BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26589_g1_i1 len=525 path=[1:0-524]

Length=525
                                                                      Score     E

ref|XP_006409426.1|  hypothetical protein EUTSA_v10022840mg             164   5e-47   
gb|KHN41911.1|  V-type proton ATPase 16 kDa proteolipid subunit         162   2e-46   
ref|XP_009625822.1|  PREDICTED: V-type proton ATPase subunit c1         160   3e-46   
ref|XP_009804090.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    159   6e-46   
ref|XP_006284579.1|  hypothetical protein CARUB_v10005804mg             160   7e-46   
ref|XP_007223415.1|  hypothetical protein PRUPE_ppa011277mg             160   1e-45   
ref|XP_010432381.1|  PREDICTED: V-type proton ATPase subunit c1-like    159   1e-45   
ref|NP_179244.1|  ATPase, F0/V0 complex, subunit C protein              159   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298701.1|  hypothetical protein CARUB_v10014796mg             158   1e-45   
ref|XP_009623992.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    158   2e-45   
ref|XP_004232469.1|  PREDICTED: V-type proton ATPase subunit c2         158   2e-45   
ref|XP_007017704.1|  Vacuolar H+-pumping ATPase 16 kDa proteolipi...    157   2e-45   
ref|XP_009758914.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    158   2e-45   
ref|NP_001233967.1|  V-type proton ATPase 16 kDa proteolipid subunit    157   3e-45   
ref|XP_002279080.1|  PREDICTED: V-type proton ATPase subunit c1         157   3e-45   Vitis vinifera
ref|XP_002313006.1|  Vacuolar ATP synthase 16 kDa proteolipid sub...    159   4e-45   Populus trichocarpa [western balsam poplar]
emb|CDP07433.1|  unnamed protein product                                157   5e-45   
ref|XP_011047217.1|  PREDICTED: V-type proton ATPase subunit c1         159   5e-45   
ref|XP_006411682.1|  hypothetical protein EUTSA_v10026433mg             157   5e-45   
ref|XP_010930879.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    157   5e-45   
ref|XP_008781499.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    157   5e-45   
ref|XP_009109515.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    157   6e-45   
gb|ABK93797.1|  unknown                                                 157   7e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008793919.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    157   7e-45   
ref|XP_008785887.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    157   7e-45   
ref|XP_010531483.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    157   8e-45   
ref|XP_008388136.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   8e-45   
ref|XP_008467065.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   8e-45   
ref|XP_002310846.1|  hypothetical protein POPTR_0007s13890g             156   9e-45   Populus trichocarpa [western balsam poplar]
ref|NP_564098.2|  VACUOLAR-TYPE H+ ATPASE C2                            156   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302232.1|  hypothetical protein POPTR_0002s08330g             156   9e-45   Populus trichocarpa [western balsam poplar]
gb|AHC08714.1|  vacuolar H+-ATPase subunit c                            156   9e-45   
ref|XP_007202676.1|  hypothetical protein PRUPE_ppa012515mg             156   9e-45   
ref|XP_007200387.1|  hypothetical protein PRUPE_ppa012519mg             156   9e-45   
ref|XP_011092859.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   9e-45   
ref|XP_002307699.1|  hypothetical protein POPTR_0005s25660g             156   9e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011088499.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   1e-44   
gb|EYU36762.1|  hypothetical protein MIMGU_mgv1a015204mg                156   1e-44   
ref|XP_008444773.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   1e-44   
ref|XP_011074644.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   1e-44   
ref|XP_009378455.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   1e-44   
ref|XP_009348673.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   1e-44   
gb|AAK01292.1|  vacuolar ATPase subunit c                               156   1e-44   Avicennia marina
ref|XP_008391887.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   1e-44   
ref|XP_006423502.1|  hypothetical protein CICLE_v10029417mg             156   1e-44   
ref|XP_007131746.1|  hypothetical protein PHAVU_011G038500g             156   1e-44   
ref|XP_010912480.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   1e-44   
gb|KDP38594.1|  hypothetical protein JCGZ_04519                         156   1e-44   
ref|XP_007157941.1|  hypothetical protein PHAVU_002G111000g             158   2e-44   
ref|XP_006423504.1|  hypothetical protein CICLE_v10029417mg             155   2e-44   
ref|XP_010933937.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   2e-44   
gb|KHN00493.1|  V-type proton ATPase 16 kDa proteolipid subunit         155   2e-44   
gb|ABK93522.1|  unknown                                                 155   2e-44   Populus trichocarpa [western balsam poplar]
emb|CAA65063.1|  c subunit of V-type ATPase                             155   2e-44   Nicotiana tabacum [American tobacco]
ref|XP_004287829.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   2e-44   
ref|XP_011037226.1|  PREDICTED: V-type proton ATPase subunit c1         155   2e-44   
ref|XP_003520270.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   2e-44   
gb|AAA82977.1|  vacuolar H+-ATPase proteolipid (16 kDa) subunit         155   2e-44   Gossypium hirsutum [American cotton]
ref|XP_002890358.1|  vacuolar-H+-pumping ATPase 16 kDa proteolipi...    155   3e-44   
ref|XP_010113377.1|  V-type proton ATPase 16 kDa proteolipid subunit    156   3e-44   
ref|XP_009335490.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    157   3e-44   
ref|XP_010912057.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   3e-44   
ref|XP_004290874.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   3e-44   
gb|ABJ74162.1|  H+-ATPase proteolipid                                   155   3e-44   Acanthus ebracteatus
ref|XP_004152664.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   3e-44   
ref|XP_006592081.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    156   4e-44   
gb|EMS54266.1|  V-type proton ATPase 16 kDa proteolipid subunit         159   4e-44   
gb|AFK34360.1|  unknown                                                 155   4e-44   
ref|XP_002962220.1|  hypothetical protein SELMODRAFT_77154              155   4e-44   
gb|ACJ86024.1|  unknown                                                 155   4e-44   Medicago truncatula
ref|XP_006423503.1|  hypothetical protein CICLE_v10029417mg             154   4e-44   
ref|XP_009414595.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   4e-44   
ref|XP_003612137.1|  V-type proton ATPase 16 kDa proteolipid subu...    155   4e-44   
ref|XP_004133996.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   4e-44   
ref|XP_003543079.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   4e-44   
ref|XP_003517187.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    155   4e-44   
gb|KEH27580.1|  vacuolar H+-pumping ATPase 16 kDa proteolipid sub...    154   5e-44   
gb|KDP27632.1|  hypothetical protein JCGZ_19637                         155   5e-44   
gb|ACJ84165.1|  unknown                                                 154   5e-44   Medicago truncatula
ref|XP_010534694.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    154   5e-44   
ref|XP_003629349.1|  V-type proton ATPase 16 kDa proteolipid subu...    154   5e-44   
gb|KDO41482.1|  hypothetical protein CISIN_1g031125mg                   154   5e-44   
ref|XP_010523552.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    154   5e-44   
ref|XP_004152663.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    154   5e-44   
ref|XP_003607079.1|  V-type proton ATPase 16 kDa proteolipid subu...    154   5e-44   
gb|AAP15165.1|  vacuolar H(+)-ATPase subunit c                          154   6e-44   Suaeda salsa
gb|AFK44451.1|  unknown                                                 154   6e-44   
gb|KDO41481.1|  hypothetical protein CISIN_1g031125mg                   154   6e-44   
ref|NP_001276180.1|  uncharacterized protein LOC100815182               154   6e-44   
gb|KDO41483.1|  hypothetical protein CISIN_1g031125mg                   153   7e-44   
ref|NP_177693.1|  V-type proton ATPase proteolipid subunit c4           154   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887606.1|  hypothetical protein ARALYDRAFT_476712             154   8e-44   
ref|XP_002513005.1|  vacuolar ATP synthase proteolipid subunit 1,...    154   8e-44   Ricinus communis
ref|XP_006416453.1|  hypothetical protein EUTSA_v10008949mg             154   9e-44   
gb|AGV54613.1|  vacuolar H+-ATP synthase 16kDa proteolipid subunit      154   9e-44   
ref|XP_002513751.1|  vacuolar ATP synthase proteolipid subunit 1,...    154   9e-44   Ricinus communis
ref|XP_006304215.1|  hypothetical protein CARUB_v10010325mg             155   9e-44   
ref|XP_010416452.1|  PREDICTED: V-type proton ATPase subunit c4-like    154   1e-43   
gb|ADQ53511.1|  VAH protein                                             154   1e-43   
ref|XP_009337683.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    154   1e-43   
ref|XP_010539643.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    154   1e-43   
ref|XP_010530297.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    154   1e-43   
gb|AAF04597.1|AF193814_1  vacuolar H+-ATP synthase 16kDa proteoli...    153   1e-43   Dendrobium crumenatum
ref|XP_006435119.1|  hypothetical protein CICLE_v10002710mg             153   1e-43   
ref|XP_010927415.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    153   2e-43   
emb|CAA71930.1|  BV-16/1                                                152   2e-43   Beta vulgaris [beet]
emb|CDY45329.1|  BnaA03g53020D                                          159   2e-43   
gb|KDP46708.1|  hypothetical protein JCGZ_06496                         153   2e-43   
ref|XP_006590717.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    153   2e-43   
gb|ABK21313.1|  unknown                                                 153   2e-43   Picea sitchensis
ref|NP_001185404.1|  V-type proton ATPase proteolipid subunit c4        154   2e-43   
ref|NP_001150274.1|  LOC100283904                                       153   2e-43   Zea mays [maize]
ref|XP_002972795.1|  hypothetical protein SELMODRAFT_228159             153   2e-43   
ref|XP_006647358.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    153   2e-43   
ref|NP_001047092.1|  Os02g0550100                                       153   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002510486.1|  vacuolar ATP synthase proteolipid subunit 1,...    153   2e-43   Ricinus communis
ref|XP_006435120.1|  hypothetical protein CICLE_v10002710mg             152   2e-43   
ref|XP_009149488.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    153   3e-43   
ref|XP_008377172.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    153   3e-43   
emb|CAC80261.1|  V-ATPase subunit c                                     152   3e-43   Beta vulgaris [beet]
ref|NP_001290014.1|  V-type proton ATPase 16 kDa proteolipid subunit    152   3e-43   
ref|NP_001054416.1|  Os05g0106100                                       152   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006854856.1|  hypothetical protein AMTR_s00182p00020350          152   4e-43   
ref|XP_009103374.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    152   4e-43   
ref|XP_007135912.1|  hypothetical protein PHAVU_009G002400g             154   4e-43   
ref|XP_006425529.1|  hypothetical protein CICLE_v10026647mg             152   5e-43   
ref|XP_002441892.1|  hypothetical protein SORBIDRAFT_08g004380          152   5e-43   Sorghum bicolor [broomcorn]
ref|NP_001149195.1|  vacuolar ATP synthase 16 kDa proteolipid sub...    152   5e-43   Zea mays [maize]
gb|KGN62657.1|  hypothetical protein Csa_2G365640                       152   5e-43   
ref|XP_006847027.1|  hypothetical protein AMTR_s00017p00172260          152   5e-43   
gb|ACN25606.1|  unknown                                                 152   5e-43   Zea mays [maize]
gb|ACZ65572.1|  vacuolar H+-ATPase 16kDa subunit c                      152   6e-43   Iris lactea var. lactea
ref|XP_004960548.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    152   6e-43   
ref|XP_004977246.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    152   6e-43   
ref|NP_001066258.1|  Os12g0168900                                       152   6e-43   Oryza sativa Japonica Group [Japonica rice]
gb|ABG22382.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit,...    150   6e-43   
ref|NP_001065855.1|  Os11g0169900                                       152   7e-43   Oryza sativa Japonica Group [Japonica rice]
gb|ACZ65574.1|  vacuolar H+-ATPase 16kDa subunit c                      151   8e-43   Iris lactea var. lactea
ref|XP_006425528.1|  hypothetical protein CICLE_v10026647mg             151   8e-43   
ref|XP_004978799.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    151   1e-42   
ref|XP_003575109.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    151   1e-42   
ref|XP_003569121.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    151   1e-42   
sp|P23957.1|VATL_AVESA  RecName: Full=V-type proton ATPase 16 kDa...    151   1e-42   Avena sativa [cultivated oat]
gb|ACX50967.1|  vacuolar membrane H+-ATPase c subunit                   151   1e-42   Tamarix hispida
gb|EMS55033.1|  V-type proton ATPase 16 kDa proteolipid subunit         150   1e-42   
ref|XP_006653951.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    150   1e-42   
gb|AEB97956.1|  vacuolar H+-ATPase 16 kDa proteolipid subunit c         150   2e-42   
dbj|BAJ90634.1|  predicted protein                                      149   3e-42   
gb|AHY99590.1|  vacuolar (H+)-ATPase c subunit                          150   4e-42   
ref|XP_004960547.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    150   4e-42   
gb|ACZ65575.1|  vacuolar H+-ATPase 16kDa subunit c                      149   4e-42   Iris lactea var. lactea
gb|ABK24299.1|  unknown                                                 149   6e-42   Picea sitchensis
ref|XP_001760844.1|  predicted protein                                  149   1e-41   
ref|XP_011083597.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    148   2e-41   
ref|XP_001751697.1|  predicted protein                                  147   6e-41   
ref|XP_001751438.1|  predicted protein                                  147   6e-41   
gb|ACZ65576.1|  vacuolar H+-ATPase 16kDa subunit c                      146   7e-41   Iris lactea var. lactea
gb|AAL09329.1|AF303372_1  vacuolar-type H(+)-ATPase subunit c           146   1e-40   Syntrichia ruralis
gb|AAA99934.1|  vacuolar H+-pumping ATPase 16 kDa proteolipid           144   5e-40   Arabidopsis thaliana [mouse-ear cress]
gb|ABN48303.1|  vacuolar ATPase subunit c                               139   7e-39   Cucumis sativus [cucumbers]
gb|AAC12797.1|  adenosine triphosphatase                                140   1e-38   Vigna radiata var. radiata [golden gram]
gb|ADH44696.1|  vacuolar H(+)-ATPase subunit c                          139   2e-38   
gb|AAT08734.1|  vacuolar H+-ATPase proteolipid 16 kDa subunit           140   2e-38   Hyacinthus orientalis [common hyacinth]
gb|AFK44243.1|  unknown                                                 140   2e-38   
ref|XP_010091197.1|  V-type proton ATPase 16 kDa proteolipid subunit    140   3e-38   
ref|XP_006646714.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    139   7e-38   
ref|XP_004971351.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    136   6e-37   
gb|ABA95924.2|  expressed protein                                       135   6e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008368022.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    134   1e-36   
ref|XP_010912058.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    134   1e-36   
gb|EPS65806.1|  hypothetical protein M569_08973                         134   2e-36   
ref|XP_008388137.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    133   2e-36   
ref|NP_001045477.1|  Os01g0962300                                       134   5e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977245.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    132   5e-35   
ref|XP_009345640.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    132   5e-35   
gb|EAY82401.1|  hypothetical protein OsI_37615                          131   6e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_004512226.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    131   6e-35   
ref|XP_009109955.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    132   6e-35   
ref|XP_010451050.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    130   8e-35   
gb|KHG30045.1|  hypothetical protein F383_01577                         136   2e-34   
ref|XP_010089505.1|  V-type proton ATPase 16 kDa proteolipid subunit    130   2e-34   
ref|XP_005848107.1|  hypothetical protein CHLNCDRAFT_30996              129   4e-34   
emb|CEF98686.1|  V-ATPase proteolipid subunit                           127   1e-33   
ref|XP_001696361.1|  vacuolar H(+)-ATPase V0 sector, c/c' subunits      127   3e-33   Chlamydomonas reinhardtii
ref|XP_005652095.1|  V-type ATPase                                      127   4e-33   
gb|ADI46947.1|  ATPvL1m                                                 126   6e-33   
gb|KFM26849.1|  V-type proton ATPase 16 kDa proteolipid subunit         126   6e-33   
gb|EYU38851.1|  hypothetical protein MIMGU_mgv1a026590mg                125   1e-32   
ref|XP_002957938.1|  hypothetical protein VOLCADRAFT_107886             125   1e-32   
dbj|BAA23352.1|  vacuolar type H+-ATPase proteolipid subunit            124   3e-32   Acetabularia acetabulum
gb|KDD76967.1|  hypothetical protein H632_c53p3                         123   8e-32   
dbj|BAA21683.1|  vacuolar type H+-ATPase proteolipid subunit            123   9e-32   Acetabularia acetabulum
dbj|BAA23351.1|  vacuolar type H+-ATPase proteolipid subunit            122   2e-31   Acetabularia acetabulum
ref|XP_001418919.1|  F-ATPase family transporter: protons (vacuolar)    121   3e-31   Ostreococcus lucimarinus CCE9901
dbj|BAA23350.1|  vacuolar type H+-ATPase proteolipid subunit            122   3e-31   Acetabularia acetabulum
ref|XP_003080310.1|  vacuolar ATPase subunit c (ISS)                    122   6e-31   
dbj|BAA21682.1|  vacuolar type H+-ATPase proteolipid subunit            114   1e-28   Acetabularia acetabulum
dbj|BAA23349.1|  vacuolar type H+-ATPase proteolipid subunit            114   2e-28   Acetabularia acetabulum
ref|XP_003058268.1|  H+-or Na+-translocating f-type, v-type and A...    113   3e-28   
ref|XP_002499550.1|  H+-or Na+-translocating f-type, v-type and A...    113   9e-28   Micromonas commoda
ref|XP_007514510.1|  unknown                                            112   3e-27   
gb|EYU37872.1|  hypothetical protein MIMGU_mgv1a020126mg                111   3e-27   
ref|XP_009393807.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    106   9e-26   
emb|CDY09753.1|  BnaC07g33080D                                          106   1e-25   
emb|CDY13486.1|  BnaA03g52040D                                          105   2e-25   
ref|XP_004510660.1|  PREDICTED: V-type proton ATPase 16 kDa prote...    103   7e-25   
gb|AFK48695.1|  unknown                                                 102   7e-25   
gb|AFW56182.1|  V-type proton ATPase proteolipid subunit                103   9e-25   
ref|XP_004344009.1|  Vtype ATPase, C subunit                            101   2e-23   
ref|XP_008675712.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  99.0    6e-23   
ref|XP_005758268.1|  vacuolar H+-ATPase V0 sector, subunits c/c         100   7e-23   
ref|XP_005703524.1|  V-type H+-transporting ATPase subunit c          97.1    8e-22   
ref|XP_967959.1|  PREDICTED: V-type proton ATPase 16 kDa proteoli...  97.1    9e-22   Tribolium castaneum [rust-red flour beetle]
pir||JC7151  vacuolar H+-ATPase (EC 3.6.1.-) C chain - red alga (...  97.1    9e-22
ref|XP_009835201.1|  V-type proton ATPase proteolipid subunit         97.1    1e-21   
gb|ETL93639.1|  V-type proton ATPase proteolipid subunit              95.1    2e-21   
ref|XP_008871715.1|  V-type proton ATPase proteolipid subunit         96.3    2e-21   
gb|ETL40537.1|  V-type proton ATPase proteolipid subunit              95.5    2e-21   
gb|ETK87080.1|  V-type proton ATPase proteolipid subunit              95.5    3e-21   
ref|XP_005538224.1|  V-type ATPase V0 subunit c                       95.9    3e-21   
emb|CDY54164.1|  BnaC02g47230D                                        98.6    3e-21   
ref|XP_008621124.1|  V-type H+-transporting ATPase 16kDa proteoli...  95.5    4e-21   
gb|AAW79383.1|  vacuolar ATP synthase                                 95.9    4e-21   Heterocapsa triquetra
sp|Q43362.1|VATL_PLECA  RecName: Full=V-type proton ATPase 16 kDa...  95.1    4e-21   Chrysotila carterae
ref|XP_008905373.1|  V-type proton ATPase proteolipid subunit         95.5    4e-21   
emb|CCI11782.1|  Ev2180                                               94.7    5e-21   
ref|XP_009692511.1|  vacuolar H+-ATPase subunit                       94.7    6e-21   
gb|KFM60257.1|  V-type proton ATPase proteolipid subunit              94.0    1e-20   
ref|NP_001011570.1|  vacuolar H+ ATP synthase 16 kDa proteolipid ...  93.6    1e-20   Apis mellifera [bee]
ref|XP_002908626.1|  V-type proton ATPase 16 kDa proteolipid subu...  94.0    1e-20   
ref|XP_005780073.1|  vacuolar H+-ATPase V0 sector, subunits c/c       93.6    2e-20   
emb|CDJ91685.1|  ATPase domain containing protein                     93.6    2e-20   
gb|ESS32292.1|  vacuolar ATP synthetase                               92.8    2e-20   
gb|EGT33594.1|  CBN-VHA-2 protein                                     93.2    2e-20   
ref|XP_797801.1|  PREDICTED: V-type proton ATPase 16 kDa proteoli...  93.2    2e-20   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003661349.1|  hypothetical protein MYCTH_2314502               93.2    2e-20   
ref|XP_001523616.1|  vacuolar ATP synthase 16 kDa proteolipid sub...  93.2    3e-20   Lodderomyces elongisporus NRRL YB-4239
ref|XP_007024570.1|  ATPase, F0/V0 complex, subunit C protein         90.9    3e-20   
ref|XP_002767877.1|  vacuolar ATP synthase 16 kDa proteolipid sub...  93.2    3e-20   Perkinsus marinus ATCC 50983
sp|P55277.1|VATL_HELVI  RecName: Full=V-type proton ATPase 16 kDa...  92.4    3e-20   Heliothis virescens
gb|EPE05694.1|  vacuolar atp synthase 16 kda proteolipid subunit      92.8    4e-20   
