDFIGELLGLPEIPAFMDTVDGGVDILQ-GVN  126

Query  397   YASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGS  576
             YASAA GIL+ TG+H   R     Q++NFEKT  ++S ++  + V + + KS+  V +G+
Sbjct  127   YASAAGGILEETGRHLGERFSMGRQVENFEKTLMEISRSMRKESVKEYMAKSLVVVSLGN  186

Query  577   NDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPT  753
             NDY+NNY  P  + +S  YDP  FA  L+  +T  L  LY  G RKFV+ G+G +GCIP 
Sbjct  187   NDYINNYLKPTLFLSSSIYDPTSFADLLLSNFTTHLLVLYGKGFRKFVIAGVGPLGCIPD  246

Query  754   MLA--RADNGECLESVNQAVLPFNANVKQMINKF---STTHPDAKFVFIDTDKMFQHIMN  918
              LA   A  GEC+E+VN+    FN  +  ++++    S T  +A FV+ +T      I+ 
Sbjct  247   QLAAREAPPGECVEAVNEMAELFNNGLVSLVDRLNSNSKTASEAIFVYGNTYGAAVDILT  306

Query  919   NNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
             N   YGF V DRGCCGVG+N GE+TCLP   PC+ R  ++FWDAFHPT A N+++   AF
Sbjct  307   NPFSYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDAFHPTQAFNLIIALRAF  366

Query  1099  NGSNYLVYPMTI  1134
             NGS    YP+ +
Sbjct  367   NGSKSDCYPINL  378



>emb|CDY35296.1| BnaC03g59270D [Brassica napus]
Length=360

 Score =   305 bits (780),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 219/330 (66%), Gaps = 7/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
             VP  FIFGDSL+DNGNNN L SFA+ANYLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  27    VPCYFIFGDSLVDNGNNNGLVSFARANYLPYGIDFGG-PTGRFSNGRTTVDEIAELLGFN  85

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I AY  S    Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T  Q+ + L
Sbjct  86    DYIPAY-NSVRGRQILTGVNYASAAAGIREETGRQLGQRISFSGQVRNYQNTVQQVVSLL  144

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
               +  A D L + I+ VGMGSNDYLNNYFMP  Y +S  + P Q+A+ L+ +Y+ QL  L
Sbjct  145   GGETQAADYLKRCIYSVGMGSNDYLNNYFMPTFYSSSRQFTPEQYANDLISRYSTQLNAL  204

Query  691   ytlGARKFVLTGIGKMGCIPTMLARA-DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             Y  GARKF L GIG +GC P  LAR+ D   C E +N A   FN+ ++ ++++ +  HPD
Sbjct  205   YNYGARKFALIGIGAIGCSPNALARSRDRRTCDERINSANQIFNSKLRSLVDQLNNNHPD  264

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF +I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC +R  Y+FWD
Sbjct  265   AKFTYINAYDIFQDMIKNPSRFGFRVTNAGCCGIGRNAGQITCLPGQRPCRDRNAYVFWD  324

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A N+++   ++   S    YPM I
Sbjct  325   AFHPTEAANIVIARRSYKAESPSDAYPMDI  354



>gb|AAX20033.1| GDSL-lipase protein [Capsicum annuum]
Length=371

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 225/338 (67%), Gaps = 7/338 (2%)
 Frame = +1

Query  100   VPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPT  279
             V VL      G+ G  N   VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGID+   PT
Sbjct  17    VVVLLGLNLWGYYGV-NAQQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDYPGGPT  75

Query  280   GRFSNGYTIVDSIAKQLGLP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRI  456
             GRFSNG T VD IA+ LG    I  Y ++   D ++ GVNYASAAAGI D TGQ    RI
Sbjct  76    GRFSNGKTTVDVIAELLGFEDYIPPYADARGEDILK-GVNYASAAAGIRDETGQQLGARI  134

Query  457   PFNEQIDNFEKTKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGY-PTSFFY  630
             PF  Q++N+  T  Q+   L + D  A  L+K ++ +G+GSNDYLNNYFMP Y  T   Y
Sbjct  135   PFGGQVNNYRDTVQQVVQILGNEDSAATYLSKCVYPIGLGSNDYLNNYFMPMYYSTGRQY  194

Query  631   DPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQA  804
             +P Q+A  L+QQYTQ L  LY  GARKFVL G+G++GC P  LA+  AD   C +++N A
Sbjct  195   NPEQYADILIQQYTQHLKTLYDYGARKFVLIGVGQIGCSPNALAQNSADGRTCAQNINAA  254

Query  805   VLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSG  984
                FN  ++ ++++F+   PDAKF++I+   +FQ +++N   +GF V + GCCGVG+N+G
Sbjct  255   NQLFNNRLRGLVDEFNGNTPDAKFIYINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNG  314

Query  985   EVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
             ++TCLP + PC NR EYLFWDAFHP  A N ++G  ++
Sbjct  315   QITCLPLQNPCPNRDEYLFWDAFHPGEAANTIVGRRSY  352



>ref|XP_004134596.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
 ref|XP_004169530.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
 gb|KGN49344.1| hypothetical protein Csa_6G520420 [Cucumis sativus]
Length=374

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 171/330 (52%), Positives = 225/330 (68%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  40    VPCYFIFGDSLVDNGNNNRLSSLARADYLPYGIDFPRGPTGRFSNGKTTVDVIAELLGFN  99

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +R GVNYASAAAGI + TGQ   GRI F+ Q+ N +    Q+   L
Sbjct  100   GYIPPYSNTRGRDILR-GVNYASAAAGIREETGQQLGGRISFSGQVRNHQNIVTQIVNIL  158

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
               +  A D L K I+ +G+GSNDYLNNYFMP  Y +S  Y P+Q+A  L+QQYTQQL+ L
Sbjct  159   GDENTAADYLNKCIYSIGLGSNDYLNNYFMPQIYSSSRQYAPDQYAQILIQQYTQQLSIL  218

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPD  867
             Y  GARKFVL G+G++GC P  LA + +G  C +  N A   FN  +K ++++ +   PD
Sbjct  219   YDNGARKFVLFGVGQIGCSPNALASSPDGRSCNQRYNFANQLFNNRLKGLVDQLNRNQPD  278

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F++ID+  +FQ I+N+   +GF V + GCCG+G+N+G++TCLPF+TPC+NR+EYLFWD
Sbjct  279   ARFIYIDSYGIFQDIINSPSSFGFRVTNAGCCGIGRNNGQITCLPFQTPCANRREYLFWD  338

Query  1048  AFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             AFHPT A N ++G  A++       YP+ I
Sbjct  339   AFHPTEAGNSIVGRRAYSAQRSSDAYPIDI  368



>gb|KHN48037.1| GDSL esterase/lipase [Glycine soja]
Length=358

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 222/330 (67%), Gaps = 5/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   P+GRFSNG T VD+IA+ LG  
Sbjct  23    VPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAELLGFD  82

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                      S D +  GVNYASAAAGI + TGQ   GRI F  Q+ N++ T +Q+   L 
Sbjct  83    DYIPPYADASGDAILKGVNYASAAAGIREETGQQLGGRISFRGQVQNYQNTVSQVVNLLG  142

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
             + D  A  L+K I+ +G+GSNDYLNNYFMP  Y +S  Y  +++A  L+Q YT+QL  LY
Sbjct  143   NEDSAANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSTDEYADVLIQAYTEQLKTLY  202

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK VL GIG++GC P  LA+   D   C+E +N A   FN  +K + ++F+   PD
Sbjct  203   NYGARKMVLFGIGQIGCSPNELAQNSPDGKTCVEIINTANQIFNNKLKGLTDQFNNQLPD  262

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AK ++I++  +FQ I++N   YGFSV + GCCGVG+N+G++TCLP +TPC NR+EYLFWD
Sbjct  263   AKVIYINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCQNRREYLFWD  322

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A NV++   A++  S    YP+ I
Sbjct  323   AFHPTEAGNVVVAQRAYSAQSASDAYPVDI  352



>ref|XP_006655493.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Oryza brachyantha]
Length=364

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 212/317 (67%), Gaps = 5/317 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  F+FGDSL+DNGNNN++ S A+ANY PYGIDF   PTGRFSNG T VD I+K LG  
Sbjct  30    VPCYFVFGDSLVDNGNNNDIVSLARANYPPYGIDFAGGPTGRFSNGLTTVDVISKLLGFD  89

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S DQ+  GVN+ASAAAGI + TGQ    RI F+ Q+ N++    QL + L 
Sbjct  90    DFIPPFAGASSDQLLTGVNFASAAAGIREETGQQLGARISFSGQVQNYQSAVQQLVSILG  149

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L++ IF VGMGSNDYLNNYFMP  Y T   Y P Q+A  L+ +YTQ L  +Y
Sbjct  150   DEDTAAAHLSQCIFTVGMGSNDYLNNYFMPAFYNTGSQYTPEQYADDLIGRYTQLLRAMY  209

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             + GARK  L G+G++GC P  LA+  A+   C+E +N A+  FN  +  ++++F+T  P 
Sbjct  210   SNGARKVALVGVGQVGCSPNELAQQSANGVTCVERINSAIRMFNQKLSGLVDQFNTL-PG  268

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +F+ I+ +   +G  V ++GCCGVG+N+G+VTCLPF+TPC+NR EY+FWD
Sbjct  269   AHFTYINIYGIFEDILRSPGSHGLKVTNQGCCGVGRNNGQVTCLPFQTPCANRHEYVFWD  328

Query  1048  AFHPTSAVNVLLGNLAF  1098
             AFHPT A NVL+G  A+
Sbjct  329   AFHPTEAANVLVGQRAY  345



>ref|XP_008786569.1| PREDICTED: GDSL esterase/lipase At1g71250 [Phoenix dactylifera]
Length=370

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/338 (49%), Positives = 221/338 (65%), Gaps = 11/338 (3%)
 Frame = +1

Query  145   GNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAK  324
             G  + VPAMF FGDSLID+GNNN L S AKANY PYGIDF   PTGRF NG T+VD +  
Sbjct  30    GEESQVPAMFAFGDSLIDDGNNNYLSSIAKANYYPYGIDFFQGPTGRFCNGKTVVDVLCD  89

Query  325   QLGLPMIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKN  498
              LGLP +  Y  SP ++  R   GVNYASAA GILD TGQ+   R   N+Q+ NFE   N
Sbjct  90    LLGLPYLPPY-TSPGLNGTRLLGGVNYASAAGGILDETGQYLGERFSLNQQVLNFENNLN  148

Query  499   QLSANLSADV-VAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqyt  672
             +L   +  +  +++ L +SI  +  GSNDY+NNY +P  Y TS+ Y P ++A+ L+  YT
Sbjct  149   ELKTLMGGERNLSQYLARSIVVMVFGSNDYINNYLLPPQYATSYNYTPEEYANLLLNHYT  208

Query  673   qqltrlytlGARKFVLTGIGKMGCIPTM----LARADNGECLESVNQAVLPFNANVKQMI  840
             +Q+  LY++G RKFVL G+G +GCIP      L  AD   C++ VNQ V  FN  ++ ++
Sbjct  209   RQILALYSVGLRKFVLAGVGPLGCIPNQRASGLTPAD--RCVDQVNQMVGLFNVGLRSLV  266

Query  841   NKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCS  1020
              + +T HP A FV+ +T      I+NN   YGF+V +RGCCG+G+  G++TCLPF  PC 
Sbjct  267   QQLNTDHPGAIFVYGNTYGALGDILNNPSTYGFTVVERGCCGLGRFQGQITCLPFSVPCL  326

Query  1021  NRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             NR +++FWDAFHPT AVN++LG  AF G    +YP+ +
Sbjct  327   NRSQHIFWDAFHPTQAVNLILGQRAFTGPPNDMYPVNV  364



>emb|CDY35297.1| BnaC03g59260D [Brassica napus]
Length=364

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 219/350 (63%), Gaps = 7/350 (2%)
 Frame = +1

Query  100   VPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPT  279
             V VL     LGF+ +     VP  FIFGDSL+DNGNNN L S A+A+YLPYGID    PT
Sbjct  11    VSVLVLYLGLGFNVKAE-PQVPCYFIFGDSLVDNGNNNGLSSLARADYLPYGIDLGG-PT  68

Query  280   GRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIP  459
             GRFSNG T VD IA+ LG           S +Q+  GVNYASAAAGI + TGQ    RIP
Sbjct  69    GRFSNGKTTVDEIAELLGFDNYIPAYSDVSGEQILQGVNYASAAAGIREETGQQLGQRIP  128

Query  460   FNEQIDNFEKTKNQLSANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYD  633
             F+ Q+ N++ T  Q+   L  +  A D L K I+ VG+GSNDYLNNYFMP Y  TS  Y 
Sbjct  129   FSGQVQNYQNTVAQVVELLGDENTAADYLRKCIYSVGLGSNDYLNNYFMPQYYSTSRQYT  188

Query  634   PNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAV  807
             P Q+A  L+ +Y  QL  LY  GARKF L G+G +GC P  LA+   D   C+E +N A 
Sbjct  189   PEQYADDLINRYRDQLNALYNYGARKFALVGVGAIGCSPNALAQGSPDGTTCVERLNSAN  248

Query  808   LPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGE  987
               FN  +K M+ + +  H DAKF +I+   +FQ I+ N   YGF+V +  CCGVGKN G+
Sbjct  249   RIFNNRLKSMVQQLNNEHSDAKFTYINAYGVFQDIIANPSTYGFTVTNAACCGVGKNGGQ  308

Query  988   VTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             +TCLP + PC NR EY+FWDAFHPT A N ++   ++N  S+  VYP+ I
Sbjct  309   LTCLPGQGPCPNRNEYVFWDAFHPTDAANTIIAQRSYNARSSSDVYPIDI  358



>emb|CDX90202.1| BnaA08g17820D [Brassica napus]
Length=360

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 218/330 (66%), Gaps = 7/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
             VP  FIFGDSL+DNGNNN L SFA+ANY PYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  27    VPCYFIFGDSLVDNGNNNGLVSFARANYFPYGIDFGG-PTGRFSNGRTTVDEIAELLGFN  85

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I AY  S    Q+  GVNYASAAAGI D TG+    RI F+ Q+ N++ T  Q+ + L
Sbjct  86    DYIPAY-NSVRGRQILTGVNYASAAAGIRDETGRQLGQRISFSGQVRNYQNTVQQVVSLL  144

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
                  A D L + I+ VGMGSNDYLNNYFMP  Y +S  + P Q+A+ L+ +Y+ QL  L
Sbjct  145   GGATQAADYLKRCIYSVGMGSNDYLNNYFMPTFYSSSRQFTPEQYANDLISRYSTQLNAL  204

Query  691   ytlGARKFVLTGIGKMGCIPTMLARA-DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             Y  GARKF L GIG +GC P  LAR+ D+  C E +N A   FN+ ++ ++++ +  HPD
Sbjct  205   YNYGARKFALIGIGAIGCSPNALARSRDSRTCDERINSANQIFNSKLRSLVDQLNNNHPD  264

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF +I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC +R  Y+FWD
Sbjct  265   AKFTYINAYDIFQDMIKNPSRFGFRVTNAGCCGIGRNAGQITCLPGQRPCRDRNAYVFWD  324

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A N+++   ++   S    YPM I
Sbjct  325   AFHPTEAANIVIARRSYKAESPSDAYPMDI  354



>ref|XP_011095134.1| PREDICTED: GDSL esterase/lipase At1g71250 [Sesamum indicum]
Length=386

 Score =   304 bits (778),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 222/328 (68%), Gaps = 7/328 (2%)
 Frame = +1

Query  169   MFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIA  348
             +F+FGDSL+DNGNNN L S AK+NY PYG+D N  PTGRFSNG T VD +   LG+    
Sbjct  51    LFVFGDSLVDNGNNNFLNSIAKSNYYPYGVDSNRGPTGRFSNGDTFVDYLGAWLGIAAPP  110

Query  349   AYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSA  522
              +   PS    R   GVNYASAAAGILD TGQH+  R   ++Q+ NFE T +QL   +S 
Sbjct  111   PF-SDPSTTGTRILGGVNYASAAAGILDETGQHYGERYSLSQQVLNFESTLSQLRTMISG  169

Query  523   DVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytl  699
               ++K L+K+I  +  GSNDY+NNY +P  YP+SF Y+P+QFA+ L+  Y +QL  LY+L
Sbjct  170   ANLSKYLSKAIAILVFGSNDYINNYLLPAMYPSSFNYNPSQFANLLLNHYARQLVALYSL  229

Query  700   GARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMINKFST-THPDA  870
             G RKFV+ G G +GCIP +LA  +A  G C++ VNQ + PFN  +  ++N  +  THP +
Sbjct  230   GLRKFVVAGTGPLGCIPNVLATGQAPPGRCVDYVNQILGPFNQGLLSLVNIMNNGTHPGS  289

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
              FV+ +T      I+NN +RYGF V DRGCCG+G+N G +TC+P+  PCSNR +Y+FWDA
Sbjct  290   MFVYGNTYGAIGDILNNPERYGFKVVDRGCCGIGRNQGVITCMPWVPPCSNRNQYVFWDA  349

Query  1051  FHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FHPT AV+ +L + A+ G    V+P+ +
Sbjct  350   FHPTQAVDAILAHRAYAGPPTDVHPINV  377



>dbj|BAB56037.1| putative proline-rich protein [Oryza sativa Japonica Group]
 gb|EAY75815.1| hypothetical protein OsI_03729 [Oryza sativa Indica Group]
 gb|EAZ13534.1| hypothetical protein OsJ_03450 [Oryza sativa Japonica Group]
Length=363

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/330 (50%), Positives = 217/330 (66%), Gaps = 5/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  F+FGDSL+DNGNNNN+ S A+ANY PYG+DF    TGRFSNG T  D+I++ LG  
Sbjct  28    VPCYFVFGDSLVDNGNNNNIASMARANYPPYGVDFPGGATGRFSNGLTTADAISRLLGFD  87

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      + +Q+  GVN+ASAAAGI D TGQ    RI F+ Q+ N++    QL + L 
Sbjct  88    DYIPPYAGATSEQLLTGVNFASAAAGIRDDTGQQLGERISFSAQLQNYQAAVRQLVSILG  147

Query  520   A-DVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L++ IF VGMGSNDYLNNYFMP  YPTS  Y P Q+A  L+ QY QQL  LY
Sbjct  148   GEDAAANRLSQCIFTVGMGSNDYLNNYFMPAFYPTSRQYTPEQYADVLINQYAQQLRTLY  207

Query  694   tlGARKFVLTGIGKMGCIPTMLAR-ADNG-ECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK  + G+G++GC P  LA+ + NG  C+E +N AV  FN  V  ++N+F+   P 
Sbjct  208   NYGARKVAVFGVGQVGCSPNELAQNSRNGVTCIERINSAVRMFNRRVVVLVNQFNRLLPG  267

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +F+ IM     +G +V +RGCCGVG+N+G+VTCLP++ PC+NR EYLFWD
Sbjct  268   ALFTYINCYGIFESIMRTPVEHGLAVTNRGCCGVGRNNGQVTCLPYQAPCANRDEYLFWD  327

Query  1048  AFHPTSAVNVLLGNLAFNGS-NYLVYPMTI  1134
             AFHPT A N+ +G  A++ +    VYP+ +
Sbjct  328   AFHPTEAANIFVGRRAYSAAMRSDVYPVDL  357



>ref|XP_009612511.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Nicotiana tomentosiformis]
Length=367

 Score =   303 bits (775),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 221/327 (68%), Gaps = 6/327 (2%)
 Frame = +1

Query  133   FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             + G   +  VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGID+   PTGRFSNG T VD
Sbjct  23    YYGAKGDPQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDYPGGPTGRFSNGKTTVD  82

Query  313   SIAKQLGLP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEK  489
              IA+ LG    I  Y  +   D +R GVNYASAAAGI + TGQ    RI F  Q++N+  
Sbjct  83    VIAELLGFEDYIPPYAAARGEDILR-GVNYASAAAGIREETGQQLGARISFAAQVNNYRN  141

Query  490   TKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvq  663
             T  Q+   L   D  A  L+K I+ VG+GSNDYLNNYFMP  Y TS  ++P Q+A  L+Q
Sbjct  142   TVQQVVQILGDEDSAANYLSKCIYSVGLGSNDYLNNYFMPLYYSTSRQFNPEQYADVLIQ  201

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQM  837
             QYTQQL  LY  GARKFVL G+G++GC P  LA+   D   C +++N A   FN+ ++ +
Sbjct  202   QYTQQLKTLYDYGARKFVLIGVGQIGCSPNSLAQNSPDGKTCAQNINVANQLFNSRLRGI  261

Query  838   INKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPC  1017
             ++ F++  PDAKF++I+   +FQ +++N   +GF V + GCCGVG+N+G++TCLP + PC
Sbjct  262   VDDFNSNTPDAKFIYINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPC  321

Query  1018  SNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
              NR EYLFWDAFHP  A NV++G  ++
Sbjct  322   PNRDEYLFWDAFHPGEAANVIVGRRSY  348



>ref|XP_010499477.1| PREDICTED: GDSL esterase/lipase At1g29670 [Camelina sativa]
Length=363

 Score =   302 bits (774),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 162/331 (49%), Positives = 219/331 (66%), Gaps = 5/331 (2%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A VP  F+FGDSL+DNGNNN L SFA+ANY PYGIDF   PTGRFSNG T VD IA+ LG
Sbjct  28    AQVPCFFVFGDSLVDNGNNNGLVSFARANYFPYGIDFGG-PTGRFSNGKTTVDEIAELLG  86

Query  334   LPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
                      S S  Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+   
Sbjct  87    FNGYIPAYNSVSGRQILSGVNYASAAAGIREETGRQLGQRISFSGQVRNYQSTVSQVVQL  146

Query  514   LSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
             L  +  A D L + I+ VG+GSNDYLNNYFMP  Y +S  + P Q+A  L+ +Y+ QL  
Sbjct  147   LGDETRAADYLKRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQYADDLISRYSTQLNA  206

Query  688   lytlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHP  864
             LY  GARKF L+G+G +GC P  LA + +G  C+E +N A   FN  +K ++++ +  HP
Sbjct  207   LYNYGARKFALSGVGAVGCSPNALAGSRDGRTCVERINSANQIFNNKLKSLVDQLNNNHP  266

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC+NR  Y+ W
Sbjct  267   DAKFIYINAYGIFQDMITNPARFGFRVTNAGCCGIGRNAGQITCLPGQRPCNNRNAYVCW  326

Query  1045  DAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             D+FHPT A NV++   ++N  S    YPM I
Sbjct  327   DSFHPTEAANVIIARRSYNAQSPSDAYPMDI  357



>ref|XP_002871339.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47598.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   303 bits (776),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 220/336 (65%), Gaps = 10/336 (3%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDF-NNNPTGRFSNGYTIVDSIAKQL  330
             A+ PAMF+FGDSL+DNGNNN+L S A++NYLPYGIDF  N PTGRFSNG TIVD + + L
Sbjct  43    AMFPAMFVFGDSLVDNGNNNHLNSLARSNYLPYGIDFAGNQPTGRFSNGKTIVDFMGELL  102

Query  331   GLPMIAAYLESPS--IDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
             GLP I A++++    +D ++ GVNYASAA GIL+ TG+H   R     Q++NFEKT  ++
Sbjct  103   GLPEIPAFMDTVDGGVDILQ-GVNYASAAGGILEETGRHLGERFSMGRQVENFEKTLMEI  161

Query  505   SANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqql  681
             S ++  + V + + KS+  V +G+NDY+NNY  P  + TS  YDP  FA  L+   T  L
Sbjct  162   SRSMRRESVKEYMAKSLVVVSLGNNDYINNYLKPTLFLTSSIYDPTSFADLLLSNSTTHL  221

Query  682   trlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKF--  849
               LY  G RKFV+ G+G +GCIP  LA   A  GEC+E+VN+    FN  +  ++++   
Sbjct  222   LELYGKGFRKFVIAGVGPLGCIPDQLAARAAPPGECVEAVNEMAELFNNRLVSLVDRLNS  281

Query  850   -STTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNR  1026
              S T  +A FV+ +T      I+ N   YGF V DRGCCGVG+N GE+TCLP   PC+ R
Sbjct  282   DSKTASEAIFVYGNTYGAAVDILTNPFNYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFR  341

Query  1027  QEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
               ++FWDAFHPT A N+++   AFNGS    YP+ +
Sbjct  342   DRHVFWDAFHPTQAFNLIIALRAFNGSKSDCYPINL  377



>ref|XP_009351953.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At5g45670-like 
[Pyrus x bretschneideri]
Length=365

 Score =   302 bits (774),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 170/349 (49%), Positives = 231/349 (66%), Gaps = 8/349 (2%)
 Frame = +1

Query  106   VLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGR  285
             V+  A ++ +SG      VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGR
Sbjct  13    VVVLAVSMWWSGARAEXQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFGG-PTGR  71

Query  286   FSNGYTIVDSIAKQLGLP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPF  462
             FSNG T VD +A+ LG    I  Y  +   D ++ GVN+ASAAAGI + TG+   GRI F
Sbjct  72    FSNGKTTVDVVAELLGFDDFIPPYATARGQDVLK-GVNFASAAAGIREETGRQLGGRITF  130

Query  463   NEQIDNFEKTKNQLSANLSA-DVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDP  636
             + Q+ N++ T +Q+   L   D  A  L+K I+ VG+GSNDYLNNYFMP  Y T+  + P
Sbjct  131   SGQVKNYQNTVSQVVNLLGGEDQAANYLSKCIYSVGLGSNDYLNNYFMPQFYNTANQFTP  190

Query  637   NQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVL  810
              Q+A +L+  Y+QQL  LY  GARK VL GIG++GC P+ LA+   D   C++ +N A  
Sbjct  191   EQYADSLIHDYSQQLRILYNYGARKVVLFGIGQVGCSPSELAQNSPDGSTCVQKINSANQ  250

Query  811   PFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEV  990
              FN  +K + N+F+T   DA+F+F+DT  +FQ I+++  +YGF V + GCCGVG+N+G++
Sbjct  251   IFNGKLKALANEFNTNLADARFIFVDTYGIFQDIISSPAQYGFRVTNAGCCGVGRNNGQI  310

Query  991   TCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             TCLP +TPC NR+EYLFWDAFHPT A N ++    ++       YP+ I
Sbjct  311   TCLPLQTPCQNRKEYLFWDAFHPTEAGNAVIARRGYSAVRASDAYPIDI  359



>ref|XP_008371536.1| PREDICTED: GDSL esterase/lipase At5g45670 [Malus domestica]
Length=365

 Score =   302 bits (774),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 170/343 (50%), Positives = 229/343 (67%), Gaps = 8/343 (2%)
 Frame = +1

Query  124   TLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYT  303
             ++ +SG      VP  FIFGDSL+DNGNNN L S A+ANYLPYGIDF   PTGRFSNG T
Sbjct  19    SMWWSGARAEPQVPCYFIFGDSLVDNGNNNQLQSLARANYLPYGIDFGG-PTGRFSNGKT  77

Query  304   IVDSIAKQLGLP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDN  480
              VD +A+ LG    I  Y  +   D ++ GVN+ASAAAGI + TG+   GRI F+ Q+ N
Sbjct  78    TVDVVAELLGFDDFIPPYATARGQDVLK-GVNFASAAAGIREETGRQLGGRITFSGQVKN  136

