BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26585_g1_i1 len=1293 path=[1271:0-1292]

Length=1293
                                                                      Score     E

ref|XP_006361858.1|  PREDICTED: glucose and ribitol dehydrogenase...    531   0.0      
ref|XP_004230182.1|  PREDICTED: glucose and ribitol dehydrogenase...    527   0.0      
ref|XP_009769381.1|  PREDICTED: glucose and ribitol dehydrogenase...    520   0.0      
ref|XP_009629944.1|  PREDICTED: glucose and ribitol dehydrogenase...    518   0.0      
ref|XP_009772647.1|  PREDICTED: glucose and ribitol dehydrogenase...    512   2e-178   
gb|EPS61688.1|  hypothetical protein M569_13104                         503   8e-175   
ref|XP_010025176.1|  PREDICTED: glucose and ribitol dehydrogenase...    503   9e-175   
gb|ACB55491.1|  seed maturation-like protein precursor                  498   5e-172   
ref|XP_011092026.1|  PREDICTED: glucose and ribitol dehydrogenase...    497   9e-172   
ref|XP_004135622.1|  PREDICTED: glucose and ribitol dehydrogenase...    492   2e-170   
ref|XP_003591094.1|  Glucose and ribitol dehydrogenase                  491   4e-170   
ref|XP_002319022.2|  hypothetical protein POPTR_0013s02480g             493   6e-170   Populus trichocarpa [western balsam poplar]
ref|XP_004166035.1|  PREDICTED: glucose and ribitol dehydrogenase...    489   2e-169   
gb|AFK39537.1|  unknown                                                 489   4e-169   
gb|EYU34848.1|  hypothetical protein MIMGU_mgv1a011082mg                488   4e-169   
ref|XP_004495735.1|  PREDICTED: glucose and ribitol dehydrogenase...    488   7e-169   
gb|AFK45385.1|  unknown                                                 487   1e-168   
ref|XP_008450654.1|  PREDICTED: glucose and ribitol dehydrogenase...    486   5e-168   
ref|XP_002512366.1|  short chain dehydrogenase, putative                486   5e-168   Ricinus communis
gb|KDP23528.1|  hypothetical protein JCGZ_23361                         484   3e-167   
ref|XP_010278084.1|  PREDICTED: glucose and ribitol dehydrogenase       483   4e-167   
ref|XP_006433300.1|  hypothetical protein CICLE_v10002055mg             483   4e-167   
emb|CDP20122.1|  unnamed protein product                                483   4e-167   
ref|XP_010528871.1|  PREDICTED: glucose and ribitol dehydrogenase...    483   2e-166   
gb|KGN66084.1|  hypothetical protein Csa_1G570090                       480   8e-166   
ref|XP_010528870.1|  PREDICTED: glucose and ribitol dehydrogenase...    480   7e-165   
ref|XP_003626301.1|  Glucose and ribitol dehydrogenase-like protein     478   9e-165   
ref|XP_010674766.1|  PREDICTED: glucose and ribitol dehydrogenase...    480   1e-164   
ref|XP_011023588.1|  PREDICTED: LOW QUALITY PROTEIN: glucose and ...    476   3e-163   
ref|XP_004302437.1|  PREDICTED: glucose and ribitol dehydrogenase...    473   4e-163   
ref|XP_008388967.1|  PREDICTED: glucose and ribitol dehydrogenase...    475   7e-163   
ref|XP_010105843.1|  Glucose and ribitol dehydrogenase-1-like pro...    474   2e-162   
ref|XP_007144740.1|  hypothetical protein PHAVU_007G180800g             474   2e-162   
gb|KFK35607.1|  hypothetical protein AALP_AA4G013100                    471   4e-162   
ref|XP_009349395.1|  PREDICTED: glucose and ribitol dehydrogenase...    471   5e-162   
ref|NP_001242815.1|  uncharacterized protein LOC100807147               469   1e-161   
ref|XP_006392477.1|  hypothetical protein EUTSA_v10023627mg             469   1e-161   
ref|XP_010043092.1|  PREDICTED: glucose and ribitol dehydrogenase...    469   2e-161   
emb|CAN77025.1|  hypothetical protein VITISV_015336                     469   3e-161   Vitis vinifera
ref|XP_010480201.1|  PREDICTED: glucose and ribitol dehydrogenase...    469   8e-161   
ref|XP_010511227.1|  PREDICTED: glucose and ribitol dehydrogenase...    469   8e-161   