gb|AGO13022.1|  AaceriAFL141Cp                                        92.8    4e-20   
sp|P31403.1|VATL_MANSE  RecName: Full=V-type proton ATPase 16 kDa...  92.4    4e-20   Manduca sexta [Carolina sphinx]
gb|KDR23608.1|  V-type proton ATPase 16 kDa proteolipid subunit       91.7    4e-20   
ref|XP_003709260.1|  V-type proton ATPase proteolipid subunit         92.4    4e-20   
gb|EPT26846.1|  vacuolar ATP synthetase                               92.0    5e-20   
tpg|DAA34683.1|  TPA: vacuolar H+-ATPase V0 sector subunits c/c'      92.0    5e-20   
ref|XP_007377699.1|  hypothetical protein SPAPADRAFT_63556            92.4    5e-20   
ref|XP_003396177.1|  PREDICTED: v-type proton ATPase 16 kDa prote...  92.0    6e-20   
ref|XP_002772137.1|  vacuolar ATP synthase 16 kDa proteolipid sub...  93.6    6e-20   Perkinsus marinus ATCC 50983
gb|EHJ71500.1|  hypothetical protein KGM_13250                        92.0    6e-20   
ref|XP_763952.1|  vacuolar ATPase subunit                             90.9    6e-20   Theileria parva strain Muguga
ref|XP_003137346.1|  vacuolar ATP synthase proteolipid subunit        91.7    8e-20   
ref|XP_001361962.1|  GA16335                                          91.7    8e-20   Drosophila pseudoobscura pseudoobscura
ref|XP_007914202.1|  putative vacuolar atp synthase 16 kda proteo...  91.7    8e-20   
gb|ERT01764.1|  V-type proton ATPase proteolipid subunit              91.3    8e-20   
gb|EGA60198.1|  Tfp3p                                                 91.3    9e-20   
ref|XP_011121971.1|  hypothetical protein AOL_s00078g406              91.7    9e-20   
gb|ACH56921.1|  vacuolar H+-ATPase V0 sector subunits c/c'            91.3    9e-20   Simulium vittatum
ref|XP_003703287.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  91.7    9e-20   
ref|XP_002556017.1|  KLTH0H03124p                                     91.7    9e-20   Lachancea thermotolerans CBS 6340
ref|XP_002371832.1|  vacuolar ATP synthase 16 kDa proteolipid sub...  91.7    1e-19   Toxoplasma gondii ME49
ref|XP_003884509.1|  hypothetical protein NCLIV_049080                91.7    1e-19   
ref|XP_001961321.1|  GF13808                                          91.3    1e-19   Drosophila ananassae
ref|XP_452911.1|  hypothetical protein                                91.7    1e-19   Kluyveromyces lactis NRRL Y-1140
ref|XP_001645235.1|  hypothetical protein Kpol_1060p33                91.3    1e-19   Vanderwaltozyma polyspora DSM 70294
ref|NP_001155531.1|  V-type proton ATPase 16 kDa proteolipid subunit  91.3    1e-19   Acyrthosiphon pisum
gb|EWC44554.1|  V-type proton ATPase proteolipid subunit 2            91.3    1e-19   
ref|XP_952989.1|  vacuolar H+-ATPase subunit                          91.3    1e-19   Theileria annulata strain Ankara
gb|EYB91426.1|  hypothetical protein Y032_0206g1987                   90.9    1e-19   
gb|ETN76971.1|  V-type ATPase, C subunit                              91.3    1e-19   
ref|XP_008815161.1|  V-type proton ATPase proteolipid subunit         90.9    1e-19   
emb|CCF75916.1|  unnamed protein product                              91.3    2e-19   
ref|NP_015090.1|  H(+)-transporting V0 sector ATPase subunit c'       90.9    2e-19   Saccharomyces cerevisiae S288C
gb|EFN78392.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit      90.9    2e-19   
gb|EMG47632.1|  V-type proton ATPase 16 kDa proteolipid subunit 2     90.9    2e-19   
gb|EYC06041.1|  hypothetical protein Y032_0078g1162                   90.9    2e-19   
ref|XP_001382501.1|  vacuolar ATPase V0 domain subunit c' (17 kDa)    90.9    2e-19   Scheffersomyces stipitis CBS 6054
gb|KIH88046.1|  V-type H+-transporting ATPase 16kDa proteolipid s...  90.9    2e-19   
ref|XP_001654757.1|  Vacuolar ATP synthase 16 kDa proteolipid sub...  90.9    2e-19   
ref|XP_445959.1|  hypothetical protein                                90.9    2e-19   
gb|AHN55086.1|  vacuolar H-ATPase 16                                  90.5    2e-19   
gb|AAB71660.1|  V-ATPase C-subunit                                    90.5    2e-19   
ref|XP_003685789.1|  hypothetical protein TPHA_0E02630                90.9    2e-19   
ref|XP_811511.1|  vacuolar ATP synthase                               91.7    2e-19   
ref|XP_808224.1|  vacuolar ATP synthase                               91.7    2e-19   
ref|XP_003112963.1|  CRE-VHA-2 protein                                90.9    2e-19   
ref|XP_458901.1|  DEHA2D10032p                                        90.9    2e-19   
ref|XP_003094813.1|  CRE-VHA-3 protein                                90.5    2e-19   
emb|CDJ96415.1|  ATPase domain containing protein                     90.5    2e-19   
ref|XP_001609797.1|  proteolipid subunit c                            90.9    2e-19   
gb|AAV36517.1|  truncated vacuolar ATPase subunit c isoform           89.0    2e-19   
emb|CDO93246.1|  unnamed protein product                              90.5    3e-19   
ref|XP_002181954.1|  predicted protein                                90.5    3e-19   
dbj|BAN64843.1|  proteolipid subunit c, putative                      90.5    3e-19   
sp|Q17046.1|VATL_ASCSU  RecName: Full=V-type proton ATPase 16 kDa...  90.1    3e-19   
gb|EIE75365.1|  V-type proton ATPase proteolipid subunit              90.1    3e-19   
gb|KHJ49390.1|  AP-3 complex subunit beta-2                           95.9    3e-19   
gb|KHJ99250.1|  V-type ATPase, C subunit                              90.1    3e-19   
gb|ESW97554.1|  V-type proton ATPase proteolipid subunit 2            90.5    3e-19   
gb|KFD57703.1|  hypothetical protein M513_01373                       90.1    3e-19   
gb|ESL12012.1|  vacuolar ATP synthase                                 90.9    3e-19   
ref|XP_001900337.1|  Vacuolar ATP synthase 16 kDa proteolipid sub...  90.1    3e-19   
ref|XP_001613765.1|  vacuolar ATP synthetase                          90.1    4e-19   
ref|XP_002259621.1|  vacuolar ATP synthetase                          90.1    4e-19   
ref|XP_010766304.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.7    4e-19   
ref|XP_002641670.1|  Hypothetical protein CBG10000                    89.7    4e-19   
ref|XP_006873944.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.7    4e-19   
ref|XP_005184512.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.7    4e-19   
ref|XP_002061756.1|  GK17170                                          89.7    4e-19   
gb|KFG45895.1|  vacuolar ATP synthetase                               88.2    4e-19   
gb|EHM99996.1|  Tfp3p                                                 89.7    5e-19   
dbj|BAN20571.1|  vacuolar H[+] ATPase subunit                         89.7    5e-19   
gb|KHN79286.1|  V-type proton ATPase 16 kDa proteolipid subunit       91.3    5e-19   
ref|XP_011105722.1|  tfp3p                                            89.7    5e-19   
gb|ETW45715.1|  V-type ATPase, C subunit                              89.4    5e-19   
ref|XP_001229170.1|  vacuolar ATP synthase 16 kDa proteolipid sub...  89.4    5e-19   
gb|EEQ46979.1|  vacuolar ATP synthase 16 kDa proteolipid subunit 2    89.7    5e-19   
ref|XP_001013914.1|  V-type ATPase, C subunit family protein          89.4    5e-19   
emb|CEF66321.1|  V-type proton ATPase 16 kDa proteolipid subunit      89.7    5e-19   
emb|CCE41998.1|  hypothetical protein CPAR2_805470                    89.7    5e-19   
ref|XP_001351750.1|  vacuolar ATP synthetase                          89.7    5e-19   
ref|XP_002062804.1|  GK19648                                          89.4    5e-19   
ref|NP_500188.1|  Protein VHA-3                                       89.4    5e-19   
gb|EPB83018.1|  V-type H+-transporting ATPase 16kDa proteolipid s...  89.4    5e-19   
ref|XP_004622655.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.7    5e-19   
ref|XP_003438506.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.4    5e-19   
emb|CDO63070.1|  V-type proton ATPase 16 kDa proteolipid subunit,...  89.7    6e-19   
emb|CDK27024.1|  unnamed protein product                              89.0    6e-19   
ref|XP_002165747.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.4    6e-19   
gb|AFK40303.1|  unknown                                               89.4    6e-19   
ref|XP_005935592.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.4    6e-19   
ref|XP_002287204.1|  v-type ATPase                                    89.4    6e-19   
ref|XP_004571403.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.4    6e-19   
dbj|BAO42064.1|  v-type proton ATPase 16 kDa proteolipid subunit 2    89.4    6e-19   
gb|ENN76641.1|  hypothetical protein YQE_06820                        89.4    6e-19   
ref|XP_004222823.1|  vacuolar ATP synthetase                          89.4    6e-19   
ref|NP_476801.1|  vacuolar H[+] ATPase 16kD subunit 1, isoform A      89.4    7e-19   
gb|ABV60304.1|  putative V-ATPase C-subunit                           89.4    7e-19   
gb|ETN86400.1|  V-type ATPase, C subunit                              91.3    7e-19   
emb|CDR44022.1|  CYFA0S13e01750g1_1                                   89.4    7e-19   
ref|XP_010784703.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.0    7e-19   
emb|CDW57191.1|  ATP-synt C domain containing protein                 89.4    7e-19   
ref|XP_004196668.1|  Piso0_003893                                     89.4    7e-19   
ref|XP_003381793.1|  vacuolar ATP synthase proteolipid subunit        89.4    7e-19   
ref|XP_004534551.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  89.0    7e-19   
gb|EUT70588.1|  V-type proton ATPase proteolipid subunit              88.6    7e-19   
gb|EIE81432.1|  V-type proton ATPase proteolipid subunit              89.4    7e-19   
gb|KFY08889.1|  hypothetical protein V492_05829                       89.4    7e-19   
gb|EFX01295.1|  vacuolar ATP synthase proteolipid subunit             89.4    7e-19   
ref|XP_007833906.1|  V-type proton ATPase                             89.4    8e-19   
ref|XP_002491614.1|  Vacuolar ATPase V0 domain subunit c', involv...  89.0    8e-19   
gb|ELU01707.1|  hypothetical protein CAPTEDRAFT_19190                 89.0    8e-19   
gb|ETW38064.1|  V-type proton ATPase proteolipid subunit              88.6    9e-19   
ref|XP_001861266.1|  conserved hypothetical protein                   89.0    9e-19   
ref|XP_004999049.1|  vacuolar ATP synthase proteolipid subunit        89.7    1e-18   
ref|XP_002421383.1|  proteolipid protein, putative; v-ATPase c' s...  89.0    1e-18   
ref|XP_001911041.1|  hypothetical protein                             89.0    1e-18   
ref|XP_721376.1|  hypothetical protein CaO19.6538                     89.0    1e-18   
ref|XP_003454063.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  88.6    1e-18   
gb|ETN66257.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit      88.6    1e-18   
gb|EFN66078.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit      88.6    1e-18   
gb|EPB91100.1|  V-type H+-transporting ATPase 16kDa proteolipid s...  88.6    1e-18   
emb|CCK69837.1|  hypothetical protein KNAG_0D00850                    88.6    1e-18   
gb|KGK40747.1|  hypothetical protein JL09_g229                        88.6    1e-18   
gb|EUC54594.1|  V-type proton ATPase 16 kDa proteolipid subunit 2     88.6    1e-18   
ref|XP_006696978.1|  hypothetical protein CTHT_0066820                88.6    1e-18   
gb|ERG86426.1|  v-type proton atpase 16 kda proteolipid subunit       90.5    1e-18   
gb|EFX70021.1|  hypothetical protein DAPPUDRAFT_231646                88.6    1e-18   
ref|XP_006637438.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  88.2    1e-18   
gb|KHN85048.1|  V-type proton ATPase 16 kDa proteolipid subunit       90.5    1e-18   
ref|NP_985409.1|  AFL141Cp                                            88.6    1e-18   
gb|AAG17394.1|AF277150_1  V-ATPase 16 kD proteolipid subunit c        88.2    2e-18   
ref|XP_007760266.1|  V-type proton ATPase proteolipid subunit         87.8    2e-18   
dbj|BAM18985.1|  vacuolar H[+] ATPase subunit 16-1                    88.2    2e-18   
gb|AFM87347.1|  v-type proton ATPase proteolipid subunit-like pro...  88.2    2e-18   
gb|AFM87499.1|  v-type proton ATPase proteolipid subunit-like pro...  88.2    2e-18   
ref|NP_001279870.1|  ATPase, H+ transporting, lysosomal 16kDa, V0...  88.2    2e-18   
emb|CDS13504.1|  Putative V-type H-transporting ATPase 16kDaFT pr...  88.2    2e-18   
gb|AAV84268.1|  vacuolar atpase 16kDa subunit                         88.2    2e-18   
emb|CDW86375.1|  vacuolar atp synthase                                93.2    2e-18   
gb|ACO09611.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit      87.8    2e-18   
ref|XP_007785267.1|  V-type proton ATPase proteolipid subunit 2       87.4    2e-18   
ref|XP_003871418.1|  Vma11 protein                                    88.2    2e-18   
ref|XP_004364210.1|  Atp6v0c protein                                  88.2    2e-18   
gb|AFM87009.1|  v-type proton ATPase proteolipid subunit-like pro...  87.8    2e-18   
ref|XP_004373239.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.8    2e-18   
ref|XP_011059583.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.8    2e-18   
ref|XP_005150717.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.8    2e-18   
dbj|BAM17838.1|  vacuolar H[+] ATPase subunit 16-1                    88.2    2e-18   
ref|XP_002433961.1|  vacuolar H+ ATPase                               87.8    2e-18   
ref|XP_006808077.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.8    2e-18   
gb|ACM08744.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit      87.4    2e-18   
ref|XP_002550819.1|  vacuolar ATP synthase 16 kDa proteolipid sub...  88.2    2e-18   
emb|CBN81316.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit     87.8    2e-18   
ref|XP_001600237.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  88.2    2e-18   
emb|CDQ68334.1|  unnamed protein product                              87.4    2e-18   
gb|KEF61494.1|  V-type H+-transporting ATPase 16kDa proteolipid s...  87.4    2e-18   
ref|NP_001154112.1|  Vacuolar ATP synthase 16 kDa proteolipid sub...  87.8    2e-18   
ref|XP_008312841.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.8    2e-18   
ref|XP_003651559.1|  hypothetical protein THITE_2112010               87.8    2e-18   
ref|XP_006684329.1|  V-type proton ATPase 16 kDa proteolipid subu...  87.8    2e-18   
gb|KFB53828.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit      87.8    2e-18   
ref|XP_007256360.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.8    2e-18   
ref|XP_001743042.1|  hypothetical protein                             88.2    2e-18   
ref|XP_005054291.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.8    2e-18   
ref|XP_004040005.1|  v-type c subunit family protein, putative        87.0    2e-18   
ref|XP_009222310.1|  V-type proton ATPase proteolipid subunit         87.8    2e-18   
ref|XP_002137844.1|  GA26304                                          87.8    2e-18   
ref|XP_008599398.1|  vacuolar ATP synthase 16 kDa proteolipid sub...  87.8    2e-18   
ref|XP_004712996.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.4    2e-18   
gb|KEY73734.1|  hypothetical protein S7711_06310                      87.8    2e-18   
gb|AFM87725.1|  v-type proton ATPase proteolipid subunit-like pro...  87.4    2e-18   
gb|KFP93001.1|  V-type proton ATPase 16 kDa proteolipid subunit       87.4    3e-18   
emb|CEJ92574.1|  Putative Vacuolar ATP synthase 16 kDa proteolipi...  87.8    3e-18   
gb|AFM86280.1|  v-type proton ATPase proteolipid subunit-like pro...  87.4    3e-18   
ref|XP_003648856.1|  hypothetical protein THITE_57625                 87.8    3e-18   
gb|ADI40537.1|  lysosomal H+-transporting ATPase V0 subunit C         87.0    3e-18   
gb|ACH45351.1|  putative vacuolar H+ ATP synthase 16 kDa proteoli...  87.0    3e-18   
gb|ESA03773.1|  hypothetical protein GLOINDRAFT_238678                87.0    3e-18   
ref|XP_002017466.1|  GL21511                                          87.4    3e-18   
ref|XP_007937733.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.4    3e-18   
gb|ACH45347.1|  putative vacuolar H+ ATP synthase 16 kDa proteoli...  87.4    3e-18   
ref|XP_002006826.1|  GI21278                                          87.4    3e-18   
ref|XP_001994973.1|  GH22892                                          87.4    3e-18   
ref|XP_006913992.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.4    3e-18   
ref|XP_008296032.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.4    3e-18   
ref|XP_002048557.1|  GJ11291                                          87.4    3e-18   
ref|XP_004080387.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.4    3e-18   
ref|XP_009309793.1|  vacuolar ATP synthase                            88.2    3e-18   
ref|XP_003964503.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.4    3e-18   
emb|CEI94683.1|  Putative V-type proton ATPase proteolipid subunit    87.4    3e-18   
ref|XP_003348177.1|  hypothetical protein SMAC_04022                  87.4    3e-18   
gb|EPY29017.1|  vacuolar type h+ ATPase subunit                       87.4    4e-18   
emb|CEG69140.1|  Putative V-type proton ATPase proteolipid subunit    87.4    4e-18   
ref|XP_001915231.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.0    4e-18   
emb|CCH45090.1|  V-type proton ATPase proteolipid subunit             86.7    4e-18   
ref|XP_003916441.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.0    4e-18   
ref|XP_009045630.1|  hypothetical protein LOTGIDRAFT_224185           87.4    4e-18   
ref|XP_008303561.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.0    4e-18   
ref|XP_009017285.1|  hypothetical protein HELRODRAFT_185574           87.4    4e-18   
ref|XP_007795242.1|  putative vacuolar atp synthase 16 kda proteo...  87.4    4e-18   
ref|XP_001364794.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.0    4e-18   
ref|XP_007544749.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  85.1    4e-18   
ref|XP_006967471.1|  predicted protein                                87.0    4e-18   
ref|NP_001091762.1|  vacuolar H+ ATP synthase 16 kDa proteolipid ...  87.0    4e-18   
ref|XP_008328324.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.0    4e-18   
emb|CDR95108.1|  proteolipid subunit c, putative                      87.8    4e-18   
ref|XP_005814433.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.0    4e-18   
gb|KEZ38785.1|  hypothetical protein SAPIO_CDS10822                   87.4    4e-18   
emb|CDF88209.1|  BN860_04764g1_1                                      87.0    4e-18   
ref|NP_991117.1|  V-type proton ATPase 16 kDa proteolipid subunit     87.0    4e-18   
ref|XP_003679216.1|  hypothetical protein TDEL_0A06730                87.0    4e-18   
ref|XP_009020257.1|  hypothetical protein HELRODRAFT_185694           87.0    5e-18   
gb|KFG31209.1|  vacuolar ATP synthetase                               86.3    5e-18   
gb|AFM90381.1|  v-type proton ATPase proteolipid subunit-like pro...  87.0    5e-18   
ref|XP_001683144.1|  putative vacuolar ATP synthase                   87.4    5e-18   
ref|XP_009040888.1|  hypothetical protein AURANDRAFT_32575            87.0    5e-18   
gb|EMF17998.1|  vacuolar membrane ATPase C                            87.0    5e-18   
gb|EHK16919.1|  hypothetical protein TRIVIDRAFT_82809                 87.0    5e-18   
gb|KFH01859.1|  vacuolar ATP synthetase                               86.3    5e-18   
gb|KFX96105.1|  hypothetical protein V490_03502                       87.0    5e-18   
emb|CDH50667.1|  ubiquitin-60s ribosomal protein l40 fusionprotein    89.0    5e-18   
gb|KDN41015.1|  hypothetical protein RSAG8_07721                      87.0    5e-18   
gb|KFX89253.1|  hypothetical protein O988_08699                       87.0    5e-18   
gb|EHH60084.1|  V-type proton ATPase 16 kDa proteolipid subunit       86.3    5e-18   
ref|NP_001264953.1|  ATPase, H+ transporting, lysosomal 16kDa, V0...  86.7    5e-18   
emb|CDH12852.1|  probable V-type proton ATPase 16 kDa proteolipid...  87.0    5e-18   
ref|XP_005025972.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  87.0    5e-18   
ref|XP_009901361.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  84.7    5e-18   
gb|EME49465.1|  hypothetical protein DOTSEDRAFT_40663                 87.0    5e-18   
ref|XP_510748.3|  PREDICTED: V-type proton ATPase 16 kDa proteoli...  86.7    5e-18   
ref|XP_667190.1|  vacuolar ATP synthase 16 kDa proteolipid subuni...  87.0    5e-18   
ref|XP_002112261.1|  conserved hypothetical protein                   86.7    5e-18   
ref|XP_001465476.1|  putative vacuolar ATP synthase                   87.4    5e-18   
gb|ABR27955.1|  vacuolar ATP synthase 16 kDa proteolipid subunit      86.7    5e-18   
ref|XP_008434615.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  86.7    5e-18   
gb|EPY31357.1|  V-type H+-transporting ATPase 16kDa proteolipid s...  87.4    5e-18   
ref|XP_007800462.1|  V-type proton ATPase proteolipid subunit         86.7    5e-18   
gb|KFY96353.1|  hypothetical protein V500_02492                       87.4    6e-18   
ref|XP_627910.1|  vacuolar ATP synthase subunit, possible signal ...  87.0    6e-18   
ref|XP_005522837.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  86.7    6e-18   
ref|XP_007736242.1|  V-type H+-transporting ATPase 16kDa proteoli...  86.7    6e-18   
gb|KFZ10098.1|  hypothetical protein V502_08315                       87.0    6e-18   
gb|ELR09535.1|  V-type proton ATPase proteolipid subunit              86.7    6e-18   
ref|XP_006893921.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  86.7    6e-18   
gb|AEM37724.1|  ATPase H+ transporting lysosomal vacuolar proton      86.7    6e-18   
ref|XP_003417810.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  86.7    6e-18   
ref|XP_002619821.1|  hypothetical protein CLUG_00980                  86.7    6e-18   
ref|XP_002734832.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  86.7    6e-18   
ref|XP_003875447.1|  putative vacuolar ATP synthase                   87.4    6e-18   
ref|XP_002755834.1|  PREDICTED: V-type proton ATPase 16 kDa prote...  86.7    6e-18   
gb|AAH67156.1|  Atp6v0c protein                                       86.3    6e-18   
sp|Q26250.1|VATL_NEPNO  RecName: Full=V-type proton ATPase 16 kDa...  86.7    6e-18   
gb|ADI40539.1|  lysosomal H+-transporting ATPase V0 subunit C         86.3    6e-18   
gb|KID80272.1|  Vacuolar ATP synthase 16 kDa proteolipid subunit      86.3    6e-18   
ref|NP_001185653.1|  TBC1 domain family, member 24                    86.3    7e-18   
ref|XP_961418.2|  vacuolar ATP synthase 16 kDa proteolipid subunit    86.7    7e-18   
emb|CDJ93761.1|  ATPase domain containing protein                     86.3    7e-18   
gb|ADX36413.1|  V-ATPase 16 kD proteolipid subunit c                  86.7    7e-18   