Query  481   FEKTKNQLSANLSA-DVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFASt  654
             ++ T +Q+   L   D  A  L+K I+ VG+GSNDYLNNYFMP  Y T+  + P Q+A +
Sbjct  137   YQNTVSQVVNLLXGEDQAANYLSKCIYSVGLGSNDYLNNYFMPQFYNTANQFTPEQYADS  196

Query  655   lvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANV  828
             L+  Y+QQL  LY  GARK VL GIG++GC P+ LA+   D   C++ +N A   FN+ +
Sbjct  197   LIHDYSQQLRILYNYGARKVVLFGIGQVGCSPSELAQNSPDGSTCVQKINSANQIFNSKL  256

Query  829   KQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFE  1008
             K + N+F+T   DA+F+F+DT  +FQ I+++  +YGF V + GCCGVG+N+G++TCLPF+
Sbjct  257   KALANEFNTNLADARFIFVDTYGIFQDIISSPAQYGFRVTNAGCCGVGRNNGQITCLPFQ  316

Query  1009  TPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             TPC NR EYLFWDAFHPT A N ++    ++       YP+ I
Sbjct  317   TPCQNRNEYLFWDAFHPTEAGNAVIARRGYSAVRASDAYPIDI  359



>ref|XP_006305157.1| hypothetical protein CARUB_v10009525mg [Capsella rubella]
 gb|EOA38055.1| hypothetical protein CARUB_v10009525mg [Capsella rubella]
Length=363

 Score =   302 bits (774),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 221/331 (67%), Gaps = 5/331 (2%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A VP  F+FGDSL+DNGNNN L SFA+ANY PYGIDF   PTGRFSNG T VD IA+ LG
Sbjct  28    AQVPCFFVFGDSLVDNGNNNGLVSFARANYFPYGIDFGG-PTGRFSNGKTTVDEIAELLG  86

Query  334   LPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
                      S S  Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+   
Sbjct  87    FNGYIPAYNSVSGRQILSGVNYASAAAGIREETGRQLGQRISFSGQVRNYQNTVSQVVQL  146

Query  514   LSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
             L  +  A D L + I+ VG+GSNDYLNNYFMP  Y +S  + P Q+A+ L+ +Y+ QL  
Sbjct  147   LGDEASAADYLKRCIYSVGLGSNDYLNNYFMPNFYSSSRQFTPEQYANDLISRYSTQLNA  206

Query  688   lytlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHP  864
             LY  GARKF L+GIG +GC P  L+ + +G  C++ +N A   FN  ++ ++++ +  HP
Sbjct  207   LYNYGARKFALSGIGAIGCSPNALSGSRDGRTCVDRINSANQIFNNKLRSLVDQLNNNHP  266

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC+NR  Y+FW
Sbjct  267   DAKFIYINAYGIFQDMITNPSRFGFRVTNAGCCGIGRNAGQITCLPGQRPCNNRNAYVFW  326

Query  1045  DAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             D+FHPT A NV++   ++N  S    YPM I
Sbjct  327   DSFHPTEAANVIIARRSYNAQSPSDAYPMDI  357



>emb|CDM83980.1| unnamed protein product [Triticum aestivum]
Length=362

 Score =   302 bits (773),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 168/330 (51%), Positives = 218/330 (66%), Gaps = 7/330 (2%)
 Frame = +1

Query  136   SGEGNNA--LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIV  309
             SG G  A   VP  F+FGDSL+DNGNNN++ S A+ANY PYGIDF    TGRFSNG T V
Sbjct  18    SGPGARADPQVPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTV  77

Query  310   DSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEK  489
             D+I++ LG           + DQ+  GVN+ASAAAGI D TGQ    RI F  Q+ N++ 
Sbjct  78    DAISRLLGFDDYIPAYAGANNDQLLSGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQA  137

Query  490   TKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvq  663
                QL + L   D  A  L++ IF VGMGSNDYLNNYFMP  Y TS  Y P Q+A  LV 
Sbjct  138   AVQQLVSILGDEDSAANHLSQCIFTVGMGSNDYLNNYFMPAVYATSRQYTPEQYADVLVS  197

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQM  837
             QYTQQL  LY  GARK  L G+G++GC P  LA+  +D   C+  +N A+  FN  + ++
Sbjct  198   QYTQQLRILYNNGARKVALMGVGQVGCSPNELAQQSSDGVTCVARINGAIEIFNQKLVEL  257

Query  838   INKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPC  1017
             +++F+T  P A F +I+   +FQ I+ +    G +V D+GCCGVG+N+G+VTCLPF+TPC
Sbjct  258   VDQFNTL-PGAHFTYINAYGIFQDIIRSPGANGLTVLDKGCCGVGRNNGQVTCLPFQTPC  316

Query  1018  SNRQEYLFWDAFHPTSAVNVLLGNLAFNGS  1107
             +NR EYLFWDAFHPT A N+L+G  A++ +
Sbjct  317   ANRNEYLFWDAFHPTEAANILVGRRAYSAA  346



>dbj|BAJ85694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   302 bits (773),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 208/317 (66%), Gaps = 4/317 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  F+FGDSL+DNGNNN + S A+ANY PYG+DF   PTGRFSNG T VD I++ LG  
Sbjct  30    VPCYFVFGDSLVDNGNNNGIVSLARANYPPYGVDFAGGPTGRFSNGLTTVDVISQLLGFD  89

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      + DQ+  GVN+ASAAAGI + TGQ   GRI F+ Q+ N++    QL + + 
Sbjct  90    DFIPPFAGATSDQLLTGVNFASAAAGIREETGQQLGGRISFSGQVQNYQSAVEQLVSIMG  149

Query  520   AD-VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +   A  L++ IF VGMGSNDYLNNYFMP  Y T   Y P Q+A  L  +YT  L  LY
Sbjct  150   DEGAAANRLSQCIFTVGMGSNDYLNNYFMPAFYDTGSRYTPTQYADDLAARYTPLLRALY  209

Query  694   tlGARKFVLTGIGKMGCIPTMLA-RADNG-ECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             + GARK  L G+G++GC P  LA ++ NG  C++ +N AV  FN  +  M+++F+   P 
Sbjct  210   SYGARKVALIGVGQVGCSPNELATQSANGVACVDRINVAVRMFNQRLVGMVDQFNRLLPG  269

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+ D +F  I+     +G  V +RGCCGVG+N+G+VTCLPF+TPC NR EYLFWD
Sbjct  270   AHFTYINIDGIFSDILRAPGGHGLRVTNRGCCGVGRNNGQVTCLPFQTPCPNRNEYLFWD  329

Query  1048  AFHPTSAVNVLLGNLAF  1098
             AFHPT A NVL+G  A+
Sbjct  330   AFHPTEAANVLVGQRAY  346



>ref|XP_006399344.1| hypothetical protein EUTSA_v10016068mg [Eutrema salsugineum]
 gb|ESQ40797.1| hypothetical protein EUTSA_v10016068mg [Eutrema salsugineum]
Length=373

 Score =   302 bits (774),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 168/336 (50%), Positives = 221/336 (66%), Gaps = 12/336 (4%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNN-NPTGRFSNGYTIVDSIAKQL  330
             A+ PAMF+FGDSL+DNGNNN L S A++NYLPYGIDF+   PTGRFSNG TIVD I + +
Sbjct  35    AMFPAMFVFGDSLVDNGNNNRLNSLARSNYLPYGIDFDGGQPTGRFSNGKTIVDFIGELI  94

Query  331   GLPMIAAYLESPS--IDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
             GLP I AY+E+    +D +R GVNYASAA GIL+ TG+H   R     Q++NFEKT  ++
Sbjct  95    GLPDIPAYIETVDGGVDILR-GVNYASAAGGILEETGRHLGERFSMRRQVENFEKTLMEI  153

Query  505   SANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqql  681
             S  + +  V + + KS+  V +G+NDY+NNY  P  + TS  YDP  FA  L+  +T  L
Sbjct  154   SRGIES--VKEYMAKSLVVVSLGNNDYINNYLKPSLFLTSSIYDPPSFADLLLSNFTSHL  211

Query  682   trlytlGARKFVLTGIGKMGCIPTMLA-RA-DNGECLESVNQAVLPFNANVKQMINKFST  855
               LY  G RKFVL G+G +GCIP  LA RA   GEC+E VN+    FN  +K ++++ ++
Sbjct  212   LELYGKGFRKFVLAGVGPLGCIPDQLAARAVPPGECVEEVNEMAQLFNDRLKSLVDRLNS  271

Query  856   ---THPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNR  1026
                T  DA FV+ +T      I+ N   YGF V DRGCCGVG+N GE+TCLP   PC+ R
Sbjct  272   DNITARDAVFVYGNTYGAAVDILTNPFAYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFR  331

Query  1027  QEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
               ++FWDAFHPT A N+++   AFNGS    YP+ +
Sbjct  332   DRHVFWDAFHPTQAFNLIIALRAFNGSKSDCYPINL  367



>ref|NP_001242353.1| uncharacterized protein LOC100777335 precursor [Glycine max]
 gb|ACU17972.1| unknown [Glycine max]
Length=367

 Score =   302 bits (773),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 172/343 (50%), Positives = 226/343 (66%), Gaps = 6/343 (2%)
 Frame = +1

Query  124   TLGFSGEGNNA-LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGY  300
             +LG  G    A  VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   P+GRFSNG 
Sbjct  19    SLGLWGGVQGAPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGK  78

Query  301   TIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDN  480
             T VD+IA+ LG           S D +  GVNYASAAAGI + TGQ   GRI F  Q+ N
Sbjct  79    TTVDAIAELLGFDDYIPPYADASGDAILKGVNYASAAAGIREETGQQLGGRISFRGQVQN  138

Query  481   FEKTKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFASt  654
             ++ T +Q+   L + D  A  L+K I+ +G+GSNDYLNNYFMP  Y +S  Y  + +A  
Sbjct  139   YQNTVSQVVNLLGNEDSAANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSTDGYADV  198

Query  655   lvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANV  828
             L+Q YT+QL  LY  GARK VL GIG++GC P  LA+   D   C+E +N A   FN  +
Sbjct  199   LIQAYTEQLKTLYNYGARKMVLFGIGQIGCSPNELAQNSPDGKTCVEKINTANQIFNNKL  258

Query  829   KQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFE  1008
             K + ++F+   PDAK ++I++  +FQ I++N   YGFSV + GCCGVG+N+G++TCLP +
Sbjct  259   KGLTDQFNNQLPDAKVIYINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQ  318

Query  1009  TPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             TPC +R+EYLFWDAFHPT A NV++   A++  S    YP+ I
Sbjct  319   TPCQDRREYLFWDAFHPTEAGNVVVAQRAYSAQSASDAYPVDI  361



>gb|ABY59947.1| nectar protein 1 [Jacaranda mimosifolia]
Length=339

 Score =   301 bits (770),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/330 (50%), Positives = 217/330 (66%), Gaps = 5/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNNN+ S A+ANYLPYG+DF + PTGRFSNG T VD IA+ LG  
Sbjct  4     VPCFFIFGDSLVDNGNNNNIQSLARANYLPYGVDFPDGPTGRFSNGKTTVDVIAELLGFD  63

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                    S S DQ+  GVNYASAAAGI   TGQ    RI F  Q++N++ T  Q+   L 
Sbjct  64    DYIPPYASASGDQILRGVNYASAAAGIRSETGQQLGARIDFTGQVNNYKNTVAQVVDILG  123

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPGYPTS-FFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K I+ VG+GSNDYLNNYFMP Y +S   Y P Q++  L+QQY++Q+  LY
Sbjct  124   DEDSAANYLSKCIYSVGVGSNDYLNNYFMPLYYSSGRQYSPEQYSDLLIQQYSEQIRTLY  183

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKF L G+G++GC P  LA+   D   C+  +N A   FN  ++ ++++ +    D
Sbjct  184   NYGARKFSLIGVGQIGCSPNALAQNSPDGSTCIRRINDANQMFNNKLRALVDELNNGAQD  243

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF++I+   +FQ +++N   +GF V + GCCGVG+N+G++TCLP +TPC NR EYLFWD
Sbjct  244   AKFIYINAYGIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPMQTPCQNRDEYLFWD  303

Query  1048  AFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             AFHPT A NV++G  ++        YP  I
Sbjct  304   AFHPTEAANVVVGRRSYRAEKASDAYPFDI  333



>ref|XP_002456353.1| hypothetical protein SORBIDRAFT_03g034560 [Sorghum bicolor]
 gb|EES01473.1| hypothetical protein SORBIDRAFT_03g034560 [Sorghum bicolor]
Length=370

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 212/321 (66%), Gaps = 5/321 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  F+FGDSL+DNGNNN++ S A+ANY PYGIDF    TGRFSNG T VD+I++ LG  
Sbjct  36    VPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFAGGATGRFSNGLTTVDAISRLLGFD  95

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S DQ+  GVN+ASAAAGI D TGQ    RI F  Q+ N++    QL + L 
Sbjct  96    DYIPAYAGASGDQLLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILG  155

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L++ IF VGMGSNDYLNNYFMP  Y TS  Y P Q+A  L+ QY+QQ+  LY
Sbjct  156   DEDSAANHLSQCIFTVGMGSNDYLNNYFMPAVYSTSQQYTPAQYADVLIDQYSQQVRTLY  215

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK  L G+G++GC P  LA+  AD   C+  +N A+  FN  +  ++++F+   P 
Sbjct  216   NYGARKVALMGVGQVGCSPNELAQHSADGATCVPEINGAIDIFNRKLVALVDQFNAL-PG  274

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +F+ I+     +G +V +RGCCGVG+N+G+VTCLPF+TPC+NR EYLFWD
Sbjct  275   AHFTYINVYGIFEDILRAPGSHGLTVTNRGCCGVGRNNGQVTCLPFQTPCANRNEYLFWD  334

Query  1048  AFHPTSAVNVLLGNLAFNGSN  1110
             AFHPT A NVL+G  A++ + 
Sbjct  335   AFHPTEAANVLVGRRAYSAAQ  355



>ref|XP_009109655.1| PREDICTED: GDSL esterase/lipase At1g29670 [Brassica rapa]
Length=361

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 218/330 (66%), Gaps = 7/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
             VP  FIFGDSL+DNGNNN L SFA+ANY PYGIDF   PTGRFSN  T VD IA+ LG  
Sbjct  28    VPCYFIFGDSLVDNGNNNGLVSFARANYFPYGIDFGG-PTGRFSNRRTTVDEIAELLGFN  86

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I AY  S    Q+  GVNYASAAAGI D TG+    RI F+ Q+ N++ T  Q+ + L
Sbjct  87    DYIPAY-NSVRGRQILTGVNYASAAAGIRDETGRQLGQRISFSGQVRNYQNTVQQVVSLL  145

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
               +  A D L + I+ VGMGSNDYLNNYFMP  Y +S  + P Q+A+ L+ +Y+ QL  L
Sbjct  146   GGETQAADYLKRCIYSVGMGSNDYLNNYFMPTFYSSSRQFTPEQYANDLISRYSTQLNAL  205

Query  691   ytlGARKFVLTGIGKMGCIPTMLARA-DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             Y  GARKF L GIG +GC P  LAR+ D+  C E +N A   FN+ ++ ++++ +  HPD
Sbjct  206   YNYGARKFALIGIGAIGCSPNALARSRDSRTCDERINSANQIFNSKLRSLVDQLNNNHPD  265

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF +I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC +R  Y+FWD
Sbjct  266   AKFTYINAYDIFQDMIKNPSRFGFRVTNAGCCGIGRNAGQITCLPGQRPCRDRNAYVFWD  325

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A N+++   ++   S    YPM I
Sbjct  326   AFHPTEAANIVIARRSYKAESPSDAYPMDI  355



>ref|XP_003546057.1| PREDICTED: GDSL esterase/lipase At1g29670 [Glycine max]
 gb|KHN06933.1| GDSL esterase/lipase [Glycine soja]
Length=364

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 227/360 (63%), Gaps = 14/360 (4%)
 Frame = +1

Query  76    FVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYG  255
             F+  I     VL     +GF+ +     VP  FIFGDSL+DNGNNN L S AKANYLPYG
Sbjct  6     FIMNIGVVAMVLGLWIRVGFAQQ-----VPCYFIFGDSLVDNGNNNQLNSLAKANYLPYG  60

Query  256   IDFNNNPTGRFSNGYTIVDSIAKQLGL-PMIAAYLESPSIDQMRYGVNYASAAAGILDFT  432
             IDF   PTGRFSNG T VD +A+ LG    I  Y  +   D +  GVNYASAAAGI + T
Sbjct  61    IDFAGGPTGRFSNGKTTVDVVAELLGFNGYIRPYARARGRDILS-GVNYASAAAGIREET  119

Query  433   GQHFMGRIPFNEQIDNFEKTKNQLSANLSAD--VVAKDLTKSIFFVGMGSNDYLNNYFMP  606
             GQ   GRI F  Q+ N+++T +Q+  NL  D    A  L+K I+ +GMGSNDYLNNYFMP
Sbjct  120   GQQLGGRISFRGQVQNYQRTVSQM-VNLLGDENTTANYLSKCIYSIGMGSNDYLNNYFMP  178

Query  607   G-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNG  777
               Y +S  + P Q+A  LVQ Y QQL  LY  GARK  L G+G++GC P  LA+   D  
Sbjct  179   LIYSSSRQFTPQQYADVLVQAYAQQLRILYKYGARKMALFGVGQIGCSPNALAQNSPDGR  238

Query  778   ECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRG  957
              C+  +N A   FN  ++ ++++ +   PDA+F++I+   +FQ I++N   YGF V + G
Sbjct  239   TCVARINSANQLFNNGLRSLVDQLNNQVPDARFIYINVYGIFQDILSNPSSYGFRVTNAG  298

Query  958   CCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             CCGVG+N+G+VTCLP +TPC  R  +LFWDAFHPT A N ++G  A+N  S    YP+ I
Sbjct  299   CCGVGRNNGQVTCLPLQTPCRTRGAFLFWDAFHPTEAANTIIGRRAYNAQSASDAYPVDI  358



>ref|XP_009769556.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Nicotiana sylvestris]
Length=367

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 220/327 (67%), Gaps = 6/327 (2%)
 Frame = +1

Query  133   FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             + G   +  VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGID+   PTGRFSNG T VD
Sbjct  23    YYGARGDPQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDYPGGPTGRFSNGKTTVD  82

Query  313   SIAKQLGLP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEK  489
              IA+ LG    I  Y  +   D +R GVNYASAAAGI + TGQ    RI F  Q++N+  
Sbjct  83    VIAELLGFEDYIPPYAAARGEDILR-GVNYASAAAGIREETGQQLGARISFAAQVNNYRN  141

Query  490   TKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvq  663
             T  Q+   L   D  A  L+K I+ VG+GSNDYLNNYFMP  Y TS  ++P Q+A  L+Q
Sbjct  142   TVQQVVQILGDEDSAANYLSKCIYSVGLGSNDYLNNYFMPLYYSTSRQFNPEQYADVLIQ  201

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQM  837
             QYTQQL  LY  GARKFVL G+G++GC P  LA+   D   C +++N A   FN  ++ +
Sbjct  202   QYTQQLKTLYDYGARKFVLIGVGQIGCSPNSLAQNSPDGKTCAQNINVANQIFNNRLRGI  261

Query  838   INKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPC  1017
             ++ F++  PDAKF++I+   +FQ +++N   +GF V + GCCGVG+N+G++TCLP + PC
Sbjct  262   VDDFNSNTPDAKFIYINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPC  321

Query  1018  SNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
              NR EYLFWDAFHP  A NV++G  ++
Sbjct  322   PNRDEYLFWDAFHPGEAANVIVGRRSY  348



>ref|NP_001149080.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACF78736.1| unknown [Zea mays]
 gb|ACF85836.1| unknown [Zea mays]
 gb|ACG32365.1| anther-specific proline-rich protein APG [Zea mays]
 gb|ACG34104.1| anther-specific proline-rich protein APG [Zea mays]
 tpg|DAA57639.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 218/330 (66%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  F+FGDSL+DNGNNN++ S A+ANY PYGIDF   PTGRFSNG T VD+I++ LG  
Sbjct  35    VPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFAAGPTGRFSNGLTTVDAISRLLGFD  94

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                      S DQ+  GVN+ASAAAGI D TGQ    RI F  Q+ N++    QL + L 
Sbjct  95    DYIPAYAGASGDQLLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILG  154

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L++ IF VGMGSNDYLNNYFMP  Y TS  Y P Q+A  L+ QY+QQL  LY
Sbjct  155   DEDSAASHLSQCIFTVGMGSNDYLNNYFMPAVYSTSQQYTPEQYADVLINQYSQQLRTLY  214

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             + GARK  L G+G++GC P  LA+   D   C+  +N A+  FN  +  ++++F+   P 
Sbjct  215   SYGARKVALMGVGQVGCSPNELAQRSTDGTTCVPQINGAIDIFNRKLVALVDQFNAL-PG  273

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +FQ I+     +G +V ++GCCGVG+N+G+VTCLPF+TPC+NR EYLFWD
Sbjct  274   AHFTYINVYGIFQDILRAPGSHGLTVTNQGCCGVGRNNGQVTCLPFQTPCANRNEYLFWD  333

Query  1048  AFHPTSAVNVLLGNLAFNGS-NYLVYPMTI  1134
             AFHPT A N+L+G  A++ +    V+PM +
Sbjct  334   AFHPTEAANILVGRRAYSAALPSDVHPMDL  363



>ref|XP_010025680.1| PREDICTED: GDSL esterase/lipase At5g08460-like [Eucalyptus grandis]
 gb|KCW62404.1| hypothetical protein EUGRSUZ_H05057 [Eucalyptus grandis]
Length=369

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 220/331 (66%), Gaps = 6/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPA F+FGDSLID+GNNN L S+AKAN+LPYG+DF+  P+GRF NG TI+D + + L LP
Sbjct  32    VPAFFVFGDSLIDDGNNNYLNSYAKANFLPYGVDFDGGPSGRFCNGKTIIDFLGELLDLP  91

Query  340   MIAAYLESPSIDQ-MRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
              I AY+ +    Q +  GVNYASAAAGILD +G+    R    +Q++NF  T +QL   +
Sbjct  92    YIPAYVNTLEDAQSILRGVNYASAAAGILDESGRELGDRFSLRQQVENFRSTLSQLKNQM  151

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               + + + L KS+  + +GSNDYLNNY MP  Y TS  ++PN +A  L+  YT  +  L+
Sbjct  152   GEEELRRYLAKSLVMMNLGSNDYLNNYLMPSLYVTSSLFNPNDYAQLLITNYTTYIEALH  211

Query  694   tlGARKFVLTGIGKMGCIPTMLARADN--GECLESVNQAVLPFNANVKQMINKF-STTHP  864
              LG RKF++TGIG +GC+P  LA   +  G+C+ SVN  V  FN  ++ ++++  +  H 
Sbjct  212   DLGLRKFLITGIGPLGCMPNQLATGADASGKCISSVNNMVGLFNVRLRSLVDQLNANAHG  271

Query  865   D-AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             + A FV+ +T  +F  I++N   YGF V DRGCCG+G+N GEV+CLP + PC NR EY+F
Sbjct  272   EGAIFVYGNTFDVFSDILSNANAYGFKVVDRGCCGLGRNQGEVSCLPLQVPCMNRDEYVF  331

Query  1042  WDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             WDAFHPT A+N ++   A+ G   + YP+ +
Sbjct  332   WDAFHPTQAMNKIIAERAYAGPPSVCYPINV  362



>ref|XP_002890825.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67084.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=363

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 222/332 (67%), Gaps = 7/332 (2%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A VP  FIFGDSL+DNGNNN L S A++NY PYGIDF   PTGRFSNG T VD IA+ LG
Sbjct  28    AQVPCYFIFGDSLVDNGNNNGLISIARSNYFPYGIDFGG-PTGRFSNGKTTVDEIAELLG  86

Query  334   L-PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
                 I AY  + S  Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+  
Sbjct  87    FNDYIPAY-NTVSGRQILSGVNYASAAAGIREETGRQLGQRISFSGQVRNYQNTVSQVVQ  145

Query  511   NLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqlt  684
              L  +  A D L + I+ VG+GSNDYLNNYFMP  Y +S  + P Q+A+ L+ +Y+ QL 
Sbjct  146   LLGDETRAADYLKRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQYANDLISRYSTQLN  205

Query  685   rlytlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTH  861
              LY  GARKF L+GIG +GC P  LA + +G  C++ +N A   FN  ++ ++++ +  H
Sbjct  206   ALYNYGARKFALSGIGAIGCSPNALAGSRDGRTCVDRINSANQIFNNKLRSLVDQLNNNH  265

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             PDAKF++I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC +R  Y+F
Sbjct  266   PDAKFIYINAYGIFQDMITNPSRFGFRVTNAGCCGIGRNAGQITCLPGQRPCRDRNAYVF  325

Query  1042  WDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             WDAFHPT A NV++   +FN  S    YPM I
Sbjct  326   WDAFHPTEAANVIIARRSFNAQSASDAYPMDI  357



>ref|XP_006449582.1| hypothetical protein CICLE_v10015686mg [Citrus clementina]
 gb|ESR62822.1| hypothetical protein CICLE_v10015686mg [Citrus clementina]
Length=366

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 221/331 (67%), Gaps = 7/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+ANYLPYGIDF N PTGRFSNG T VD IA+ LG  
Sbjct  31    VPCYFIFGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTVDVIAQLLGFD  90

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +R GVNYASAAAGI + TG+    RI F+ Q+ N++ T  Q+   L
Sbjct  91    GYIPPYSAARGQDILR-GVNYASAAAGIREETGRQLGDRISFSGQVKNYQNTVQQVVNLL  149

Query  517   -SADVVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqltrl  690
              + D  A  L++ I+ +G+GSNDYLNNYF P  Y T   Y P Q+A  L+QQYTQQL  L
Sbjct  150   GNEDQAANYLSRCIYSIGLGSNDYLNNYFQPLYYSTGRQYTPEQYADLLIQQYTQQLQAL  209

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKFVL G+G++GC P  LA+   D   C++ VN A + FN  ++ ++++F+    
Sbjct  210   YNYGARKFVLIGVGQIGCSPNQLAQNSPDGRTCVQRVNDANVIFNNKLRGLVDQFNNNDS  269

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++I+   +FQ I  N  RYGF V + GCCGVG+N+G++TCLP + PC NR+EY+FW
Sbjct  270   DAKFIYINAYGIFQDITANPARYGFRVTNTGCCGVGRNNGQITCLPLQNPCPNRREYVFW  329

Query  1045  DAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             DAFHPT A N ++   +++  S    YP+ I
Sbjct  330   DAFHPTEAANTIIATRSYSAQSPSDAYPIDI  360



>ref|XP_011102152.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Sesamum indicum]
Length=360

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 220/330 (67%), Gaps = 11/330 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGIDF + PTGRFSNG T VD IA+ LG  
Sbjct  31    VPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDFPDGPTGRFSNGKTTVDVIAELLGFD  90

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                 Y+     +Q+  GVNYASAAAGI   TGQ    RI F  Q++N++ T  Q+   L 
Sbjct  91    ---DYIPG---EQILRGVNYASAAAGIRSETGQQLGARIDFTGQVNNYKDTVEQVVNILG  144

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K I+ +G+GSNDYLNNYFMP  Y TS  Y P Q+A  L+QQY+QQ+  LY
Sbjct  145   DEDSAANYLSKCIYSIGVGSNDYLNNYFMPLYYSTSRQYSPEQYADILIQQYSQQIRTLY  204

