BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26621_g1_i1 len=835 path=[813:0-834]

Length=835
                                                                      Score     E

ref|XP_009767116.1|  PREDICTED: glycine-rich cell wall structural...  53.9    8e-06   
ref|XP_009601015.1|  PREDICTED: glycine-rich cell wall structural...  53.5    1e-05   
ref|XP_009769769.1|  PREDICTED: ctenidin-3-like                       53.5    1e-05   



>ref|XP_009767116.1| PREDICTED: glycine-rich cell wall structural protein 1-like [Nicotiana 
sylvestris]
Length=141

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 6/63 (10%)
 Frame = +1

Query  40   SLYVMFVLAVVVAHATARNIPDATKPSAAVNPGGTQDLTVNPKTVEPAMAP---GAVDDK  210
            S YVMF+ A+V+ HATARNIP+ TKP+   N   T D  +N + +  A  P   G ++DK
Sbjct  3    SWYVMFIFALVLVHATARNIPEVTKPN---NVAQTHDKNLNTEILSTAPTPSTTGGLNDK  59

Query  211  KNL  219
            KN 
Sbjct  60   KNF  62



>ref|XP_009601015.1| PREDICTED: glycine-rich cell wall structural protein 1-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009601016.1| PREDICTED: glycine-rich cell wall structural protein 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=137

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 4/64 (6%)
 Frame = +1

Query  40   SLYVMFVLAVVVAHATARNIPDATKPS---AAVNPGGTQDLTVNPKTVEPAMAPG-AVDD  207
            S YVMFV A+V+ HATARNIP+ +KP+      +   T  LTVN + +  A  P   +DD
Sbjct  3    SWYVMFVFALVLVHATARNIPEVSKPNEPQTQAHEVQTHGLTVNTQVISTAPTPSEGLDD  62

Query  208  KKNL  219
            +KN 
Sbjct  63   QKNF  66



>ref|XP_009769769.1| PREDICTED: ctenidin-3-like [Nicotiana sylvestris]
Length=144

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 4/64 (6%)
 Frame = +1

Query  40   SLYVMFVLAVVVAHATARNIPDATKPS---AAVNPGGTQDLTVNPKTVEPAMAPG-AVDD  207
            S YVMFV  +V+ HATARNIP+ +KP+      +   TQ LT+N + +  A  P   +DD
Sbjct  3    SWYVMFVFGLVLVHATARNIPEVSKPNEPQTQAHEVQTQGLTINTEVISTAPTPSEGLDD  62

Query  208  KKNL  219
            +KN 
Sbjct  63   QKNF  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1602903310554