>ref|XP_006409426.1| hypothetical protein EUTSA_v10022840mg [Eutrema salsugineum]
 gb|ESQ50879.1| hypothetical protein EUTSA_v10022840mg [Eutrema salsugineum]
Length=224

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 106/122 (87%), Gaps = 4/122 (3%)
 Frame = -1

Query  366  YAGNSQIRSITPSLQIRSNPDSKAPEKMSTFSGDETAPffgflgaaaalvFSCMGAAYGT  187
            + G  +I+   P  + RS   S   EKMSTFSGDETAPFFGFLGAAAALVFSCMGAAYGT
Sbjct  38   HRGRYKIQISLPRFE-RSGLRS---EKMSTFSGDETAPFFGFLGAAAALVFSCMGAAYGT  93

Query  186  AKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYA  7
            AKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYA
Sbjct  94   AKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYA  153

Query  6    HL  1
            HL
Sbjct  154  HL  155



>gb|KHN41911.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=212

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 103/116 (89%), Gaps = 3/116 (3%)
 Frame = -1

Query  348  IRSITPSLQIRSNPDSKAPEKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVG  169
            I+  T +  +R +P+     KM+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVG
Sbjct  31   IKEETTATDLRFSPNK---HKMAAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVG  87

Query  168  VASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            VASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  88   VASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  143



>ref|XP_009625822.1| PREDICTED: V-type proton ATPase subunit c1 [Nicotiana tomentosiformis]
Length=164

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/95 (100%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  95



>ref|XP_009804090.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
sylvestris]
Length=164

 Score =   159 bits (403),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 95/95 (100%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTF+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSTFAGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  95



>ref|XP_006284579.1| hypothetical protein CARUB_v10005804mg, partial [Capsella rubella]
 gb|EOA17477.1| hypothetical protein CARUB_v10005804mg, partial [Capsella rubella]
Length=192

 Score =   160 bits (405),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -1

Query  288  KMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  109
            KMSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  28   KMSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  87

Query  108  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  88   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  123



>ref|XP_007223415.1| hypothetical protein PRUPE_ppa011277mg [Prunus persica]
 gb|EMJ24614.1| hypothetical protein PRUPE_ppa011277mg [Prunus persica]
Length=216

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 111/129 (86%), Gaps = 7/129 (5%)
 Frame = -1

Query  372  QPYAGNSQIR-SITPSLQIRSNPD--SKAPEKMS--TFSGDETAPffgflgaaaalvFSC  208
            + YA   + + +ITP  ++RS+ +   +   +MS  TFSGDETAPFFGFLGAAAALVFSC
Sbjct  21   KAYAERREKKNTITP--EVRSDQEYLVRKSRRMSSSTFSGDETAPFFGFLGAAAALVFSC  78

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  79   MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  138

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  139  YLFDGYAHL  147



>ref|XP_010432381.1| PREDICTED: V-type proton ATPase subunit c1-like [Camelina sativa]
Length=164

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|NP_179244.1| ATPase, F0/V0 complex, subunit C protein [Arabidopsis thaliana]
 ref|NP_195603.1| vacuolar-type H(+)-ATPase C3 [Arabidopsis thaliana]
 ref|NP_195198.1| vacuolar H+-pumping ATPase C1 [Arabidopsis thaliana]
 ref|XP_002306142.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 family 
protein [Populus trichocarpa]
 ref|XP_002285861.1| PREDICTED: V-type proton ATPase subunit c1 [Vitis vinifera]
 ref|XP_002866823.1| vacuolar ATP synthase 16 kDa proteolipid subunit 5 [Arabidopsis 
lyrata subsp. lyrata]
 ref|XP_002867106.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002886055.1| vacuolar ATP synthase 16 kDa proteolipid subunit 5 [Arabidopsis 
lyrata subsp. lyrata]
 ref|XP_006412191.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 ref|XP_006412192.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 ref|XP_006412193.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 ref|XP_009109559.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009136312.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009138323.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009101920.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009108707.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
 ref|XP_009401127.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009404986.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009410658.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009414856.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Musa acuminata subsp. malaccensis]
 ref|XP_010516605.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010431841.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010436985.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010446405.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010467382.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010489224.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010489226.1| PREDICTED: V-type proton ATPase subunit c1 [Camelina sativa]
 ref|XP_010647579.1| PREDICTED: V-type proton ATPase subunit c1 [Vitis vinifera]
 sp|P0DH92.1|VATL1_ARATH RecName: Full=V-type proton ATPase subunit c1; Short=V-ATPase 
subunit c1; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c1; Short=V-ATPase 16 kDa proteolipid subunit 
c1; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 1; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c1; AltName: Full=Vacuolar proton pump subunit c1 [Arabidopsis 
thaliana]
 sp|P0DH93.1|VATL3_ARATH RecName: Full=V-type proton ATPase subunit c3; Short=V-ATPase 
subunit c3; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c3; Short=V-ATPase 16 kDa proteolipid subunit 
c3; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 3; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c3; AltName: Full=Vacuolar proton pump subunit c3 [Arabidopsis 
thaliana]
 sp|P0DH94.1|VATL5_ARATH RecName: Full=V-type proton ATPase subunit c5; Short=V-ATPase 
subunit c5; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c5; Short=V-ATPase 16 kDa proteolipid subunit 
c5; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 5; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c5; AltName: Full=Vacuolar proton pump subunit c5 [Arabidopsis 
thaliana]
 gb|AAK49588.1|AF372872_1 AT4g34720/T4L20_300 [Arabidopsis thaliana]
 gb|AAL06550.1|AF412097_1 AT4g38920/F19H22_20 [Arabidopsis thaliana]
 gb|AAA99933.1| vacuolar H+-pumping ATPase 16 kDa proteolipid [Arabidopsis thaliana]
 gb|AAA99935.1| vacuolar H+-pumping ATPase 16 kDa proteolipid [Arabidopsis thaliana]
 emb|CAA18851.1| vacuolar H+-transporting ATPase 16K chain [Arabidopsis thaliana]
 emb|CAB38812.1| H+-transporting ATPase 16K chain P2, vacuolar [Arabidopsis thaliana]
 gb|AAD26493.1| putative vacuolar proton-ATPase 16 kDa proteolipid [Arabidopsis 
thaliana]
 emb|CAB80189.1| vacuolar H+-transporting ATPase 16K chain [Arabidopsis thaliana]
 emb|CAB80555.1| H+-transporting ATPase 16K chain P2, vacuolar [Arabidopsis thaliana]
 gb|AAK83591.1| AT4g38920/F19H22_20 [Arabidopsis thaliana]
 gb|AAL24318.1| H+-transporting ATPase 16K chain P2, vacuolar [Arabidopsis thaliana]
 gb|AAL90932.1| AT4g38920/F19H22_20 [Arabidopsis thaliana]
 gb|AAM13248.1| H+-transporting ATPase 16K chain P2, vacuolar [Arabidopsis thaliana]
 gb|AAM63410.1| vacuolar H+-transporting ATPase 16K chain [Arabidopsis thaliana]
 gb|AAM64670.1| vacuolar H+-transporting ATPase 16K chain [Arabidopsis thaliana]
 gb|AAM91049.1| AT4g34720/T4L20_300 [Arabidopsis thaliana]
 gb|AAT41752.1| At2g16510 [Arabidopsis thaliana]
 gb|AAT70456.1| At2g16510 [Arabidopsis thaliana]
 gb|ABK93045.1| unknown [Populus trichocarpa]
 gb|ABK94186.1| unknown [Populus trichocarpa]
 emb|CAN62098.1| hypothetical protein VITISV_006218 [Vitis vinifera]
 gb|EEE86653.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 family 
protein [Populus trichocarpa]
 gb|EFH43082.1| vacuolar ATP synthase 16 kDa proteolipid subunit 5 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43365.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62314.1| vacuolar ATP synthase 16 kDa proteolipid subunit 5 [Arabidopsis 
lyrata subsp. lyrata]
 emb|CBI37981.3| unnamed protein product [Vitis vinifera]
 emb|CBI19010.3| unnamed protein product [Vitis vinifera]
 gb|AEC06505.1| ATPase, F0/V0 complex, subunit C protein [Arabidopsis thaliana]
 gb|AEE86415.1| vacuolar H+-pumping ATPase C1 [Arabidopsis thaliana]
 gb|AEE86993.1| vacuolar-type H(+)-ATPase C3 [Arabidopsis thaliana]
 gb|AEQ39042.1| putative proton-transporting ATPase [Wolffia arrhiza]
 gb|ESQ53644.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 gb|ESQ53645.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 gb|ESQ53646.1| hypothetical protein EUTSA_v10026432mg [Eutrema salsugineum]
 gb|KFK30108.1| hypothetical protein AALP_AA7G217800 [Arabis alpina]
 gb|KFK30483.1| hypothetical protein AALP_AA7G266800 [Arabis alpina]
 gb|KFK40060.1| hypothetical protein AALP_AA3G325100 [Arabis alpina]
Length=164

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_006298701.1| hypothetical protein CARUB_v10014796mg [Capsella rubella]
 ref|XP_009393424.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009399178.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411919.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_010061023.1| PREDICTED: V-type proton ATPase subunit c1 [Eucalyptus grandis]
 gb|EOA31599.1| hypothetical protein CARUB_v10014796mg [Capsella rubella]
 gb|KCW67923.1| hypothetical protein EUGRSUZ_F01624 [Eucalyptus grandis]
Length=164

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_009623992.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
tomentosiformis]
 ref|XP_009606165.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
tomentosiformis]
 ref|XP_009617684.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
tomentosiformis]
 ref|XP_009804961.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
sylvestris]
 ref|XP_009757474.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
sylvestris]
Length=165

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  96



>ref|XP_004232469.1| PREDICTED: V-type proton ATPase subunit c2 [Solanum lycopersicum]
 ref|XP_004238323.1| PREDICTED: V-type proton ATPase subunit c2 [Solanum lycopersicum]
 ref|XP_006340710.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2-like 
[Solanum tuberosum]
 ref|XP_006342012.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2-like 
[Solanum tuberosum]
 ref|XP_009625408.1| PREDICTED: V-type proton ATPase subunit c2 [Nicotiana tomentosiformis]
 ref|XP_009603555.1| PREDICTED: V-type proton ATPase subunit c2 [Nicotiana tomentosiformis]
 ref|XP_009791892.1| PREDICTED: V-type proton ATPase subunit c2 [Nicotiana sylvestris]
 ref|XP_009770493.1| PREDICTED: V-type proton ATPase subunit c2 [Nicotiana sylvestris]
Length=165

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  96



>ref|XP_007017704.1| Vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 isoform 
2, partial [Theobroma cacao]
 gb|EOY14929.1| Vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 isoform 
2, partial [Theobroma cacao]
Length=137

 Score =   157 bits (397),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 101/119 (85%), Gaps = 11/119 (9%)
 Frame = -1

Query  357  NSQIRSITPSLQIRSNPDSKAPEKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKS  178
              QIRSIT   ++ S           TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKS
Sbjct  16   EQQIRSITIFGKMSS-----------TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKS  64

Query  177  GVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  65   GVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  123



>ref|XP_009758914.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nicotiana 
sylvestris]
 sp|Q40585.1|VATL_TOBAC RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Nicotiana tabacum]
 emb|CAA65062.1| c subunit of V-type ATPase [Nicotiana tabacum]
Length=165

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  96



>ref|NP_001233967.1| V-type proton ATPase 16 kDa proteolipid subunit [Solanum lycopersicum]
 ref|NP_001275382.1| vacuolar proton ATPase proteolipid subunit-like protein [Solanum 
tuberosum]
 ref|XP_004248676.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Solanum 
lycopersicum]
 ref|XP_004248677.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Solanum 
lycopersicum]
 ref|XP_006365928.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Solanum tuberosum]
 ref|XP_006365929.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Solanum tuberosum]
 sp|O24011.1|VATL_SOLLC RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Solanum lycopersicum]
 gb|AAB64199.1| vacuolar proton ATPase proteolipid subunit [Solanum lycopersicum]
 gb|ABA40433.1| vacuolar proton ATPase proteolipid subunit-like protein [Solanum 
tuberosum]
 gb|ABB29937.1| vacuolar proton ATPase proteolipid subunit-like protein [Solanum 
tuberosum]
Length=164