sp|Q5KTS5.1|GRDH_DAUCA  RecName: Full=Glucose and ribitol dehydro...    467   8e-161   Daucus carota [carrots]
ref|NP_564670.2|  glucose and ribitol dehydrogenase homolog 1           469   9e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284803.3|  PREDICTED: glucose and ribitol dehydrogenase...    467   1e-160   Vitis vinifera
ref|XP_006301375.1|  hypothetical protein CARUB_v10021787mg             469   1e-160   
ref|XP_004148135.1|  PREDICTED: glucose and ribitol dehydrogenase...    467   2e-160   
gb|KHN16133.1|  Glucose and ribitol dehydrogenase like 1                466   2e-160   
ref|XP_004494625.1|  PREDICTED: glucose and ribitol dehydrogenase...    466   2e-160   
ref|XP_003521711.1|  PREDICTED: glucose and ribitol dehydrogenase...    465   8e-160   
ref|NP_001238285.1|  seed maturation protein PM34                       464   1e-159   
ref|XP_008439102.1|  PREDICTED: glucose and ribitol dehydrogenase...    466   2e-159   
gb|KHN20212.1|  Glucose and ribitol dehydrogenase                       463   4e-159   
ref|XP_009119565.1|  PREDICTED: glucose and ribitol dehydrogenase...    463   4e-159   
ref|XP_004302438.1|  PREDICTED: LOW QUALITY PROTEIN: glucose and ...    462   7e-159   
ref|XP_008246486.1|  PREDICTED: glucose and ribitol dehydrogenase...    462   1e-158   
sp|Q9FZ42.1|GRDH1_ARATH  RecName: Full=Glucose and ribitol dehydr...    462   1e-158   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43488.1|  BnaA01g21430D                                          461   2e-158   
ref|XP_010674769.1|  PREDICTED: glucose and ribitol dehydrogenase...    461   3e-158   
ref|XP_010105844.1|  Glucose and ribitol dehydrogenase-1-like pro...    460   5e-158   
gb|ACU18973.1|  unknown                                                 460   6e-158   Glycine max [soybeans]
ref|XP_010418919.1|  PREDICTED: glucose and ribitol dehydrogenase...    461   1e-157   
emb|CDY17559.1|  BnaC01g26830D                                          459   1e-157   
gb|ACU23676.1|  unknown                                                 459   2e-157   Glycine max [soybeans]
ref|XP_007147059.1|  hypothetical protein PHAVU_006G092800g             458   3e-157   
gb|KHN04002.1|  Glucose and ribitol dehydrogenase like 1                458   4e-157   
ref|XP_007205659.1|  hypothetical protein PRUPE_ppa009407mg             457   8e-157   
gb|KGN57282.1|  hypothetical protein Csa_3G176290                       457   2e-156   
ref|XP_008246487.1|  PREDICTED: glucose and ribitol dehydrogenase...    456   2e-156   
gb|AAN15136.1|  putative TAG factor protein                             456   4e-156   Lupinus angustifolius
gb|AAG51119.1|AC069144_16  dormancy related protein, putative           453   3e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007030862.1|  NAD(P)-binding Rossmann-fold superfamily pro...    452   7e-155   
ref|NP_187177.1|  NAD(P)-binding Rossmann-fold superfamily protein      451   3e-154   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16204.1|AF428435_1  AT3g05260/T12H1_23                            450   4e-154   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37931.1|  hypothetical protein AALP_AA3G048700                    450   4e-154   
ref|XP_010906880.1|  PREDICTED: glucose and ribitol dehydrogenase...    451   1e-153   
ref|XP_009397642.1|  PREDICTED: glucose and ribitol dehydrogenase...    447   5e-153   
ref|XP_008790990.1|  PREDICTED: glucose and ribitol dehydrogenase...    449   1e-152   
ref|XP_003553739.1|  PREDICTED: glucose and ribitol dehydrogenase...    445   4e-152   
ref|XP_006433301.1|  hypothetical protein CICLE_v10003201mg             444   5e-152   
ref|XP_006298247.1|  hypothetical protein CARUB_v10014308mg             445   5e-152   
ref|XP_010464044.1|  PREDICTED: glucose and ribitol dehydrogenase...    442   6e-151   
ref|XP_009147260.1|  PREDICTED: glucose and ribitol dehydrogenase...    441   2e-150   