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKF L G+G++GC P  LA+   D   C++ +N A   FN  ++ ++++F++   D
Sbjct  205   NYGARKFALIGVGQIGCSPNALAQNSPDGSTCVQRINGANQIFNNKLRALVDEFNSDAQD  264

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF++I+   +FQ ++ N   +GF V + GCCGVG+N+G++TCLP +TPC NR EYLFWD
Sbjct  265   AKFIYINAYGIFQDLIENPSAFGFRVTNAGCCGVGRNNGQITCLPLQTPCQNRDEYLFWD  324

Query  1048  AFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             AFHPT A N+++G  +++       YP  I
Sbjct  325   AFHPTEAANIIVGRRSYSAQKASDAYPFDI  354



>ref|XP_006355561.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Solanum tuberosum]
Length=368

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 165/322 (51%), Positives = 221/322 (69%), Gaps = 6/322 (2%)
 Frame = +1

Query  148   NNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQ  327
             N   VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGID+ + PTGRFSNG T VD IA+ 
Sbjct  29    NAQQVPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDYPDGPTGRFSNGKTTVDVIAEL  88

Query  328   LGL-PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
             LG    I  Y  +   D ++ GVNYASAAAGI + TGQ    RI F  Q++N+  T  Q+
Sbjct  89    LGFDDYIPPYASARGEDILK-GVNYASAAAGIREETGQQLGARITFGGQVNNYRNTVQQV  147

Query  505   SANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqq  678
                L  +  A + L+K I+ +G+GSNDYLNNYFMP  Y TS  ++P+Q+A  L+QQYTQQ
Sbjct  148   VQILGDENSAANYLSKCIYSIGLGSNDYLNNYFMPQYYSTSRQFNPDQYADVLIQQYTQQ  207

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFS  852
             L  LY  GARKFVL G+G++GC P  LA+   D   C E++N A   FN  +K ++++F+
Sbjct  208   LKSLYDYGARKFVLIGVGQIGCSPNSLAQNSPDGRTCAENINNANKLFNNRLKGIVDEFN  267

Query  853   TTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
                PDAKF++I+   +FQ +++N   +GF V + GCCGVG+N+G++TCLP + PC NR E
Sbjct  268   GNTPDAKFIYINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCQNRDE  327

Query  1033  YLFWDAFHPTSAVNVLLGNLAF  1098
             YLFWDAFHP  A N+++G  ++
Sbjct  328   YLFWDAFHPGEAANIVVGRRSY  349



>ref|XP_002305046.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE85557.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=367

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 171/371 (46%), Positives = 233/371 (63%), Gaps = 20/371 (5%)
 Frame = +1

Query  43    VFSALFILALVF-VSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNL  219
             V    +++ ++F V  ++EP    AQ              VP  FIFGDSL+DNGNNN L
Sbjct  4     VLKKCWVVGVIFAVVLLSEPYGARAQQ-------------VPGYFIFGDSLVDNGNNNQL  50

Query  220   FSFAKANYLPYGIDFNN-NPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVN  396
              S A+A+YLPYGIDF    PTGRF NG T VD IA+QLG         +     +  GVN
Sbjct  51    SSLARADYLPYGIDFRPPRPTGRFCNGRTTVDVIAEQLGFRNYIPPYATARGRAILGGVN  110

Query  397   YASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-SADVVAKDLTKSIFFVGMG  573
             YASAAAGI D TGQ    RI F+ Q+ N++ T +Q+   L   D  A  L++ IF +G+G
Sbjct  111   YASAAAGIRDETGQQLGDRISFSGQVRNYQNTVSQIVNILGDEDTAANYLSRCIFSIGLG  170

Query  574   SNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIP  750
             SNDYLNNYFMP  Y +S  Y P Q+A+ L+QQYT QL  LY  GARKFVL G+G++GC P
Sbjct  171   SNDYLNNYFMPQIYSSSRQYTPEQYANVLIQQYTDQLKILYNYGARKFVLIGVGQIGCSP  230

Query  751   TMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNN  924
             + LA+   D   C++ +N A   FN  ++ ++ +F+   PDA+F++I+   +FQ I+N  
Sbjct  231   SQLAQNSPDGRTCVQKINSANQIFNNKLRSLVAQFNGNTPDARFIYINAYGIFQDIINRP  290

Query  925   KRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG  1104
               +GF+V + GCCGVG+N+G++TCLP + PC NR +Y+FWDAFHPT A NV++G  +++ 
Sbjct  291   ATFGFTVTNAGCCGVGRNNGQITCLPLQNPCRNRDQYVFWDAFHPTEAANVIIGRRSYSA  350

Query  1105  -SNYLVYPMTI  1134
              S    YP  I
Sbjct  351   QSASDAYPFDI  361



>emb|CDY62118.1| BnaCnng39210D [Brassica napus]
Length=375

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 168/336 (50%), Positives = 222/336 (66%), Gaps = 11/336 (3%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNN-NPTGRFSNGYTIVDSIAKQL  330
             A+ PAMF+FGDSL+DNGNNN L S A++NYLPYGIDF+   PTGRFSNG TIVD I + L
Sbjct  36    AMFPAMFVFGDSLVDNGNNNRLNSLARSNYLPYGIDFDGGQPTGRFSNGKTIVDFIGELL  95

Query  331   GLPMIAAYLES--PSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
             GLP I A++E+    +D +R GVNYASAA GIL+ TG+H   R     Q++NF+KT  ++
Sbjct  96    GLPDIPAFMETMDGGVDVLR-GVNYASAAGGILEETGRHLGERFSMRRQVENFDKTLMEI  154

Query  505   SANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqql  681
             S  + + V  + + KS+  V +G+NDY+NNY  P  + TS  Y+P  FA  LV  +T  L
Sbjct  155   SRGIGSSV-TEYMAKSLVVVSLGNNDYINNYLKPSLFLTSSIYNPTSFADLLVSNFTSNL  213

Query  682   trlytlGARKFVLTGIGKMGCIPTMLA-RA-DNGECLESVNQAVLPFNANVKQMINKFST  855
               LY  G RKFVL G+G +GCIP  LA RA   GEC+ESVN+    FN  +K ++++ ++
Sbjct  214   LELYDKGFRKFVLAGVGPLGCIPDQLAARAVPPGECVESVNEMAELFNNRLKSLVDRLNS  273

Query  856   ---THPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNR  1026
                T  DA FV+ +T      I+ N   YGF V DRGCCGVG+N GE+TCLP   PC+ R
Sbjct  274   DNKTGRDAIFVYGNTYGAAVDILTNPIDYGFEVTDRGCCGVGRNGGEITCLPLAVPCAFR  333

Query  1027  QEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
               ++FWDAFHPT A N+++   AFNGS    YP+ +
Sbjct  334   DRHVFWDAFHPTQAFNLIIALRAFNGSKSDCYPINL  369



>ref|XP_006471326.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Citrus sinensis]
Length=366

 Score =   300 bits (769),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 168/331 (51%), Positives = 221/331 (67%), Gaps = 7/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+ANYLPYGIDF N PTGRFSNG T VD IA+ LG  
Sbjct  31    VPCYFIFGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTVDVIAQLLGFD  90

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +R GVNYASAAAGI + TG+    RI F+ Q+ N++ T  Q+   L
Sbjct  91    GYIPPYSAARGQDILR-GVNYASAAAGIREETGRQLGDRISFSGQVKNYQNTVQQVVNLL  149

Query  517   -SADVVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqltrl  690
              + D  A  L++ I+ +G+GSNDYLNNYF P  Y T   Y P Q+A  L+QQYTQQL   
Sbjct  150   GNEDQAANYLSRCIYSIGLGSNDYLNNYFQPLYYSTGRQYTPEQYADLLIQQYTQQLQAF  209

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKFVL G+G++GC P  LA+   D   C++ VN A + FN  ++ ++++F+  + 
Sbjct  210   YNYGARKFVLIGVGQIGCSPNQLAQNSPDGRTCVKRVNDANVIFNNKLRGLVDQFNNNNS  269

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++I+   +FQ I  N  RYGF V + GCCGVG+N+G++TCLP + PC NR+EY+FW
Sbjct  270   DAKFIYINAYGIFQDITANPARYGFRVTNTGCCGVGRNNGQITCLPLQNPCPNRREYVFW  329

Query  1045  DAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             DAFHPT A N ++   +++  S    YP+ I
Sbjct  330   DAFHPTEAANTIIATRSYSAQSPSDAYPIDI  360



>ref|NP_196463.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FNP2.1|GDL75_ARATH RecName: Full=GDSL esterase/lipase At5g08460; AltName: Full=Extracellular 
lipase At5g08460; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09995.1| GDSL-motif lipase/acylhydrolase-like protein [Arabidopsis thaliana]
 gb|AED91306.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score =   301 bits (771),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 222/336 (66%), Gaps = 10/336 (3%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDF-NNNPTGRFSNGYTIVDSIAKQL  330
             A+ PAMF+FGDSL+DNGNNN+L S A++NYLPYGIDF  N PTGRFSNG TIVD I + L
Sbjct  45    AMFPAMFVFGDSLVDNGNNNHLNSLARSNYLPYGIDFAGNQPTGRFSNGKTIVDFIGELL  104

Query  331   GLPMIAAYLESPS--IDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
             GLP I A++++    +D + +GVNYASAA GIL+ TG+H   R     Q++NFEKT  ++
Sbjct  105   GLPEIPAFMDTVDGGVDIL-HGVNYASAAGGILEETGRHLGERFSMGRQVENFEKTLMEI  163

Query  505   SANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqql  681
             S ++  + V + + KS+  V +G+NDY+NNY  P  + +S  YDP  FA  L+  +T  L
Sbjct  164   SRSMRKESVKEYMAKSLVVVSLGNNDYINNYLKPRLFLSSSIYDPTSFADLLLSNFTTHL  223

Query  682   trlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFST  855
               LY  G RKFV+ G+G +GCIP  LA   A  GEC+E+VN+    FN  +  ++++ ++
Sbjct  224   LELYGKGFRKFVIAGVGPLGCIPDQLAAQAALPGECVEAVNEMAELFNNRLVSLVDRLNS  283

Query  856   ---THPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNR  1026
                T  +A FV+ +T      I+ N   YGF V DRGCCGVG+N GE+TCLP   PC+ R
Sbjct  284   DNKTASEAIFVYGNTYGAAVDILTNPFNYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFR  343

Query  1027  QEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
               ++FWDAFHPT A N+++   AFNGS    YP+ +
Sbjct  344   DRHVFWDAFHPTQAFNLIIALRAFNGSKSDCYPINL  379



>gb|EYU28141.1| hypothetical protein MIMGU_mgv1a008629mg [Erythranthe guttata]
Length=367

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 216/320 (68%), Gaps = 4/320 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNNN+ S AKANYLPYG DF   PTGRFSNG T VD +A+ LG  
Sbjct  32    VPCYFIFGDSLVDNGNNNNIQSLAKANYLPYGTDFPQGPTGRFSNGKTTVDVVAELLGFD  91

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    +   +Q+  GVNYASAAAGI   TGQ    RI F+ QI+N++ T  Q+   L 
Sbjct  92    DYIPPYATARGEQILRGVNYASAAAGIRQETGQQLGARIDFSAQINNYKNTVAQVVDILG  151

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L K I+ VG+GSNDYLNNYFMP Y  TS  Y P Q+A  L++QY++Q+  LY
Sbjct  152   DENTAADYLRKCIYSVGVGSNDYLNNYFMPNYYSTSRQYTPQQYADVLIRQYSEQIRTLY  211

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKF L GIG++GC P  LA+   D   C++ +N A   FN+ ++ ++++F++   D
Sbjct  212   NYGARKFALNGIGQIGCSPNALAQNSPDGVTCVQRINGANQIFNSRLRSLVDEFNSNSQD  271

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F++++   +FQ +++N   +GF V + GCCGVG+N+G++TCLPF+  C NR EY+FWD
Sbjct  272   AQFIYLNAYDVFQDLIDNPSSFGFRVSNAGCCGVGRNNGQITCLPFQNSCQNRDEYVFWD  331

Query  1048  AFHPTSAVNVLLGNLAFNGS  1107
             AFHPT A N+++G  A++  
Sbjct  332   AFHPTEAANIIVGRRAYSAE  351



>ref|XP_006467574.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Citrus sinensis]
Length=366

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 221/331 (67%), Gaps = 7/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+ANYLPYGIDF N PTGRFSNG T VD IA+ LG  
Sbjct  31    VPCYFIFGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTVDVIAQLLGFD  90

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +R GVNYASAAAGI + TG+    RI F+ Q+ N++ T  Q+   L
Sbjct  91    GYIPPYSAARGQDILR-GVNYASAAAGIREETGRQLGDRISFSGQVKNYQNTVQQVVNLL  149

Query  517   -SADVVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqltrl  690
              + D  A  L++ I+ +G+GSNDYLNNYF P  Y T   Y P Q+A  L+QQYTQQL  L
Sbjct  150   GNQDQAANYLSRCIYSIGLGSNDYLNNYFQPLYYSTGRQYTPEQYADLLIQQYTQQLQAL  209

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKFVL G+G++GC P  LA+   D   C++ VN A + FN  ++ ++++F+    
Sbjct  210   YNYGARKFVLIGVGQIGCSPNQLAQNSPDGRTCVKRVNDANVIFNNKLRGLVDQFNNNDS  269

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++I+   +FQ I  N  RYGF V + GCCGVG+N+G++TCLP + PC NR+EY+FW
Sbjct  270   DAKFIYINAYGIFQDITANPARYGFRVTNTGCCGVGRNNGQITCLPLQNPCPNRREYVFW  329

Query  1045  DAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             DAFHPT A N ++   +++  S    YP+ I
Sbjct  330   DAFHPTEAANTIIATRSYSAQSPSDAYPIDI  360



>ref|XP_009102833.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Brassica rapa]
Length=360

 Score =   300 bits (768),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 215/329 (65%), Gaps = 5/329 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L SFA+ANY PYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  27    VPCYFIFGDSLVDNGNNNGLVSFARANYFPYGIDFGG-PTGRFSNGKTTVDEIAELLGFK  85

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    + S  Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T  Q+ + L 
Sbjct  86    DYIPAYNTVSGRQILTGVNYASAAAGIREETGRQLGQRISFSGQVRNYQTTVQQVVSVLG  145

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L K I+ VG+GSNDYLNNYFMP  Y +S  + P QFA  L+ +YT QL  LY
Sbjct  146   GEAQAADYLKKCIYSVGIGSNDYLNNYFMPTFYSSSRQFTPEQFADDLISRYTTQLNALY  205

Query  694   tlGARKFVLTGIGKMGCIPTMLARA-DNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
               GARKF L G+G +GC P  L+R+ D+  C + +N A   FN  ++ M+++ +  HPDA
Sbjct  206   NYGARKFALIGVGAIGCSPNALSRSRDSKTCDDRINSANQIFNNKLRSMVDQLNNNHPDA  265

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             +F +I+   +FQ ++ N  R+GF+  + GCCG+G+N+G++TCLP + PC NR  Y+FWDA
Sbjct  266   RFTYINAYGIFQDMITNPSRFGFTTTNAGCCGIGRNAGQITCLPGQRPCGNRNAYVFWDA  325

Query  1051  FHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             FHPT A NV++   ++   S    YP+ I
Sbjct  326   FHPTEAANVVIARRSYTAQSPSDAYPIDI  354



>ref|XP_006441809.1| hypothetical protein CICLE_v10023910mg [Citrus clementina]
 gb|ESR55049.1| hypothetical protein CICLE_v10023910mg [Citrus clementina]
Length=366

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 222/337 (66%), Gaps = 7/337 (2%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G   + +V  +F+FGDSL+D GNNN L S AK+NY PYG+DF   PTGRFSNG T VD I
Sbjct  26    GVAESQVVRGIFVFGDSLVDVGNNNYLSSIAKSNYYPYGVDFEYGPTGRFSNGKTFVDFI  85

Query  319   AKQLGLPMIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKT  492
              K +GLP   A+ + P+ +  R   GV+YASAAAGILD TGQH+  R   ++Q+ NFE T
Sbjct  86    GKIMGLPYPLAFAD-PNTNGARLLGGVDYASAAAGILDETGQHYGQRYTLSQQVLNFEST  144

Query  493   KNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqy  669
              NQL   + A  +   L+KSI  +  GSNDY+NNY MP  Y +SF+Y+P+Q+A+ L+  Y
Sbjct  145   LNQLRGIMGASNLTNYLSKSIAIMVFGSNDYINNYLMPSIYSSSFYYNPSQYANLLLNHY  204

Query  670   tqqltrlytlGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMIN  843
              +QL  LY++G RKF L GIG +GCIP      +A  G C++ VNQ + PFN  ++ +++
Sbjct  205   ARQLLALYSVGLRKFFLAGIGPLGCIPNQRGSGQAPPGRCVDYVNQILGPFNEGLRSLVD  264

Query  844   KFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSN  1023
             + +   P A FV+ +T      I+NN   +GF+V DR CCG+G+N G++TCLPF  PC N
Sbjct  265   QLNK-RPGAMFVYGNTYGAVGDILNNPATFGFNVVDRACCGIGRNQGQITCLPFAMPCFN  323

Query  1024  RQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             R +Y+FWDAFHPT AVN +L   A  GS+   YP+ +
Sbjct  324   RNQYVFWDAFHPTEAVNAILARRAIYGSSADCYPINM  360



>ref|XP_004969944.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Setaria italica]
Length=366

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 211/320 (66%), Gaps = 5/320 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  F+FGDSL+DNGNNN++ S A+ANY PYGIDF    TGRFSNG T VD+I++ LG  
Sbjct  32    VPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTVDAISRLLGFD  91

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S DQ+  GVN+ASAAAGI D TGQ    RI F  Q+ N++    QL + L 
Sbjct  92    DYIPAYAGASNDQLLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILG  151

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L++ IF VGMGSNDYLNNYFMP  Y TS  Y P Q+A  L  QY+QQL  LY
Sbjct  152   DEDSAANHLSQCIFTVGMGSNDYLNNYFMPAVYSTSQQYTPEQYADALAGQYSQQLRTLY  211

Query  694   tlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK  L G+G++GC P  LA+   D   C+  +N A+  FN  +  ++++F+   P 
Sbjct  212   NYGARKVALMGVGQVGCSPNELAQRSPDGATCVSEINAAIDIFNRRLVALVDQFNAL-PG  270

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +F+ I+ +   +G +V +RGCCGVG+N+G+VTCLPF+TPC+NR EYLFWD
Sbjct  271   AHFTYINAYGIFEDILRSPGSHGLTVTNRGCCGVGRNNGQVTCLPFQTPCTNRNEYLFWD  330

Query  1048  AFHPTSAVNVLLGNLAFNGS  1107
             AFHPT A N+L+G  A++ +
Sbjct  331   AFHPTEAANILVGRRAYSAA  350



>ref|XP_006289976.1| hypothetical protein CARUB_v10003606mg [Capsella rubella]
 gb|EOA22874.1| hypothetical protein CARUB_v10003606mg [Capsella rubella]
Length=371

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 170/372 (46%), Positives = 232/372 (62%), Gaps = 18/372 (5%)
 Frame = +1

Query  49    SALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSF  228
             S+  + +L  VS     V VLA     G       A+ PAMF+FGDSL+DNGNNN+L S 
Sbjct  2     SSFTVQSLAIVSCFV-VVAVLA-----GGEDSSETAMFPAMFVFGDSLVDNGNNNHLNSL  55

Query  229   AKANYLPYGIDF-NNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSID---QMRYGVN  396
             A++NYLPYGID+  N PTGRFSNG TIVD I + LGLP I A++++  +D    +R GVN
Sbjct  56    ARSNYLPYGIDYAGNQPTGRFSNGKTIVDFIGELLGLPEIPAFMDT--VDGGVDIRRGVN  113

Query  397   YASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGS  576
             YASAA GIL+ TG+H   R     Q++NFEKT  +++     + V + + KS+  V +G+
Sbjct  114   YASAAGGILEETGRHLGERFSMGRQVENFEKTLVEITEMSRPESVKEFMAKSLVVVSLGN  173

Query  577   NDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPT  753
             NDY+NNY  P  +  S  YDP  FA  L+  +T  L  LY  G RKFV+ G+G +GCIP 
Sbjct  174   NDYINNYLKPSLFLASSIYDPTSFADLLISNFTTHLLELYGKGFRKFVIAGVGPLGCIPD  233

Query  754   MLAR--ADNGECLESVNQAVLPFNANVKQMINKFST---THPDAKFVFIDTDKMFQHIMN  918
              LA   A  GEC+E+VN+    FN+ +  ++++ ++   T  +A FV+ +T      I+ 
Sbjct  234   QLAARAAPPGECVEAVNEMAQLFNSRLVSLVDRLNSDNKTTSEAIFVYGNTYGAAVDILT  293

Query  919   NNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAF  1098
             N   YGF V DRGCCGVG+N GE+TCLP   PC+ R  ++FWDAFHPT A N+++   AF
Sbjct  294   NPFAYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDAFHPTQAFNLIIALRAF  353

Query  1099  NGSNYLVYPMTI  1134
             NGS    YP+ +
Sbjct  354   NGSKSDCYPINL  365



>ref|XP_009787100.1| PREDICTED: GDSL esterase/lipase At1g71250 [Nicotiana sylvestris]
Length=373

 Score =   300 bits (769),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 222/329 (67%), Gaps = 7/329 (2%)
 Frame = +1

Query  166   AMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMI  345
             A+++FGDSL+DNGNNN + S AK+NY PYGIDFN  PTGRFSNG T +D + + LG+   
Sbjct  37    ALWVFGDSLVDNGNNNFINSIAKSNYYPYGIDFNRGPTGRFSNGKTFIDILGELLGIASP  96

Query  346   AAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
               + + PS    R   GVNYASAAAGILD TGQH++ R P ++Q+ NFE T +QL   +S
Sbjct  97    PPFAD-PSTRGGRILGGVNYASAAAGILDETGQHYLERYPLSQQVINFESTLSQLRTMMS  155

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlyt  696
                +   L++SI  +  GSNDY+NNY MP  Y +S  Y P QFA+ L+  Y +QL  LY+
Sbjct  156   PGDLNTYLSRSIAVMVFGSNDYINNYLMPNLYTSSINYTPQQFANLLLNHYARQLVALYS  215

Query  697   lGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMINKFST-THPD  867
             +G RKF+L G+G +GCIP  LA  +A  G C++ VNQ +  FN  +K ++   +  +HP 
Sbjct  216   VGLRKFLLAGVGPLGCIPNQLATGQAPPGRCVDYVNQMLGSFNEGLKSLVASMNNGSHPG  275

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             + FV+ +T  +   I+NN  RYGF+V+DR CCGVG+N G++TC+P++ PC +R +Y+FWD
Sbjct  276   SIFVYGNTYAVIGDILNNAARYGFNVWDRACCGVGRNQGQITCMPYQFPCLDRSKYIFWD  335

Query  1048  AFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             AFHPT AV+ +L   AF+G     YP+ +
Sbjct  336   AFHPTQAVDAILAQRAFSGPPSDCYPINV  364



>ref|XP_004485963.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=367

 Score =   300 bits (767),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 167/337 (50%), Positives = 220/337 (65%), Gaps = 9/337 (3%)
 Frame = +1

Query  145   GNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAK  324
             G    VP  FIFGDSL+DNGNNN L S AKANY PYGIDF   P+GRFSNG T VD IA+
Sbjct  27    GGAQQVPCYFIFGDSLVDNGNNNQLTSLAKANYFPYGIDFPGGPSGRFSNGKTAVDVIAE  86

Query  325   QLGL-PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQ  501
              LG    I +Y  +   D ++ GVNYASAAAGI + TGQ    RI F  Q+ N+++T +Q
Sbjct  87    NLGFNSYIPSYASARGQDILK-GVNYASAAAGIREETGQQLGQRISFRGQVQNYQRTVSQ  145

Query  502   LSANLSAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqyt  672
             +  N+  D    A  L+K I+ +G+GSNDYLNNYFMP  Y +S  Y P Q+A  L+Q Y 
Sbjct  146   V-VNILGDENTAANYLSKCIYTIGLGSNDYLNNYFMPTIYSSSRQYTPQQYADALIQAYA  204

Query  673   qqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINK  846
             QQL  LY  GARK  L GIG +GC P+ LA+   D   C+  +N A   FN  +K ++++
Sbjct  205   QQLRILYNYGARKMALFGIGAIGCSPSELAQNSPDGRTCVSRINSANQLFNNGLKSLVDQ  264

Query  847   FSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNR  1026
             F+   PDA+F++I+   +FQ I+NN   YGF V + GCCG+GKN+G++TCLP + PC +R
Sbjct  265   FNNQFPDARFIYINVYDIFQDIINNPSSYGFRVTNAGCCGIGKNNGQITCLPLQAPCRDR  324

Query  1027  QEYLFWDAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             + +LFWDAFHPT A N ++G  A+N  + L  +P  I
Sbjct  325   KGFLFWDAFHPTEAGNSVIGRRAYNAQSALDAHPYDI  361



>ref|XP_009122453.1| PREDICTED: GDSL esterase/lipase At5g08460 [Brassica rapa]
 emb|CDX69951.1| BnaA10g23000D [Brassica napus]
Length=377

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 223/336 (66%), Gaps = 11/336 (3%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNN-NPTGRFSNGYTIVDSIAKQL  330
             A+ PAMF+FGDSL+DNGNNN L S A++NYLPYGIDF+   PTGRFSNG TIVD I + L
Sbjct  38    AMFPAMFVFGDSLVDNGNNNRLNSLARSNYLPYGIDFDGGQPTGRFSNGKTIVDFIGELL  97

Query  331   GLPMIAAYLES--PSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQL  504
             GLP I A++E+    ++ +R GVNYASAA GIL+ TG+H   R     Q++NF+KT  ++
Sbjct  98    GLPDIPAFMETIDGGVNVLR-GVNYASAAGGILEETGRHLGERFSMRRQVENFDKTLMEI  156

Query  505   SANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqql  681
             S  + + V  + + KS+  V +G+NDY+NNY  P  + TS  YDP  FA  LV  +T  L
Sbjct  157   SRGIGSSV-PEYMAKSLVVVSLGNNDYINNYLKPSLFLTSSIYDPTSFADLLVSNFTSNL  215

Query  682   trlytlGARKFVLTGIGKMGCIPTMLA-RA-DNGECLESVNQAVLPFNANVKQMINKFST  855
               LY  G RKFVL G+G +GCIP  LA RA   G+C+E+VN+    FN  +K ++++ ++
Sbjct  216   LELYDKGFRKFVLAGVGPLGCIPDQLAARAVPPGQCVEAVNEMAELFNNRLKSLVDRLNS  275

Query  856   ---THPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNR  1026
                T  DA FV+ +T      I+NN   YGF V DRGCCGVG+N GE+TCLP   PC+ R
Sbjct  276   DNKTGRDAIFVYGNTYGAAVDILNNPINYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFR  335

Query  1027  QEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
               ++FWDAFHPT A N+++   AFNGS    YP+ +
Sbjct  336   DRHVFWDAFHPTQAFNLIIALRAFNGSKSDCYPINL  371



>gb|AGJ83937.1| GLIP [Brassica napus]
Length=361

 Score =   300 bits (767),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 218/330 (66%), Gaps = 7/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
             VP  FIFGDSL+DNGNNN L SFA+ANYLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  28    VPCYFIFGDSLVDNGNNNGLVSFARANYLPYGIDFGG-PTGRFSNGRTTVDEIAELLGFN  86