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSNFAGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  95



>ref|XP_002279080.1| PREDICTED: V-type proton ATPase subunit c1 [Vitis vinifera]
 emb|CAN78114.1| hypothetical protein VITISV_027417 [Vitis vinifera]
 emb|CBI19803.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MTTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_002313006.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 family 
protein [Populus trichocarpa]
 gb|EEE86961.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 family 
protein [Populus trichocarpa]
Length=207

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  44   MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  103

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  104  AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  138



>emb|CDP07433.1| unnamed protein product [Coffea canephora]
 emb|CDP07434.1| unnamed protein product [Coffea canephora]
 emb|CDP01923.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPKTK+YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKTKAYYLFDGYAHL  96



>ref|XP_011047217.1| PREDICTED: V-type proton ATPase subunit c1 [Populus euphratica]
Length=207

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  44   MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  103

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  104  AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  138



>ref|XP_006411682.1| hypothetical protein EUTSA_v10026433mg [Eutrema salsugineum]
 gb|ESQ53135.1| hypothetical protein EUTSA_v10026433mg [Eutrema salsugineum]
Length=164

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_010930879.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
Length=164

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_008781499.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Phoenix 
dactylifera]
 ref|XP_008784205.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Phoenix 
dactylifera]
 ref|XP_008805578.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Phoenix 
dactylifera]
 ref|XP_010555255.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
 ref|XP_010526574.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
 ref|XP_010526908.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
 ref|XP_010911678.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Elaeis 
guineensis]
Length=164

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_009109515.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Brassica rapa]
Length=164

 Score =   157 bits (396),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVII TGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIIRTGINPKAKSYYLFDGYAHL  95



>gb|ABK93797.1| unknown [Populus trichocarpa]
Length=165

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            +STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  2    VSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  61

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  62   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_008793919.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Phoenix dactylifera]
Length=164

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSNFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_008785887.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Phoenix dactylifera]
Length=164

 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSNFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_010531483.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Tarenaya hassleriana]
Length=164

 Score =   157 bits (396),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_008388136.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Malus domestica]
Length=125

 Score =   155 bits (392),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_008467065.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis melo]
Length=130

 Score =   155 bits (393),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_002310846.1| hypothetical protein POPTR_0007s13890g [Populus trichocarpa]
 ref|XP_011025922.1| PREDICTED: V-type proton ATPase subunit c2-like [Populus euphratica]
 gb|EEE91296.1| hypothetical protein POPTR_0007s13890g [Populus trichocarpa]
Length=165

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            +STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  2    VSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  61

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  62   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|NP_564098.2| VACUOLAR-TYPE H+ ATPASE C2 [Arabidopsis thaliana]
 ref|XP_002300729.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 4 family protein 
[Populus trichocarpa]
 ref|XP_006386190.1| hypothetical protein POPTR_0002s02870g [Populus trichocarpa]
 ref|XP_011028959.1| PREDICTED: V-type proton ATPase subunit c2 [Populus euphratica]
 ref|XP_011028960.1| PREDICTED: V-type proton ATPase subunit c2 [Populus euphratica]
 sp|P59228.1|VATL2_ARATH RecName: Full=V-type proton ATPase subunit c2; Short=V-ATPase 
subunit c2; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c2; Short=V-ATPase 16 kDa proteolipid subunit 
c2; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 2; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c2; AltName: Full=Vacuolar proton pump subunit c2 [Arabidopsis 
thaliana]
 gb|AAG12542.1|AC007797_2 vacuolar H+-pumping ATPase [Arabidopsis thaliana]
 gb|AAA99937.1| vacuolar H+-pumping ATPase 16 kDa proteolipid [Arabidopsis thaliana]
 gb|ABD65598.1| At1g19910 [Arabidopsis thaliana]
 gb|ABK93405.1| unknown [Populus trichocarpa]
 gb|EEE80002.1| Vacuolar ATP synthase 16 kDa proteolipid subunit 4 family protein 
[Populus trichocarpa]
 gb|AEE29912.1| VACUOLAR-TYPE H+ ATPASE C2 [Arabidopsis thaliana]
 gb|ERP63987.1| hypothetical protein POPTR_0002s02870g [Populus trichocarpa]
 gb|KFK44115.1| hypothetical protein AALP_AA1G217500 [Arabis alpina]
 gb|KHG04199.1| V-type proton ATPase 16 kDa proteolipid subunit c2 -like protein 
[Gossypium arboreum]
 gb|KHG08825.1| V-type proton ATPase 16 kDa proteolipid subunit c2 -like protein 
[Gossypium arboreum]
 gb|KHG19338.1| V-type proton ATPase 16 kDa proteolipid subunit c2 -like protein 
[Gossypium arboreum]
 gb|KHG25128.1| V-type proton ATPase 16 kDa proteolipid subunit c2 -like protein 
[Gossypium arboreum]
Length=165

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_002302232.1| hypothetical protein POPTR_0002s08330g [Populus trichocarpa]
 gb|ABK93712.1| unknown [Populus trichocarpa]
 gb|EEE81505.1| hypothetical protein POPTR_0002s08330g [Populus trichocarpa]
Length=165

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>gb|AHC08714.1| vacuolar H+-ATPase subunit c [Rosa rugosa]
Length=166

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|XP_007202676.1| hypothetical protein PRUPE_ppa012515mg [Prunus persica]
 ref|XP_007227535.1| hypothetical protein PRUPE_ppa012508mg [Prunus persica]
 ref|XP_008219630.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Prunus 
mume]
 ref|XP_008241801.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Prunus 
mume]
 ref|XP_008372768.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
 ref|XP_008378478.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
 ref|XP_008338772.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
 ref|XP_009378196.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
 ref|XP_009338639.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
 gb|EMJ03875.1| hypothetical protein PRUPE_ppa012515mg [Prunus persica]
 gb|EMJ28734.1| hypothetical protein PRUPE_ppa012508mg [Prunus persica]
Length=166

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|XP_007200387.1| hypothetical protein PRUPE_ppa012519mg [Prunus persica]
 ref|XP_008221315.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Prunus 
mume]
 ref|XP_008236829.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Prunus 
mume]
 ref|XP_008387974.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
 gb|EMJ01586.1| hypothetical protein PRUPE_ppa012519mg [Prunus persica]
 gb|AIY85418.1| V-ATPase subunit C3 [Eriobotrya japonica]
Length=166

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|XP_011092859.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Sesamum 
indicum]
Length=165

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_002307699.1| hypothetical protein POPTR_0005s25660g [Populus trichocarpa]
 ref|XP_006434205.1| hypothetical protein CICLE_v10002719mg [Citrus clementina]
 ref|XP_006434206.1| hypothetical protein CICLE_v10002719mg [Citrus clementina]
 ref|XP_006472789.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Citrus sinensis]
 ref|XP_007017703.1| ATPase, F0/V0 complex, subunit C protein isoform 1 [Theobroma 
cacao]
 ref|XP_007019085.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 ref|XP_007042016.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 ref|XP_007046739.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 ref|XP_010109123.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 ref|XP_011027515.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Populus 
euphratica]
 ref|XP_011045145.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Populus 
euphratica]
 sp|Q43434.1|VATL_GOSHI RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Gossypium hirsutum]
 gb|AAA82976.1| vacuolar H+-ATPase proteolipid (16 kDa) subunit [Gossypium hirsutum]
 dbj|BAA75542.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 dbj|BAA89595.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 gb|ABK95764.1| unknown [Populus trichocarpa]
 gb|EEE94695.1| hypothetical protein POPTR_0005s25660g [Populus trichocarpa]
 gb|EOX90896.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 gb|EOX97847.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 gb|EOY14928.1| ATPase, F0/V0 complex, subunit C protein isoform 1 [Theobroma 
cacao]
 gb|EOY16310.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 gb|ESR47445.1| hypothetical protein CICLE_v10002719mg [Citrus clementina]
 gb|ESR47446.1| hypothetical protein CICLE_v10002719mg [Citrus clementina]
 gb|EXC55711.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|KDO80622.1| hypothetical protein CISIN_1g031149mg [Citrus sinensis]
 gb|KDO80623.1| hypothetical protein CISIN_1g031149mg [Citrus sinensis]
 gb|KDO80624.1| hypothetical protein CISIN_1g031149mg [Citrus sinensis]
 gb|KDO80625.1| hypothetical protein CISIN_1g031149mg [Citrus sinensis]
 gb|KHG23863.1| V-type proton ATPase 16 kDa proteolipid subunit [Gossypium arboreum]
 gb|KHG30047.1| CVA16-2: V-type proton ATPase 16 kDa proteolipid subunit [Gossypium 
arboreum]
Length=165

 Score =   156 bits (395),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_011088499.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Sesamum indicum]
Length=165

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>gb|EYU36762.1| hypothetical protein MIMGU_mgv1a015204mg [Erythranthe guttata]
 gb|EYU40398.1| hypothetical protein MIMGU_mgv1a015188mg [Erythranthe guttata]
Length=165

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_008444773.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Cucumis 
melo]
 ref|XP_008444777.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Cucumis 
melo]
 ref|XP_010066228.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Eucalyptus 
grandis]
 ref|XP_010028655.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Eucalyptus 
grandis]
 ref|XP_010104504.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 ref|XP_010263904.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nelumbo 
nucifera]
 ref|XP_010271457.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nelumbo 
nucifera]
 ref|XP_010242823.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nelumbo 
nucifera]
 ref|XP_010247680.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Nelumbo 
nucifera]
 sp|Q96473.1|VATL_KALDA RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=V-type 
H(+)-ATPase 16 kDa subunit; AltName: Full=Vacuolar proton 
pump 16 kDa proteolipid subunit [Kalanchoe daigremontiana]
 gb|AAC49473.1| V-type H+-ATPase 16 kDa subunit [Kalanchoe daigremontiana]
 gb|ACU87545.1| V-H+-ATPase subunit c protein [Limonium bicolor]
 gb|EXC01105.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
Length=165

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_011074644.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Sesamum 
indicum]
 ref|XP_011083595.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform 
X1 [Sesamum indicum]
 ref|XP_011083596.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform 
X2 [Sesamum indicum]
 emb|CAH58637.1| vacuolar H+-ATPase C subunit [Plantago major]
 emb|CAJ38382.1| vacuolar H+-ATPase, subunit C 2 [Plantago major]
 gb|EPS58502.1| hypothetical protein M569_16311 [Genlisea aurea]
 gb|EPS66400.1| hypothetical protein M569_08374 [Genlisea aurea]
Length=165

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_009378455.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Pyrus 
x bretschneideri]
 ref|XP_009379559.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Pyrus 
x bretschneideri]
 gb|AIY85416.1| V-ATPase subunit C2 [Eriobotrya japonica]
Length=165

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_009348673.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
Length=166

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>gb|AAK01292.1| vacuolar ATPase subunit c [Avicennia marina]
Length=165

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            +STFSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  2    VSTFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  61

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  62   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_008391887.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Malus domestica]
 ref|XP_008358082.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Malus domestica]
 ref|XP_008365697.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1 
[Malus domestica]
Length=166

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|XP_006423502.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
 gb|ESR36742.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
Length=165

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_007131746.1| hypothetical protein PHAVU_011G038500g [Phaseolus vulgaris]
 sp|O22552.1|VATL_VIGRR RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Vigna radiata 
var. radiata]
 gb|AAC12798.1| adenosine triphosphatase [Vigna radiata]
 gb|ESW03740.1| hypothetical protein PHAVU_011G038500g [Phaseolus vulgaris]
Length=164

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M++FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MASFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_010912480.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
Length=164

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS+FSGD+TAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSSFSGDQTAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|KDP38594.1| hypothetical protein JCGZ_04519 [Jatropha curcas]
Length=167

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  5    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  64

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  65   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  98



>ref|XP_007157941.1| hypothetical protein PHAVU_002G111000g [Phaseolus vulgaris]
 gb|ESW29935.1| hypothetical protein PHAVU_002G111000g [Phaseolus vulgaris]
Length=239

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = -1

Query  303  SKAPEKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKS  124
             +  E+M  FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKS
Sbjct  70   QRRKERMVDFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKS  129

Query  123  IVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            IVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  130  IVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  170



>ref|XP_006423504.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
 gb|ESR36744.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
Length=151

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_010933937.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
Length=164

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|KHN00493.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=133

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|ABK93522.1| unknown [Populus trichocarpa]
Length=141

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>emb|CAA65063.1| c subunit of V-type ATPase [Nicotiana tabacum]
Length=165

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVA MGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVACMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIA+IISTGINPKTKSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIALIISTGINPKTKSYYLFDGYAHL  96



>ref|XP_004287829.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Fragaria vesca subsp. vesca]
 ref|XP_004291823.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Fragaria vesca subsp. vesca]
Length=166

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            +TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    TTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|XP_011037226.1| PREDICTED: V-type proton ATPase subunit c1 [Populus euphratica]
Length=164

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            A VLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   ACVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_003520270.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
 ref|XP_003522823.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
 ref|XP_003547948.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
 ref|XP_007156122.1| hypothetical protein PHAVU_003G260400g [Phaseolus vulgaris]
 gb|ESW28116.1| hypothetical protein PHAVU_003G260400g [Phaseolus vulgaris]
 gb|KHN20025.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
 gb|KHN33708.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
 gb|KHN34303.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=164

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|AAA82977.1| vacuolar H+-ATPase proteolipid (16 kDa) subunit [Gossypium hirsutum]
 gb|KHF97295.1| V-type proton ATPase 16 kDa proteolipid subunit [Gossypium arboreum]
Length=165

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            +TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    TTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_002890358.1| vacuolar-H+-pumping ATPase 16 kDa proteolipid subunit 2 [Arabidopsis 
lyrata subsp. lyrata]
 ref|XP_006302919.1| hypothetical protein CARUB_v10021055mg [Capsella rubella]
 ref|XP_010498416.1| PREDICTED: V-type proton ATPase subunit c2 [Camelina sativa]
 ref|XP_010459670.1| PREDICTED: V-type proton ATPase subunit c2 [Camelina sativa]
 ref|XP_010477217.1| PREDICTED: V-type proton ATPase subunit c2 [Camelina sativa]
 gb|EFH66617.1| vacuolar-H+-pumping ATPase 16 kDa proteolipid subunit 2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EOA35817.1| hypothetical protein CARUB_v10021055mg [Capsella rubella]
 gb|KFK41996.1| hypothetical protein AALP_AA2G198800 [Arabis alpina]
Length=165

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_010113377.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|EXC35384.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
Length=188

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_009335490.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
Length=218

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  56   STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  115

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  116  GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  149



>ref|XP_010912057.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X1 [Elaeis guineensis]
Length=164

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MS FSGD+TAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSDFSGDQTAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_004290874.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c4-like 
[Fragaria vesca subsp. vesca]
Length=166

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>gb|ABJ74162.1| H+-ATPase proteolipid [Acanthus ebracteatus]
Length=165

 Score =   155 bits (392),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/93 (99%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = -1

Query  279  TFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  100
            TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  4    TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  63

Query  99   VLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            VLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   VLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_004152664.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_004164437.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_006487263.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Citrus sinensis]
 gb|KDO41480.1| hypothetical protein CISIN_1g031125mg [Citrus sinensis]
Length=165

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_006592081.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
Length=203

 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -1

Query  321  IRSNPDSKAPEKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRP  142
            +RS+        M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRP
Sbjct  28   LRSDQSDVVAVIMAPFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRP  87

Query  141  ELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            ELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  88   ELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  134



>gb|EMS54266.1| V-type proton ATPase 16 kDa proteolipid subunit [Triticum urartu]
Length=313

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 110/129 (85%), Gaps = 5/129 (4%)
 Frame = -1

Query  375  AQPYAGNSQIRSITPSLQIRSNPD---SKAPEKMST-FSGDETAPffgflgaaaalvFSC  208
            A+  + N + R++   ++ R++PD   S    KMS+ FSGDETAPFFGFLGAAAALVFSC
Sbjct  117  AKSQSDNRKARALAWVVE-RADPDPSSSTRRRKMSSVFSGDETAPFFGFLGAAAALVFSC  175

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K Y
Sbjct  176  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPY  235

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  236  YLFDGYAHL  244



>gb|AFK34360.1| unknown [Lotus japonicus]
Length=164

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_002962220.1| hypothetical protein SELMODRAFT_77154 [Selaginella moellendorffii]
 ref|XP_002965134.1| hypothetical protein SELMODRAFT_82765 [Selaginella moellendorffii]
 gb|EFJ33972.1| hypothetical protein SELMODRAFT_82765 [Selaginella moellendorffii]
 gb|EFJ37480.1| hypothetical protein SELMODRAFT_77154 [Selaginella moellendorffii]
Length=163

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M  FSGDETAPFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MDAFSGDETAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|ACJ86024.1| unknown [Medicago truncatula]
Length=164

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAGFSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_006423503.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
 gb|ESR36743.1| hypothetical protein CICLE_v10029417mg [Citrus clementina]
Length=146

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_009414595.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Musa acuminata subsp. malaccensis]
Length=164

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTF+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MSTFTGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  95



>ref|XP_003612137.1| V-type proton ATPase 16 kDa proteolipid subunit c4 [Medicago 
truncatula]
 gb|AES95095.1| vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 [Medicago 
truncatula]
 gb|AFK43432.1| unknown [Medicago truncatula]
 gb|AFK45686.1| unknown [Medicago truncatula]
Length=164

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAGFSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_004133996.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_004169510.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 gb|KGN56739.1| Vacuolar H+-ATPase c subunit [Cucumis sativus]
Length=165

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_003543079.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
 ref|XP_003544693.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform 1 [Glycine max]
 ref|XP_007141015.1| hypothetical protein PHAVU_008G160200g [Phaseolus vulgaris]
 gb|ESW13009.1| hypothetical protein PHAVU_008G160200g [Phaseolus vulgaris]
 gb|KHN04119.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
 gb|KHN33841.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=164

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_003517187.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform 1 [Glycine max]
Length=164

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|KEH27580.1| vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 [Medicago 
truncatula]
Length=132

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAGFSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|KDP27632.1| hypothetical protein JCGZ_19637 [Jatropha curcas]
 gb|KDP32809.1| hypothetical protein JCGZ_12101 [Jatropha curcas]
Length=165

 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>gb|ACJ84165.1| unknown [Medicago truncatula]
Length=164

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAGFSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_010534694.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Tarenaya hassleriana]
Length=165

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_003629349.1| V-type proton ATPase 16 kDa proteolipid subunit c1/c3/c5 [Medicago 
truncatula]
 gb|AET03825.1| vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 [Medicago 
truncatula]
Length=164

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAP FGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAPFSGDETAPLFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|KDO41482.1| hypothetical protein CISIN_1g031125mg [Citrus sinensis]
Length=151