ref|XP_010424987.1|  PREDICTED: glucose and ribitol dehydrogenase...    441   2e-150   
ref|XP_002884497.1|  short-chain dehydrogenase/reductase family p...    441   3e-150   
ref|XP_010546674.1|  PREDICTED: glucose and ribitol dehydrogenase...    440   4e-150   
ref|XP_010485956.1|  PREDICTED: glucose and ribitol dehydrogenase...    436   1e-148   
ref|XP_007154111.1|  hypothetical protein PHAVU_003G091300g             436   2e-148   
gb|KDO59502.1|  hypothetical protein CISIN_1g039897mg                   434   7e-148   
ref|XP_006408096.1|  hypothetical protein EUTSA_v10022134mg             427   5e-145   
ref|XP_009398932.1|  PREDICTED: glucose and ribitol dehydrogenase...    427   5e-145   
ref|XP_002891915.1|  oxidoreductase                                     428   1e-144   
ref|NP_001241158.1|  uncharacterized protein LOC100809384               425   3e-144   
ref|XP_007147090.1|  hypothetical protein PHAVU_006G095500g             424   1e-143   
dbj|BAJ85825.1|  predicted protein                                      424   4e-143   
pir||T06212  glucose and ribitol dehydrogenase homolog - barley         421   2e-142
ref|XP_003568968.1|  PREDICTED: glucose and ribitol dehydrogenase...    423   2e-142   
ref|XP_002517191.1|  short chain dehydrogenase, putative                420   3e-142   Ricinus communis
gb|EMT30749.1|  Glucose and ribitol dehydrogenase-like protein          419   6e-142   
ref|XP_003610393.1|  Glucose and ribitol dehydrogenase-like protein     419   7e-142   
ref|XP_002517192.1|  short chain dehydrogenase, putative                416   2e-140   Ricinus communis
ref|XP_004507706.1|  PREDICTED: glucose and ribitol dehydrogenase...    415   3e-140   
gb|EAY96497.1|  hypothetical protein OsI_18399                          416   3e-140   Oryza sativa Indica Group [Indian rice]
sp|Q75KH3.2|GRDH_ORYSJ  RecName: Full=Glucose and ribitol dehydro...    413   2e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011090772.1|  PREDICTED: glucose and ribitol dehydrogenase...    410   1e-138   
ref|NP_001054600.1|  Os05g0140800                                       413   2e-138   Oryza sativa Japonica Group [Japonica rice]
gb|KDP40130.1|  hypothetical protein JCGZ_02128                         404   6e-136   
ref|XP_006654977.1|  PREDICTED: LOW QUALITY PROTEIN: glucose and ...    401   8e-134   
ref|XP_002439250.1|  hypothetical protein SORBIDRAFT_09g003150          398   3e-133   Sorghum bicolor [broomcorn]
ref|NP_001140439.1|  uncharacterized protein LOC100272498               397   6e-133   Zea mays [maize]
tpg|DAA41374.1|  TPA: general stress protein 39Short-chain dehydr...    396   9e-132   
ref|XP_004960440.1|  PREDICTED: glucose and ribitol dehydrogenase...    395   2e-131   
ref|XP_002517190.1|  short chain dehydrogenase, putative                392   3e-131   Ricinus communis
ref|XP_008363981.1|  PREDICTED: LOW QUALITY PROTEIN: glucose and ...    389   3e-130   
ref|XP_011021590.1|  PREDICTED: glucose and ribitol dehydrogenase...    390   3e-130   
tpg|DAA41375.1|  TPA: hypothetical protein ZEAMMB73_293728              388   1e-128   
ref|XP_001752356.1|  predicted protein                                  383   1e-127   
ref|XP_011025991.1|  PREDICTED: glucose and ribitol dehydrogenase...    379   5e-126   
ref|XP_002311602.2|  hypothetical protein POPTR_0008s14850g             378   8e-126   Populus trichocarpa [western balsam poplar]
gb|EYU41520.1|  hypothetical protein MIMGU_mgv1a0189502mg               375   5e-125   
ref|XP_001752921.1|  predicted protein                                  367   2e-121   
gb|ADE76781.1|  unknown                                                 360   6e-119   
ref|WP_014247477.1|  short-chain dehydrogenase                          360   1e-118   
ref|XP_002961003.1|  hypothetical protein SELMODRAFT_402549             354   2e-116   
ref|WP_009459400.1|  MULTISPECIES: short-chain dehydrogenase            353   6e-116   