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I AY  S    Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T  Q+ + L
Sbjct  87    DYIPAY-NSVRGRQILTGVNYASAAAGIREETGRQLGQRISFSGQVRNYQNTVQQVVSLL  145

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
               +  A D L + I+ VGMGSNDYLNNY MP  Y +S  + P Q+A+ L+ +Y+ QL  L
Sbjct  146   GGETQAADYLKRCIYSVGMGSNDYLNNYSMPTFYSSSRQFTPEQYANDLISRYSTQLNAL  205

Query  691   ytlGARKFVLTGIGKMGCIPTMLARA-DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             Y  GARKF L GIG +GC P  LAR+ D   C E +N A   FN+ ++ ++++ +  HPD
Sbjct  206   YNYGARKFALIGIGAIGCSPNALARSRDRRTCDERINSANQIFNSKLRSLVDQPNNNHPD  265

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF +I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC +R  Y+FWD
Sbjct  266   AKFTYINAYDIFQDMIKNPSRFGFRVTNAGCCGIGRNAGQITCLPGQRPCRDRNAYVFWD  325

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A N+++   ++   S    YPM I
Sbjct  326   AFHPTEAANIVIARRSYKAESPSDAYPMDI  355



>ref|XP_004154173.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Cucumis sativus]
 ref|XP_004161958.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Cucumis sativus]
Length=342

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 217/330 (66%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             V A+F+FGDSL+D GNNN L S A+ANY PYG+DF + PTGRFSNG T++D     LG+P
Sbjct  8     VSAIFVFGDSLVDVGNNNFLHSAARANYYPYGVDFTDGPTGRFSNGRTVIDMFVDMLGIP  67

Query  340   MIAAYLESP--SIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
               A    +P  S D++  GVNYASAAAGILD TG+H+  R   ++Q+ NFE T N L  +
Sbjct  68    N-APEFSNPDTSGDRILNGVNYASAAAGILDETGRHYGDRYTLSQQVVNFESTLNDLRRS  126

Query  514   LSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
             + +  + + L+KSI F+  GSNDY+NNY MP  Y T F Y+ NQFA+ L+ +Y++QL  L
Sbjct  127   MGSWNLTRYLSKSIAFLAFGSNDYINNYLMPNLYTTRFRYNSNQFANLLLNRYSRQLLAL  186

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADN--GECLESVNQAVLPFNANVKQMINKFSTTHP  864
              ++G +K V+ G+G +GCIP   A      G C + VN+ +  FN  +K ++ + ++ +P
Sbjct  187   QSVGVKKLVIAGLGPLGCIPNQRATGVTLPGRCADKVNEMLGAFNEGLKSLVTQLNSQYP  246

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             D KFV+ +   +F  I+NN + YGFSV D  CCGVG N G++TCLP + PC NR EY+FW
Sbjct  247   DTKFVYTNIYGIFGDILNNPETYGFSVVDTACCGVGLNRGQITCLPLQFPCLNRNEYVFW  306

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             DAFHPT A + +L   AF G     YP+ +
Sbjct  307   DAFHPTEAASYILAGRAFRGPPSDSYPINV  336



>gb|KDO51376.1| hypothetical protein CISIN_1g036887mg [Citrus sinensis]
Length=366

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 221/337 (66%), Gaps = 7/337 (2%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G   + +V  +F+FGDSL+D GNNN L S AK+NY PYG+DF   PTGRFSNG T VD I
Sbjct  26    GVAESQVVRGIFVFGDSLVDVGNNNYLSSIAKSNYYPYGVDFEYGPTGRFSNGKTFVDFI  85

Query  319   AKQLGLPMIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKT  492
              K +GLP   A+ + P+ +  R   GVNYASAAAGILD TGQH+  R   ++Q+ NFE T
Sbjct  86    GKIMGLPYPLAFAD-PNTNGARLLGGVNYASAAAGILDETGQHYGQRYTLSQQVLNFEST  144

Query  493   KNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqy  669
              NQL   + A  +   L+KSI  +  GSNDY+NNY MP  Y +SF+Y+P+Q+A+ L+  Y
Sbjct  145   LNQLRGIMGASNLTNYLSKSIAIMVFGSNDYINNYLMPSIYSSSFYYNPSQYANLLLNHY  204

Query  670   tqqltrlytlGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMIN  843
              +QL  LY++G R F L GIG +GCIP      +A  G C++ VNQ + PFN  ++ +++
Sbjct  205   ARQLLALYSVGLRNFFLAGIGPLGCIPNQRGSGQAPPGRCVDYVNQILGPFNEGLRSLVD  264

Query  844   KFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSN  1023
             + +   P A FV+ +T      I+NN   +GF+V DR CCG+G+N G++TCLPF  PC N
Sbjct  265   QLNK-RPGAMFVYGNTYGSVGDILNNPATFGFNVVDRACCGIGRNQGQITCLPFAMPCFN  323

Query  1024  RQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             R +Y+FWDAFHPT AVN +L   A  GS+   YP+ +
Sbjct  324   RNQYVFWDAFHPTEAVNAILARRAVYGSSADCYPINM  360



>ref|XP_004250819.1| PREDICTED: GDSL esterase/lipase At1g71250 [Solanum lycopersicum]
Length=359

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 221/329 (67%), Gaps = 7/329 (2%)
 Frame = +1

Query  166   AMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMI  345
             A++IFGDSL+DNGNNN L + AKANY PYGIDF+  PTGRFSNG T VD + + LG+P  
Sbjct  24    ALWIFGDSLVDNGNNNFLNTIAKANYFPYGIDFSRGPTGRFSNGKTFVDILGELLGVPSP  83

Query  346   AAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
               +  +PS    R   GVNYASAA GILD TG+H+M R   ++Q+ NFE T +QL   +S
Sbjct  84    PPF-ANPSTRGERILGGVNYASAAGGILDETGKHYMDRYTLSQQVINFESTLSQLRTMMS  142

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlyt  696
                +   L++SI  +  GSNDY+NNY +P  Y TS  Y+P QF++ L+  Y +QL  LY+
Sbjct  143   PGDLNTYLSRSIAVMVFGSNDYINNYLLPSLYSTSINYNPQQFSNLLLNHYARQLVALYS  202

Query  697   lGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMINKFST-THPD  867
             +G RKF++ G+G +GCIP  LA  +A  G C++ VNQ +  FN  ++ ++ + +  +HP 
Sbjct  203   VGLRKFLIAGVGPLGCIPNQLATGQAPPGRCVDYVNQILGSFNEGLRSLVTRLNNGSHPG  262

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A FV+ +T      I+NN  RYGF+V+DR CCGVG+N G++TCLP++ PC +R +Y+FWD
Sbjct  263   AVFVYGNTYAAIGDILNNPARYGFNVWDRACCGVGRNQGQITCLPYQFPCLDRSKYIFWD  322

Query  1048  AFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             AFHPT AV+ +L   A+ G     YPM +
Sbjct  323   AFHPTQAVDAILAQRAYYGPPSDCYPMNV  351



>ref|XP_003569805.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Brachypodium 
distachyon]
Length=362

 Score =   299 bits (765),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 216/320 (68%), Gaps = 5/320 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  F+FGDSL+DNGNNN++ S A+ANY PYGIDF    TGRFSNG T VD+I++ LG  
Sbjct  28    VPCYFVFGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTVDAISRLLGFD  87

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                      + DQ+  GVN+ASAAAGI D TGQ    RI F  Q+ N++    QL + L 
Sbjct  88    DYIPAYAGANNDQLLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILG  147

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L++ IF VGMGSNDYLNNYFMP  Y +S  Y P Q+A  L+ QY+QQLT LY
Sbjct  148   DEDSAANHLSQCIFTVGMGSNDYLNNYFMPAVYSSSRQYTPEQYADVLINQYSQQLTTLY  207

Query  694   tlGARKFVLTGIGKMGCIPTMLA-RADNG-ECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK  L G+G++GC P  LA ++DNG  C++ +N A+  FN  +  ++N+F+   P 
Sbjct  208   NNGARKVALMGVGQVGCSPNELAQQSDNGVTCVDRINSAIEIFNQKLVDLVNQFN-GQPG  266

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +FQ I+     +G +V ++GCCGVG+N+G+VTCLPF+TPC+NR +YLFWD
Sbjct  267   AHFTYINAYGIFQDILRAPGAHGLTVTNKGCCGVGRNNGQVTCLPFQTPCANRDQYLFWD  326

Query  1048  AFHPTSAVNVLLGNLAFNGS  1107
             AFHPT A N+L+G  A++ +
Sbjct  327   AFHPTEAANILVGRRAYSAA  346



>gb|KFK44794.1| hypothetical protein AALP_AA1G304300 [Arabis alpina]
Length=360

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 216/329 (66%), Gaps = 5/329 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L SFA++NY PYGIDF   PTGRF NG T VD IA+ LG  
Sbjct  27    VPCYFIFGDSLVDNGNNNGLVSFARSNYFPYGIDFGG-PTGRFCNGKTTVDEIAELLGFN  85

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S  Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+   L 
Sbjct  86    GYIPAYSDVSGRQILSGVNYASAAAGIREETGRQLGQRISFSGQVRNYQSTVSQVVNLLG  145

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L + I+ VG+GSNDYLNNYFMP  Y +S  + P Q+A+ L+ +YT QL  LY
Sbjct  146   GETQAADYLKRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQYATDLINRYTTQLNALY  205

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPDA  870
               GARKF L GIG +GC P  LA + +G  C+E +N A   FN  ++ ++++ +  HPDA
Sbjct  206   NYGARKFSLIGIGAIGCSPNALAGSRDGRTCVERINSANQIFNNKLRSLVDQLNNQHPDA  265

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             KF +I+   +FQ ++ N  R+GFSV + GCCG+G+N+G++TCLP + PC NR  Y+FWD+
Sbjct  266   KFTYINAYGIFQDMIQNPSRFGFSVTNAGCCGIGRNAGQITCLPGQRPCRNRNAYVFWDS  325

Query  1051  FHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             FHPT A NV++   ++N  S    YP+ I
Sbjct  326   FHPTEAANVVIARRSYNAQSASDAYPIDI  354



>ref|XP_010924691.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Elaeis guineensis]
Length=367

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 224/330 (68%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN++ S A+ANY+PYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  33    VPCYFIFGDSLVDNGNNNDMASLARANYMPYGIDFPGGPTGRFSNGLTAVDVIAQLLGFE  92

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                +   +     +  GVN+ASAAAGI + TGQ    RI F+ Q++N++    ++   L 
Sbjct  93    DFISPYAAARDRALLTGVNFASAAAGIREETGQQLGDRISFSGQLENYQAAVQEVVNILG  152

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K IF VGMGSNDYLNNYFMP  Y +S  Y P Q+A+ L++QY+QQ+  LY
Sbjct  153   DEDSAANYLSKCIFSVGMGSNDYLNNYFMPAFYSSSRQYTPEQYANVLIEQYSQQIRTLY  212

Query  694   tlGARKFVLTGIGKMGCIPTMLAR-ADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK VL G+G++GC P  LA+ + NGE C+  +N A+  FN+ +  ++++F+T    
Sbjct  213   NYGARKVVLMGVGQIGCSPNELAQQSSNGETCVNRINSAIQIFNSKLIALVDEFNTLD-G  271

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +F+ I+ N   +G +V +RGCCGVGKN+G++TCLP++TPC NR EYLFWD
Sbjct  272   AHFTYINAYGIFEDILRNPSAHGLTVTNRGCCGVGKNNGQITCLPYQTPCPNRNEYLFWD  331

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A N+++G  +++  S+   YPM I
Sbjct  332   AFHPTEAANIVIGKRSYSAESSSDAYPMDI  361



>ref|XP_008440329.1| PREDICTED: GDSL esterase/lipase At1g71250 [Cucumis melo]
Length=370

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 217/329 (66%), Gaps = 4/329 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPA+F+FGDSL+D GNNN L S A+ANY PYGIDF++ PTGRFSNG T++D     LG+P
Sbjct  36    VPAIFVFGDSLVDVGNNNFLHSAARANYYPYGIDFSDGPTGRFSNGRTVIDMFVDMLGIP  95

Query  340   MIAAYLE-SPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
                 +     S D++  GVNYASAAAGILD TG+H+  R   ++Q+ NFE T N L  ++
Sbjct  96    NAPEFANPDTSGDRILNGVNYASAAAGILDETGRHYGDRYSLSQQVVNFESTLNDLRRSM  155

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  + + L+KSI F+  GSNDY+NNY MP  Y T F Y+ NQFA+ L+ +Y++QL  L 
Sbjct  156   GSWNLTRYLSKSIAFLAFGSNDYINNYLMPNLYTTRFRYNSNQFANLLLNRYSRQLLALR  215

Query  694   tlGARKFVLTGIGKMGCIPTMLARADN--GECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             ++G RK V+ G+G +GCIP   A      G C ++VN+ +  FN  +K ++ + ++ +PD
Sbjct  216   SVGLRKLVVAGVGPLGCIPNQRATGLTIPGRCADNVNEMLGAFNEGLKSLVTQLNSQYPD  275

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             + FV+ +   +F  I+NN + YGF V D  CCGVG N G++TCLP + PC NR EY+FWD
Sbjct  276   SNFVYTNIYGIFGDILNNPETYGFRVVDTACCGVGLNRGQITCLPLQFPCLNRNEYVFWD  335

Query  1048  AFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             AFHPT A + +L   AF G     YP+ +
Sbjct  336   AFHPTEAASNVLAGRAFRGPPSDSYPINV  364



>ref|XP_004145208.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Cucumis sativus]
 gb|KGN64457.1| hypothetical protein Csa_1G056930 [Cucumis sativus]
Length=360

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 217/330 (66%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             V A+F+FGDSL+D GNNN L S A+ANY PYG+DF + PTGRFSNG T++D     LG+P
Sbjct  26    VSAIFVFGDSLVDVGNNNFLHSAARANYYPYGVDFTDGPTGRFSNGRTVIDMFVDMLGIP  85

Query  340   MIAAYLESP--SIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
               A    +P  S D++  GVNYASAAAGILD TG+H+  R   ++Q+ NFE T N L  +
Sbjct  86    N-APEFSNPDTSGDRILNGVNYASAAAGILDETGRHYGDRYTLSQQVVNFESTLNDLRRS  144

Query  514   LSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
             + +  + + L+KSI F+  GSNDY+NNY MP  Y T F Y+ NQFA+ L+ +Y++QL  L
Sbjct  145   MGSWNLTRYLSKSIAFLAFGSNDYINNYLMPNLYTTRFRYNSNQFANLLLNRYSRQLLAL  204

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADN--GECLESVNQAVLPFNANVKQMINKFSTTHP  864
              ++G +K V+ G+G +GCIP   A      G C + VN+ +  FN  +K ++ + ++ +P
Sbjct  205   QSVGVKKLVIAGLGPLGCIPNQRATGVTLPGRCADKVNEMLGAFNEGLKSLVTQLNSQYP  264

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             D KFV+ +   +F  I+NN + YGFSV D  CCGVG N G++TCLP + PC NR EY+FW
Sbjct  265   DTKFVYTNIYGIFGDILNNPETYGFSVVDTACCGVGLNRGQITCLPLQFPCLNRNEYVFW  324

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             DAFHPT A + +L   AF G     YP+ +
Sbjct  325   DAFHPTEAASYILAGRAFRGPPSDSYPINV  354



>ref|XP_006478360.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Citrus sinensis]
Length=375

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 221/337 (66%), Gaps = 7/337 (2%)
 Frame = +1

Query  139   GEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSI  318
             G   + +V  +F+FGDSL+D GNNN L S AK+NY PYG+DF   PTGRFSNG T VD I
Sbjct  35    GVAESQVVRGIFVFGDSLVDVGNNNYLSSIAKSNYYPYGVDFEYGPTGRFSNGKTFVDFI  94

Query  319   AKQLGLPMIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKT  492
              K +GLP   A+ + P+ +  R   GVNYASAAAGILD TGQH+  R   ++Q+ NFE T
Sbjct  95    GKIMGLPYPLAFAD-PNTNGARLLGGVNYASAAAGILDETGQHYGQRYTLSQQVLNFEST  153

Query  493   KNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqy  669
              NQL   + A  +   L+KSI  +  GSNDY+NNY MP  Y +SF+Y+P+Q+A+ L+  Y
Sbjct  154   LNQLRGIMGASNLTNYLSKSIAIMVFGSNDYINNYLMPSIYSSSFYYNPSQYANLLLNHY  213

Query  670   tqqltrlytlGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMIN  843
              +QL  LY++G R F L GIG +GCIP      +A  G C++ VNQ + PFN  ++ +++
Sbjct  214   ARQLLALYSVGLRNFFLAGIGPLGCIPNQRGSGQAPPGRCVDYVNQILGPFNEGLRSLVD  273

Query  844   KFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSN  1023
             + +   P A FV+ +T      I+NN   +GF+V DR CCG+G+N G++TCLPF  PC N
Sbjct  274   QLNK-RPGAMFVYGNTYGSVGDILNNPATFGFNVVDRACCGIGRNQGQITCLPFAMPCFN  332

Query  1024  RQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             R +Y+FWDAFHPT AVN +L   A  GS+   YP+ +
Sbjct  333   RNQYVFWDAFHPTEAVNAILARRAVYGSSADCYPINM  369



>ref|XP_003566036.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Brachypodium 
distachyon]
Length=364

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/318 (50%), Positives = 207/318 (65%), Gaps = 5/318 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  F+FGDSL+DNGNNN + S A+ANY PYGIDF   PTGRFSNG T VD I++ LG  
Sbjct  30    VPCYFVFGDSLVDNGNNNVIVSMARANYPPYGIDFAGGPTGRFSNGLTTVDVISRLLGFD  89

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S DQ+  GVN+ASAAAGI + TGQ   GRI F+ Q+ N++    QL + L 
Sbjct  90    DFIPPFAGASSDQLLTGVNFASAAAGIREETGQQLGGRISFSGQVQNYQSAVQQLVSILG  149

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L++ IF VGMGSNDYLNNYFMP  Y T   Y P Q+A  L  +YT+ L  LY
Sbjct  150   DEDAAAAHLSRCIFTVGMGSNDYLNNYFMPAFYNTGSRYTPQQYADDLAARYTELLRVLY  209

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK  L G+G++GC P  LA+  A+   C++ ++ AV  FN  +  ++++F+   P 
Sbjct  210   GYGARKVALMGVGQVGCSPNELAQGSANGVACVDRIDTAVRMFNRRLTGIVDQFNAL-PG  268

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +++ D +F  I+     +G  V + GCCGVG+N+G+VTCLPF+TPC+NR EYLFWD
Sbjct  269   AHFTYVNIDGIFADILKAPGAHGLKVTNAGCCGVGRNNGQVTCLPFQTPCANRHEYLFWD  328

Query  1048  AFHPTSAVNVLLGNLAFN  1101
             AFHPT A N L+G  A++
Sbjct  329   AFHPTEAANELVGQRAYS  346



>ref|XP_006415558.1| hypothetical protein EUTSA_v10007994mg [Eutrema salsugineum]
 gb|ESQ33911.1| hypothetical protein EUTSA_v10007994mg [Eutrema salsugineum]
Length=364

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 214/331 (65%), Gaps = 8/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+Y PYGID    PTGRFSNG T VD IA+ LG  
Sbjct  30    VPCYFIFGDSLVDNGNNNRLVSIARADYYPYGIDLGR-PTGRFSNGKTTVDEIAELLGFD  88

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I AY +  S +Q+  GVNYASAAAGI + TGQ    R+ F+ Q+ N++ T +Q+   L
Sbjct  89    NYIPAYTDV-SGEQILQGVNYASAAAGIREETGQQLGQRVTFSGQVQNYKTTVSQVVELL  147

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
               +  A D L + I+ VG+GSNDYLNNYFMP  Y TS  Y P Q+A  L+ +Y+ QL  L
Sbjct  148   GDENTAADYLKRCIYSVGLGSNDYLNNYFMPQFYSTSRQYTPEQYADDLINRYSDQLNAL  207

Query  691   ytlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKF L G+G +GC P  LA+   D   C+E  N A   FN  +K M+ + +  HP
Sbjct  208   YNYGARKFALVGVGAIGCSPNALAQGSLDGTTCVERYNSANRIFNDRLKSMVQQLNNDHP  267

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF +I+   +FQ I+ N   YGF V +  CCGVG+N G++TCLP + PC NR E++FW
Sbjct  268   DAKFTYINAYGVFQDIIANPSAYGFRVTNAACCGVGRNGGQLTCLPGQAPCPNRDEFVFW  327

Query  1045  DAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             DAFHPT A N ++   +FN  S+  VYP+ I
Sbjct  328   DAFHPTDAANTIIAQRSFNAQSSSDVYPIDI  358



>ref|XP_010054297.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Eucalyptus grandis]
 gb|KCW76041.1| hypothetical protein EUGRSUZ_D00409 [Eucalyptus grandis]
Length=370

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 170/363 (47%), Positives = 227/363 (63%), Gaps = 18/363 (5%)
 Frame = +1

Query  28    MNNPSVFSALFILALVFV-SAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNG  204
             M +     AL  LA+V V SA    V   AQ              VP  FI GDSL+DNG
Sbjct  1     MESGKAIQALMGLAVVLVLSAGNCGVEAQAQPQ------------VPCFFILGDSLLDNG  48

Query  205   NNNNLF-SFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQM  381
             NNN L  S AKANY PYGIDF+  PTGRFSNG T  D I++ LG         +   + +
Sbjct  49    NNNGLAASLAKANYRPYGIDFSAGPTGRFSNGKTAGDVISQLLGFSNYIPPYATTRGNAL  108

Query  382   RYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKD-LTKSIF  558
               GVNYASAAAGI + TG+   GRI F+ Q+ N++ T +QL + L  +  A D L+K IF
Sbjct  109   LKGVNYASAAAGIREETGRQLGGRITFSRQVQNYQSTVSQLVSILGGNSTAADYLSKCIF  168

Query  559   FVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGK  735
              VGMGSNDYLNNY+MP  Y +S  Y P Q+A  L+QQY QQL  +Y  GARK  L G+G+
Sbjct  169   VVGMGSNDYLNNYYMPQFYTSSQQYSPEQWADILIQQYVQQLRIMYNNGARKVALIGLGQ  228

Query  736   MGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQH  909
             +GC P+ LAR  +DN  C++ +N A   FN  +K +++ F+  + +AKF +I+T  +FQ 
Sbjct  229   IGCSPSELARNSSDNSTCVQKINDACQIFNNKLKPVVDDFNKNYANAKFTYINTYNIFQD  288

Query  910   IMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGN  1089
             ++     +GF + + GCCGVG+N+G++TCLP + PC NR+EYLFWDAFHPT A N ++G 
Sbjct  289   LLTKPSSFGFRIINSGCCGVGRNNGQITCLPLQNPCPNRKEYLFWDAFHPTEAANTVVGQ  348

Query  1090  LAF  1098
              ++
Sbjct  349   RSY  351



>gb|AAM64368.1| lipase/hydrolase, putative [Arabidopsis thaliana]
Length=363

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 219/331 (66%), Gaps = 5/331 (2%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A VP  F+FGDSL+DNGNNN L S A++NY PYGIDF   PTGRFSNG T VD IA+ LG
Sbjct  28    AQVPCFFVFGDSLVDNGNNNGLISIARSNYFPYGIDFGG-PTGRFSNGKTTVDVIAELLG  86

Query  334   LPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
                      + S  Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+   
Sbjct  87    FNGYIPAYNTVSGRQILSGVNYASAAAGIREETGRQLGQRISFSGQVRNYQTTVSQVVQL  146

Query  514   LSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
             L  +  A D L + I+ VG+GSNDYLNNYFMP  Y +S  + P Q+A+ L+ +Y+ QL  
Sbjct  147   LGDETRAADYLKRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQYANDLISRYSTQLNA  206

Query  688   lytlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHP  864
             LY  GARKF L+GIG +GC P  LA + +G  C++ +N A   FN  ++ ++++ +  HP
Sbjct  207   LYNYGARKFALSGIGSVGCSPNALAGSPDGRTCVDRINSANQIFNNKLRSLVDQLNNNHP  266

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC +R  Y+FW
Sbjct  267   DAKFIYINAYGIFQDMITNPARFGFRVTNAGCCGIGRNAGQITCLPGQRPCRDRNAYVFW  326

Query  1045  DAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             DAFHPT A NV++   ++N  S    YPM I
Sbjct  327   DAFHPTEAANVIIARRSYNAQSASDAYPMDI  357



>ref|XP_004232990.1| PREDICTED: GDSL esterase/lipase At5g45670 [Solanum lycopersicum]
Length=367

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 223/331 (67%), Gaps = 7/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGID+ + PTGRFSNG T VD IA+ LG  
Sbjct  32    VPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDYPDGPTGRFSNGKTTVDVIAELLGFD  91

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D ++ GVN+ASAAAGI + TGQ    RI F  Q++N+  T  Q+   L
Sbjct  92    DYIPPYASARGEDILK-GVNFASAAAGIREETGQQLGARITFGGQVNNYRNTVQQVVQIL  150

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqqltrl  690
               +  A + L+K I+ +G+GSNDYLNNYFMP Y  TS  ++P+Q+A  L+QQY+QQL  L
Sbjct  151   GDENSAANYLSKCIYSIGLGSNDYLNNYFMPQYYSTSRQFNPDQYADVLIQQYSQQLKTL  210

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARKFVL G+G++GC P  LA+   D   C E++N A   FN  +K ++++F+   P
Sbjct  211   YDYGARKFVLIGVGQIGCSPNALAQNSPDGRTCAENINNANKLFNNRLKGIVDEFNGNTP  270

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++I+   +FQ +++N   +GF V + GCCGVG+N+G++TCLP + PC NR EY+FW
Sbjct  271   DAKFIYINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCQNRDEYVFW  330

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             DAFHP  A N+++G  ++        YP  I
Sbjct  331   DAFHPGEAANIVVGRRSYRAERSSDAYPFDI  361



>ref|XP_010452841.1| PREDICTED: GDSL esterase/lipase At5g08460-like [Camelina sativa]
Length=383

 Score =   298 bits (764),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 232/373 (62%), Gaps = 16/373 (4%)
 Frame = +1

Query  43    VFSALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLF  222
             V S+  + +LV VS     V VLA     G     + A+ PAMF+FGDSL+DNGNNN+L 
Sbjct  12    VMSSFAVHSLVLVSWFV-VVAVLA-----GGEDSSDTAMFPAMFVFGDSLVDNGNNNHLN  65

Query  223   SFAKANYLPYGIDF-NNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESP--SIDQMRYGV  393
             S A++NYLPYGIDF  N PTGRF NG TIVD + + LGLP I A++++    +D  R GV
Sbjct  66    SLARSNYLPYGIDFAGNQPTGRFCNGKTIVDFVGELLGLPDIPAFMDTVDGEVDISR-GV  124

Query  394   NYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMG  573
             NYASAA GIL+ TG+    R     Q++NFEKT  +++    ++ V + + KS+  V +G
Sbjct  125   NYASAAGGILEETGRQLGERFSMARQVENFEKTLVEITRMSRSESVKEYMAKSLVVVSLG  184

Query  574   SNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIP  750
             +NDY+NNY  P  + TS  YDP  FA  LV  +T  L  LY  G RKFVL G+G +GCIP
Sbjct  185   NNDYINNYLKPSLFLTSSIYDPTSFADLLVSNFTTHLLELYGKGFRKFVLAGVGPLGCIP  244