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_010523552.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
Length=165

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_004152663.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_004164438.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Cucumis sativus]
 ref|XP_006466918.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Citrus sinensis]
 dbj|BAA75515.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 dbj|BAA89594.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 gb|KDO71128.1| hypothetical protein CISIN_1g031129mg [Citrus sinensis]
 gb|KGN62658.1| hypothetical protein Csa_2G365650 [Cucumis sativus]
Length=165

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_003607079.1| V-type proton ATPase 16 kDa proteolipid subunit c1/c3/c5 [Medicago 
truncatula]
 ref|XP_004507511.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Cicer arietinum]
 ref|XP_004509343.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Cicer arietinum]
 gb|AES89276.1| vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 [Medicago 
truncatula]
 gb|AFK35156.1| unknown [Medicago truncatula]
 gb|AFK44894.1| unknown [Medicago truncatula]
Length=164

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAPFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|AAP15165.1| vacuolar H(+)-ATPase subunit c [Suaeda salsa]
 gb|AEP40376.1| vacuolar proton pump ATPase subunit C [Suaeda corniculata]
Length=164

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|AFK44451.1| unknown [Lotus japonicus]
Length=164

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAPFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|KDO41481.1| hypothetical protein CISIN_1g031125mg [Citrus sinensis]
Length=145

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|NP_001276180.1| uncharacterized protein LOC100815182 [Glycine max]
 gb|ACU19338.1| unknown [Glycine max]
 gb|KHN25433.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
 gb|KHN39851.1| V-type proton ATPase 16 kDa proteolipid subunit [Glycine soja]
Length=164

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAPFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|KDO41483.1| hypothetical protein CISIN_1g031125mg [Citrus sinensis]
Length=132

 Score =   153 bits (387),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|NP_177693.1| V-type proton ATPase proteolipid subunit c4 [Arabidopsis thaliana]
 sp|P59229.1|VATL4_ARATH RecName: Full=V-type proton ATPase subunit c4; Short=V-ATPase 
subunit c4; AltName: Full=V-type proton ATPase 16 kDa proteolipid 
subunit c4; Short=V-ATPase 16 kDa proteolipid subunit 
c4; AltName: Full=Vacuolar H(+)-ATPase subunit c isoform 4; 
AltName: Full=Vacuolar proton pump 16 kDa proteolipid subunit 
c4; AltName: Full=Vacuolar proton pump subunit c4 [Arabidopsis 
thaliana]
 gb|AAD38803.1|AF153677_1 vacuolar H+-pumping ATPase 16 kDa subunit c isoform 4 [Arabidopsis 
thaliana]
 gb|AAF87129.1|AC006434_25 F10A5.17 [Arabidopsis thaliana]
 gb|AAL11568.1|AF424574_1 At1g75630/F10A5_17 [Arabidopsis thaliana]
 gb|AAA99936.1| vacuolar H+-pumping ATPase 16 kDa proteolipid [Arabidopsis thaliana]
 gb|AAM19995.1| At1g75630/F10A5_17 [Arabidopsis thaliana]
 gb|AEE35739.1| V-type proton ATPase proteolipid subunit c4 [Arabidopsis thaliana]
Length=166

 Score =   154 bits (389),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|XP_002887606.1| hypothetical protein ARALYDRAFT_476712 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63865.1| hypothetical protein ARALYDRAFT_476712 [Arabidopsis lyrata subsp. 
lyrata]
Length=183

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_002513005.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 ref|XP_002531515.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 gb|EEF30869.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 gb|EEF49508.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
Length=165

 Score =   154 bits (389),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_006416453.1| hypothetical protein EUTSA_v10008949mg [Eutrema salsugineum]
 ref|XP_009110251.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2-like 
[Brassica rapa]
 ref|XP_010428588.1| PREDICTED: V-type proton ATPase subunit c2-like [Camelina sativa]
 ref|XP_010471677.1| PREDICTED: V-type proton ATPase subunit c2-like [Camelina sativa]
 gb|ESQ34806.1| hypothetical protein EUTSA_v10008949mg [Eutrema salsugineum]
Length=165

 Score =   154 bits (389),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>gb|AGV54613.1| vacuolar H+-ATP synthase 16kDa proteolipid subunit [Phaseolus 
vulgaris]
Length=164

 Score =   154 bits (389),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M  FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MVDFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_002513751.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 gb|EEF48334.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
Length=169

 Score =   154 bits (389),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  7    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  66

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  67   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  100



>ref|XP_006304215.1| hypothetical protein CARUB_v10010325mg [Capsella rubella]
 gb|EOA37113.1| hypothetical protein CARUB_v10010325mg [Capsella rubella]
Length=203

 Score =   155 bits (392),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  41   SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  100

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  101  GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  134



>ref|XP_010416452.1| PREDICTED: V-type proton ATPase subunit c4-like [Camelina sativa]
Length=165

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>gb|ADQ53511.1| VAH protein [Phyllostachys edulis]
Length=165

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAAL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>ref|XP_009337683.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Pyrus x bretschneideri]
Length=166

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  97



>ref|XP_010539643.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Tarenaya hassleriana]
 ref|XP_010539854.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tarenaya 
hassleriana]
Length=165

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_010530297.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Tarenaya hassleriana]
Length=165

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>gb|AAF04597.1|AF193814_1 vacuolar H+-ATP synthase 16kDa proteolipid subunit [Dendrobium 
crumenatum]
Length=164

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M  FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MVGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>ref|XP_006435119.1| hypothetical protein CICLE_v10002710mg [Citrus clementina]
 ref|XP_006473604.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Citrus sinensis]
 dbj|BAA75516.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 dbj|BAA89596.1| vacuolar H+-ATPase c subunit [Citrus unshiu]
 gb|ESR48359.1| hypothetical protein CICLE_v10002710mg [Citrus clementina]
 gb|KDO84764.1| hypothetical protein CISIN_1g031073mg [Citrus sinensis]
Length=166

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            + FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    TLFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|XP_010927415.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
 ref|XP_010927416.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
 ref|XP_010927417.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
 ref|XP_010927418.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Elaeis guineensis]
Length=164

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDE APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MTDFSGDEVAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>emb|CAA71930.1| BV-16/1 [Beta vulgaris subsp. vulgaris]
Length=121

 Score =   152 bits (383),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 1/96 (1%)
 Frame = -1

Query  285  MST-FSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  109
            MST F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  108  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>emb|CDY45329.1| BnaA03g53020D [Brassica napus]
Length=376

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/95 (99%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  213  MSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  272

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  273  AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  307



>gb|KDP46708.1| hypothetical protein JCGZ_06496 [Jatropha curcas]
Length=165

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -1

Query  276  FSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  97
            FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  5    FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  64

Query  96   LGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            LGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  65   LGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_006590717.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Glycine max]
Length=164

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M  FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MPGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  95



>gb|ABK21313.1| unknown [Picea sitchensis]
 gb|ABK25220.1| unknown [Picea sitchensis]
 gb|ABK25983.1| unknown [Picea sitchensis]
Length=165

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            +  FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  2    VEAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  61

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  62   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|NP_001185404.1| V-type proton ATPase proteolipid subunit c4 [Arabidopsis thaliana]
 gb|AEE35740.1| V-type proton ATPase proteolipid subunit c4 [Arabidopsis thaliana]
Length=200

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|NP_001150274.1| LOC100283904 [Zea mays]
 gb|ACF85712.1| unknown [Zea mays]
 gb|ACG33481.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACG38468.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|AFW75023.1| Vacuolar ATP synthase proteolipid subunit [Zea mays]
Length=166

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  97



>ref|XP_002972795.1| hypothetical protein SELMODRAFT_228159 [Selaginella moellendorffii]
 ref|XP_002984370.1| hypothetical protein SELMODRAFT_271704 [Selaginella moellendorffii]
 gb|EFJ14420.1| hypothetical protein SELMODRAFT_271704 [Selaginella moellendorffii]
 gb|EFJ26016.1| hypothetical protein SELMODRAFT_228159 [Selaginella moellendorffii]
Length=166

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/93 (97%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -1

Query  279  TFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  100
             FSGDETAPFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  6    AFSGDETAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  65

Query  99   VLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            VLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  66   VLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  98



>ref|XP_006647358.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Oryza brachyantha]
Length=167

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            +TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  5    TTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  64

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  65   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  98



>ref|NP_001047092.1| Os02g0550100 [Oryza sativa Japonica Group]
 dbj|BAD16200.1| putative Vacuolar ATP synthase 16 kDa proteolipid subunit [Oryza 
sativa Japonica Group]
 dbj|BAD33262.1| putative Vacuolar ATP synthase 16 kDa proteolipid subunit [Oryza 
sativa Japonica Group]
 dbj|BAF09006.1| Os02g0550100 [Oryza sativa Japonica Group]
 gb|EEC73374.1| hypothetical protein OsI_07608 [Oryza sativa Indica Group]
 gb|EEE57166.1| hypothetical protein OsJ_07092 [Oryza sativa Japonica Group]
Length=167

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  5    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  64

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  65   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  98



>ref|XP_002510486.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
 gb|EEF52673.1| vacuolar ATP synthase proteolipid subunit 1, 2, 3, putative [Ricinus 
communis]
Length=165

 Score =   153 bits (386),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/93 (98%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = -1

Query  279  TFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  100
             FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG
Sbjct  4    AFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  63

Query  99   VLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            VLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   VLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_006435120.1| hypothetical protein CICLE_v10002710mg [Citrus clementina]
 gb|ESR48360.1| hypothetical protein CICLE_v10002710mg [Citrus clementina]
Length=148

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            + FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    TLFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  97



>ref|XP_009149488.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2 
[Brassica rapa]
Length=165

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAA VFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETAPFFGFLGAAAAPVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_008377172.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Malus domestica]
 ref|XP_008347353.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Malus 
domestica]
Length=166

 Score =   153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            +TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    TTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  97



>emb|CAC80261.1| V-ATPase subunit c [Beta vulgaris]
Length=135

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 1/96 (1%)
 Frame = -1

Query  285  MST-FSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  109
            MST F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  108  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|NP_001290014.1| V-type proton ATPase 16 kDa proteolipid subunit [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010667733.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Beta 
vulgaris subsp. vulgaris]
 sp|P68161.1|VATL_MESCR RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Mesembryanthemum 
crystallinum]
 sp|P68162.1|VATL_BETVU RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Beta vulgaris]
 emb|CAA67356.1| subunit c of V-type ATPase [Beta vulgaris subsp. vulgaris]
 emb|CAA64455.1| V-type ATPase c subunit [Mesembryanthemum crystallinum]
 emb|CAC79689.1| subunit c of V-type ATPase [Beta vulgaris]
Length=165

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 1/96 (1%)
 Frame = -1

Query  285  MST-FSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  109
            MST F+GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  60

Query  108  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|NP_001054416.1| Os05g0106100 [Oryza sativa Japonica Group]
 gb|AAU44174.1| putative vacuolar ATP synthase 16 kDa proteolipid subunit [Oryza 
sativa Japonica Group]
 dbj|BAF16330.1| Os05g0106100 [Oryza sativa Japonica Group]
 gb|EAY96230.1| hypothetical protein OsI_18123 [Oryza sativa Indica Group]
 dbj|BAG88579.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62035.1| hypothetical protein OsJ_16817 [Oryza sativa Japonica Group]
Length=166

 Score =   152 bits (385),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    STFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  97



>ref|XP_006854856.1| hypothetical protein AMTR_s00182p00020350 [Amborella trichopoda]
 gb|ERN16323.1| hypothetical protein AMTR_s00182p00020350 [Amborella trichopoda]
Length=164

 Score =   152 bits (384),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M +FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MVSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  95



>ref|XP_009103374.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c2-like 
[Brassica rapa]
Length=165

 Score =   152 bits (384),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDET+PFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETSPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTG+NPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGVNPKAKSYYLFDGYAHL  96



>ref|XP_007135912.1| hypothetical protein PHAVU_009G002400g [Phaseolus vulgaris]
 gb|ESW07906.1| hypothetical protein PHAVU_009G002400g [Phaseolus vulgaris]
Length=211

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  48   MAGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  107

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  108  AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  142



>ref|XP_006425529.1| hypothetical protein CICLE_v10026647mg [Citrus clementina]
 gb|ESR38769.1| hypothetical protein CICLE_v10026647mg [Citrus clementina]
Length=165

 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S F GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SAFIGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_002441892.1| hypothetical protein SORBIDRAFT_08g004380 [Sorghum bicolor]
 ref|XP_002442886.1| hypothetical protein SORBIDRAFT_08g004390 [Sorghum bicolor]
 gb|EES15730.1| hypothetical protein SORBIDRAFT_08g004380 [Sorghum bicolor]
 gb|EES16724.1| hypothetical protein SORBIDRAFT_08g004390 [Sorghum bicolor]
Length=165

 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>ref|NP_001149195.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 ref|NP_001147046.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 ref|NP_001148417.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 ref|XP_002450376.1| hypothetical protein SORBIDRAFT_05g004510 [Sorghum bicolor]
 ref|XP_003577806.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Brachypodium distachyon]
 ref|XP_003578850.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Brachypodium distachyon]
 ref|XP_008679623.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Zea 
mays]
 gb|AAL08022.1|AF416606_1 vacuolar H+-ATPase 16 kDa proteolipid subunit c [Cenchrus americanus]
 gb|AAV36518.1| vacuolar ATPase subunit c isoform [Cenchrus americanus]
 gb|ACG25259.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACG31406.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACG32031.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACG34512.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Zea mays]
 gb|ACL52430.1| unknown [Zea mays]
 gb|ACN25454.1| unknown [Zea mays]
 gb|ACN35717.1| unknown [Zea mays]
 gb|EES09364.1| hypothetical protein SORBIDRAFT_05g004510 [Sorghum bicolor]
 dbj|BAJ84818.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86865.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89097.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFW65377.1| hypothetical protein ZEAMMB73_020019 [Zea mays]
 tpg|DAA39043.1| TPA: V-type proton ATPase proteolipid subunit [Zea mays]
Length=165

 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>gb|KGN62657.1| hypothetical protein Csa_2G365640 [Cucumis sativus]
Length=165

 Score =   152 bits (384),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S+FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPEL MKSIVPVVMA
Sbjct  3    SSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELGMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_006847027.1| hypothetical protein AMTR_s00017p00172260 [Amborella trichopoda]
 gb|ERN08608.1| hypothetical protein AMTR_s00017p00172260 [Amborella trichopoda]
Length=164

 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M  FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MVAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  95



>gb|ACN25606.1| unknown [Zea mays]
 tpg|DAA55568.1| TPA: ATPase1 [Zea mays]
Length=165

 Score =   152 bits (383),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGA+AALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SAFSGDETAPFFGFLGASAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>gb|ACZ65572.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
 gb|ACZ65573.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
Length=164

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M +FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MPSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  95



>ref|XP_004960548.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X2 [Setaria italica]
Length=166

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            ++TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    VATFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  97



>ref|XP_004977246.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X2 [Setaria italica]
Length=164

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M  FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MVAFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  95



>ref|NP_001066258.1| Os12g0168900 [Oryza sativa Japonica Group]
 ref|XP_006663858.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Oryza brachyantha]
 gb|AAK91135.1|AF286464_1 V-ATPase subunit c [Oryza coarctata]
 dbj|BAF29277.1| Os12g0168900 [Oryza sativa Japonica Group]
 gb|EAZ19781.1| hypothetical protein OsJ_35361 [Oryza sativa Japonica Group]
Length=165

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>gb|ABG22382.1| Vacuolar ATP synthase 16 kDa proteolipid subunit, putative, expressed 
[Oryza sativa Japonica Group]
Length=122

 Score =   150 bits (379),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAA+AL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAASALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>ref|NP_001065855.1| Os11g0169900 [Oryza sativa Japonica Group]
 sp|Q0IUB5.1|VATL_ORYSJ RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Oryza sativa 
Japonica Group]
 sp|A2ZBW5.1|VATL_ORYSI RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Oryza sativa 
Indica Group]
 gb|AAA68175.1| H+-ATPase [Oryza sativa]
 gb|AAX93004.1| V-type ATPase, C subunit, putative [Oryza sativa Japonica Group]
 gb|ABA91617.1| Vacuolar ATP synthase 16 kDa proteolipid subunit, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27700.1| Os11g0169900 [Oryza sativa Japonica Group]
 gb|EAY80099.1| hypothetical protein OsI_35271 [Oryza sativa Indica Group]
 gb|EAZ17575.1| hypothetical protein OsJ_33113 [Oryza sativa Japonica Group]
 dbj|BAG97078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00387.1| unnamed protein product [Oryza sativa Japonica Group]
Length=165

 Score =   152 bits (383),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAA+AL+FSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAASALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>gb|ACZ65574.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
Length=164

 Score =   151 bits (382),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M +FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MPSFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  95



>ref|XP_006425528.1| hypothetical protein CICLE_v10026647mg [Citrus clementina]
 gb|ESR38768.1| hypothetical protein CICLE_v10026647mg [Citrus clementina]
Length=167

 Score =   151 bits (382),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S F GDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SAFIGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_004978799.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Setaria italica]
Length=165

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>ref|XP_003575109.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Brachypodium distachyon]
Length=166

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  4    SVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  64   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  97



>ref|XP_003569121.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Brachypodium 
distachyon]
Length=165

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  96



>sp|P23957.1|VATL_AVESA RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Avena sativa]
 gb|AAA32712.1| H+-ATPase [Avena sativa]
 gb|ABG23316.1| vacuolar ATPase subunit c [Triticum aestivum]
 gb|ACV20869.1| vacuolar H+-ATPase subunit c [Leymus chinensis]
 dbj|BAJ92041.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32401.1| V-type proton ATPase 16 kDa proteolipid subunit [Aegilops tauschii]
 gb|AHW46300.1| vacuolar-type H+-ATPase 16 kDa subunit c [Puccinellia tenuiflora]
Length=165

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  96



>gb|ACX50967.1| vacuolar membrane H+-ATPase c subunit [Tamarix hispida]
Length=165

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 93/96 (97%), Gaps = 1/96 (1%)
 Frame = -1

Query  285  MST-FSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  109
            MST F+GDETAPFFGFLGAAAALVFSCMGAAYGTAK GVGVASMGVMRPELVMKSIVPVV
Sbjct  1    MSTVFNGDETAPFFGFLGAAAALVFSCMGAAYGTAKGGVGVASMGVMRPELVMKSIVPVV  60

Query  108  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>gb|EMS55033.1| V-type proton ATPase 16 kDa proteolipid subunit [Triticum urartu]
Length=162

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  96



>ref|XP_006653951.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Oryza brachyantha]
Length=165

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SAFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  96



>gb|AEB97956.1| vacuolar H+-ATPase 16 kDa proteolipid subunit c [Aeluropus littoralis]
Length=165

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSG+ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGEETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  96



>dbj|BAJ90634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=145

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFL AAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLDAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  96



>gb|AHY99590.1| vacuolar (H+)-ATPase c subunit [Annona cherimola]
Length=166

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -1

Query  276  FSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  97
            FS DETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV
Sbjct  6    FSSDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  65