ref|XP_002967005.1|  hypothetical protein SELMODRAFT_230991             351   3e-115   
ref|WP_026841337.1|  short-chain dehydrogenase                          350   4e-115   
ref|WP_012528577.1|  short-chain dehydrogenase                          350   8e-115   
ref|WP_019491234.1|  short-chain dehydrogenase                          350   9e-115   
ref|WP_012773835.1|  short-chain dehydrogenase                          349   1e-114   
ref|WP_012974033.1|  short-chain dehydrogenase                          347   9e-114   
ref|WP_014095754.1|  short-chain dehydrogenase                          347   2e-113   
ref|WP_023172258.1|  short-chain dehydrogenase/reductase SDR            344   1e-112   
ref|WP_006634949.1|  short-chain dehydrogenase                          343   2e-112   
ref|WP_035189366.1|  short-chain dehydrogenase                          344   2e-112   
ref|WP_009674322.1|  MULTISPECIES: short-chain dehydrogenase            343   3e-112   
ref|WP_015182467.1|  dehydrogenase                                      343   4e-112   
ref|WP_026236114.1|  short-chain dehydrogenase                          343   4e-112   
ref|WP_026100139.1|  short-chain dehydrogenase                          343   5e-112   
ref|WP_015152646.1|  short-chain dehydrogenase/reductase SDR            342   8e-112   
ref|WP_015235209.1|  dehydrogenase                                      343   9e-112   
ref|WP_015176884.1|  3-oxoacyl-(acyl-carrier-protein) reductase         342   1e-111   
ref|WP_017291127.1|  short-chain dehydrogenase                          342   1e-111   
ref|WP_026733559.1|  short-chain dehydrogenase                          342   1e-111   
ref|WP_016859210.1|  short-chain dehydrogenase                          342   2e-111   
ref|WP_015217262.1|  3-oxoacyl-(acyl-carrier-protein) reductase         341   2e-111   
ref|WP_017318827.1|  short-chain dehydrogenase                          341   2e-111   
ref|WP_007358209.1|  MULTISPECIES: short-chain dehydrogenase            341   2e-111   
ref|WP_036011125.1|  short-chain dehydrogenase                          341   3e-111   
gb|AHL75688.1|  short-chain dehydrogenase                               341   3e-111   
ref|WP_039713375.1|  short-chain dehydrogenase                          340   3e-111   
ref|WP_026964919.1|  short-chain dehydrogenase                          340   3e-111   
ref|WP_026722248.1|  short-chain dehydrogenase                          338   2e-110   
ref|WP_016877040.1|  short-chain dehydrogenase                          338   2e-110   
ref|WP_029007658.1|  short-chain dehydrogenase                          338   2e-110   
ref|WP_017310770.1|  short-chain dehydrogenase                          338   2e-110   
ref|WP_006528898.1|  dehydrogenase of unknown specificity               338   2e-110   
ref|WP_015148322.1|  dehydrogenase                                      338   4e-110   
ref|WP_016865637.1|  short-chain dehydrogenase                          337   5e-110   
ref|WP_015204565.1|  3-oxoacyl-(acyl-carrier-protein) reductase         337   7e-110   
ref|WP_014820194.1|  short-chain dehydrogenase                          337   8e-110   
ref|WP_038072904.1|  short-chain dehydrogenase                          337   9e-110   
ref|WP_038088120.1|  short-chain dehydrogenase                          337   1e-109   
ref|WP_012409849.1|  short-chain dehydrogenase                          337   2e-109   
ref|WP_007960687.1|  short-chain dehydrogenase                          336   2e-109   
ref|WP_023445357.1|  short-chain dehydrogenase                          336   2e-109   
ref|WP_003292953.1|  short-chain dehydrogenase                          336   2e-109   
ref|WP_022539629.1|  short-chain dehydrogenase                          336   2e-109   
ref|WP_015138394.1|  dehydrogenase                                      336   3e-109   