Query  751   TMLAR--ADNGECLESVNQAVLPFNANVKQMINKFST---THPDAKFVFIDTDKMFQHIM  915
               LA   A  GEC+E+VN+    FN  +  ++++ ++   T  +  FV+ +T      I+
Sbjct  245   DQLAARAAPPGECVEAVNEMAELFNNRLISLVDRLNSDNKTASEGIFVYGNTYGAAVDIL  304

Query  916   NNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLA  1095
              N   YGF V DRGCCGVG+N GE+TCLP   PC+ R  ++FWDAFHPT A N+++   A
Sbjct  305   TNPFAYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDAFHPTEAFNLIIARRA  364

Query  1096  FNGSNYLVYPMTI  1134
             FNGS    YP+ +
Sbjct  365   FNGSKSDCYPINL  377



>emb|CDX90201.1| BnaA08g17830D [Brassica napus]
Length=364

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 217/350 (62%), Gaps = 7/350 (2%)
 Frame = +1

Query  100   VPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPT  279
             V VL     LGF+ +     VP  FIFGDSL+DNGNNN L S A+A+Y PYGID    PT
Sbjct  11    VSVLVLYLGLGFNVKAE-PQVPCYFIFGDSLVDNGNNNGLSSLARADYYPYGIDLGG-PT  68

Query  280   GRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIP  459
             GRFSNG T VD IA+ LG           S +Q+  GVNYASAAAGI + TGQ    RIP
Sbjct  69    GRFSNGKTTVDEIAELLGFDNYIPAYSDVSGEQILQGVNYASAAAGIREETGQQLGQRIP  128

Query  460   FNEQIDNFEKTKNQLSANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYD  633
             F+ Q+ N++ T  Q+   L  +  A D L K I+ VG+GSNDYLNNYFMP Y  TS  Y 
Sbjct  129   FSGQVQNYQNTVAQVVELLGDENTAADYLRKCIYSVGLGSNDYLNNYFMPQYYSTSRQYT  188

Query  634   PNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAV  807
             P Q+A  L+ +Y  QL  LY  GARKF L G+G +GC P  LA+   D   C+E +N A 
Sbjct  189   PEQYADDLINRYRDQLNALYNYGARKFALVGVGAIGCSPNALAQGSPDGTTCVERLNSAN  248

Query  808   LPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGE  987
               FN  +K M+ + +  H DAKF +I+   +FQ I+ N   YGF+V +  CCGVG+N G+
Sbjct  249   RIFNNRLKSMVQQLNNEHSDAKFTYINAYGVFQDIIANPSAYGFTVTNAACCGVGRNGGQ  308

Query  988   VTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             +TCLP + PC NR EY+FWDAFHPT A N ++   ++   S+  VYP+ I
Sbjct  309   LTCLPGQGPCPNRNEYVFWDAFHPTDAANTIIAQRSYKAQSSSDVYPIDI  358



>ref|NP_174260.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C7N4.1|GDL15_ARATH RecName: Full=GDSL esterase/lipase At1g29670; AltName: Full=Extracellular 
lipase At1g29670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51758.1|AC068667_37 lipase/hydrolase, putative; 118270-120144 [Arabidopsis thaliana]
 gb|AAL57681.1| At1g29670/F15D2_22 [Arabidopsis thaliana]
 gb|AEE31116.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=363

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 219/331 (66%), Gaps = 5/331 (2%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A VP  F+FGDSL+DNGNNN L S A++NY PYGIDF   PTGRFSNG T VD IA+ LG
Sbjct  28    AQVPCFFVFGDSLVDNGNNNGLISIARSNYFPYGIDFGG-PTGRFSNGKTTVDVIAELLG  86

Query  334   LPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
                      + S  Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+   
Sbjct  87    FNGYIPAYNTVSGRQILSGVNYASAAAGIREETGRQLGQRISFSGQVRNYQTTVSQVVQL  146

Query  514   LSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
             L  +  A D L + I+ VG+GSNDYLNNYFMP  Y +S  + P Q+A+ L+ +Y+ QL  
Sbjct  147   LGDETRAADYLKRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQYANDLISRYSTQLNA  206

Query  688   lytlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHP  864
             LY  GARKF L+GIG +GC P  LA + +G  C++ +N A   FN  ++ ++++ +  HP
Sbjct  207   LYNYGARKFALSGIGAVGCSPNALAGSPDGRTCVDRINSANQIFNNKLRSLVDQLNNNHP  266

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DAKF++I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC +R  Y+FW
Sbjct  267   DAKFIYINAYGIFQDMITNPARFGFRVTNAGCCGIGRNAGQITCLPGQRPCRDRNAYVFW  326

Query  1045  DAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             DAFHPT A NV++   ++N  S    YPM I
Sbjct  327   DAFHPTEAANVIIARRSYNAQSASDAYPMDI  357



>ref|XP_009599586.1| PREDICTED: GDSL esterase/lipase At1g71250 [Nicotiana tomentosiformis]
Length=369

 Score =   298 bits (762),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 222/329 (67%), Gaps = 7/329 (2%)
 Frame = +1

Query  166   AMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMI  345
             A+++FGDSL+DNGNNN + S AK+NY PYGIDFN  PTGRFSNG T +D + + LG+   
Sbjct  33    ALWVFGDSLVDNGNNNFINSIAKSNYYPYGIDFNRGPTGRFSNGKTFIDILGELLGIASP  92

Query  346   AAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
               + + PS  + R   GVNYASAAAGILD TGQH++ R   ++Q+ NFE T +QL   +S
Sbjct  93    PPFAD-PSTREGRILGGVNYASAAAGILDETGQHYLERYTLSQQVINFESTLSQLRTMMS  151

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlyt  696
                +   L++SI  +  GSNDY+NNY MP  Y +S  Y P QFA+ L+  Y +QL  LY+
Sbjct  152   PGDLNTYLSRSIAVMVFGSNDYINNYLMPNLYTSSINYTPQQFANLLLNHYARQLVALYS  211

Query  697   lGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMINKFST-THPD  867
             +G RKF+L G+G +GCIP  LA  +A  G C++ VNQ +  FN  ++ ++   +  +HP 
Sbjct  212   IGLRKFLLAGVGPLGCIPNQLATGQAPPGRCVDYVNQILGSFNEGLRSLVASMNNGSHPG  271

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             + FV+ +T  +   I+NN  RYGF+V+DR CCGVG+N G++TC+P++ PC +R +Y+FWD
Sbjct  272   SIFVYGNTYAVIGDILNNAARYGFNVWDRACCGVGRNQGQITCMPYQFPCLDRSKYIFWD  331

Query  1048  AFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             AFHPT AVN +L   A++G     YP+ +
Sbjct  332   AFHPTQAVNAILAQRAYSGPPSDCYPINV  360



>ref|XP_006836894.1| hypothetical protein AMTR_s00099p00119900 [Amborella trichopoda]
 gb|ERM99747.1| hypothetical protein AMTR_s00099p00119900 [Amborella trichopoda]
Length=351

 Score =   297 bits (760),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 216/332 (65%), Gaps = 6/332 (2%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             L  AMF FGDSL D GNNNNL S AK+NY+PYGIDF   PTGRF NG TI D + + LGL
Sbjct  14    LATAMFNFGDSLTDCGNNNNLASLAKSNYVPYGIDFFMGPTGRFCNGRTIADFLGELLGL  73

Query  337   PMIAAYLESPSIDQ-MRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
             P I  + +  + D+ +  GVNYASAAAGILD TG     RI  ++Q+ NFE T N+L   
Sbjct  74    PYIPPFEDPNTKDRNLLSGVNYASAAAGILDETGYQLGDRISLSQQVLNFESTLNELRGV  133

Query  514   LSA--DVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqlt  684
             L      + + L+KSI FV  GSNDY+NNY +P  Y TS+ Y P  +++ L+  YT+Q+ 
Sbjct  134   LGGVNPRLMEFLSKSIAFVVFGSNDYINNYLLPSLYTTSYNYSPEAYSNLLLTHYTRQIL  193

Query  685   rlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTT  858
              L++LG RKFVL G+G +GCIP  LA   A  G C+  VN+ V  FN  ++ ++ + +  
Sbjct  194   ALHSLGLRKFVLAGVGPLGCIPNQLATGLAPIGSCVTYVNEIVGSFNIGLRDLVTQLNAN  253

Query  859   HPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
             HP+A F++ +       I++N   YGF V +RGCCG+G+N G++TCLP  TPC NR EY+
Sbjct  254   HPNATFIYGNVYGALGDILHNPSTYGFKVANRGCCGLGRNEGQITCLPLATPCPNRNEYV  313

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT AVN +L + AF G   + YP+ +
Sbjct  314   FWDAFHPTEAVNNILAHRAFTGPPSVCYPINV  345



>gb|ACN29259.1| unknown [Zea mays]
 tpg|DAA57789.1| TPA: anther-specific proline-rich protein APG isoform 1 [Zea 
mays]
 tpg|DAA57790.1| TPA: anther-specific proline-rich protein APG isoform 2 [Zea 
mays]
Length=368

 Score =   297 bits (761),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 213/330 (65%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANY PYGIDF   P+GRF+NG T VD IA+ LG  
Sbjct  34    VPCYFIFGDSLVDNGNNNYIVSLARANYPPYGIDFAAGPSGRFTNGLTTVDVIAQLLGFD  93

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                    + S DQ+  G N+ASAAAGI   TGQ   GRIPF  Q+ N++     L + L 
Sbjct  94    NFIPPFAATSADQLLGGANFASAAAGIRAETGQQLGGRIPFAGQVQNYQTAVQTLVSILG  153

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  +  L++ IF VGMGSNDYLNNYFMP  Y T   Y P QFA +L+  Y + L  LY
Sbjct  154   DQDTASDHLSRCIFSVGMGSNDYLNNYFMPAFYNTGSRYTPEQFADSLIADYRRHLRVLY  213

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK V+ G+G++GC P  LAR  AD   C++ ++ A+  FN  +  ++++F+   P 
Sbjct  214   NYGARKVVMIGVGQVGCSPNELARYSADGVTCVDRIDDAIQMFNRRLVGLVDEFNAL-PG  272

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F FI+   +F  I+ N   YGF+V + GCCGVG+N+G+VTCLP++ PC+NR +++FWD
Sbjct  273   AHFTFINAYNIFDDILANAASYGFTVTNAGCCGVGRNNGQVTCLPYQAPCANRDQHIFWD  332

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP+ A N+++G  ++   S   VYPM I
Sbjct  333   AFHPSEAANIIVGRRSYRAESPNDVYPMDI  362



>ref|XP_004961487.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Setaria italica]
Length=368

 Score =   297 bits (761),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 205/317 (65%), Gaps = 4/317 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANY PYGIDF   PTGRFSNG T VD +AK LG  
Sbjct  33    VPCYFIFGDSLVDNGNNNFIVSMARANYPPYGIDFAGGPTGRFSNGLTTVDVLAKLLGFD  92

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S  Q+  GVN+ASAAAGI + TGQ   GRI F+ Q+ N++    +L + L 
Sbjct  93    DFIPPFAGASSQQLLTGVNFASAAAGIREETGQQLGGRISFSGQVQNYQSAVQELISILG  152

Query  520   AD-VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +   A  L++ IF VGMGSNDYLNNYFMP  Y T   Y P Q+A +L   Y++ L  +Y
Sbjct  153   DEGSAATHLSRCIFSVGMGSNDYLNNYFMPAFYDTGSRYTPEQYADSLAADYSRLLMVMY  212

Query  694   tlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK  + G+G++GC P  LA+   D   C+E++N A+  FN  +  ++++F+   P 
Sbjct  213   RYGARKVAVIGVGQVGCSPNELAQRSPDGATCVEAINAAIRIFNQRLVGLVDRFNRQLPG  272

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F +++   +F  I+ +   +G  V + GCCGVG+N+G+VTCLPF+ PC+NR EYLFWD
Sbjct  273   ARFTYVNAYGIFDDILRSPGAHGLRVTNAGCCGVGRNNGQVTCLPFQMPCANRHEYLFWD  332

Query  1048  AFHPTSAVNVLLGNLAF  1098
             AFHPT A NVL+G   +
Sbjct  333   AFHPTEAANVLVGQRTY  349



>ref|XP_009109657.1| PREDICTED: GDSL esterase/lipase At1g29660 [Brassica rapa]
Length=364

 Score =   297 bits (760),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 171/350 (49%), Positives = 217/350 (62%), Gaps = 7/350 (2%)
 Frame = +1

Query  100   VPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPT  279
             V VL     LGF+ +     VP  FIFGDSL+DNGNNN L S A+A+Y PYGID    PT
Sbjct  11    VSVLVLYLGLGFNVKAE-PQVPCYFIFGDSLVDNGNNNGLSSLARADYYPYGIDLGG-PT  68

Query  280   GRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIP  459
             GRFSNG T VD IA+ LG           S +Q+  GVNYASAAAGI + TGQ    RIP
Sbjct  69    GRFSNGKTTVDEIAELLGFDNYIPAYSDVSGEQILQGVNYASAAAGIREETGQQLGQRIP  128

Query  460   FNEQIDNFEKTKNQLSANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYD  633
             F+ Q+ N++ T  Q+   L  +  A D L K I+ VG+GSNDYLNNYFMP Y  TS  Y 
Sbjct  129   FSGQVQNYQNTVAQVVELLGDENTAADYLRKCIYSVGLGSNDYLNNYFMPQYYSTSRQYT  188

Query  634   PNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAV  807
             P Q+A  L+ +Y  QL  LY  GARKF L G+G +GC P  LA+   D   C+E +N A 
Sbjct  189   PEQYADDLINRYRDQLNALYNYGARKFALVGVGAIGCSPNALAQGSPDGTTCVERLNSAN  248

Query  808   LPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGE  987
               FN  +K M+ + +  H DAKF +I+   +FQ I+ N   YGF+V +  CCGVG+N G+
Sbjct  249   RIFNNRLKSMVQQLNNEHSDAKFSYINAYGVFQDIIANPSAYGFTVTNAACCGVGRNGGQ  308

Query  988   VTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             +TCLP + PC NR EY+FWDAFHPT A N ++   ++   S+  VYP+ I
Sbjct  309   LTCLPGQGPCPNRNEYVFWDAFHPTDAANTIIAQRSYKAQSSSDVYPIDI  358



>gb|KEH15769.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=365

 Score =   297 bits (760),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 167/340 (49%), Positives = 218/340 (64%), Gaps = 7/340 (2%)
 Frame = +1

Query  133   FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             +SG G    VP  FIFGDSL+DNGNNN L S AKANYLPYGIDF   PTGRFSNG T VD
Sbjct  21    WSGIGVAQQVPCYFIFGDSLVDNGNNNQLTSIAKANYLPYGIDFPGGPTGRFSNGKTTVD  80

Query  313   SIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKT  492
              IA+QLG         S    Q+  GVNYASAAAGI + TGQ    RI F  Q+ N+++T
Sbjct  81    VIAEQLGFNGYIPSYASARGRQILRGVNYASAAAGIREETGQQLGQRISFRGQVQNYQRT  140

Query  493   KNQLSANLSAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvq  663
              +QL  N   D    A  L+K I+ +G+GSNDYLNNYFMP  Y TS  + P Q+A+ L+Q
Sbjct  141   VSQL-VNYFGDENTAANYLSKCIYTIGLGSNDYLNNYFMPTIYSTSRQFTPQQYANVLLQ  199

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQM  837
              Y QQL  LY  GARK  L G+G++GC P  LA+   D   C+  +N A   FN  ++ +
Sbjct  200   AYAQQLRILYNYGARKMALFGVGQIGCTPNALAQNSPDGRTCVARINSANQLFNNGLRSL  259

Query  838   INKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPC  1017
             +++ +   PDA+F++++   +FQ I+ +   YGF V + GCCGVG+N+G++TCLPF+  C
Sbjct  260   VDQLNNQLPDARFIYVNVYGIFQDIITSPSTYGFRVTNAGCCGVGRNNGQITCLPFQPAC  319

Query  1018  SNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
              +R  +LFWDAFHPT A N ++G  A+N  S    YP+ I
Sbjct  320   RDRNGFLFWDAFHPTEAGNSVIGRRAYNAQSASDAYPIDI  359



>ref|NP_001149980.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG37397.1| anther-specific proline-rich protein APG [Zea mays]
Length=368

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 213/330 (65%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANY PYGIDF   P+GRF+NG T VD IA+ LG  
Sbjct  34    VPCYFIFGDSLVDNGNNNYIVSLARANYPPYGIDFAAGPSGRFTNGLTTVDVIAQLLGFD  93

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                    + S DQ+  G N+ASAAAGI   TGQ   GRIPF  Q+ N++     L + L 
Sbjct  94    NFIPPFAATSADQLLGGANFASAAAGIRAETGQQLGGRIPFAGQVQNYQTAVQTLVSILG  153

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  +  L++ IF VGMGSNDYLNNYFMP  Y T   Y P QFA +L+  Y + L  LY
Sbjct  154   DQDTASDHLSRCIFSVGMGSNDYLNNYFMPAFYNTGSRYTPEQFADSLIADYRRHLRVLY  213

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK V+ G+G++GC P  LAR  AD   C++ ++ A+  FN  +  ++++F+   P 
Sbjct  214   NYGARKVVMIGVGQVGCSPNELARYSADGVTCVDRIDDAIQMFNRRLVGLVDEFNAL-PG  272

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F FI+   +F  I+ N   YGF+V + GCCGVG+N+G+VTCLP++ PC+NR +++FWD
Sbjct  273   AHFTFINAYNIFDDILANAASYGFTVTNAGCCGVGRNNGQVTCLPYQAPCANRDQHIFWD  332

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP+ A N+++G  ++   S   VYPM I
Sbjct  333   AFHPSEAANIIVGRRSYRAESPNDVYPMDI  362



>ref|XP_004293650.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Fragaria vesca 
subsp. vesca]
Length=367

 Score =   297 bits (760),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 217/318 (68%), Gaps = 5/318 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGRFSNG TIVD +A+ LG  
Sbjct  33    VPCYFIFGDSLVDNGNNNQLQSLARADYLPYGIDFGG-PTGRFSNGKTIVDVVAELLGFD  91

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    +    Q+  GVN+ASAAAGI + TG+   GRI F+ Q+ N++ T +Q+   L 
Sbjct  92    DYIPPYATARDQQILKGVNFASAAAGIREETGRQLGGRITFSGQVRNYQNTVSQVVNLLG  151

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L K ++ +G+GSNDYLNNYFMP Y  T   Y P ++A++L+Q Y++QL  LY
Sbjct  152   DEDTAANYLGKCMYSIGLGSNDYLNNYFMPQYYNTGNQYTPEEYATSLIQDYSKQLQILY  211

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK VL GIG++GC P+ LA+   D   C+  +N A   FN  +K + N+F+T  PD
Sbjct  212   NYGARKVVLFGIGQVGCSPSELAQNSPDGKTCVAKINSANQIFNGKLKALANEFNTNFPD  271

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
              +F+FID+  +F  I+N+  +YGF+  + GCCGVG+N+G++TCLP++TPC+NR EYLFWD
Sbjct  272   GRFIFIDSYAIFADIVNSPAQYGFTNINTGCCGVGRNNGQITCLPYQTPCANRDEYLFWD  331

Query  1048  AFHPTSAVNVLLGNLAFN  1101
             AFHPT A N ++   ++N
Sbjct  332   AFHPTEAGNAVVARRSYN  349



>ref|XP_010273430.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Nelumbo nucifera]
Length=365

 Score =   297 bits (760),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 166/333 (50%), Positives = 222/333 (67%), Gaps = 7/333 (2%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A VP  FIFGDSL+D+GNNN L S A+A+Y+PYGIDF+  PTGRF NG T  D IA+ LG
Sbjct  28    AEVPCYFIFGDSLVDDGNNNQLSSLARADYMPYGIDFDGGPTGRFRNGKTTTDVIAQLLG  87

Query  334   LP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
                 I  Y  +   D ++ GVN+ASAAAGI D TG+HF  RI  N Q+ N++   +Q+  
Sbjct  88    FDDYIPPYATTGGQDLLK-GVNFASAAAGIRDETGRHFGDRISMNRQVRNYQSVFSQIVE  146

Query  511   NLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqlt  684
              L  +  AKD L+K IF VGMGSNDYLNNYFMP  Y TS  Y P Q+A  L+Q+YT QL 
Sbjct  147   ILGDEASAKDHLSKCIFTVGMGSNDYLNNYFMPLYYTTSQEYTPEQYADALIQEYTGQLK  206

Query  685   rlytlGARKFVLTGIGKMGCIPTMLAR-ADNG-ECLESVNQAVLPFNANVKQMINKFSTT  858
              LY  GARK  L G+G++GC P  LA+ + NG  C++ +N A   FN  +K ++N F+  
Sbjct  207   TLYNYGARKVSLFGVGQIGCTPNELAKNSPNGVTCVDRINVANQMFNNKLKALVNDFNNN  266

Query  859   HPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
                 KF +I+ + +F+ ++ N   YGF+V + GCCG+G+N+G++TCLP +TPC NR +YL
Sbjct  267   LVGTKFTYINANGIFEDMLKNPSAYGFTVTNTGCCGMGQNNGQITCLPLQTPCQNRNQYL  326

Query  1039  FWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             FWDAFHPT A NV++G  ++   S+   YP+ I
Sbjct  327   FWDAFHPTEAANVIVGGRSYRAQSSSDAYPVDI  359



>ref|XP_008366024.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Malus domestica]
Length=366

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 225/340 (66%), Gaps = 8/340 (2%)
 Frame = +1

Query  133   FSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             +SG      VP  FIFGDSL+DNGNNN L S A+A+YLPYG+DF   PTGRFSNG T VD
Sbjct  23    WSGARAEPQVPCYFIFGDSLVDNGNNNQLQSLARADYLPYGVDFGG-PTGRFSNGKTTVD  81

Query  313   SIAKQLGLP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEK  489
              +A+ LG    I  Y  +   D ++ GVN+ASAAAGI + TG+    RI F+ Q+ N++ 
Sbjct  82    VVAELLGFDDFIPPYATARGQDVLK-GVNFASAAAGIREETGRQLGDRITFSGQVKNYQN  140

Query  490   TKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvq  663
             T +Q+   L   D  A  L+K I+ VG+GSNDYLNNYFMP  Y T   + P ++A +L+ 
Sbjct  141   TVSQVVNLLGDEDQAANYLSKCIYSVGLGSNDYLNNYFMPQFYSTGNQFTPEEYADSLIH  200

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQM  837
              Y QQLT LY  GARK VL GIG++GC P  LA+   D   C++ +N A   FN+ +K +
Sbjct  201   DYGQQLTILYNYGARKVVLFGIGQIGCSPNELAQNSPDGSSCVQKINSANQIFNSKLKAL  260

Query  838   INKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPC  1017
              N+F+T   DA+F+F+D+  +FQ I++N  +YGF V + GCCGVG+N+G++TCLPF+TPC
Sbjct  261   ANEFNTNLADARFIFVDSYGIFQDIISNPAQYGFRVTNAGCCGVGRNNGQITCLPFQTPC  320

Query  1018  SNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
              NR EYLFWDAFHPT A N ++   A++       YP+ I
Sbjct  321   QNRDEYLFWDAFHPTEAGNAVIARRAYSAVQASDAYPVDI  360



>ref|XP_010112067.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXC32486.1| GDSL esterase/lipase [Morus notabilis]
Length=378

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 217/344 (63%), Gaps = 8/344 (2%)
 Frame = +1

Query  127   LGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTI  306
             +G +    +  VPAMF+FGDSL+DNGNNNNL S AKANY PYG DFN   TGRF+NG TI
Sbjct  29    MGLAAAVGSPQVPAMFVFGDSLVDNGNNNNLRSLAKANYYPYGCDFNGGSTGRFTNGRTI  88

Query  307   VDSIAKQLGLPMIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDN  480
             VD +   LGLP + A+ E  +    R   GVNYASAA GILD TGQHF  R   ++Q+ N
Sbjct  89    VDMLGALLGLPYLPAFKEIENTAGSRAVGGVNYASAAGGILDETGQHFGERYSMSQQVMN  148

Query  481   FEKT-KNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFASt  654
             FE+T KN+L   +S   + + L KSI  + +GSNDY+NNY +P  Y ++  Y P QFA+ 
Sbjct  149   FERTLKNELGRMMSGSSLRQYLAKSIVVLVLGSNDYINNYLLPSIYSSACTYTPPQFANL  208

Query  655   lvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANV  828
             L+  YT+ +  L++LG RKF++ GIG +GCIP   A  +A  G C + VN  +  FN  +
Sbjct  209   LLSHYTRHILALHSLGFRKFLVAGIGPLGCIPNQRASGKAPPGRCADYVNSMLGSFNEGL  268

Query  829   KQMINKFSTTHPD--AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLP  1002
             K  +   +  H    A F++ +T   F  I+NN   YGF V D  CCG+G+N G++TC+P
Sbjct  269   KSQVELLNRNHTGTGAMFLYGNTYGAFGDILNNPAAYGFKVIDTACCGIGRNQGQITCMP  328

Query  1003  FETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             F+ PC NR ++LFWDAFHPT A N +L   A+ G     YP+ +
Sbjct  329   FQVPCDNRNDHLFWDAFHPTEAANAVLAWRAYLGPPTDCYPINV  372



>ref|XP_009596154.1| PREDICTED: GDSL esterase/lipase At1g33811 isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 219/332 (66%), Gaps = 8/332 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + + A+ANY+PYGIDF    TGRF+NG T VD +A+ LG P
Sbjct  31    VPCFFIFGDSLVDNGNNNGILTLARANYMPYGIDFPQGATGRFTNGRTYVDILAQLLGFP  90

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y        +R G NYAS AAGI D TG +    +P N+Q++NF +T  +L    
Sbjct  91    NYIPPYARVRGRALLR-GANYASGAAGIRDETGNNLGDHMPMNQQVENFARTAEELRRLF  149

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqqltr  687
               +   +   L+K IF+ G+GSNDYLNNYFM  Y  T   Y P  +A+ L+Q Y +QL+ 
Sbjct  150   RGNNNTLNGYLSKCIFYSGLGSNDYLNNYFMTDYYSTHSQYTPQAYATALLQDYCKQLSE  209

Query  688   lytlGARKFVLTGIGKMGCIPTMLARAD--NGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY LGARK V+TG+G++GCIP  LAR D  +  C E +N A+L FN+ +K+++ +F+   
Sbjct  210   LYNLGARKVVVTGVGQIGCIPYELARYDGNDSRCNEEINNAILLFNSGLKKLVVRFNKVL  269

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             P AKFVF+D+ +  + ++ N K YGF V D+GCCGVG+N+G++TCLP + PC +R +Y+F
Sbjct  270   PGAKFVFLDSFESTKDLVVNAKTYGFEVVDKGCCGVGRNNGQITCLPLQQPCDDRSKYIF  329

Query  1042  WDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             WDAFHPT   N++L   +++  S    YP+ I
Sbjct  330   WDAFHPTEVANIILAKKSYSSISKTFAYPINI  361



>gb|EPS68861.1| hypothetical protein M569_05905 [Genlisea aurea]
Length=365

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 213/317 (67%), Gaps = 6/317 (2%)
 Frame = +1