Query  96   LGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            LGIYGLIIAVIISTGINP+ KSYYLFDGYAHL
Sbjct  66   LGIYGLIIAVIISTGINPRAKSYYLFDGYAHL  97



>ref|XP_004960547.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X1 [Setaria italica]
Length=175

 Score =   150 bits (379),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            ++TFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  3    VATFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  62

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K Y+LFDGYAHL
Sbjct  63   AGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHL  97



>gb|ACZ65575.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
Length=164

 Score =   149 bits (377),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M +FSGDE APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM
Sbjct  1    MPSFSGDEAAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  61   AGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  95



>gb|ABK24299.1| unknown [Picea sitchensis]
 gb|ACN40949.1| unknown [Picea sitchensis]
Length=165

 Score =   149 bits (376),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = -1

Query  279  TFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  100
             FSGDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVM+PELVMKSIVPVVMAG
Sbjct  4    AFSGDEMAPFFGFMGAAAALVFSCMGAAYGTAKSGVGVASMGVMKPELVMKSIVPVVMAG  63

Query  99   VLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            VLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  64   VLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  96



>ref|XP_001760844.1| predicted protein [Physcomitrella patens]
 gb|EDQ74233.1| predicted protein [Physcomitrella patens]
Length=167

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            + F+GDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  5    AVFNGDEVAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  64

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK+K+YY+FDGYAHL
Sbjct  65   GVLGIYGLIIAVIISTGINPKSKAYYVFDGYAHL  98



>ref|XP_011083597.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform 
X3 [Sesamum indicum]
Length=177

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/106 (88%), Positives = 93/106 (88%), Gaps = 12/106 (11%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGL------------IIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGL            IIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   GVLGIYGLIIAVIISTGVFMIIAVIISTGINPKAKSYYLFDGYAHL  108



>ref|XP_001751697.1| predicted protein [Physcomitrella patens]
 gb|EDQ83132.1| predicted protein [Physcomitrella patens]
Length=167

 Score =   147 bits (370),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            + F+GDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  5    AAFNGDEVAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  64

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK+K YY+FDGYAHL
Sbjct  65   GVLGIYGLIIAVIISTGINPKSKPYYVFDGYAHL  98



>ref|XP_001751438.1| predicted protein [Physcomitrella patens]
 ref|XP_001760927.1| predicted protein [Physcomitrella patens]
 ref|XP_001776059.1| predicted protein [Physcomitrella patens]
 gb|EDQ59104.1| predicted protein [Physcomitrella patens]
 gb|EDQ74316.1| predicted protein [Physcomitrella patens]
 gb|EDQ83755.1| predicted protein [Physcomitrella patens]
Length=167

 Score =   147 bits (370),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            + F+GDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  5    AVFNGDEVAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  64

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK+K YY+FDGYAHL
Sbjct  65   GVLGIYGLIIAVIISTGINPKSKPYYVFDGYAHL  98



>gb|ACZ65576.1| vacuolar H+-ATPase 16kDa subunit c [Iris lactea var. lactea]
Length=164

 Score =   146 bits (369),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M +FSGDETAPFFGFLGAA ALVFSCMGAAYGTAKSGVG ASMGVMRPELVMKS VPVVM
Sbjct  1    MPSFSGDETAPFFGFLGAAVALVFSCMGAAYGTAKSGVGAASMGVMRPELVMKSTVPVVM  60

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLI+AVIISTGINPK K YYLFDGYAHL
Sbjct  61   AGVLGIYGLIMAVIISTGINPKAKPYYLFDGYAHL  95



>gb|AAL09329.1|AF303372_1 vacuolar-type H(+)-ATPase subunit c [Syntrichia ruralis]
Length=167

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            + F+GDE APFFGF+GAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  5    AVFNGDEVAPFFGFIGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  64

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGINPK+K YY+FDGYAHL
Sbjct  65   GVLGIYGLIIAVIISTGINPKSKPYYVFDGYAHL  98



>gb|AAA99934.1| vacuolar H+-pumping ATPase 16 kDa proteolipid, partial [Arabidopsis 
thaliana]
Length=157

 Score =   144 bits (363),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/88 (99%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = -1

Query  264  ETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY  85
            ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY
Sbjct  1    ETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY  60

Query  84   GLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  61   GLIIAVIISTGINPKAKSYYLFDGYAHL  88



>gb|ABN48303.1| vacuolar ATPase subunit c [Cucumis sativus]
Length=106

 Score =   139 bits (351),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  5    SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  64

Query  33   SYYLFDGYAHL  1
            SYYLFDGYAHL
Sbjct  65   SYYLFDGYAHL  75



>gb|AAC12797.1| adenosine triphosphatase [Vigna radiata]
Length=145

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  6    SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  65

Query  33   SYYLFDGYAHL  1
            SYYLFDGYAHL
Sbjct  66   SYYLFDGYAHL  76



>gb|ADH44696.1| vacuolar H(+)-ATPase subunit c [Salvia miltiorrhiza]
Length=117

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  15   SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  74

Query  33   SYYLFDGYAHL  1
            SYYLFDGYAHL
Sbjct  75   SYYLFDGYAHL  85



>gb|AAT08734.1| vacuolar H+-ATPase proteolipid 16 kDa subunit [Hyacinthus orientalis]
Length=158

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/88 (97%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  264  ETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY  85
             TAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY
Sbjct  2    STAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIY  61

Query  84   GLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GLIIAVIISTGINP  KSYYLFDGYAHL
Sbjct  62   GLIIAVIISTGINPNAKSYYLFDGYAHL  89



>gb|AFK44243.1| unknown [Medicago truncatula]
Length=158

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K
Sbjct  19   SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAK  78

Query  33   SYYLFDGYAHL  1
            SYYLFDGYAHL
Sbjct  79   SYYLFDGYAHL  89



>ref|XP_010091197.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 ref|XP_010091198.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|EXB43297.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|EXB43298.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
Length=182

 Score =   140 bits (353),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 91/111 (82%), Gaps = 17/111 (15%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvF---------------SC--MGAAYGTAKSGVGVASMG  154
            STFSGDETAPFFGFLGAAAAL+                 C  MGAAYGTAKSGVGVASMG
Sbjct  3    STFSGDETAPFFGFLGAAAALIQISEIRLKLTVFGVNLGCIGMGAAYGTAKSGVGVASMG  62

Query  153  VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  63   VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  113



>ref|XP_006646714.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Oryza brachyantha]
Length=165

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 87/96 (91%), Gaps = 1/96 (1%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvF-SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV  109
            MSTFSGDE APFFGFLGAAAA +  SCMGAAYGTA+SGVGVASMGV RPELVMKSIVPVV
Sbjct  1    MSTFSGDEVAPFFGFLGAAAAALVFSCMGAAYGTARSGVGVASMGVRRPELVMKSIVPVV  60

Query  108  MAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MAGVLGIYGLIIAVI+STGINP  + Y LFDGYAHL
Sbjct  61   MAGVLGIYGLIIAVIVSTGINPMAQPYLLFDGYAHL  96



>ref|XP_004971351.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Setaria italica]
Length=166

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = -1

Query  276  FSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGV  97
            F+GDE APFFGF+GAA+ALVFSCMGAAYGTAKSGVGVA MGVMRPELV KSIVPVVMAGV
Sbjct  6    FNGDEVAPFFGFIGAASALVFSCMGAAYGTAKSGVGVAHMGVMRPELVTKSIVPVVMAGV  65

Query  96   LGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            LGIYGLI+AVIIS+GINP  K YYLFDG+AHL
Sbjct  66   LGIYGLIVAVIISSGINPVAKPYYLFDGFAHL  97



>gb|ABA95924.2| expressed protein [Oryza sativa Japonica Group]
Length=117

 Score =   135 bits (339),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            S FSGDETAPFFGFLGAA+ALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    SVFSGDETAPFFGFLGAASALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFD  16
            GVLGIYGLIIAVIISTGINPK K YYL  
Sbjct  63   GVLGIYGLIIAVIISTGINPKAKPYYLLR  91



>ref|XP_008368022.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c4-like 
[Malus domestica]
Length=122

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETA FFGFL AA  LVF CMG AYGTA SG+G+ SMGV+R ELVMKSIVPVVMA
Sbjct  4    STFSGDETATFFGFLNAATTLVFFCMGTAYGTANSGMGMVSMGVIRSELVMKSIVPVVMA  63

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
             VLGIYGLIIAVIISTGINPK KSYYLFDGY HL
Sbjct  64   RVLGIYGLIIAVIISTGINPKAKSYYLFDGYTHL  97



>ref|XP_010912058.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X2 [Elaeis guineensis]
 gb|KCW55428.1| hypothetical protein EUGRSUZ_I01331 [Eucalyptus grandis]
Length=138

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  1    MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  60

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  61   YLFDGYAHL  69



>gb|EPS65806.1| hypothetical protein M569_08973 [Genlisea aurea]
Length=138

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  1    MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  60

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  61   YLFDGYAHL  69



>ref|XP_008388137.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Malus domestica]
Length=110

 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  13   MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  72

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  73   YLFDGYAHL  81



>ref|NP_001045477.1| Os01g0962300 [Oryza sativa Japonica Group]
 dbj|BAB63620.1| putative vacuolar H+-ATPase 16 kDa proteolipid subunit c [Oryza 
sativa Japonica Group]
 dbj|BAF07391.1| Os01g0962300 [Oryza sativa Japonica Group]
 gb|EAY77328.1| hypothetical protein OsI_05310 [Oryza sativa Indica Group]
 gb|EAZ14921.1| hypothetical protein OsJ_04853 [Oryza sativa Japonica Group]
Length=165

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STF+GDE APF GF+GAA ALVFSCMGAAYGTA+SGVGVA MGVMRPELVMKSIVPVVMA
Sbjct  3    STFNGDEFAPFLGFIGAALALVFSCMGAAYGTARSGVGVAHMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GVLGIYGLIIAVII+TGINP    YY FDG  HL
Sbjct  63   GVLGIYGLIIAVIITTGINPTAMPYYHFDGSVHL  96



>ref|XP_004977245.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform X1 [Setaria italica]
Length=192

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/69 (97%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K Y
Sbjct  55   MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPY  114

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  115  YLFDGYAHL  123



>ref|XP_009345640.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c4-like 
[Pyrus x bretschneideri]
Length=181

 Score =   132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = -1

Query  261  TAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYG  82
            TAPFFGFLGA AALVFSCMGAAYGTAKS VGVASMGV RPELVMKSIVPVVMAGVLGIYG
Sbjct  71   TAPFFGFLGAGAALVFSCMGAAYGTAKSRVGVASMGVTRPELVMKSIVPVVMAGVLGIYG  130

Query  81   LIIAVIISTGINPKTKSYYLFDGYAH  4
            LIIAVIISTGINP+ KSYYLFDGYAH
Sbjct  131  LIIAVIISTGINPEAKSYYLFDGYAH  156



>gb|EAY82401.1| hypothetical protein OsI_37615 [Oryza sativa Indica Group]
Length=167

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/69 (97%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K Y
Sbjct  30   MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPY  89

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  90   YLFDGYAHL  98



>ref|XP_004512226.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c4-like 
[Cicer arietinum]
Length=155

 Score =   131 bits (329),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 84/95 (88%), Gaps = 9/95 (9%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVM  106
            M+ FSGDETAPFFGFLGAAAALVFSCMGA         GVASMGVMRPELVMKSIVPVVM
Sbjct  1    MAGFSGDETAPFFGFLGAAAALVFSCMGA---------GVASMGVMRPELVMKSIVPVVM  51

Query  105  AGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            AGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  52   AGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  86



>ref|XP_009109955.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Brassica rapa]
Length=195

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/69 (97%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLII VIISTGINPK KSY
Sbjct  59   MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIDVIISTGINPKAKSY  118

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  119  YLFDGYAHL  127



>ref|XP_010451050.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Camelina 
sativa]
Length=159

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/68 (97%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -1

Query  204  GAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYY  25
            GAAYGTAKSGVGVASMGVMRPELVMKSIV VVMAGVLGIYGLIIAVIISTGINPK KSYY
Sbjct  23   GAAYGTAKSGVGVASMGVMRPELVMKSIVTVVMAGVLGIYGLIIAVIISTGINPKAKSYY  82

Query  24   LFDGYAHL  1
            LFDGYAHL
Sbjct  83   LFDGYAHL  90



>gb|KHG30045.1| hypothetical protein F383_01577 [Gossypium arboreum]
Length=484

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/69 (99%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSY
Sbjct  347  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSY  406

Query  27   YLFDGYAHL  1
            YLFDGYAHL
Sbjct  407  YLFDGYAHL  415



>ref|XP_010089505.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
 gb|EXB37915.1| V-type proton ATPase 16 kDa proteolipid subunit [Morus notabilis]
Length=168

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S MGAAYGTA+SGVGVASMGVMRPELVMKSIVPVVM GVLGIYGLIIAVI STGINPK K
Sbjct  19   SRMGAAYGTARSGVGVASMGVMRPELVMKSIVPVVMGGVLGIYGLIIAVINSTGINPKAK  78

Query  33   SYYLFDGYAHL  1
            SYYLFDGYAHL
Sbjct  79   SYYLFDGYAHL  89



>ref|XP_005848107.1| hypothetical protein CHLNCDRAFT_30996 [Chlorella variabilis]
 gb|EFN56005.1| hypothetical protein CHLNCDRAFT_30996 [Chlorella variabilis]
Length=169

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 4/99 (4%)
 Frame = -1

Query  285  MST---FSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP  115
            MST   ++GD+ AP FG+LGAA+ALVFSC GAAYGTAKSGVG+ASMGVMRPELVMKSIVP
Sbjct  1    MSTTVVWNGDQVAPLFGYLGAASALVFSCFGAAYGTAKSGVGIASMGVMRPELVMKSIVP  60

Query  114  VVMAGVLGIYGLIIAVIISTGINP-KTKSYYLFDGYAHL  1
            VVMAGVLGIYGLIIAVIIST IN  + K+YY FDGYAH 
Sbjct  61   VVMAGVLGIYGLIIAVIISTNINQTQDKAYYFFDGYAHF  99



>emb|CEF98686.1| V-ATPase proteolipid subunit [Ostreococcus tauri]
Length=158

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 85/91 (93%), Gaps = 2/91 (2%)
 Frame = -1

Query  273  SGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL  94
            SGDE APFFGF+GA++ALVFSCMGAAYGTAKSGVG+ASMGVMRPELVMKSI+PVV +G+L
Sbjct  3    SGDEVAPFFGFMGASSALVFSCMGAAYGTAKSGVGIASMGVMRPELVMKSILPVVFSGIL  62

Query  93   GIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GIYGLIIAV+IS+GINP  KSY LF GYAHL
Sbjct  63   GIYGLIIAVVISSGINP--KSYTLFQGYAHL  91



>ref|XP_001696361.1| vacuolar H(+)-ATPase V0 sector, c/c' subunits [Chlamydomonas 
reinhardtii]
 gb|EDP08338.1| vacuolar H(+)-ATPase V0 sector, c/c' subunits [Chlamydomonas 
reinhardtii]
Length=176

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 85/91 (93%), Gaps = 2/91 (2%)
 Frame = -1

Query  273  SGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL  94
            S  +TAPFFGF+GAAAALVFSCMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVL
Sbjct  14   SNQDTAPFFGFIGAAAALVFSCMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVL  73

Query  93   GIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GIYGLIIAVIISTG+NP T  Y L+DG+AHL
Sbjct  74   GIYGLIIAVIISTGVNPAT--YKLYDGFAHL  102



>ref|XP_005652095.1| V-type ATPase [Coccomyxa subellipsoidea C-169]
 gb|EIE27551.1| V-type ATPase [Coccomyxa subellipsoidea C-169]
Length=176

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
              + GD   PFFGF+GAAAALVF+C GAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMA
Sbjct  12   EQWVGDSVGPFFGFMGAAAALVFACFGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMA  71

Query  102  GVLGIYGLIIAVIISTGINPKT-KSYYLFDGYAHL  1
            GVLGIYGLIIAVIISTGIN    K YYLFDGYAHL
Sbjct  72   GVLGIYGLIIAVIISTGINQTADKPYYLFDGYAHL  106



>gb|ADI46947.1| ATPvL1m [Volvox carteri f. nagariensis]
Length=174

 Score =   126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 82/89 (92%), Gaps = 2/89 (2%)
 Frame = -1

Query  267  DETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGI  88
              TAPFFGF+GAAAALVFSCMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVLGI
Sbjct  18   SATAPFFGFIGAAAALVFSCMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLGI  77

Query  87   YGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            YGLIIAVIISTG+NP    Y LFDG+AHL
Sbjct  78   YGLIIAVIISTGVNP--AKYQLFDGFAHL  104



>gb|KFM26849.1| V-type proton ATPase 16 kDa proteolipid subunit [Auxenochlorella 
protothecoides]
Length=176

 Score =   126 bits (317),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 85/98 (87%), Gaps = 1/98 (1%)
 Frame = -1

Query  291  EKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  112
            E  + ++GD+ AP FG+LGAA+AL FSC GAAYGTAK+GVG+ASMGV+RP+LV+KSI+PV
Sbjct  10   ETTTQWNGDQVAPLFGYLGAASALAFSCFGAAYGTAKAGVGIASMGVLRPDLVIKSIIPV  69

Query  111  VMAGVLGIYGLIIAVIISTGINPKT-KSYYLFDGYAHL  1
            VMAGVLGIYGLIIAVIISTGIN    K+YY FDGYAH 
Sbjct  70   VMAGVLGIYGLIIAVIISTGINQTADKAYYYFDGYAHF  107



>gb|EYU38851.1| hypothetical protein MIMGU_mgv1a026590mg [Erythranthe guttata]
Length=152

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 80/94 (85%), Gaps = 13/94 (14%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  62

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GV             TGINPK KSYYLFDGYAHL
Sbjct  63   GV-------------TGINPKAKSYYLFDGYAHL  83



>ref|XP_002957938.1| hypothetical protein VOLCADRAFT_107886 [Volvox carteri f. nagariensis]
 gb|ADI46881.1| ATPvL1f [Volvox carteri f. nagariensis]
 gb|EFJ40964.1| hypothetical protein VOLCADRAFT_107886 [Volvox carteri f. nagariensis]
Length=174

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 88/109 (81%), Gaps = 13/109 (12%)
 Frame = -1

Query  327  LQIRSNPDSKAPEKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVM  148
            LQ  S  D+ A           TAPFFGF+GAAAALVFSCMGAAYGTAKSGVG+ASMGVM
Sbjct  9    LQSSSGSDASA-----------TAPFFGFIGAAAALVFSCMGAAYGTAKSGVGIASMGVM  57

Query  147  RPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            RPELVMKSIVPVVMAGVLGIYGLIIAVIISTG+NP    Y LFDG+AHL
Sbjct  58   RPELVMKSIVPVVMAGVLGIYGLIIAVIISTGVNP--VKYQLFDGFAHL  104



>dbj|BAA23352.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=168

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 88/98 (90%), Gaps = 3/98 (3%)
 Frame = -1