Query  163   PAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPM  342
             P +F+FGDSL+DNGNNNN+ S A+ANYLPYG+D+ + PTGRFSNG T VD IA+ LG+  
Sbjct  31    PCLFVFGDSLVDNGNNNNIQSLARANYLPYGVDYPDGPTGRFSNGKTSVDVIAELLGIDQ  90

Query  343   -IAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
              I  Y  +   D +R GVN+ASAAAGI   TG     RI F+EQ++N++ T  ++   L 
Sbjct  91    PILPYSSASGQDVLR-GVNFASAAAGIRQETGMQLGARIAFSEQVNNYKNTAAEVVNILG  149

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  + K +F VGMGSNDYLNNYFMP  Y TS  Y P ++A  L+Q+YT Q+  LY
Sbjct  150   DEDSAANYIGKCVFSVGMGSNDYLNNYFMPQYYQTSQQYTPEEYADALIQEYTHQIQALY  209

Query  694   tlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKF L GI ++GC P  LA+   D   C+E +N A   FN  +  ++++F++   D
Sbjct  210   NYGARKFALIGISQIGCSPNSLAQGSPDGRTCVERINGANRMFNDRLYTLVDEFNSNSQD  269

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +FQ ++ N   YGF V + GCCGVG+N+G++TCLP +TPCSNR+EY+FWD
Sbjct  270   ANFTYINAYAIFQDLIANPSPYGFRVTNAGCCGVGRNNGQITCLPLQTPCSNREEYVFWD  329

Query  1048  AFHPTSAVNVLLGNLAF  1098
             AFHPT   N ++G  +F
Sbjct  330   AFHPTERANTIIGRRSF  346



>ref|XP_010273431.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Nelumbo nucifera]
Length=374

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 165/333 (50%), Positives = 220/333 (66%), Gaps = 7/333 (2%)
 Frame = +1

Query  154   ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLG  333
             A VP  FIFGDSL+DNGNNN L S A+A+Y+PYGIDF+  PTGRF NG T  D IA+ LG
Sbjct  37    AEVPCYFIFGDSLVDNGNNNQLSSLARADYMPYGIDFDGGPTGRFCNGKTTTDVIAQLLG  96

Query  334   LP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSA  510
                 I  Y  +   D ++ GVN+ASAAAGI D TG+    RI  N Q+ N++   +Q+  
Sbjct  97    FDDYIPPYATTRGQDLLK-GVNFASAAAGIRDETGRQLGDRITMNGQVRNYQSVASQIVQ  155

Query  511   NLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqlt  684
              L  +  A D L+K IF VGMGSNDYLNNYFMP  Y TS  Y P Q+A  L+Q+YT QL 
Sbjct  156   ILGDEASAADHLSKCIFTVGMGSNDYLNNYFMPLYYTTSQEYTPEQYADALIQEYTGQLR  215

Query  685   rlytlGARKFVLTGIGKMGCIPTMLAR-ADNG-ECLESVNQAVLPFNANVKQMINKFSTT  858
              LY  GARK  L G+G++GC P  LA+ + NG  C++ +N A   FN  +K +++ F++ 
Sbjct  216   TLYNYGARKVALIGVGQIGCSPNQLAQNSQNGVACVDRINVANQMFNNKLKALVDNFNSN  275

Query  859   HPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
                AKF +I+   +F+ ++ N   YGF+V + GCCGVG+N+G++TCLP +TPC NR +YL
Sbjct  276   LDGAKFTYINAYGIFEDMLKNPSAYGFTVTNTGCCGVGRNNGQITCLPLQTPCQNRNQYL  335

Query  1039  FWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             FWDAFHPT A NV++G  ++   S+   YP+ I
Sbjct  336   FWDAFHPTEAANVIVGKRSYRAQSSSDAYPVDI  368



>ref|XP_002456282.1| hypothetical protein SORBIDRAFT_03g033460 [Sorghum bicolor]
 gb|EES01402.1| hypothetical protein SORBIDRAFT_03g033460 [Sorghum bicolor]
Length=364

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 164/365 (45%), Positives = 222/365 (61%), Gaps = 17/365 (5%)
 Frame = +1

Query  55    LFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAK  234
             L  +  V VS      PV    P            VP  FIFGDSL+DNGNNN + S A+
Sbjct  6     LLCVVAVVVSCWALAAPVARCDPQ-----------VPCYFIFGDSLVDNGNNNYIVSLAR  54

Query  235   ANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVNYASAAA  414
             ANY PYGIDF   P+GRF+NG T VD IA+ LG         + S DQ+  G N+ASAAA
Sbjct  55    ANYPPYGIDFAGGPSGRFTNGLTTVDVIAQLLGFDNFIPPFAATSGDQLLGGANFASAAA  114

Query  415   GILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-SADVVAKDLTKSIFFVGMGSNDYLN  591
             GI   TGQ   GRIPF  Q+ N++     L + L   D  +  L++ IF +GMGSNDYLN
Sbjct  115   GIRAETGQQLGGRIPFAGQVQNYQTAVQTLVSILGDQDTASDHLSRCIFSIGMGSNDYLN  174

Query  592   NYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLAR-  765
             NYFMP  Y T   Y P Q+A +L+  Y + L  LY+ GARK V+ G+G++GC P  LAR 
Sbjct  175   NYFMPAFYNTGSRYTPEQYADSLIADYRRYLQTLYSYGARKVVMIGVGQVGCAPNELARY  234

Query  766   -ADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFS  942
              AD   C++ ++ A+  FN  +  ++++F+   P A F FI+   +F  I+ N   YGF+
Sbjct  235   SADGVTCVDRIDDAIQMFNRRLVGLVDEFNAL-PGAHFTFINAYNIFDDILANAASYGFT  293

Query  943   VFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG-SNYLV  1119
             V + GCCGVG+N+G+VTCLP++ PC+NR +++FWDAFHP+ A N+++G  ++   S   V
Sbjct  294   VTNAGCCGVGRNNGQVTCLPYQAPCANRDQHIFWDAFHPSEAANIIVGRRSYRAESPNDV  353

Query  1120  YPMTI  1134
             YPM I
Sbjct  354   YPMDI  358



>ref|XP_010521634.1| PREDICTED: GDSL esterase/lipase At5g08460 [Tarenaya hassleriana]
Length=382

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 217/342 (63%), Gaps = 9/342 (3%)
 Frame = +1

Query  136   SGEGNN-ALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVD  312
             +G+G + AL PAMF+FGDSL+DNGNNN L S A++NY PYGIDFN  PTGRFSNG T VD
Sbjct  35    AGDGTSPALFPAMFVFGDSLVDNGNNNYLNSLARSNYFPYGIDFNGGPTGRFSNGKTFVD  94

Query  313   SIAKQLGLPMIAAYLESPSID-QMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEK  489
              I + LGLP I AY+E+ +    +  GVNYASAA GIL+ TG+H   R+    Q+ NF +
Sbjct  95    FIGELLGLPPIPAYMETLNGGASILRGVNYASAAGGILEETGRHLGERMSMGRQVMNFGR  154

Query  490   TKNQLSANLSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvq  663
             T  +L + ++ +    + L KS+  V +G+NDY+NNY  P  Y TS  YDP  FA  L+ 
Sbjct  155   TLMELRSTMTEEEALNEYLAKSLVVVSLGNNDYINNYLKPSLYLTSSIYDPTAFADILLS  214

Query  664   qytqqltrlytlGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQM  837
              +T  L  L   G RKFV+  +G +GCIP  LA  +A  GEC+  VN     FN  ++ +
Sbjct  215   NFTNHLLELKGKGFRKFVVGAVGPLGCIPDQLAAGKAPPGECVSEVNDMAELFNLRLRSL  274

Query  838   INKFS---TTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFE  1008
             +++ +    T P   FV+ +T   F  I+++   YGF V D GCCGVG+N GE+TCLP E
Sbjct  275   VDRLNNDDETSPRPVFVYGNTYGAFVDILSHPLAYGFDVTDTGCCGVGRNRGEITCLPLE  334

Query  1009  TPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
              PC+ R+ ++FWDAFHPT A N+++   AFNGS    YP  +
Sbjct  335   VPCAMRERHVFWDAFHPTEAFNMIIALRAFNGSQSDCYPFNL  376



>ref|XP_011095907.1| PREDICTED: GDSL esterase/lipase At1g33811 [Sesamum indicum]
Length=374

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 223/333 (67%), Gaps = 9/333 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP +FIFGDSL+DNGNNN++ + A+A+Y PYGIDF    TGRF+NG T VD +A+ LG P
Sbjct  37    VPCLFIFGDSLVDNGNNNDILTLARADYGPYGIDFPQGATGRFTNGRTFVDILAQLLGFP  96

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +     ++ G NYAS A+GI D TG +    +  N Q+D+F  T  QL+   
Sbjct  97    NYILPYARARGRALLQ-GANYASGASGIRDETGNNLGDHMSMNRQVDSFASTVQQLNRYF  155

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqqltr  687
               D   +   L+K IF+ G+GSNDYLNNYFM  Y  TS  Y P  +A++L++ YT+QLT 
Sbjct  156   KGDGNALGNYLSKCIFYSGLGSNDYLNNYFMSDYYSTSSEYTPRTYAASLIEDYTKQLTE  215

Query  688   lytlGARKFVLTGIGKMGCIPTMLARAD-NG-ECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY LGARK V+TG+G++GCIP  LAR D NG  C E +N A+  FN  +K+++++F+   
Sbjct  216   LYKLGARKVVVTGVGQIGCIPYQLARYDGNGSRCNEEINNAIALFNTGLKRLVDRFNKGQ  275

Query  862   -PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P AKF+++D+ +  Q ++ N K YGF V D GCCGVGKN+G++TCLP + PC +RQ+YL
Sbjct  276   LPGAKFIYLDSFQSSQDLVLNAKTYGFEVVDEGCCGVGKNNGQITCLPLQMPCDDRQKYL  335

Query  1039  FWDAFHPTSAVNVLLGNLAF-NGSNYLVYPMTI  1134
             FWDAFHPT A N+LL   A+ + S    YP+ I
Sbjct  336   FWDAFHPTEAANILLAKKAYISKSKSHAYPINI  368



>ref|XP_004969823.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Setaria italica]
Length=361

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 212/330 (64%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANY PYGIDF   P+GRF+NG T VD IA+ LG  
Sbjct  27    VPCYFIFGDSLVDNGNNNYIVSLARANYPPYGIDFAGGPSGRFTNGLTTVDVIAQLLGFD  86

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                    + S DQ+  G N+ASAAAGI   TGQ   GRIPF  Q+ N++     L + L 
Sbjct  87    NFIPPFAATSGDQLLGGANFASAAAGIRAETGQQLGGRIPFAGQVQNYQTAVQTLVSILG  146

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  +  L++ IF VGMGSNDYLNNYFMP  Y T   Y P QFA  L+  Y + L  LY
Sbjct  147   DQDTASDHLSRCIFSVGMGSNDYLNNYFMPAFYNTGSRYSPEQFADALIADYRRYLQVLY  206

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK VL G+G++GC P  LAR  AD   C++ ++ A+  FN  +  ++++F+   P 
Sbjct  207   NYGARKVVLIGVGQVGCSPNELARYSADGVTCVDRIDGAIQIFNRRLVGLVDEFNAL-PG  265

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F FI+   +F  ++ N   YGF+V + GCCGVG+N+G+VTCLP++ PC+NR +++FWD
Sbjct  266   AHFTFINAYNIFDDLLANAASYGFTVTNAGCCGVGRNNGQVTCLPYQAPCANRDQHIFWD  325

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP+ A N+++G  ++   S   VYPM I
Sbjct  326   AFHPSEAANIIVGRRSYRAESPNDVYPMDI  355



>ref|XP_007148614.1| hypothetical protein PHAVU_005G001200g [Phaseolus vulgaris]
 gb|ESW20608.1| hypothetical protein PHAVU_005G001200g [Phaseolus vulgaris]
Length=371

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 219/332 (66%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + + A+ANY PYGIDF    TGRF+NG T VD++A+ LG P
Sbjct  36    VPCFFIFGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFP  95

Query  340   M-IAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I     +  ++ +R G NYAS AAGI D TG +  G    N+Q+ NF  T  QL    
Sbjct  96    TYIPPNSRARGLELLR-GANYASGAAGIRDETGNNLGGHTSMNDQVANFGNTVQQLRRFF  154

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
               D   +   L+K +FF GMGSNDYLNNYFMP  Y TS  +    FAS L+Q Y++QL++
Sbjct  155   RGDNDSLNSYLSKCLFFSGMGSNDYLNNYFMPDFYSTSSDFTVKAFASALLQDYSRQLSQ  214

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY+LGARK ++T +G++GCIP  LAR   ++ +C E +N A+L FN+ +K+M+  F+   
Sbjct  215   LYSLGARKVMVTAVGQIGCIPYQLARFHGNSTKCNEKINSAILLFNSGLKKMVQNFNGGQ  274

Query  862   -PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P AKFVF+D  +    + +N   YGF V D+GCCGVGKN+G++TCLP + PC NRQ+YL
Sbjct  275   LPGAKFVFLDFYQSSSDLSSNGTSYGFDVMDKGCCGVGKNNGQITCLPLQQPCENRQKYL  334

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT   N+LL    ++  +Y  YP+ I
Sbjct  335   FWDAFHPTEVANILLAKATYSSQSY-TYPINI  365



>gb|KFK44793.1| hypothetical protein AALP_AA1G304100 [Arabis alpina]
Length=364

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 212/330 (64%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+Y PYGID    PTGRFSNG T VD +A  LG  
Sbjct  30    VPCYFIFGDSLVDNGNNNRLISVARADYFPYGIDLGR-PTGRFSNGKTTVDELAILLGFD  88

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S +Q+  GVNYASAAAGI + TGQ    RI F+ Q+ N++ T +Q+   L 
Sbjct  89    NYIPAYSDVSGEQILQGVNYASAAAGIREETGQQLGQRITFSGQVQNYKSTVSQVVQILG  148

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L+K I+ +GMGSNDYLNNYFMP  Y TS  Y+P+Q+A  L+ +Y  QL  LY
Sbjct  149   DENTAADYLSKCIYTIGMGSNDYLNNYFMPQSYSTSRQYNPDQYADDLISRYYNQLNDLY  208

Query  694   tlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKF L GIG +GC P  LA+   D   C+E +N A   FN  +K M+N+ +    D
Sbjct  209   RYGARKFALVGIGAIGCSPNALAQGSPDGRTCVERINSANRIFNNKLKSMVNRLNNNRAD  268

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF +I+   +FQ I++N  +YGF+  +  CCGVG+N G++TCLP + PC NR E++FWD
Sbjct  269   AKFTYINAYGVFQDIISNPSQYGFTDTNTACCGVGRNGGQLTCLPGQPPCLNRDEHVFWD  328

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A N ++   ++   S+  VYP+ I
Sbjct  329   AFHPTDAANTIIAQRSYQAQSSSDVYPIDI  358



>ref|XP_011035467.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Populus euphratica]
Length=367

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 233/371 (63%), Gaps = 20/371 (5%)
 Frame = +1

Query  43    VFSALFILALVF-VSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNL  219
             +    +++ ++F V  ++EP    AQ              VP  FIFGDSL+DNGNNN L
Sbjct  4     MLKKCWMVGVIFAVVLLSEPYGARAQQ-------------VPGYFIFGDSLVDNGNNNQL  50

Query  220   FSFAKANYLPYGIDFNN-NPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRYGVN  396
              S A+A+YLPYGIDF    PTGRFSNG T VD IA+QLG         +     +  GVN
Sbjct  51    SSLARADYLPYGIDFRPPRPTGRFSNGKTTVDVIAEQLGFRNYIPPYATARGRAILGGVN  110

Query  397   YASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-SADVVAKDLTKSIFFVGMG  573
             YASAAAGI D TG+    RI F+ Q+ N++ T +Q+   L   D  A  L++ IF + +G
Sbjct  111   YASAAAGIRDETGRQLGDRISFSGQVRNYQNTVSQIVNILGDEDTAANYLSRCIFSIALG  170

Query  574   SNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIP  750
             SNDYLNNYFMP  Y +S  Y P Q+A+ L+QQYT QL  LY  GARKFVL G+G++GC P
Sbjct  171   SNDYLNNYFMPQIYSSSRQYTPEQYANVLIQQYTDQLKILYNYGARKFVLVGVGQIGCSP  230

Query  751   TMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNN  924
             + LA+   D   C++ +N A   FN  ++ ++ +F+   PDA+F++I+   +FQ I++  
Sbjct  231   SQLAQNSPDGRTCVQKINSANQIFNNKLRSLVAQFNGNTPDARFIYINAYGIFQDIISRP  290

Query  925   KRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG  1104
               +GF+V + GCCGVG+N+G++TCLP + PC NR +Y+FWDAFHPT A NV++G  +++ 
Sbjct  291   ATFGFTVTNAGCCGVGRNNGQITCLPLQNPCRNRNQYVFWDAFHPTEAANVIIGRRSYSA  350

Query  1105  -SNYLVYPMTI  1134
              S    YP  I
Sbjct  351   QSASDAYPFDI  361



>ref|XP_008786406.1| PREDICTED: GDSL esterase/lipase At1g33811 [Phoenix dactylifera]
Length=369

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 218/336 (65%), Gaps = 11/336 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANY PYG+DF    +GRF+NG T+VD +A+ LG  
Sbjct  28    VPCFFIFGDSLVDNGNNNGILSLARANYRPYGVDFPQGASGRFTNGRTMVDILAQFLGFR  87

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    +   D++  G+NYAS AAG+   TG +     PF EQI++F  T   +     
Sbjct  88    SFIPPYATARGDEVLRGLNYASGAAGLRSETGSNLGQHYPFAEQINHFRNTVQYMRRTFK  147

Query  520   ADV--VAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqltrl  690
              +   +   L+K I+FVGMGSNDYLNNYFMP  YPTS+ Y P+ FA+ L+Q Y+QQL +L
Sbjct  148   GNTTKLRDHLSKCIYFVGMGSNDYLNNYFMPFYYPTSYEYSPSTFATLLLQAYSQQLMQL  207

Query  691   ytlGARKFVLTGIGKMGCIPTMLARADNG-------ECLESVNQAVLPFNANVKQMINKF  849
             Y LGARK  + GIG++GCIP  LAR  N        +C E++N+ +  FN  + QM+N+F
Sbjct  208   YNLGARKVAIIGIGQVGCIPYELARNRNSNNGRNNSQCNETINKDITIFNNGLVQMVNRF  267

Query  850   STTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQ  1029
             +     AKF++++T +  + I  N   YGF V DRGCCGVG+N+G++TCLP++TPCS+R 
Sbjct  268   NKQKSGAKFIYVNTFQTSKDIAANAASYGFKVVDRGCCGVGRNNGQITCLPYQTPCSDRT  327

Query  1030  EYLFWDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             +YLFWDAFHPT   NV+    A++  S    YPM I
Sbjct  328   KYLFWDAFHPTEVANVIYARKAYSSKSKSDAYPMNI  363



>gb|EAY75691.1| hypothetical protein OsI_03598 [Oryza sativa Indica Group]
 gb|EAZ13410.1| hypothetical protein OsJ_03329 [Oryza sativa Japonica Group]
Length=363

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 209/330 (63%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANY PYGIDF   P+GRF+NG T VD IA+ LG  
Sbjct  29    VPCYFIFGDSLVDNGNNNYIVSLARANYPPYGIDFAGGPSGRFTNGLTTVDVIAQLLGFD  88

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    + S DQ+  G N+ASAAAGI   TGQ   GRIPF  Q+ N++     L + L 
Sbjct  89    NFIPPYAATSGDQILNGANFASAAAGIRAETGQQLGGRIPFAGQVQNYQTAVQTLISILG  148

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
                 A D L+K IF VGMGSNDYLNNYFMP  Y T   Y P QFA +L+  Y + +  LY
Sbjct  149   DQDTASDRLSKCIFSVGMGSNDYLNNYFMPAFYNTGSQYTPEQFADSLIADYRRYVQVLY  208

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK V+ G+G++GC P  LAR  AD   C+  ++ A+  FN  +  ++++ +T  P 
Sbjct  209   NYGARKVVMIGVGQVGCSPNELARYSADGATCVARIDSAIQIFNRRLVGLVDEMNTL-PG  267

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F FI+   +F  I+ N   YGF+    GCCGVG+N+G+VTCLP+E PCSNR +++FWD
Sbjct  268   AHFTFINAYNIFSDILANAASYGFTETTAGCCGVGRNNGQVTCLPYEAPCSNRDQHIFWD  327

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP+ A N+++G  ++   S    YPM I
Sbjct  328   AFHPSEAANIIVGRRSYRAESPNDAYPMDI  357



>ref|XP_011010176.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Populus euphratica]
Length=365

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 222/332 (67%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S AKANY+PYGIDF   PTGRFSNG T VD IA+QLG  
Sbjct  30    VPCYFIFGDSLVDNGNNNQLSSLAKANYMPYGIDFPRGPTGRFSNGRTTVDVIAQQLGFR  89

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+  N+
Sbjct  90    NYIPPYATARGRDILG-GVNYASAAAGIREETGRQLGDRISFSGQVRNYQNTVSQI-VNI  147

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
               D    A  L+K I  + +GSNDYLNNYFMP  Y +S  Y P Q+A+ L+QQYTQQL  
Sbjct  148   LGDKNTTANYLSKCIVSIALGSNDYLNNYFMPQFYSSSRQYTPEQYANVLIQQYTQQLRI  207

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY  GARKF L G+G++GC P+ LA+   D   C++ +N A   FN  ++ ++ +F+   
Sbjct  208   LYNNGARKFALIGLGQIGCSPSELAQNSPDGRTCVQRINSANQIFNNKLRSLVAQFNGNT  267

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             PDA+F++I+   +FQ ++     YGF+  + GCCGVG+N+G++TCLP ++PC NR +Y+F
Sbjct  268   PDARFIYINVYGIFQDLITRPAAYGFTNTNAGCCGVGRNNGQITCLPLQSPCQNRNQYVF  327

Query  1042  WDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             WDAFHPT AVN+++G  +++  S    YP  I
Sbjct  328   WDAFHPTEAVNIIIGRRSYSAQSASDAYPYDI  359



>gb|EYU28213.1| hypothetical protein MIMGU_mgv1a008354mg [Erythranthe guttata]
Length=376

 Score =   295 bits (755),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 212/317 (67%), Gaps = 9/317 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP +FIFGDSL+DNGNNN + S A+ANY+PYGIDF    TGRF+NG T VD +A+ LG P
Sbjct  36    VPGLFIFGDSLVDNGNNNGILSLARANYMPYGIDFPQGATGRFTNGRTFVDILAQLLGFP  95

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                          +  G NYAS A+GI D TG +    +  N+Q+D+F  T  QL     
Sbjct  96    NYIPPYARTGGRALFQGANYASGASGIRDETGNNLGDHMSMNQQVDHFATTVQQLRRYFR  155

Query  520   AD---VVAKDLTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqqltr  687
              D    +A  L+K IF+ G+GSNDYLNNYFM  Y PTS  Y P  +A++L+Q Y++QL  
Sbjct  156   GDNINALAAYLSKCIFYCGLGSNDYLNNYFMTDYYPTSSQYTPKAYAASLIQDYSKQLAG  215

Query  688   lytlGARKFVLTGIGKMGCIPTMLARAD---NGECLESVNQAVLPFNANVKQMINKFSTT  858
             LY LGARK V+ G+G++GCIP  LAR +   +  C E +N A++ FN  +K+++++F+  
Sbjct  216   LYKLGARKVVVAGVGQIGCIPYQLARYNGNSSNRCNEEINSAIVLFNTGLKRLVDQFNKR  275

Query  859   H--PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQE  1032
                P AKFV++D+ +  + ++ N K YGF V D+GCCGVG+N+G++TCLP +TPC NRQ+
Sbjct  276   GQLPGAKFVYLDSFESSKDLVQNAKTYGFEVADKGCCGVGRNNGQITCLPLQTPCDNRQK  335

Query  1033  YLFWDAFHPTSAVNVLL  1083
             Y+FWDAFHPT A N+L 
Sbjct  336   YVFWDAFHPTEAANILF  352



>ref|XP_010549444.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Tarenaya hassleriana]
Length=365

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 213/329 (65%), Gaps = 4/329 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+ANY PYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  31    VPCYFIFGDSLVDNGNNNRLVSLARANYFPYGIDFPGGPTGRFSNGKTTVDVIAQLLGFD  90

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    + S  Q+  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+   L 
Sbjct  91    GYIPPYSAASGRQILSGVNYASAAAGIREETGRQLGQRISFSGQVRNYQNTVSQVVNLLG  150

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L + I+ VG+GSNDYLNNYFMP  Y +S  + P QFA  L+ +Y+QQL  LY
Sbjct  151   DENTAADYLRRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQFADDLINRYSQQLNALY  210

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPDA  870
               GARKF L G+G +GC P  LA + +G  C E +N A   FN  ++ ++++ +   PDA
Sbjct  211   NYGARKFALIGVGAIGCSPNKLANSRDGRTCDERINSANQIFNNKLRSLVDRLNNNLPDA  270

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             KF++I+   +FQ ++NN   YGF V + GCCGVG+N G++TCLP + PC +R  Y+FWDA
Sbjct  271   KFIYINAYGIFQDLVNNPSAYGFRVTNAGCCGVGRNGGQITCLPGQRPCQSRNAYVFWDA  330

Query  1051  FHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             FHPT A N ++G  ++   S+   YP  I
Sbjct  331   FHPTEAANTIIGQRSYRARSSSDAYPFDI  359



>ref|XP_010549442.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Tarenaya hassleriana]
Length=363

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 216/329 (66%), Gaps = 4/329 (1%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+YLPYGIDF   PTGRFSNG T VD IA+ LG  
Sbjct  29    VPCYFIFGDSLVDNGNNNQLSSLARADYLPYGIDFPGGPTGRFSNGQTTVDVIAELLGFD  88

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      +  ++  GVNYASAAAGI + +GQ    RI F+ Q+ N++ T  Q+   L 
Sbjct  89    DYIPPYSGVNGQEILTGVNYASAAAGIREESGQQLGQRITFSGQVQNYQNTVAQVVNLLG  148

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L K I+ +G+GSNDYLNNYFMP  Y +S  + P Q+A  L+ +Y+QQL  LY
Sbjct  149   DENTAADYLRKCIYSIGLGSNDYLNNYFMPTFYSSSRQFTPEQYADDLIDRYSQQLNALY  208

Query  694   tlGARKFVLTGIGKMGCIPTMLARADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPDA  870
               GARKF L G+G +GC P  LA + +G  C + +N A   FN  ++ ++++ +    DA
Sbjct  209   NYGARKFALIGVGAIGCSPNKLANSPDGTTCDDEINSANQIFNNKLRSLVDRLNNELSDA  268

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             KF F++   +FQ ++NN   YGFSV + GCCGVG+N+G++TCLP + PC NR+EY+FWDA
Sbjct  269   KFTFVNAYGIFQDLINNPSAYGFSVTNAGCCGVGRNNGQITCLPGQNPCPNRKEYVFWDA  328

Query  1051  FHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             FHPT A N ++G  ++   +Y  VYP+ I
Sbjct  329   FHPTEAANAIIGQRSYRAQSYSDVYPIDI  357



>ref|XP_002267889.1| PREDICTED: GDSL esterase/lipase At5g08460 [Vitis vinifera]
 emb|CBI27701.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   295 bits (754),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 218/328 (66%), Gaps = 4/328 (1%)
 Frame = +1

Query  163   PAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPM  342
             PAMF+ GDS++D+GNNNNL S AK+N++PYGIDFN  P+GRF NG TI+D + + LGLP 
Sbjct  32    PAMFVMGDSIVDDGNNNNLNSLAKSNFMPYGIDFNGGPSGRFCNGKTIIDFLGELLGLPY  91

Query  343   IAAYLESPSID-QMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
             + A+ +S +    +  GVNYASAAAGILD TG++   R   ++Q+ NFE T NQL + + 
Sbjct  92    LPAFADSSTTGGNVLRGVNYASAAAGILDETGRNLGDRYSLSQQVQNFESTLNQLRSQMD  151

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlyt  696
              + +++ L KS+  + +GSNDY+NNY  P  Y +S+ Y P  +A  L+  YT+Q+  L++
Sbjct  152   ENSLSQYLAKSLVVIVLGSNDYINNYLKPSFYTSSYLYTPIDYADLLINHYTRQILTLHS  211

Query  697   lGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
             LG RKF L  IG +GCIP  LA   A   +C+  VN+ V  FN  ++ ++++ +  HP A
Sbjct  212   LGFRKFFLADIGPLGCIPNQLATGLAPPRKCVFFVNELVKMFNTRLRSLVDQLNANHPGA  271

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
              FV  +T +    I+N+   YGFSV +R CCG+G N  ++TCLPF  PC +R +Y+FWDA
Sbjct  272   IFVHGNTYRALNDILNSPINYGFSVTNRACCGMGMNQAQITCLPFSVPCVDRDQYVFWDA  331

Query  1051  FHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FHPT AVN +L + A+ GS    YP+ I
Sbjct  332   FHPTQAVNKILAHKAYAGSRSECYPINI  359



>ref|XP_010460737.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Camelina sativa]
Length=364

 Score =   294 bits (753),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 212/330 (64%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+Y PYGIDF   PTGRFSNG T VD +A+ LG  
Sbjct  30    VPCYFIFGDSLVDNGNNNRLTSIARADYFPYGIDFGG-PTGRFSNGKTTVDVLAELLGFD  88

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    S S  Q+  GVNYASAAAGI D TG     RI F+ Q++N++ T +Q+   L 
Sbjct  89    NYIPPYSSVSGQQILQGVNYASAAAGIRDETGAQLGQRITFSGQVENYKNTVSQVVEILG  148

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L + I+ +GMGSNDYLNNYFMP  Y TS  Y P Q+A  L+ +Y +QL  LY
Sbjct  149   DENTAADYLKRCIYTIGMGSNDYLNNYFMPQVYATSRQYSPEQYAQDLITRYREQLNALY  208

Query  694   tlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             + GARKF L G+G +GC P  LA+   D   C+E +N A   FN  +K ++ + +  H D
Sbjct  209   SYGARKFALVGVGAIGCSPNELAQGSPDGTTCVERINSANRIFNNKLKSLVQQLNNDHSD  268

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F +I+   +FQ I+ N   YGF+V +  CCGVG+N G++TCLP + PC NR EY+FWD
Sbjct  269   ARFTYINAYGVFQDIIANPSAYGFTVTNAACCGVGRNGGQLTCLPGQPPCPNRNEYVFWD  328

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP+ A N ++   ++N  S+  VYP  I
Sbjct  329   AFHPSDAANTVIAQRSYNAQSSSDVYPYDI  358



>ref|XP_003526398.2| PREDICTED: GDSL esterase/lipase At1g33811-like [Glycine max]
Length=376

 Score =   295 bits (754),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 217/332 (65%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  +IFGDSL+DNGNNN + + A+ANY PYGIDF    TGRF+NG T VD++A+ LG P
Sbjct  41    VPCFYIFGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFP  100

Query  340   M-IAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               IA Y  +  ++ +R G NYAS AAGI + TG +       NEQ+ NF  T  QL    
Sbjct  101   TYIAPYSRARGLELLR-GANYASGAAGIREETGSNLGAHTSLNEQVANFGNTVQQLRRFF  159

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
               D   +   L K +FF GMGSNDYLNNYFM   Y TS  Y    FA+ L+Q Y++QL++
Sbjct  160   RGDNESLNSYLNKCLFFSGMGSNDYLNNYFMSDFYSTSSDYTVKAFATVLLQDYSRQLSQ  219

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY+LGARK ++T +G++GCIP  LAR   +N  C E +N A+  FN+ +K+M+  F+   
Sbjct  220   LYSLGARKVMVTAVGQIGCIPYQLARFHGNNSRCNEKINNAISLFNSGLKKMVQNFNGGQ  279

Query  862   -PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P AKFV++D  +  Q + +N   YGF V D+GCCGVG+N+G++TCLP + PC NRQ+YL
Sbjct  280   LPGAKFVYLDFYESSQDLSSNGTSYGFDVIDKGCCGVGRNNGQITCLPLQQPCENRQKYL  339

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT   N+LL    ++  +Y  YP+ I
Sbjct  340   FWDAFHPTELANILLAKATYSSQSY-TYPINI  370



>ref|XP_010423079.1| PREDICTED: GDSL esterase/lipase At5g08460-like [Camelina sativa]
Length=371

 Score =   295 bits (754),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 169/371 (46%), Positives = 229/371 (62%), Gaps = 16/371 (4%)
 Frame = +1

Query  49    SALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSF  228
             S+  + +LV VS     V VLA     G     + A+ PAMF+FGDSL+DNGNNN+L S 
Sbjct  2     SSFTVHSLVLVSWFV-VVAVLA-----GGEDSSDTAMFPAMFVFGDSLVDNGNNNHLNSL  55

Query  229   AKANYLPYGIDF-NNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLES--PSIDQMRYGVNY  399
             A++NYLPYGIDF  N PTGRF NG TIVD + + LGLP I A++++    +D  R GVNY
Sbjct  56    ARSNYLPYGIDFAGNQPTGRFCNGKTIVDFVGELLGLPDIPAFMDTVDGEVDISR-GVNY  114

Query  400   ASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSN  579
             ASAA GIL+  G+    R     Q++NFEKT  +++    ++ V + + KS+  V MG+N
Sbjct  115   ASAAGGILEENGRQLGERFSMARQVENFEKTLVEITRMSRSESVKEYMAKSLVVVSMGNN  174

Query  580   DYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTM  756
             DY+NNY  P  + TS  YDP  FA  LV  +T     LY  G RKFV+ G+G +GCIP  
Sbjct  175   DYINNYLKPSLFLTSSIYDPTSFADLLVSNFTTHPLELYGKGFRKFVIAGVGPLGCIPDQ  234

Query  757   LAR--ADNGECLESVNQAVLPFNANVKQMINKFST---THPDAKFVFIDTDKMFQHIMNN  921
             LA   A  GEC+E+VN+    FN  +  ++++ ++   T  +  FV+ +T      I+ N
Sbjct  235   LAAGAAPPGECVEAVNEMAELFNNRLISLVDRLNSDNKTASEGIFVYGNTYGAAVDILTN  294

Query  922   NKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFN  1101
                YGF V DRGCCGVG+N GE+TCLP   PC+ R  ++FWDAFHPT A N+++   AFN
Sbjct  295   PFAYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDAFHPTEAFNLIIARRAFN  354

Query  1102  GSNYLVYPMTI  1134
             GS    YP+ +
Sbjct  355   GSKSDCYPINL  365



>gb|KHN20550.1| GDSL esterase/lipase [Glycine soja]
Length=381

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 217/332 (65%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  +IFGDSL+DNGNNN + + A+ANY PYGIDF    TGRF+NG T VD++A+ LG P
Sbjct  46    VPCFYIFGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFP  105

Query  340   M-IAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               IA Y  +  ++ +R G NYAS AAGI + TG +       NEQ+ NF  T  QL    
Sbjct  106   TYIAPYSRARGLELLR-GANYASGAAGIREETGSNLGAHTSLNEQVANFGNTVQQLRRFF  164

Query  517   SADVVAKD--LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
               D  + +  L K +FF GMGSNDYLNNYFM   Y TS  Y    FA+ L+Q Y++ L++
Sbjct  165   RGDNESLNSYLNKCLFFSGMGSNDYLNNYFMSDFYSTSSDYTVKAFATVLLQDYSRHLSQ  224

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY+LGARK ++T +G++GCIP  LAR   +N  C E +N A+  FN+ +K+M+  F+   
Sbjct  225   LYSLGARKVMVTAVGQIGCIPYQLARFHGNNSRCNEKINNAISLFNSGLKKMVQNFNGGQ  284

Query  862   -PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P AKFV++D  +  Q + +N   YGF V D+GCCGVG+N+G++TCLP + PC NRQ+YL
Sbjct  285   LPGAKFVYLDFYESSQDLSSNGTSYGFDVIDKGCCGVGRNNGQITCLPLQQPCENRQKYL  344

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT   N+LL    ++  +Y  YP+ I
Sbjct  345   FWDAFHPTELANILLAKATYSSQSY-TYPINI  375



>ref|XP_011102202.1| PREDICTED: uncharacterized protein LOC105180227 [Sesamum indicum]
Length=740

 Score =   305 bits (781),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 219/330 (66%), Gaps = 5/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNNN+ S A+ANYLPYGIDF + PTGRFSNG T VD IA+ LG  
Sbjct  31    VPCYFIFGDSLVDNGNNNNIQSLARANYLPYGIDFPDGPTGRFSNGKTTVDVIAELLGFD  90

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL-  516
                    S   +Q+  GVNYASAAAGI   TGQ    RI F  Q++N++ T  Q+   L 
Sbjct  91    DYIPPYASARGEQILRGVNYASAAAGIRSETGQQLGARIDFTGQVNNYKDTVEQVVNILG  150

Query  517   SADVVAKDLTKSIFFVGMGSNDYLNNYFMP-GYPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K I+ +G+GSNDYLNNYFMP  Y TS  Y P Q+A  L+QQY+QQ+  LY
Sbjct  151   DEDSAANYLSKCIYSIGVGSNDYLNNYFMPLYYSTSRQYSPEQYADILIQQYSQQIRTLY  210

Query  694   tlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKF L G+G++GC P  LA+   D   C++ +N A   FN  ++ ++++F++   D
Sbjct  211   NYGARKFALIGVGQIGCSPNALAQNSPDGSTCVQRINGANQIFNNKLRALVDEFNSDAQD  270

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             AKF++I+   +FQ ++ N   +GF V + GCCGVG+N+G++TCLP +TPC NR EYLFWD
Sbjct  271   AKFIYINAYGIFQDLIENPSAFGFRVTNAGCCGVGRNNGQITCLPLQTPCQNRDEYLFWD  330

Query  1048  AFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             AFHPT A N+++G  +++       YP  I
Sbjct  331   AFHPTEAANIIVGRRSYSAQKASDAYPFDI  360


 Score =   228 bits (581),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 191/320 (60%), Gaps = 16/320 (5%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL-  336
             VP  FIFGDSL+DNGNN N  + AK NY PYGIDF   PTGRF+NG  I D IA+ LG  
Sbjct  414   VPCFFIFGDSLVDNGNNINRNTTAKVNYFPYGIDFPGGPTGRFNNGRNIADIIAELLGFD  473

Query  337   PMIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               IA +  + + D +R GVNY S  +GIL+ TG  F   I F EQ+ N E   ++++  L
Sbjct  474   KYIAPFANATNQDILR-GVNYGSGGSGILEETGHLFGDVINFKEQLSNHEVVISRVARLL  532

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPGYPTSFFYDPNQFAStlvqqytqqltrly  693
              ++ VAK  L++ I+ VGMG+NDYL NY    +  +  Y P QFAS ++ QY++QL RLY
Sbjct  533   GSESVAKQHLSRCIYSVGMGNNDYLANYLPQYHSKTTPYTPRQFASLVIAQYSKQLRRLY  592

Query  694   tlGARKFVLTGIGKMGCIPTMLA---RADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
               GARK  +  +GK+GCIP  LA    +D   C+E+ N  V  FN  +K +I+  ++   
Sbjct  593   DAGARKVAVFALGKLGCIPQQLAAYGASDGSSCVETSNNVVKSFNEYLKILIHYLNSNLA  652

Query  865   DAKFVFIDTDKMFQHIMNNNKRYG-FSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             DAKFV+           ++++ YG  S     CCGV    G+  C+    PCSNR  YLF
Sbjct  653   DAKFVYTQD-------TSDSESYGNISNLSEPCCGVSAEDGQ--CVAGSAPCSNRDAYLF  703

Query  1042  WDAFHPTSAVNVLLGNLAFN  1101
             WDAFHPT A ++L   +A++
Sbjct  704   WDAFHPTEAASLLSAKIAYD  723



>ref|XP_010911116.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Elaeis guineensis]
Length=367

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 219/330 (66%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANY+PYGIDF   P+GRFSNG T VD IA+ LG  
Sbjct  33    VPCYFIFGDSLVDNGNNNYIASLARANYMPYGIDFPGGPSGRFSNGMTTVDVIAQLLGFD  92

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    +     +  G N+ASAAAGI + TGQ   GRI F  Q+ N++    ++   L 
Sbjct  93    DFIPPYATTRGQALLTGANFASAAAGIREETGQQLGGRINFGGQLQNYQAAVQEVVNILG  152

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K IF VGMGSNDYLNNYFMP  Y +S  Y P Q+A  L++QY+QQ+  LY
Sbjct  153   DEDSAASYLSKCIFSVGMGSNDYLNNYFMPAFYSSSRQYTPVQYADVLIEQYSQQIRTLY  212

Query  694   tlGARKFVLTGIGKMGCIPTMLAR-ADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK VL G+G++GC P  LA+ + NGE C++ ++ A+  FN  +  ++++F+T    
Sbjct  213   NYGARKVVLIGLGQVGCSPNELAQLSPNGEVCVDRIDSAIQIFNRKLIALVDQFNTLE-G  271

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+ + +F  IM N   YG +V +RGCCGVG+N+G++TCLP++TPC NR EYLFWD
Sbjct  272   AHFTYINANGIFADIMRNPSAYGLTVTNRGCCGVGRNNGQITCLPYQTPCPNRNEYLFWD  331

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A N+++G  +++  S+   YPM I
Sbjct  332   AFHPTEAANIIIGKRSYSAESSSDAYPMDI  361



>emb|CAN77693.1| hypothetical protein VITISV_030206 [Vitis vinifera]
Length=385

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 164/349 (47%), Positives = 219/349 (63%), Gaps = 25/349 (7%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VPA+F FGDSLID+GNNN L S AK+NY PYGIDF   PTGRF NG TIVD +A+ LG+ 
Sbjct  32    VPAIFCFGDSLIDDGNNNFLDSIAKSNYYPYGIDFRG-PTGRFCNGKTIVDLLAEMLGVS  90

Query  340   MIAAYLESPSI-DQMRYGVNYASAAAGILDFTGQHFMG----------------------  450
                 + +  S   ++  GVNYASAAAGILD TGQ+++                       
Sbjct  91    YPQPFADPGSTGSKIFSGVNYASAAAGILDETGQNYVSYFYLLNSITIITWTREQAIIGQ  150

Query  451   RIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFF  627
             R   ++Q+ NFE T +Q+    +   +++ L KSI  +  GSNDYLNNY MP  YP+S+ 
Sbjct  151   RFSLSQQVLNFETTLSQMRTMANGTTLSRYLAKSIVIMVFGSNDYLNNYLMPSLYPSSYN  210

Query  628   YDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAV  807
             Y P  FA+ L+  Y +Q+  LY+LG RKF L GIG +GC+P   A A  G CL+  NQ +
Sbjct  211   YSPPDFANLLLNHYARQILALYSLGLRKFFLAGIGPLGCMPNQRALAPPGRCLDYDNQIL  270

Query  808   LPFNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGE  987
               FN  ++ ++N+ +  HP + FV+ +T  +F  I+NN   YGFSV DRGCCG+G+N G+
Sbjct  271   GTFNEGLRALVNQLNGNHPGSIFVYGNTYGIFGDILNNPATYGFSVVDRGCCGLGRNQGQ  330

Query  988   VTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             +TCLP + PC NR EY+FWDAFHPT+A NV+L   AF G     YP+ +
Sbjct  331   ITCLPMQMPCLNRNEYVFWDAFHPTTAANVILAQTAFYGPPSDCYPINV  379



>ref|XP_010491482.1| PREDICTED: GDSL esterase/lipase At5g08460 [Camelina sativa]
Length=371

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/370 (45%), Positives = 231/370 (62%), Gaps = 14/370 (4%)
 Frame = +1

Query  49    SALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSF  228
             S+  + +LV VS     V VLA     G     + A+ PAMF+FGDSL+DNGNNN+L S 
Sbjct  2     SSFTVQSLVLVSWFV-VVAVLA-----GGEDSSDAAMFPAMFVFGDSLVDNGNNNHLNSL  55

Query  229   AKANYLPYGIDF-NNNPTGRFSNGYTIVDSIAKQLGLPMIAAYLESPSID-QMRYGVNYA  402
             A++NYLPYGIDF  N PTGRF NG TIVD + + LGLP I A++++   +  +  GVNYA
Sbjct  56    ARSNYLPYGIDFAGNQPTGRFCNGKTIVDFVGELLGLPDIPAFMDTVDGEVDISGGVNYA  115

Query  403   SAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSND  582
             SAA GIL+ TG+    R     Q++NFEKT  +++    ++ V + + KS+  V +G+ND
Sbjct  116   SAAGGILEETGRQLGERFSMARQVENFEKTLVEITRMSRSESVKEYMAKSLVVVSLGNND  175

Query  583   YLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTML  759
             Y+NNY  P  + T+  YDP  FA  LV  +T  L +LY  G RKFVL G+G +GCIP  L
Sbjct  176   YINNYLKPSLFLTNSIYDPTSFADLLVSNFTTHLLKLYGKGFRKFVLAGVGPLGCIPDQL  235

Query  760   AR--ADNGECLESVNQAVLPFNANVKQMINKFST---THPDAKFVFIDTDKMFQHIMNNN  924
             A   A  GEC+E+VN+    FN  +  ++++ ++   T  +  FV+ +T      I+ N 
Sbjct  236   AARAAPPGECVEAVNEMAELFNNRLISLVDRLNSDNKTASEGIFVYGNTYGAAVDILTNP  295

Query  925   KRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG  1104
               YGF V DRGCCGVG+N GE+TCLP   PC+ R  ++FWDAFHPT A N+++   AFNG
Sbjct  296   FAYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDAFHPTEAFNLIIARRAFNG  355

Query  1105  SNYLVYPMTI  1134
             S    YP+ +
Sbjct  356   SKSDCYPINL  365



>ref|XP_006362723.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Solanum tuberosum]
Length=357

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 220/329 (67%), Gaps = 7/329 (2%)
 Frame = +1

Query  166   AMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPMI  345
             A+++FGDSL+DNGNNN L + AKANY PYGIDF+  PTGRFSNG T VD + + LG+   
Sbjct  22    ALWVFGDSLVDNGNNNFLNTIAKANYFPYGIDFSRGPTGRFSNGKTFVDILGELLGVASP  81

Query  346   AAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
               +  +PS    R   GVNYASAA GILD TG+H+M R   ++Q+ NFE T +QL   +S
Sbjct  82    PPF-ANPSTRGERILGGVNYASAAGGILDETGKHYMERFTLSQQVINFESTLSQLRTMMS  140

Query  520   ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlyt  696
                +   L+KSI  +  GSNDY+NNY +P  Y +S  Y+P QF++ L+  Y +QL  LY+
Sbjct  141   PGDLNTYLSKSIAVMVFGSNDYINNYLLPSLYTSSINYNPQQFSNLLLNHYARQLVALYS  200

Query  697   lGARKFVLTGIGKMGCIPTMLA--RADNGECLESVNQAVLPFNANVKQMINKFST-THPD  867
             +G RKF++ G+G +GCIP  LA  +A  G C++ VNQ +  FN  +K +++  +  THP 
Sbjct  201   VGLRKFLVAGVGPLGCIPNQLATGQAPPGRCVDYVNQILGSFNEGLKSLVSIMNNGTHPG  260

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A FV+ +T      I+NN  RYGF+V+DR CCGVG+N G++TCLP++ PC +R +Y+FWD
Sbjct  261   AVFVYGNTYAAIGDILNNPARYGFNVWDRACCGVGRNQGQITCLPYQFPCLDRSKYIFWD  320

Query  1048  AFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             AFHPT AV+ +L   A+ G     YP+ +
Sbjct  321   AFHPTQAVDAILAQRAYYGPPSDCYPINV  349



>ref|XP_011074971.1| PREDICTED: GDSL esterase/lipase At1g33811-like [Sesamum indicum]
Length=368

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 215/318 (68%), Gaps = 8/318 (3%)
 Frame = +1

Query  151   NALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQL  330
             N  VP +FIFGDSL+DNGNNN + + A+ANY+PYGIDF    TGRF+NG T VD +A+ L
Sbjct  28    NRQVPCLFIFGDSLVDNGNNNGILTLARANYMPYGIDFPQGATGRFTNGRTFVDILAQLL  87

Query  331   GLP-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLS  507
             G P  I  Y  +   + ++ G NYAS A+GI D TG +    +  N+Q+D+F  T  QL 
Sbjct  88    GFPNYIPPYARARGRELLQ-GANYASGASGIRDETGNNLGDHMSMNQQVDSFGMTVQQLR  146

Query  508   ANLSADV--VAKDLTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqq  678
                  DV  +   L K IF+ G+GSNDYLNNYFM  Y  TS  Y    +A++L+Q Y++Q
Sbjct  147   RYFRGDVNALGTYLRKCIFYSGLGSNDYLNNYFMRDYYSTSSQYTSQAYAASLIQDYSRQ  206

Query  679   ltrlytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFS  852
             LT LY LGARK ++TG+G++GCIP  LAR       C E +N A++ FN  +K+++++F+
Sbjct  207   LTALYNLGARKVIVTGVGQIGCIPYQLARYNGSGSRCNEEINSAIVLFNTALKRLVDRFN  266

Query  853   TTH-PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQ  1029
                 P AKFV++D+ +  Q ++ N + YGF V D+GCCGVG+N+G++TCLP +TPC +R+
Sbjct  267   KGQLPGAKFVYLDSFQSSQDLVQNARAYGFEVVDKGCCGVGRNNGQITCLPLQTPCDDRR  326

Query  1030  EYLFWDAFHPTSAVNVLL  1083
             +YLFWDAFHPT   N+LL
Sbjct  327   KYLFWDAFHPTEVANILL  344



>ref|XP_010478329.1| PREDICTED: GDSL esterase/lipase At1g29660 [Camelina sativa]
Length=364

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 211/330 (64%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+Y PYGIDF   PTGRFSNG T VD +A+ LG  
Sbjct  30    VPCYFIFGDSLVDNGNNNRLTSIARADYFPYGIDFGG-PTGRFSNGKTTVDVLAELLGFD  88

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    S S  Q+  GVNYASAAAGI D TG     RI F+ Q++N++ T +Q+   L 
Sbjct  89    NYIPPYSSVSGQQILQGVNYASAAAGIRDETGAQLGQRITFSGQVENYKNTVSQVVEILG  148

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L + I+ +GMGSNDYLNNYFMP  Y TS  Y P Q+A  L+ +Y  QL  LY
Sbjct  149   DENTAADYLKRCIYTIGMGSNDYLNNYFMPQVYATSRQYSPEQYAEDLITRYRDQLNALY  208

Query  694   tlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             + GARKF L G+G +GC P  LA+   D   C+E +N A   FN  +K ++ + +  H D
Sbjct  209   SYGARKFALVGVGAIGCSPNELAQGSPDGTTCVERINSANRIFNNKLKSLVQQLNNDHSD  268

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F +I+   +F+ I+ N   YGF+V +  CCGVG+N G++TCLP + PC NR EY+FWD
Sbjct  269   ARFTYINAYGVFEDIIANPSAYGFTVTNAACCGVGRNGGQLTCLPGQPPCPNRNEYVFWD  328

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP+ A N ++   ++N  S+  VYP  I
Sbjct  329   AFHPSDAANTVIAQRSYNAQSSSDVYPYDI  358



>ref|XP_010499475.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g29660 
[Camelina sativa]
Length=364

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 211/330 (64%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+Y PYGIDF   PTGRFSNG T VD +A+ LG  
Sbjct  30    VPCYFIFGDSLVDNGNNNRLTSIARADYFPYGIDFGG-PTGRFSNGKTTVDVLAELLGFD  88

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    + S  Q+  GVNYASAAAGI D TG     RI F+ Q++N+  T +Q+   L 
Sbjct  89    NYIPAYSTVSGQQILQGVNYASAAAGIRDETGAQLGQRITFSGQVENYXNTVSQVVEILG  148

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L + I+ +GMGSNDYLNNYFMP  Y TS  Y P Q+A  L+ +Y +QL  LY
Sbjct  149   DENTAADYLKRCIYTIGMGSNDYLNNYFMPQVYATSRQYSPEQYAQDLITRYREQLNALY  208

Query  694   tlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
             + GARKF L G+G +GC P  LA+   D   C+E +N A   FN  +K ++ + +  H D
Sbjct  209   SYGARKFALVGVGAIGCSPNELAQGSPDGTTCVERINSANRIFNNKLKSLVQQLNNDHSD  268

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F +I+   +F+ I+ N   YGF+V +  CCGVG+N G++TCLP + PC NR EY+FWD
Sbjct  269   ARFTYINAYGVFEDIIANPSAYGFTVTNAACCGVGRNGGQLTCLPGQPPCPNRNEYVFWD  328

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP+ A N ++   ++N  S+  VYP  I
Sbjct  329   AFHPSDAANTVIAQRSYNAQSSSDVYPYDI  358



>ref|XP_009105797.1| PREDICTED: GDSL esterase/lipase At1g71250 [Brassica rapa]
Length=366

 Score =   292 bits (748),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 162/346 (47%), Positives = 216/346 (62%), Gaps = 7/346 (2%)
 Frame = +1

Query  106   VLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGR  285
             V+ Q P L  +G+   A VPAMF+ GDSL+D GNNN L S A+ANYLPYGID N  PTGR
Sbjct  18    VMLQQPELLVTGQ---ATVPAMFVLGDSLVDVGNNNFLASVARANYLPYGIDLNYRPTGR  74

Query  286   FSNGYTIVDSIAKQLGLPMIAAYLESPSIDQMRY--GVNYASAAAGILDFTGQHFMGRIP  459
             FSNG   VD +A+ LG+     + + P+    R   GVNYASAA GILD +GQH+  R  
Sbjct  75    FSNGMNFVDLLAQLLGISSPPPFAD-PTTWGTRILGGVNYASAAGGILDESGQHYGDRFS  133

Query  460   FNEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDP  636
              ++Q+ N E T +QL   +S       L KS+  +  GSNDYLNNY MP  Y +SF Y P
Sbjct  134   LSQQVVNLEGTLSQLRTMMSPQNFTDYLKKSLVVLVFGSNDYLNNYLMPNLYSSSFRYRP  193

Query  637   NQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADNGECLESVNQAVLPF  816
              +FA+ L+ QY +QL  LY+LG RK  + G+G +GCIP   A A  G C+++VN+ +  F
Sbjct  194   PEFANLLINQYARQLLTLYSLGLRKIFIAGVGPLGCIPNQRATAPPGRCVDNVNEILGTF  253

Query  817   NANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTC  996
             N  ++ ++++ +   P A FV+ +T +    I+NN   YGFSV DR CCG G+N G++TC
Sbjct  254   NQGLRALVDQLNQRSPGAIFVYGNTFRAVGDILNNPATYGFSVADRACCGTGRNQGQITC  313