Query  291  EKMSTFS-GDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVP  115
            E +ST S G++TAPFFGF+GAA+ALVF+CMGAAYGTAKSGVG+ASMGVMRPELVMKSIVP
Sbjct  7    ETLSTASAGNDTAPFFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSIVP  66

Query  114  VVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            VVMAGVLGIYGLIIAVIIST  N K   Y L+DGYAHL
Sbjct  67   VVMAGVLGIYGLIIAVIIST--NVKRDVYKLYDGYAHL  102



>gb|KDD76967.1| hypothetical protein H632_c53p3 [Helicosporidium sp. ATCC 50920]
Length=176

 Score =   123 bits (309),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 86/97 (89%), Gaps = 1/97 (1%)
 Frame = -1

Query  291  EKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV  112
            +  + ++GD+ AP FG+LGAA+ALVF+C G+AYGTAKSGVG+A+MGVMRPELV+KS+VPV
Sbjct  10   QTNAQWNGDQVAPLFGYLGAASALVFACFGSAYGTAKSGVGIAAMGVMRPELVIKSVVPV  69

Query  111  VMAGVLGIYGLIIAVIISTGINPKT-KSYYLFDGYAH  4
            VMAG+LGIYGLIIAVIISTGI     K+YYLFDGYAH
Sbjct  70   VMAGILGIYGLIIAVIISTGITQTADKAYYLFDGYAH  106



>dbj|BAA21683.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=176

 Score =   123 bits (309),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 84/91 (92%), Gaps = 2/91 (2%)
 Frame = -1

Query  273  SGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL  94
            SG++TAPFFGF+GAA+ALVF+CMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVL
Sbjct  22   SGNDTAPFFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVL  81

Query  93   GIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GIYGLIIAVIIST  N K   Y L+DGYAHL
Sbjct  82   GIYGLIIAVIIST--NVKRDVYKLYDGYAHL  110



>dbj|BAA23351.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=167

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 2/91 (2%)
 Frame = -1

Query  273  SGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL  94
            +G++TAPFFGF+GAA+ALVF+CMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVL
Sbjct  13   AGNDTAPFFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVL  72

Query  93   GIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            GIYGLIIAVIIST  N K   Y L+DGYAHL
Sbjct  73   GIYGLIIAVIIST--NVKRDVYKLYDGYAHL  101



>ref|XP_001418919.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO97212.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
Length=159

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 79/89 (89%), Gaps = 2/89 (2%)
 Frame = -1

Query  267  DETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGI  88
            DE APFFGF+GA +ALVFSCMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVLGI
Sbjct  5    DEVAPFFGFMGATSALVFSCMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLGI  64

Query  87   YGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            YGLIIAV+IST  N    SY LF GYAHL
Sbjct  65   YGLIIAVVIST--NIDASSYTLFQGYAHL  91



>dbj|BAA23350.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=168

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 83/90 (92%), Gaps = 2/90 (2%)
 Frame = -1

Query  270  GDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLG  91
            G++TAPFFGF+GAA+ALVF+CMGAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVLG
Sbjct  15   GNDTAPFFGFMGAASALVFACMGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLG  74

Query  90   IYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            IYGLIIAVIIST  N K   Y L+DGYAHL
Sbjct  75   IYGLIIAVIIST--NVKRDVYKLYDGYAHL  102



>ref|XP_003080310.1| vacuolar ATPase subunit c (ISS) [Ostreococcus tauri]
Length=226

 Score =   122 bits (307),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 83/121 (69%), Gaps = 4/121 (3%)
 Frame = -1

Query  357  NSQIRSITPSLQIRSNPDSKAPEK--MSTFSGDETAPffgflgaaaalvFSCMGAAYGTA  184
            +++ R + PS   R    +    +      +GD             ALVFSCMGAAYGTA
Sbjct  41   SARARGMRPSTTRRCRASTTEASRPGARDDAGDLVRTRARCRAVTNALVFSCMGAAYGTA  100

Query  183  KSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAH  4
            KSGVG+ASMGVMRPELVMKSI+PVV +G+LGIYGLIIAV+IS+GINP  KSY LF GYAH
Sbjct  101  KSGVGIASMGVMRPELVMKSILPVVFSGILGIYGLIIAVVISSGINP--KSYTLFQGYAH  158

Query  3    L  1
            L
Sbjct  159  L  159



>dbj|BAA21682.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=164

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 63/71 (89%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SCMGAAYGTAKSG+G+A MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIST  N K  
Sbjct  28   SCMGAAYGTAKSGIGIAQMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIST--NVKKT  85

Query  33   SYYLFDGYAHL  1
             Y L+DGYAH+
Sbjct  86   GYTLYDGYAHI  96



>dbj|BAA23349.1| vacuolar type H+-ATPase proteolipid subunit [Acetabularia acetabulum]
Length=164

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SCMGAAYGTAKSG+G+A MGVM+PELVMKSIVPVVMAGVLGIYGLIIAVIIST  N K  
Sbjct  28   SCMGAAYGTAKSGIGIAQMGVMKPELVMKSIVPVVMAGVLGIYGLIIAVIIST--NVKKT  85

Query  33   SYYLFDGYAHL  1
            +Y L+DGYAH+
Sbjct  86   AYTLYDGYAHM  96



>ref|XP_003058268.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
 gb|EEH58219.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas pusilla CCMP1545]
Length=145

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 63/71 (89%), Gaps = 1/71 (1%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SCMGAAYGTAKSGVG+A+MGV RPELVMKSIVPVVMAGVLGIYGLIIAVIIST  +P   
Sbjct  7    SCMGAAYGTAKSGVGIAAMGVFRPELVMKSIVPVVMAGVLGIYGLIIAVIISTNTSPG-G  65

Query  33   SYYLFDGYAHL  1
            +Y LF GYAHL
Sbjct  66   TYTLFQGYAHL  76



>ref|XP_002499550.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO60808.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=180

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SC GAAYGTAKSGVG+ASMGVMRPELVMKSIVPVVMAGVLGIYGLI++VII+T I+P   
Sbjct  43   SCFGAAYGTAKSGVGIASMGVMRPELVMKSIVPVVMAGVLGIYGLIVSVIIATNIHP--T  100

Query  33   SYYLFDGYAHL  1
             Y LF GYAHL
Sbjct  101  GYTLFQGYAHL  111



>ref|XP_007514510.1| unknown [Bathycoccus prasinos]
 emb|CCO14750.1| unknown [Bathycoccus prasinos]
Length=190

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 85/117 (73%), Gaps = 2/117 (2%)
 Frame = -1

Query  351  QIRSITPSLQIRSNPDSKAPEKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGV  172
            QI  +   L I S       +     SGD  APFFGF+GAA+ALVF+ +GAAYGTAKSGV
Sbjct  6    QIAVLLALLFISSGTKGALAQTNDDSSGDAVAPFFGFMGAASALVFANIGAAYGTAKSGV  65

Query  171  GVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            G+ASMGVMRPELVMKS++  VMAGVLGIYGLIIAVIIST I P    Y LF GYAHL
Sbjct  66   GIASMGVMRPELVMKSVIAPVMAGVLGIYGLIIAVIISTNITP--TGYTLFQGYAHL  120



>gb|EYU37872.1| hypothetical protein MIMGU_mgv1a020126mg [Erythranthe guttata]
Length=147

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 75/94 (80%), Gaps = 18/94 (19%)
 Frame = -1

Query  282  STFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMA  103
            STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGV                
Sbjct  3    STFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGV----------------  46

Query  102  GVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
              LGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  47   --LGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  78



>ref|XP_009393807.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Musa acuminata subsp. malaccensis]
Length=122

 Score =   106 bits (264),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/53 (98%), Positives = 52/53 (98%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  1    MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHL  53



>emb|CDY09753.1| BnaC07g33080D [Brassica napus]
Length=131

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 56/66 (85%), Gaps = 2/66 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYG         GINPK K
Sbjct  68   SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGY--CCYHQYGINPKAK  125

Query  33   SYYLFD  16
            SYYLFD
Sbjct  126  SYYLFD  131



>emb|CDY13486.1| BnaA03g52040D [Brassica napus]
Length=125

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 79/98 (81%), Gaps = 13/98 (13%)
 Frame = -1

Query  285  MSTFSGDETAPffgflgaaaalvFSC----------MGAAYGTAKSGVGVASMGVMRPEL  136
            MSTFSGDE+A FFGF+GAAAALVFS           MGAAYGTAKSGVGVASMGVMRPEL
Sbjct  1    MSTFSGDESARFFGFIGAAAALVFSVLFFVSSLRSGMGAAYGTAKSGVGVASMGVMRPEL  60

Query  135  VMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYL  22
            VM+SIVPVVMAGVLGIYGLIIAVIIST     T SY+ 
Sbjct  61   VMQSIVPVVMAGVLGIYGLIIAVIIST---ESTSSYFF  95



>ref|XP_004510660.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit c1-like 
[Cicer arietinum]
Length=91

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MGVMRPELVMKSIVPVVMAGVLGIYGLII VIISTGINPK KSYYLFDGYAHL
Sbjct  1    MGVMRPELVMKSIVPVVMAGVLGIYGLIIDVIISTGINPKAKSYYLFDGYAHL  53



>gb|AFK48695.1| unknown [Lotus japonicus]
Length=75

 Score =   102 bits (255),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MGVMRPELVMKSIVPVVMA VLGIYGLIIAVIISTGINPK KSYYLFDGYAHL
Sbjct  1    MGVMRPELVMKSIVPVVMARVLGIYGLIIAVIISTGINPKVKSYYLFDGYAHL  53



>gb|AFW56182.1| V-type proton ATPase proteolipid subunit [Zea mays]
Length=122

 Score =   103 bits (257),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPK K YYLFDGYAHL
Sbjct  1    MGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHL  53



>ref|XP_004344009.1| Vtype ATPase, C subunit [Acanthamoeba castellanii str. Neff]
 gb|ELR20606.1| Vtype ATPase, C subunit [Acanthamoeba castellanii str. Neff]
Length=167

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 62/71 (87%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            +C+GAAYGTAKSGVGVA+MGV +P++VMKSI+PVVMAGV+GIYGLIIAVI++T + P   
Sbjct  37   ACLGAAYGTAKSGVGVAAMGVTKPDMVMKSIIPVVMAGVIGIYGLIIAVILATNVTP--T  94

Query  33   SYYLFDGYAHL  1
            +Y  F G+AHL
Sbjct  95   AYTAFRGFAHL  105



>ref|XP_008675712.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Zea mays]
Length=118

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 65/93 (70%), Gaps = 5/93 (5%)
 Frame = -1

Query  279  TFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAG  100
            TFSGD+  PFFG   A        MG  Y T KSGVGVASMGVMR +LVMKSIV VVMA 
Sbjct  5    TFSGDKATPFFGTATALVFR----MGVIYETTKSGVGVASMGVMRLKLVMKSIVLVVMAR  60

Query  99   VLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            VL IY LII  IIS GINPK K Y+L DGYAHL
Sbjct  61   VLDIYDLIIVAIISAGINPKAKPYFL-DGYAHL  92



>ref|XP_005758268.1| vacuolar H+-ATPase V0 sector, subunits c/c [Emiliania huxleyi 
CCMP1516]
 ref|XP_005789998.1| vacuolar H+-ATPase, subunit C [Emiliania huxleyi CCMP1516]
 gb|EOD05839.1| vacuolar H+-ATPase V0 sector, subunits c/c [Emiliania huxleyi 
CCMP1516]
 gb|EOD37569.1| vacuolar H+-ATPase, subunit C [Emiliania huxleyi CCMP1516]
Length=170

 Score =   100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 4/91 (4%)
 Frame = -1

Query  261  TAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYG  82
            TAPFFGF+GAA AL+F+ +GAAYGTAKSGVGV+SMGVM+P+L+MKSI+PVVMAGVLGIYG
Sbjct  12   TAPFFGFMGAAVALIFANLGAAYGTAKSGVGVSSMGVMKPDLIMKSIIPVVMAGVLGIYG  71

Query  81   LIIAVIISTGINPKTKS----YYLFDGYAHL  1
            LIIAVII+ G+ P T      Y  F G+AHL
Sbjct  72   LIIAVIIANGVMPPTSEGTTKYSSFTGFAHL  102



>ref|XP_005703524.1| V-type H+-transporting ATPase subunit c [Galdieria sulphuraria]
 gb|EME27004.1| V-type H+-transporting ATPase subunit c [Galdieria sulphuraria]
Length=159

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSGVGVASMGVMRPELVM+SI+PVVMAGVLGIYGLI+AVI+   I     
Sbjct  23   SNLGAAYGTAKSGVGVASMGVMRPELVMRSIIPVVMAGVLGIYGLIVAVILVGQIAETNY  82

Query  33   SYYLFDGYAHL  1
             Y+L  G+AHL
Sbjct  83   PYFL--GFAHL  91



>ref|XP_967959.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Tribolium 
castaneum]
 gb|EEZ97227.1| hypothetical protein TcasGA2_TC011025 [Tribolium castaneum]
Length=159

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL+IAV+I+ GI+    
Sbjct  27   SSLGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVIAVLIAGGIDSAAN  86

Query  33   SYYLFDGYAHL  1
            +Y L+ G+ HL
Sbjct  87   NYSLYKGFVHL  97



>pir||JC7151 vacuolar H+-ATPase (EC 3.6.1.-) C chain - red alga (Porphyra 
tenera)
 dbj|BAA87944.1| vacuolar-ATPase c subunit [Pyropia yezoensis]
 dbj|BAA87945.1| vacuolar-ATPase c subunit [Pyropia yezoensis]
Length=161

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSGVGVASMGVMRPELVM+ I+PVVMAGVLGIYGLI+AVI+S  +  +  
Sbjct  25   SNLGAAYGTAKSGVGVASMGVMRPELVMRCIIPVVMAGVLGIYGLIVAVIVSGQVVEENY  84

Query  33   SYYLFDGYAHL  1
             Y+L  G+AHL
Sbjct  85   PYFL--GFAHL  93



>ref|XP_009835201.1| V-type proton ATPase proteolipid subunit [Aphanomyces astaci]
 gb|ETV75153.1| V-type proton ATPase proteolipid subunit [Aphanomyces astaci]
Length=169

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGI---NPKT  37
            +GAAYGTAKSGVG+ASMGVMRPELVM++IVPV+MAGVLGIYGLI+AVII   I   N K 
Sbjct  31   LGAAYGTAKSGVGIASMGVMRPELVMRNIVPVIMAGVLGIYGLIVAVIIQGSIDVPNGKE  90

Query  36   KSYYLFDGYAHL  1
              Y  + G+AHL
Sbjct  91   TVYGSYTGFAHL  102



>gb|ETL93639.1| V-type proton ATPase proteolipid subunit, partial [Phytophthora 
parasitica]
Length=126

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP---KT  37
            +GAAYGTAKSGVG+ASMGVMRPEL M++I+PVVMAGVLGIYGLI+AVII   I+P     
Sbjct  31   LGAAYGTAKSGVGIASMGVMRPELAMRNIIPVVMAGVLGIYGLIVAVIIQGSIDPPNGNA  90

Query  36   KSYYLFDGYAHL  1
              Y  + G+AHL
Sbjct  91   PKYGSYTGFAHL  102



>ref|XP_008871715.1| V-type proton ATPase proteolipid subunit [Aphanomyces invadans]
 gb|ETV99939.1| V-type proton ATPase proteolipid subunit [Aphanomyces invadans]
Length=169

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGI---NPKT  37
            +GAAYGTAKSGVG+ASMGVMRPELVM++I+PV+MAGVLGIYGLI+AVII   I   N K 
Sbjct  31   LGAAYGTAKSGVGIASMGVMRPELVMRNIIPVIMAGVLGIYGLIVAVIIQGSIDVPNGKD  90

Query  36   KSYYLFDGYAHL  1
              Y  + G+AHL
Sbjct  91   TVYGSYTGFAHL  102



>gb|ETL40537.1| V-type proton ATPase proteolipid subunit, partial [Phytophthora 
parasitica]
Length=137

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP---KT  37
            +GAAYGTAKSGVG+ASMGVMRPEL M++I+PVVMAGVLGIYGLI+AVII   I+P     
Sbjct  31   LGAAYGTAKSGVGIASMGVMRPELAMRNIIPVVMAGVLGIYGLIVAVIIQGSIDPPNGNA  90

Query  36   KSYYLFDGYAHL  1
              Y  + G+AHL
Sbjct  91   PKYGSYTGFAHL  102



>gb|ETK87080.1| V-type proton ATPase proteolipid subunit, partial [Phytophthora 
parasitica]
 gb|ETK87141.1| V-type proton ATPase proteolipid subunit, partial [Phytophthora 
parasitica]
 gb|ETL40495.1| V-type proton ATPase proteolipid subunit, partial [Phytophthora 
parasitica]
 gb|ETP44990.1| V-type proton ATPase proteolipid subunit, partial [Phytophthora 
parasitica P10297]
 gb|ETP45034.1| V-type proton ATPase proteolipid subunit, partial [Phytophthora 
parasitica P10297]
Length=150

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP---KT  37
            +GAAYGTAKSGVG+ASMGVMRPEL M++I+PVVMAGVLGIYGLI+AVII   I+P     
Sbjct  31   LGAAYGTAKSGVGIASMGVMRPELAMRNIIPVVMAGVLGIYGLIVAVIIQGSIDPPNGNA  90

Query  36   KSYYLFDGYAHL  1
              Y  + G+AHL
Sbjct  91   PKYGSYTGFAHL  102



>ref|XP_005538224.1| V-type ATPase V0 subunit c [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82188.1| V-type ATPase V0 subunit c [Cyanidioschyzon merolae strain 10D]
Length=164

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 62/71 (87%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S MGAAYGTAKSGVG+A++GV+RPEL+M+SI+P VMAG+LGIYGLI+AVI+S  I+ ++ 
Sbjct  27   SNMGAAYGTAKSGVGIAAVGVLRPELIMRSIIPTVMAGILGIYGLIVAVILSGQISLQSY  86

Query  33   SYYLFDGYAHL  1
             YYL  G+AHL
Sbjct  87   PYYL--GFAHL  95



>emb|CDY54164.1| BnaC02g47230D [Brassica napus]
Length=417

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            +RPELVMKSIVPVVMAGVLGIYGLIIAVIIST INPK KSYYLFDGYAHL
Sbjct  11   LRPELVMKSIVPVVMAGVLGIYGLIIAVIISTEINPKAKSYYLFDGYAHL  60



>ref|XP_008621124.1| V-type H+-transporting ATPase 16kDa proteolipid subunit [Saprolegnia 
diclina VS20]
 gb|EQC25465.1| V-type H+-transporting ATPase 16kDa proteolipid subunit [Saprolegnia 
diclina VS20]
 gb|KDO28057.1| hypothetical protein SPRG_06764 [Saprolegnia parasitica CBS 223.65]
Length=168

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 59/72 (82%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGI---NPKT  37
            +GAAYGTAKSGVG++SMGVMRPELVM++I+PVVMAGVLGIYGLI+AVII   I   N K 
Sbjct  30   LGAAYGTAKSGVGISSMGVMRPELVMRNIIPVVMAGVLGIYGLIVAVIIQGSIDVPNGKE  89