Query  997   LPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             LP + PC NR +Y+FWDAFHPT   N  L   AF G     YP+ +
Sbjct  314   LPLQNPCPNRSQYVFWDAFHPTQTANSFLVRRAFYGPPSDAYPVNV  359



>ref|XP_010100103.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB81486.1| GDSL esterase/lipase [Morus notabilis]
Length=366

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 163/371 (44%), Positives = 230/371 (62%), Gaps = 21/371 (6%)
 Frame = +1

Query  46    FSALFILALVFVSAITEPVPVLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFS  225
             FS L ++ +V++       P   Q              VP  FIFGDSL+DNGNNN + +
Sbjct  3     FSELVLVVIVWLWLSGRAFPQEQQVQ------------VPCFFIFGDSLVDNGNNNGILT  50

Query  226   FAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLPM-IAAYLESPSIDQMRYGVNYA  402
              A+ANY PYGIDF    TGRF+NG T VD +A+ LG P  I  Y  +     +R GVNYA
Sbjct  51    LARANYRPYGIDFPQGSTGRFTNGRTFVDVLAQLLGFPTYIPPYSRTRGRALLR-GVNYA  109

Query  403   SAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLSADVVAKD--LTKSIFFVGMGS  576
             S A+GI D TG +       NEQ+ NF  T  Q+      D  + +  L++ IF+ G+GS
Sbjct  110   SGASGIRDETGNNLGAHASMNEQVSNFADTVQQMRRFFRGDTNSLNSYLSRCIFYSGLGS  169

Query  577   NDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPT  753
             NDYLNNYFM   Y TS  + P  +AS+L+Q YT+QLT LY LGARK ++T +G++GCIP 
Sbjct  170   NDYLNNYFMRDFYSTSSQFTPKAYASSLIQDYTRQLTLLYQLGARKVIVTAVGQIGCIPY  229

Query  754   MLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH-PDAKFVFIDTDKMFQHIMNNN  924
              LAR   +N  C E +N+A++ FN+ +++++++F+    P AKFVF+D+ +    +    
Sbjct  230   QLARYNGNNSRCNEDINKAIVIFNSELRKLVDRFNGGQLPGAKFVFLDSYQSTLDLYQKG  289

Query  925   KRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNG  1104
             K YGF + D+GCCGVG+N+G++TCLP + PC++R +YLFWDAFHPT A N++ G  A++ 
Sbjct  290   KSYGFDIIDKGCCGVGRNNGQITCLPLQQPCADRSKYLFWDAFHPTEAANIIFGKAAYSS  349

Query  1105  S-NYLVYPMTI  1134
                   YP+ I
Sbjct  350   KPQSYTYPINI  360



>ref|XP_010415834.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Camelina sativa]
Length=374

 Score =   292 bits (747),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 161/347 (46%), Positives = 219/347 (63%), Gaps = 8/347 (2%)
 Frame = +1

Query  106   VLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGR  285
             V+ Q P L  +G+   A VPAMF+ GDSL+D+GNNN L S A+ANYLPYGID N  PTGR
Sbjct  25    VILQQPEL-VTGQ---ARVPAMFVLGDSLVDSGNNNFLQSVARANYLPYGIDLNFRPTGR  80

Query  286   FSNGYTIVDSIAKQLGLPMIAAYLESPSI-DQMRYGVNYASAAAGILDFTGQHFMGRIPF  462
             FSNG T VD +A+ LGLP   A+ +  +  +++  GVN+ASAAAGILD +G H+  R   
Sbjct  81    FSNGLTFVDLLAQLLGLPSPPAFADPTTTGNRILQGVNHASAAAGILDESGYHYGARFTL  140

Query  463   NEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPN  639
             ++Q+ N E T +QL   +S       L +S+  +  GSNDY+NNY +P  Y +SF Y P 
Sbjct  141   SQQMVNLETTLSQLRTMMSPQNFTDYLARSLVVLVFGSNDYINNYLLPNLYSSSFRYRPA  200

Query  640   QFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADN--GECLESVNQAVLP  813
              FA+ L+ QY +QL  LY+LG RK  + G+  +GCIP   A      G C++SVNQ +  
Sbjct  201   DFANLLLSQYARQLLTLYSLGLRKIFIPGVAPLGCIPNQRATGAGPPGRCVDSVNQILGT  260

Query  814   FNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVT  993
             FN  +K ++++ +   P A FV+ +T      I+NN   YGFSV DR CCG+G+N G++T
Sbjct  261   FNEGLKSLVDQLNQRSPGAIFVYGNTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQIT  320

Query  994   CLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             CLP + PC NR +Y+FWDAFHPT   N +L   AF G     YP+ +
Sbjct  321   CLPMQNPCPNRSQYVFWDAFHPTQTANSILARRAFYGPPSDAYPVNV  367



>ref|XP_010471141.1| PREDICTED: GDSL esterase/lipase At1g71250 [Camelina sativa]
Length=374

 Score =   292 bits (747),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 160/347 (46%), Positives = 220/347 (63%), Gaps = 8/347 (2%)
 Frame = +1

Query  106   VLAQAPTLGFSGEGNNALVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGR  285
             V+ Q P L  +G+   A +PAMF+ GDSL+D+GNNN L S A+ANYLPYGID N  PTGR
Sbjct  25    VILQQPEL-VTGQ---ARIPAMFVLGDSLVDSGNNNFLQSVARANYLPYGIDLNFRPTGR  80

Query  286   FSNGYTIVDSIAKQLGLPMIAAYLE-SPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPF  462
             FSNG T +D +A+ LG+P   A+ + + S +++  GVN+ASAAAGILD +G H+  R   
Sbjct  81    FSNGLTFIDLLAQLLGIPSPPAFADPTTSGNRILQGVNHASAAAGILDESGYHYGARFTL  140

Query  463   NEQIDNFEKTKNQLSANLSADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPN  639
             ++Q+ N E T +QL   +S       L +S+  +  GSNDY+NNY MP  Y +SF Y P 
Sbjct  141   SQQMVNLETTLSQLRTMMSPQNFTDYLARSLVVLVFGSNDYINNYLMPNLYSSSFRYRPA  200

Query  640   QFAStlvqqytqqltrlytlGARKFVLTGIGKMGCIPTMLARADN--GECLESVNQAVLP  813
              FA+ L+ QY +QL  LY+LG RK  + G+  +GCIP   A      G C++SVNQ +  
Sbjct  201   DFANLLLSQYARQLLTLYSLGLRKIFIPGVAPLGCIPNQRATGAGPPGRCVDSVNQILGT  260

Query  814   FNANVKQMINKFSTTHPDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVT  993
             FN  +K ++++ +   P A FV+ +T      I+NN   YGFSV DR CCG+G+N G++T
Sbjct  261   FNEGLKSLVDQLNQRSPGAIFVYGNTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQIT  320

Query  994   CLPFETPCSNRQEYLFWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             CLP + PC NR +Y+FWDAFHPT   N +L   AF G     YP+ +
Sbjct  321   CLPMQNPCPNRSQYVFWDAFHPTQTANSILARRAFYGPPSDAYPVNV  367



>gb|ABF72016.1| GDSL-motif lipase/hydrolase family protein [Musa acuminata]
Length=356

 Score =   291 bits (745),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 218/330 (66%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNNN+ S A ANY PYGIDF + P+GRF+NG T VD IA+ LG  
Sbjct  22    VPCYFIFGDSLVDNGNNNNIASLAVANYPPYGIDFPSGPSGRFTNGLTTVDVIAQLLGFD  81

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    S     +  GVN+ASAAAGI + TGQ   GRIPF  Q+ N++    ++ + L 
Sbjct  82    DFVPPYASTRGQALLTGVNFASAAAGIREETGQQLGGRIPFGGQLQNYQSAVQEMVSILG  141

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K IF VG+GSNDYLNNYFMP  Y T   Y P Q+A  L+QQY+QQL  LY
Sbjct  142   DEDSAANYLSKCIFSVGLGSNDYLNNYFMPAFYSTGQRYTPEQYADELIQQYSQQLRTLY  201

Query  694   tlGARKFVLTGIGKMGCIPTMLA-RADNG-ECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK VL G+G++GC P  LA R+ NG  C+E +N A+  FNA +  ++++F+     
Sbjct  202   NYGARKVVLIGVGQVGCSPNELAQRSPNGVACVEEINSAIRIFNAKLIDLVDEFNALD-G  260

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F++I+   +F+ I+ N    G SV +RGCCGVG+N+G++TCLP++ PC NR EYLF+D
Sbjct  261   AHFIYINGYGIFEDILRNPAANGLSVTNRGCCGVGRNNGQITCLPYQAPCPNRDEYLFFD  320

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT A N+++G  +++  S    YPM I
Sbjct  321   AFHPTEAANIIIGKRSYSARSPGDAYPMDI  350



>ref|XP_006415557.1| hypothetical protein EUTSA_v10008016mg [Eutrema salsugineum]
 gb|ESQ33910.1| hypothetical protein EUTSA_v10008016mg [Eutrema salsugineum]
Length=360

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 212/329 (64%), Gaps = 5/329 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L SFA+ANY PYGIDF   PTGRFSNG T  D +A+ LG  
Sbjct  27    VPCYFIFGDSLVDNGNNNGLVSFARANYFPYGIDFGG-PTGRFSNGKTTADELAELLGFN  85

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    +    ++  GVNYASAAAGI + TG+    RI F+ Q+ N++ T  Q+ + L 
Sbjct  86    GYIPAYNAVRGRRILTGVNYASAAAGIREETGRQLGQRISFSGQVRNYQNTVQQVVSLLG  145

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L + I+ VG+GSNDYLNNYFMP  Y +S  + P Q+A  L+ +Y+ QL  LY
Sbjct  146   GETQAADYLKRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQYADDLISRYSTQLNALY  205

Query  694   tlGARKFVLTGIGKMGCIPTMLARA-DNGECLESVNQAVLPFNANVKQMINKFSTTHPDA  870
               GARKF L G+G +GC P  LAR+ D+  C   +N A   FN  ++ +++  +  HPDA
Sbjct  206   NYGARKFALIGVGAIGCSPNALARSRDSRTCDNRINSANQIFNNKLRSLVDTLNNNHPDA  265

Query  871   KFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWDA  1050
             +F +I+   +FQ ++ N  R+GF V + GCCG+G+N+G++TCLP + PC NR  Y+FWDA
Sbjct  266   RFTYINAYGIFQDMITNPSRFGFRVTNAGCCGIGRNAGQITCLPGQRPCPNRNAYVFWDA  325

Query  1051  FHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             FHPT A NV++   ++N  S    YP+ I
Sbjct  326   FHPTEAANVVIAKRSYNAQSPSDAYPIDI  354



>ref|XP_002441391.1| hypothetical protein SORBIDRAFT_09g025780 [Sorghum bicolor]
 gb|EES19821.1| hypothetical protein SORBIDRAFT_09g025780 [Sorghum bicolor]
Length=366

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 205/318 (64%), Gaps = 5/318 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + S A+ANY PYGIDF   PTGRFSNG T VD+IAK LG  
Sbjct  32    VPCYFIFGDSLVDNGNNNFIVSMARANYPPYGIDFAGGPTGRFSNGLTTVDAIAKLLGFD  91

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S  Q+  G N+ASAAAGI + TGQ   GRI F+ Q+ N++    ++ + L 
Sbjct  92    DFVPPFSGASSQQLLRGANFASAAAGIREETGQQLGGRISFSGQVQNYQSAVQEVISILG  151

Query  520   AD-VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +   A  L++ IF VGMGSNDYLNNYFMP  Y T   Y P Q+A +L   Y++ L  +Y
Sbjct  152   DEGSAATHLSRCIFTVGMGSNDYLNNYFMPAFYSTGSQYTPEQYAESLADDYSRLLQVMY  211

Query  694   tlGARKFVLTGIGKMGCIPTMLA-RADNG-ECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK  L G+G++GC P  LA R+ NG  C+E +N AV  FN  +  ++++F+   P 
Sbjct  212   RYGARKVALIGVGQVGCSPNELAQRSANGVTCVEQINAAVRMFNRRLVGLVDRFNKL-PG  270

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +F  I+ +   +G  V + GCCGVG+N+G+VTCLPF+ PC+NR EYLFWD
Sbjct  271   AHFTYINIYGIFDDILRSPGAHGLKVTNAGCCGVGRNNGQVTCLPFQMPCANRHEYLFWD  330

Query  1048  AFHPTSAVNVLLGNLAFN  1101
             AFHPT A NVL+    ++
Sbjct  331   AFHPTEAANVLVAQRTYS  348



>ref|XP_002316749.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE97361.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=365

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 221/332 (67%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S AKANY+PYGIDF   PTGRFSNG T VD IA+QLG  
Sbjct  30    VPCYFIFGDSLVDNGNNNQLSSLAKANYMPYGIDFPRGPTGRFSNGRTTVDVIAEQLGFR  89

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y  +   D +  GVNYASAAAGI + TG+    RI F+ Q+ N++ T +Q+  N+
Sbjct  90    NYIPPYATARGRDILG-GVNYASAAAGIREETGRQLGDRISFSGQVRNYQNTVSQI-VNI  147

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
               D    A  L+K I  + +GSNDYLNNYFMP  Y +S  Y P Q+A+ L+QQYTQQL  
Sbjct  148   LGDKNTTANYLSKCILSIALGSNDYLNNYFMPQLYSSSQQYTPEQYANVLIQQYTQQLRI  207

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY  GARKF L G+G++GC P+ LA+   D   C++ +N A   FN  ++ ++ +F+   
Sbjct  208   LYNNGARKFALIGLGQIGCSPSELAQNSPDGRTCVQRINSANQIFNDKLRSLVAQFNGNT  267

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             PDA+F++I+   +FQ ++     +GF+  + GCCGVG+N+G++TCLP + PC NR +Y+F
Sbjct  268   PDARFIYINAYGIFQDLITRPAAFGFTNTNTGCCGVGRNNGQITCLPLQAPCRNRNQYVF  327

Query  1042  WDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             WDAFHPT AVN+++G  +++  S    YP  I
Sbjct  328   WDAFHPTEAVNLIIGRRSYSAQSASDAYPYDI  359



>gb|KHN47079.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 217/332 (65%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  +IFGDSL+DNGNNN + + A+ANY PYGIDF    TGRF+NG T VD++A+ LG P
Sbjct  35    VPCFYIFGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFP  94

Query  340   M-IAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               IA Y  +  ++ +R G NYAS AAGI + TG +       NEQ+ NF  T  QL    
Sbjct  95    TYIAPYSRARGLELLR-GANYASGAAGIREETGSNLGAHTSLNEQVANFGNTVQQLRRFF  153

Query  517   SADVVAKD--LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
               D  + +  L K +FF GMGSNDYLNNYFM   Y TS  Y    FAS L+Q Y+++L++
Sbjct  154   RGDNESLNSYLNKCLFFSGMGSNDYLNNYFMSDFYSTSSDYTVKAFASVLLQDYSRKLSQ  213

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY+LGARK ++T +G++GCIP  LAR   ++  C E +N A+  FN+ +K M+  F+   
Sbjct  214   LYSLGARKVMVTAVGQIGCIPYQLARFHGNSSRCNEKINNAISLFNSGLKTMVQNFNGGQ  273

Query  862   -PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P AKFV++D  +  Q + +N   YGF V D+GCCGVG+N+G++TCLP + PC NRQ+YL
Sbjct  274   LPGAKFVYLDFYQSSQDLSSNGTSYGFDVIDKGCCGVGRNNGQITCLPQQQPCENRQKYL  333

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT   N+LL    ++  +Y  YP+ I
Sbjct  334   FWDAFHPTELANILLAKATYSSQSY-TYPINI  364



>ref|XP_008792294.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Phoenix dactylifera]
Length=367

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 220/330 (67%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN++ S A+A+Y+PYGIDF   PTGRF NG T VD IA+ LG  
Sbjct  33    VPCYFIFGDSLVDNGNNNDIASLARADYMPYGIDFAGGPTGRFGNGLTTVDVIAQLLGFE  92

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                    +     +  GVN+ASAAAGI + TGQ    RI F+ Q+ N++    ++ + L 
Sbjct  93    DFIPPYAAARGRALLTGVNFASAAAGIREETGQQLGDRISFSGQLQNYQAAVQEVVSILG  152

Query  520   -ADVVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
               D  A  L+K IF VGMGSNDYLNNYFMP  Y +S  Y P Q+A  L++QY+QQ+  LY
Sbjct  153   DEDSAANYLSKCIFSVGMGSNDYLNNYFMPAFYSSSSQYTPEQYADVLIEQYSQQIRTLY  212

Query  694   tlGARKFVLTGIGKMGCIPTMLAR-ADNGE-CLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARK VL G+G++GC P  LA+ + NG+ C+  +N  +  FN  +  ++++F+T +  
Sbjct  213   NYGARKVVLMGVGQIGCSPNELAQNSPNGQTCVHRINSGIQIFNRKLIALVDQFNTLN-Q  271

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A F +I+   +F+ I  N  ++G +V +RGCCGVGKN+G++TCLP++TPC NR EYLFWD
Sbjct  272   ANFTYINAYGIFEDIWRNPSKHGLTVTNRGCCGVGKNNGQITCLPYQTPCPNRNEYLFWD  331

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHP+ A N+++G  +++  S+   YPM I
Sbjct  332   AFHPSEAANIIIGKRSYSAESSSDAYPMDI  361



>emb|CDO96914.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 218/331 (66%), Gaps = 7/331 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNNNL S AKANYLPYGIDF   PTGRFSNG T VD I ++LG  
Sbjct  32    VPCYFIFGDSLVDNGNNNNLNSLAKANYLPYGIDFPRGPTGRFSNGKTTVDVITEELGFD  91

Query  340   M-IAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y      D +R GVNYASAAAGI + TG+    RI F+ Q+ N+  T   +   L
Sbjct  92    RYIPPYSRVRGQDILR-GVNYASAAAGIREETGRQLGQRISFSGQVRNYINTVRGIVNIL  150

Query  517   SADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrl  690
               +  A D L++ IF VG+GSNDYLNNYFMP  YPTS  Y P Q+A  L+QQY +Q+  +
Sbjct  151   GDENAAADYLSQCIFSVGLGSNDYLNNYFMPLIYPTSRQYTPEQYAQVLIQQYAEQIRIM  210

Query  691   ytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTHP  864
             Y  GARK VL G+G++GC P  LA+   D   C+  +N A   FN  +K +++  +    
Sbjct  211   YNYGARKLVLLGVGQIGCSPNALAQNSPDGRTCVARINNANQLFNNQLKALVDTLNNQFT  270

Query  865   DAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFW  1044
             DA+F++ID+  +FQ I+N+   YGF+V +RGCCGVG+N+G++TCLP +TPC NR +YLFW
Sbjct  271   DARFIYIDSYGIFQDILNSPSSYGFTVTNRGCCGVGRNNGQITCLPLQTPCRNRNQYLFW  330

Query  1045  DAFHPTSAVNVLLGNLAFNGSNYL-VYPMTI  1134
             DAFHPT A N ++G  A+        YP+ I
Sbjct  331   DAFHPTEAANTIVGRRAYRAQKSSDAYPIDI  361



>ref|XP_002865231.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41490.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=360

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 208/319 (65%), Gaps = 6/319 (2%)
 Frame = +1

Query  157   LVPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGL  336
             + P  FIFGDSL+DNGNNN L S A+ANY PYGIDF   PTGRFSNG T VD IA+ LG 
Sbjct  24    IAPCYFIFGDSLVDNGNNNQLQSLARANYFPYGIDFAAGPTGRFSNGRTTVDVIAELLGF  83

Query  337   P-MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSAN  513
                I  Y  +   D +R GVNYASAAAGI D TG+   GRI F  Q+ N   T +Q+   
Sbjct  84    DDYITPYASARGQDILR-GVNYASAAAGIRDETGRQLGGRIAFAGQVANHVNTVSQVVNI  142

Query  514   LSADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
             L     A + L+K I+ +G+GSNDYLNNYFMP  Y T   + P  +A  LV +YT+QL  
Sbjct  143   LGDQNEASNYLSKCIYSIGLGSNDYLNNYFMPNFYSTGNQFSPESYADDLVARYTEQLRI  202

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LYT GARKF L G+G +GC P  LA+   D   C E +N A   FN+ +  +++ F+   
Sbjct  203   LYTNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIFNSKLISIVDAFNQNT  262

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             PDAKF +I+   +FQ I+ N  RYGFSV + GCCGVG+N+G++TCLP + PC NR EY+F
Sbjct  263   PDAKFTYINAYGIFQDIVTNPARYGFSVTNAGCCGVGRNNGQITCLPGQAPCLNRNEYVF  322

Query  1042  WDAFHPTSAVNVLLGNLAF  1098
             WDAFHP  A N+++G  +F
Sbjct  323   WDAFHPGEAANIVIGRRSF  341



>ref|XP_003522601.2| PREDICTED: GDSL esterase/lipase At1g33811-like [Glycine max]
Length=376

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 216/332 (65%), Gaps = 9/332 (3%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  +IFGDSL+DNGNNN + + A+ANY PYGIDF    TGRF+NG T VD++A+ LG P
Sbjct  41    VPCFYIFGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFP  100

Query  340   M-IAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               IA Y  +  ++ +R G NYAS AAGI + TG +       NEQ+ NF  T  QL    
Sbjct  101   TYIAPYSRARGLELLR-GANYASGAAGIREETGSNLGAHTSLNEQVANFGNTVQQLRRFF  159

Query  517   SAD--VVAKDLTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltr  687
               D   +   L K +FF GMGSNDYLNNYFM   Y TS  Y    FAS L+Q Y+++L++
Sbjct  160   RGDNESLNSYLNKCLFFSGMGSNDYLNNYFMSDFYSTSSDYTVKAFASVLLQDYSRKLSQ  219

Query  688   lytlGARKFVLTGIGKMGCIPTMLAR--ADNGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY+LGARK ++T +G++GCIP  LAR   ++  C E +N A+  FN+ +K M+  F+   
Sbjct  220   LYSLGARKVMVTAVGQIGCIPYQLARFHGNSSRCNEKINNAISLFNSGLKTMVQNFNGGQ  279

Query  862   -PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYL  1038
              P AKFV++D  +  Q + +N   YGF V D+GCCGVG+N+G++TCLP + PC NRQ+YL
Sbjct  280   LPGAKFVYLDFYQSSQDLSSNGTSYGFDVIDKGCCGVGRNNGQITCLPQQQPCENRQKYL  339

Query  1039  FWDAFHPTSAVNVLLGNLAFNGSNYLVYPMTI  1134
             FWDAFHPT   N+LL    ++  +Y  YP+ I
Sbjct  340   FWDAFHPTELANILLAKATYSSQSY-TYPINI  370



>emb|CDX94689.1| BnaC07g09690D [Brassica napus]
Length=364

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 208/330 (63%), Gaps = 6/330 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN L S A+A+Y PYGID    PTGRFSNG T VD IA+ LG  
Sbjct  30    VPCYFIFGDSLVDNGNNNRLASIARADYYPYGIDLGR-PTGRFSNGKTTVDEIAELLGFD  88

Query  340   MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANLS  519
                      S +Q+  G NYASAAAGI + TGQ    RI F+ Q+ N+  T +Q+   L 
Sbjct  89    NYIPAYSDVSGEQILQGCNYASAAAGIREETGQQLGQRITFSGQVQNYLNTVSQVVQILG  148

Query  520   ADVVAKD-LTKSIFFVGMGSNDYLNNYFMPG-YPTSFFYDPNQFAStlvqqytqqltrly  693
              +  A D L + I+ VG+GSNDYLNNYFMP  Y TS  Y P Q+A  L+ +Y  QL  LY
Sbjct  149   DENSAADYLRQCIYSVGLGSNDYLNNYFMPQFYSTSRQYTPEQYADDLINRYKDQLNALY  208

Query  694   tlGARKFVLTGIGKMGCIPTMLARA--DNGECLESVNQAVLPFNANVKQMINKFSTTHPD  867
               GARKF L G+G +GC P  LA    D   C+ES+N A   FN+ +K M+ + +  H D
Sbjct  209   NYGARKFALVGVGAIGCSPNSLATGSPDGTTCVESINSANRIFNSRLKSMVQQLNNDHSD  268

Query  868   AKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLFWD  1047
             A+F +I+   +FQ I+ N   YGF V +  CCGVG+N G++TCLP ++PC NR EY+FWD
Sbjct  269   ARFTYINAYGVFQDIIANPSAYGFRVTNAACCGVGRNGGQLTCLPGQSPCPNRDEYVFWD  328

Query  1048  AFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             AFHPT   N ++   ++N  S+  VYP+ I
Sbjct  329   AFHPTDHANTIIAQRSYNAQSSDDVYPIDI  358



>ref|XP_009770266.1| PREDICTED: GDSL esterase/lipase At1g33811 isoform X1 [Nicotiana 
sylvestris]
Length=367

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 218/332 (66%), Gaps = 8/332 (2%)
 Frame = +1

Query  160   VPAMFIFGDSLIDNGNNNNLFSFAKANYLPYGIDFNNNPTGRFSNGYTIVDSIAKQLGLP  339
             VP  FIFGDSL+DNGNNN + + A+ANY+PYGIDF    TGRF+NG T VD +A+ LG  
Sbjct  31    VPCFFIFGDSLVDNGNNNGILTLARANYMPYGIDFPQGATGRFTNGRTYVDILAQLLGFS  90

Query  340   -MIAAYLESPSIDQMRYGVNYASAAAGILDFTGQHFMGRIPFNEQIDNFEKTKNQLSANL  516
               I  Y        +R G NYAS AAGI D TG +    +  N+Q++NF +T  +L    
Sbjct  91    NYIPPYSRVRGRALLR-GANYASGAAGIRDETGNNLGDHMSMNQQVENFARTVEELRRLF  149

Query  517   SADVVAKD--LTKSIFFVGMGSNDYLNNYFMPGY-PTSFFYDPNQFAStlvqqytqqltr  687
               +  A +  L+K IF+ G+GSNDYLNNYFM  Y  T   Y P  +A+ L+Q Y +QL+ 
Sbjct  150   RGNNNALNGYLSKCIFYSGLGSNDYLNNYFMTDYYSTHSQYTPQAYATALLQDYCKQLSE  209

Query  688   lytlGARKFVLTGIGKMGCIPTMLARAD--NGECLESVNQAVLPFNANVKQMINKFSTTH  861
             LY LGARK V+TG+G++GCIP  LAR D  +  C E +N A+L FN+ +K+++ +F+   
Sbjct  210   LYNLGARKVVVTGVGQIGCIPYELARYDGNDSRCNEEINNAILLFNSGLKKLVVRFNKVL  269

Query  862   PDAKFVFIDTDKMFQHIMNNNKRYGFSVFDRGCCGVGKNSGEVTCLPFETPCSNRQEYLF  1041
             P AKFVF+D+ +  + ++ N K YGF V D+GCCGVG+N+G++TCLP + PC +R +Y+F
Sbjct  270   PGAKFVFLDSFESTKDLVVNAKTYGFEVVDKGCCGVGRNNGQITCLPLQQPCEDRSKYIF  329

Query  1042  WDAFHPTSAVNVLLGNLAFNG-SNYLVYPMTI  1134
             WDAFHPT   N++L   +F+  S    YP+ I
Sbjct  330   WDAFHPTEVANIILAKKSFSSISKTFAYPINI  361



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3583994365200