Query  36   KSYYLFDGYAHL  1
              Y  + G+AHL
Sbjct  90   TVYGSYTGFAHL  101



>gb|AAW79383.1| vacuolar ATP synthase [Heterocapsa triquetra]
Length=178

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 59/69 (86%), Gaps = 2/69 (3%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSY  28
            +GAAYGTAKSGVG++SMGVMRP++VM+SI+PVVMAGVLGIYGLI AVII+  I+    SY
Sbjct  36   LGAAYGTAKSGVGISSMGVMRPDMVMRSIIPVVMAGVLGIYGLITAVIINGKIH--APSY  93

Query  27   YLFDGYAHL  1
              F GYAHL
Sbjct  94   SAFSGYAHL  102



>sp|Q43362.1|VATL_PLECA RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Pleurochrysis 
carterae]
 gb|AAB67833.1| V-type ATPase 16 kDa proteolipid subunit [Pleurochrysis carterae]
 gb|AAB58498.1| vacuolar-type H(+)-ATPase [Pleurochrysis carterae]
Length=164

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 3/90 (3%)
 Frame = -1

Query  261  TAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYG  82
            TAPFFGF+GAA AL+F+ +GAAYGTAKSGVGV+SMGVM+P+LVMKSI+PVVMAGVLGIYG
Sbjct  8    TAPFFGFMGAAVALIFANLGAAYGTAKSGVGVSSMGVMKPDLVMKSIIPVVMAGVLGIYG  67

Query  81   LIIAVIISTGIN-PK--TKSYYLFDGYAHL  1
            LIIAVII  G+  P+     Y  F G+AHL
Sbjct  68   LIIAVIIGNGVKGPEGGKPQYSSFTGFAHL  97



>ref|XP_008905373.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
INRA-310]
 ref|XP_008905374.1| V-type proton ATPase proteolipid subunit, variant [Phytophthora 
parasitica INRA-310]
 ref|XP_008905377.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
INRA-310]
 ref|XP_009524153.1| hypothetical protein PHYSODRAFT_285608 [Phytophthora sojae]
 ref|XP_009524154.1| hypothetical protein PHYSODRAFT_285609 [Phytophthora sojae]
 gb|EGZ21436.1| hypothetical protein PHYSODRAFT_285608 [Phytophthora sojae]
 gb|EGZ21437.1| hypothetical protein PHYSODRAFT_285609 [Phytophthora sojae]
 gb|ETI47188.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
P1569]
 gb|ETI47189.1| V-type proton ATPase proteolipid subunit, variant [Phytophthora 
parasitica P1569]
 gb|ETI47190.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
P1569]
 gb|ETL93700.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica]
 gb|ETM46938.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica]
 gb|ETN09540.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
INRA-310]
 gb|ETN09541.1| V-type proton ATPase proteolipid subunit, variant [Phytophthora 
parasitica INRA-310]
 gb|ETN09544.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
INRA-310]
 gb|ETO75870.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
P1976]
 gb|ETO75871.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
P1976]
 gb|ETP16965.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
CJ01A1]
 gb|ETP16966.1| V-type proton ATPase proteolipid subunit [Phytophthora parasitica 
CJ01A1]
Length=171

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 58/72 (81%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP---KT  37
            +GAAYGTAKSGVG+ASMGVMRPEL M++I+PVVMAGVLGIYGLI+AVII   I+P     
Sbjct  31   LGAAYGTAKSGVGIASMGVMRPELAMRNIIPVVMAGVLGIYGLIVAVIIQGSIDPPNGNA  90

Query  36   KSYYLFDGYAHL  1
              Y  + G+AHL
Sbjct  91   PKYGSYTGFAHL  102



>emb|CCI11782.1| Ev2180 [Albugo candida]
Length=151

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP---KT  37
            +GAAYGTAKSGVG+ASMGVMRP+L M++I+PVVMAGVLGIYGLI+AVII   I+P    +
Sbjct  12   LGAAYGTAKSGVGIASMGVMRPDLAMRNIIPVVMAGVLGIYGLIVAVIIQGSIDPPSGNS  71

Query  36   KSYYLFDGYAHL  1
             +Y  + G+AHL
Sbjct  72   PAYGSYTGFAHL  83



>ref|XP_009692511.1| vacuolar H+-ATPase subunit [Theileria orientalis strain Shintoku]
 dbj|BAM42210.1| vacuolar H+-ATPase subunit [Theileria orientalis strain Shintoku]
Length=166

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTA+SGVG++SMGVMRP+LVMKSIVPV+MAGVLGIYGLII+++I+T    K  
Sbjct  24   SNLGAAYGTARSGVGISSMGVMRPDLVMKSIVPVIMAGVLGIYGLIISIVITTNYG-KPG  82

Query  33   SYYLFDGYAHL  1
             Y  F GY+HL
Sbjct  83   EYSHFSGYSHL  93



>gb|KFM60257.1| V-type proton ATPase proteolipid subunit, partial [Stegodyphus 
mimosarum]
Length=157

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG G+A+M +MRPEL+MKSI+PVVMAG++ IYGL++AV+I+  I+  T 
Sbjct  24   SALGAAYGTAKSGTGIAAMSIMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNISSSTD  83

Query  33   SYYLFDGYAHL  1
             Y L+ G+ H 
Sbjct  84   GYKLYKGFLHF  94



>ref|NP_001011570.1| vacuolar H+ ATP synthase 16 kDa proteolipid subunit [Apis mellifera]
 ref|XP_003693843.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform 1 [Apis florea]
 ref|XP_003693844.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
isoform 2 [Apis florea]
 ref|XP_006614834.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Apis dorsata]
 gb|AAQ21381.1| vacuolar H+ ATP synthase 16 kDa proteolipid subunit [Apis mellifera]
Length=156

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+I+ G+  + K
Sbjct  25   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGGLE-EPK  83

Query  33   SYYLFDGYAHL  1
             Y LF G+ HL
Sbjct  84   GYTLFKGFVHL  94



>ref|XP_002908626.1| V-type proton ATPase 16 kDa proteolipid subunit, putative [Phytophthora 
infestans T30-4]
 ref|XP_002908627.1| V-type proton ATPase 16 kDa proteolipid subunit, putative [Phytophthora 
infestans T30-4]
 gb|EEY61709.1| V-type proton ATPase 16 kDa proteolipid subunit, putative [Phytophthora 
infestans T30-4]
 gb|EEY61710.1| V-type proton ATPase 16 kDa proteolipid subunit, putative [Phytophthora 
infestans T30-4]
Length=171

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 3/72 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP---KT  37
            +GAAYGTAKSGVG+ASMGVMRP+L M++I+PVVMAGVLGIYGLI+AVII   I+P     
Sbjct  31   LGAAYGTAKSGVGIASMGVMRPDLAMRNIIPVVMAGVLGIYGLIVAVIIQGSIDPPNGNA  90

Query  36   KSYYLFDGYAHL  1
              Y  + G+AHL
Sbjct  91   PKYGSYTGFAHL  102



>ref|XP_005780073.1| vacuolar H+-ATPase V0 sector, subunits c/c [Emiliania huxleyi 
CCMP1516]
 ref|XP_005784316.1| vacuolar H+-ATPase V0 sector, subunits c/c [Emiliania huxleyi 
CCMP1516]
 gb|EOD27644.1| vacuolar H+-ATPase V0 sector, subunits c/c [Emiliania huxleyi 
CCMP1516]
 gb|EOD31887.1| vacuolar H+-ATPase V0 sector, subunits c/c [Emiliania huxleyi 
CCMP1516]
Length=160

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIIS---TGINP  43
            S MGAAYGT KSG+G++++GV +PEL+MKSIVPVVMAGVLGIYGLIIAVIIS   T ++ 
Sbjct  22   SNMGAAYGTGKSGIGISTLGVGQPELIMKSIVPVVMAGVLGIYGLIIAVIISNEVTTVDQ  81

Query  42   KTKSYYLFDGYAHL  1
            K  SY  F  +AH 
Sbjct  82   KAPSYTTFKAFAHF  95



>emb|CDJ91685.1| ATPase domain containing protein [Haemonchus contortus]
 emb|CDJ83726.1| ATPase domain containing protein [Haemonchus contortus]
Length=161

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            + +GAAYGTAKS VG+ SMGVMRPEL+MKS++PV+MAG++GIYGL++A+++   + P ++
Sbjct  29   TVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMVLKGKVTPASE  88

Query  33   SYYLFDGYAHL  1
             Y L  G+AHL
Sbjct  89   GYNLNKGFAHL  99



>gb|ESS32292.1| vacuolar ATP synthetase [Toxoplasma gondii VEG]
Length=134

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 61/72 (85%), Gaps = 3/72 (4%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGIN-PKT  37
            S +GAAYGTAKSGVG++SMGVMRP+LVM+SI+PVVMAG+LGIYGLII+++I+  ++ P T
Sbjct  28   SNLGAAYGTAKSGVGISSMGVMRPDLVMRSIIPVVMAGILGIYGLIISIVINGSMDTPDT  87

Query  36   KSYYLFDGYAHL  1
             S Y   GY HL
Sbjct  88   YSSY--AGYGHL  97



>gb|EGT33594.1| CBN-VHA-2 protein [Caenorhabditis brenneri]
 gb|EGT48630.1| CBN-VHA-3 protein [Caenorhabditis brenneri]
Length=161

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            + +GAAYGTAKS VG+ SMGVMRPEL+MKS++PV+MAG++GIYGL++A+++   +N  ++
Sbjct  29   TVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMVLKGKVNAASQ  88

Query  33   SYYLFDGYAHL  1
             Y L  G+AHL
Sbjct  89   GYDLNKGFAHL  99



>ref|XP_797801.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Strongylocentrotus purpuratus]
Length=155

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG GVA+M VMRPEL+MKSI+PVVMAG++GIYGL++A +I+ GI     
Sbjct  23   SALGAAYGTAKSGTGVAAMSVMRPELIMKSIIPVVMAGIVGIYGLVVAAVIANGIPSDPS  82

Query  33   SYYLFDGYAHL  1
            +Y L+  + HL
Sbjct  83   AYTLYKSFMHL  93



>ref|XP_003661349.1| hypothetical protein MYCTH_2314502 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56104.1| hypothetical protein MYCTH_2314502 [Myceliophthora thermophila 
ATCC 42464]
Length=162

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 62/71 (87%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS G+  K  
Sbjct  25   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISDGL--KQD  82

Query  33   SYYLFDGYAHL  1
            +Y LF G+  L
Sbjct  83   NYALFTGFIQL  93



>ref|XP_001523616.1| vacuolar ATP synthase 16 kDa proteolipid subunit 2 [Lodderomyces 
elongisporus NRRL YB-4239]
 gb|EDK46851.1| vacuolar ATP synthase 16 kDa proteolipid subunit 2 [Lodderomyces 
elongisporus NRRL YB-4239]
Length=162

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 77/102 (75%), Gaps = 6/102 (6%)
 Frame = -1

Query  306  DSKAPEKMSTFSGDETAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMK  127
            D+  PE    F     AP+ GF G AAA++ SC GAA GTAKSG+G+A +G  +PEL+MK
Sbjct  3    DTLGPEFYPLF-----APWLGFAGCAAAMILSCAGAAIGTAKSGIGIAGIGTFKPELIMK  57

Query  126  SIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            S++PVVM+G+L +YGL++AV+I+ G++P T++Y LF+G+ HL
Sbjct  58   SLIPVVMSGILSVYGLVVAVLIAGGLSP-TENYSLFNGFMHL  98



>ref|XP_007024570.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
 gb|EOY27192.1| ATPase, F0/V0 complex, subunit C protein [Theobroma cacao]
Length=88

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  150  MRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            MRPELVMK+IVPVVMAGVLGIYGLIIAVII TGINPK  SYYL DGYAHL
Sbjct  1    MRPELVMKAIVPVVMAGVLGIYGLIIAVIIGTGINPKANSYYLSDGYAHL  50



>ref|XP_002767877.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002769335.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002769336.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002773961.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002773962.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002774253.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 ref|XP_002777951.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER00595.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER02053.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER02054.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER05777.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER05778.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER06069.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER09746.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
Length=176

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGIN-PKTKS  31
            +GAAYGTAKSGVG+ SMGVMRP+LVM+SI+PVVMAGVLGIYGLI +VII+  ++ P T S
Sbjct  32   LGAAYGTAKSGVGICSMGVMRPDLVMRSIIPVVMAGVLGIYGLITSVIINGKMDTPATYS  91

Query  30   YYLFDGYAHL  1
             Y   GYAHL
Sbjct  92   QY--SGYAHL  99



>sp|P55277.1|VATL_HELVI RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Heliothis virescens]
 gb|AAC37176.1| H+-ATPase V-type subunit [Heliothis virescens]
Length=156

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+I+  ++  + 
Sbjct  23   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGSLDAPSN  82

Query  33   SYYLFDGYAHL  1
            +Y L+ G+ HL
Sbjct  83   NYTLYKGFIHL  93



>gb|EPE05694.1| vacuolar atp synthase 16 kda proteolipid subunit [Ophiostoma 
piceae UAMH 11346]
Length=162

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 61/71 (86%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS   N K K
Sbjct  25   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISD--NLKQK  82

Query  33   SYYLFDGYAHL  1
             Y L+ G+  L
Sbjct  83   EYALYTGFIQL  93



>gb|AGO13022.1| AaceriAFL141Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=164

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 61/71 (86%), Gaps = 1/71 (1%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            SC+GAA GTAKSG+G++ +G  RPEL+MKS++PVVM+G+L +YGL++AV+++ G++P T+
Sbjct  29   SCLGAAIGTAKSGIGISGIGTFRPELIMKSLIPVVMSGILAVYGLVVAVLVAGGLSP-TE  87

Query  33   SYYLFDGYAHL  1
             Y LF+G+ HL
Sbjct  88   EYTLFNGFMHL  98



>sp|P31403.1|VATL_MANSE RecName: Full=V-type proton ATPase 16 kDa proteolipid subunit; 
Short=V-ATPase 16 kDa proteolipid subunit; AltName: Full=Vacuolar 
proton pump 16 kDa proteolipid subunit [Manduca sexta]
 emb|CAA46187.1| vacuolar ATPase 16 kD proteolipid subunit [Manduca sexta]
Length=156

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+I+  ++  + 
Sbjct  23   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGSLDSPSN  82

Query  33   SYYLFDGYAHL  1
            +Y L+ G+ HL
Sbjct  83   NYTLYRGFIHL  93



>gb|KDR23608.1| V-type proton ATPase 16 kDa proteolipid subunit, partial [Zootermopsis 
nevadensis]
Length=132

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG+L IYGL++AV+I+  +    K
Sbjct  1    SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGILAIYGLVVAVLIAGALEEPDK  60

Query  33   SYYLFDGYAHL  1
             Y LF G+ HL
Sbjct  61   -YSLFKGFVHL  70



>ref|XP_003709260.1| V-type proton ATPase proteolipid subunit [Magnaporthe oryzae 
70-15]
 gb|EHA56648.1| V-type proton ATPase proteolipid subunit [Magnaporthe oryzae 
70-15]
 gb|ELQ35163.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Magnaporthe 
oryzae Y34]
 gb|ELQ66331.1| vacuolar ATP synthase 16 kDa proteolipid subunit [Magnaporthe 
oryzae P131]
Length=162

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 60/71 (85%), Gaps = 2/71 (3%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            +C+GA+YGTAKSGVG+A+MGV+RP+L++K+IVPV+MAG++GIYGL+++V+IS   N K  
Sbjct  25   TCLGASYGTAKSGVGIAAMGVLRPDLIVKNIVPVIMAGIIGIYGLVVSVLISD--NLKQD  82

Query  33   SYYLFDGYAHL  1
             Y LF G+  L
Sbjct  83   EYALFTGFIQL  93



>gb|EPT26846.1| vacuolar ATP synthetase [Toxoplasma gondii ME49]
Length=157

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 61/72 (85%), Gaps = 3/72 (4%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGIN-PKT  37
            S +GAAYGTAKSGVG++SMGVMRP+LVM+SI+PVVMAG+LGIYGLII+++I+  ++ P T
Sbjct  28   SNLGAAYGTAKSGVGISSMGVMRPDLVMRSIIPVVMAGILGIYGLIISIVINGSMDTPDT  87

Query  36   KSYYLFDGYAHL  1
             S Y   GY HL
Sbjct  88   YSSY--AGYGHL  97



>tpg|DAA34683.1| TPA_inf: vacuolar H+-ATPase V0 sector subunits c/c' [Amblyomma 
variegatum]
Length=154

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 3/71 (4%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+IS+ I P   
Sbjct  24   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLISSTIKPD--  81

Query  33   SYYLFDGYAHL  1
             Y LF  + HL
Sbjct  82   -YKLFSAFLHL  91



>ref|XP_007377699.1| hypothetical protein SPAPADRAFT_63556 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW29933.1| hypothetical protein SPAPADRAFT_63556 [Spathaspora passalidarum 
NRRL Y-27907]
Length=163

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 76/99 (77%), Gaps = 5/99 (5%)
 Frame = -1

Query  285  MSTFSGDE----TAPffgflgaaaalvFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIV  118
            MS   GDE     APF GF G AAA++ SC GAA GTAKSG+G+A +G  +PEL+MKS++
Sbjct  1    MSEAFGDEYYPAFAPFLGFGGCAAAMILSCAGAAIGTAKSGIGIAGIGTFKPELIMKSLI  60

Query  117  PVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHL  1
            PVVM+G+L +YGL++AV+I+ G++P T+ Y LF+G+ HL
Sbjct  61   PVVMSGILSVYGLVVAVLIAGGLSP-TERYSLFNGFMHL  98



>ref|XP_003396177.1| PREDICTED: v-type proton ATPase 16 kDa proteolipid subunit-like 
[Bombus terrestris]
 ref|XP_003484912.1| PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit-like 
[Bombus impatiens]
Length=159

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = -1

Query  213  SCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTK  34
            S +GAAYGTAKSG G+A+M VMRPEL+MKSI+PVVMAG++ IYGL++AV+I+ G+   +K
Sbjct  28   SALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGGLEEPSK  87

Query  33   SYYLFDGYAHL  1
             Y L+ G+ HL
Sbjct  88   -YSLYKGFVHL  97



>ref|XP_002772137.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER03953.1| vacuolar ATP synthase 16 kDa proteolipid subunit, putative [Perkinsus 
marinus ATCC 50983]
Length=240

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 3/70 (4%)
 Frame = -1

Query  207  MGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGIN-PKTKS  31
            +GAAYGTAKSGVG+ SMGVMRP+LVM+SI+PVVMAGVLGIYGLI +VII+  ++ P T S
Sbjct  96   LGAAYGTAKSGVGICSMGVMRPDLVMRSIIPVVMAGVLGIYGLITSVIINGKMDTPATYS  155

Query  30   YYLFDGYAHL  1
             Y   GYAHL
Sbjct  156  QY--SGYAHL  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517204629360