ref|WP_010810657.1|  MULTISPECIES: short-chain dehydrogenase            335   3e-109   
ref|WP_029045306.1|  short-chain dehydrogenase                          335   3e-109   
gb|KIF81345.1|  short-chain dehydrogenase                               335   3e-109   
ref|WP_007937306.1|  MULTISPECIES: short-chain dehydrogenase            335   4e-109   
ref|WP_038668342.1|  short-chain dehydrogenase                          335   4e-109   
dbj|BAP79673.1|  general stress protein 39                              335   4e-109   
ref|WP_013916625.1|  short-chain dehydrogenase                          335   5e-109   
ref|WP_018987439.1|  hypothetical protein                               335   6e-109   
ref|WP_038660057.1|  short-chain dehydrogenase                          335   6e-109   
ref|WP_015842620.1|  short-chain dehydrogenase                          335   6e-109   
ref|WP_024308204.1|  short-chain dehydrogenase                          334   1e-108   
ref|WP_003460153.1|  short-chain dehydrogenase                          334   1e-108   
ref|WP_013715546.1|  short-chain dehydrogenase                          334   1e-108   
ref|WP_013953926.1|  short-chain dehydrogenase                          334   1e-108   
ref|XP_001773923.1|  predicted protein                                  334   2e-108   
ref|WP_011319210.1|  short-chain dehydrogenase                          333   2e-108   
ref|WP_015436274.1|  short-chain dehydrogenase family protein           333   2e-108   
ref|WP_035826078.1|  short-chain dehydrogenase                          333   2e-108   
ref|WP_014370097.1|  short-chain dehydrogenase                          333   3e-108   
ref|WP_024028192.1|  short-chain dehydrogenase/reductase sdr            333   3e-108   
emb|CDZ80776.1|  General stress protein 39                              333   4e-108   
ref|WP_003300330.1|  short-chain dehydrogenase                          332   5e-108   
ref|WP_035348378.1|  short-chain dehydrogenase                          332   5e-108   
ref|WP_018662428.1|  short-chain dehydrogenase                          333   5e-108   
ref|WP_006212031.1|  MULTISPECIES: short-chain dehydrogenase            332   6e-108   
ref|WP_006838474.1|  short-chain dehydrogenase                          332   6e-108   
ref|WP_012356893.1|  short-chain dehydrogenase                          332   6e-108   
ref|WP_010999306.1|  short-chain dehydrogenase                          332   7e-108   
ref|WP_012598459.1|  short-chain dehydrogenase                          332   7e-108   
ref|WP_013322819.1|  short-chain dehydrogenase                          332   7e-108   
ref|WP_018005530.1|  short-chain dehydrogenase                          332   8e-108   
ref|WP_016836613.1|  hypothetical protein                               332   9e-108   
ref|WP_018315257.1|  short-chain dehydrogenase                          332   9e-108   
ref|WP_027482598.1|  short-chain dehydrogenase                          332   9e-108   
ref|WP_026567649.1|  short-chain dehydrogenase                          332   1e-107   
ref|WP_023959633.1|  oxidoreductase, short chain dehydrogenase/re...    332   1e-107   
ref|WP_017360894.1|  short-chain dehydrogenase                          331   1e-107   
ref|WP_019339147.1|  short-chain dehydrogenase                          331   1e-107   
ref|WP_011913295.1|  short-chain dehydrogenase                          331   2e-107   
ref|WP_003285036.1|  short-chain dehydrogenase                          331   2e-107   
ref|WP_029193233.1|  short-chain dehydrogenase                          331   2e-107   
gb|KGK84870.1|  short-chain dehydrogenase                               331   2e-107   
ref|WP_021489020.1|  short-chain dehydrogenase                          331   2e-107   
ref|WP_015276966.1|  dehydrogenase                                      331   2e-107   
ref|WP_017244544.1|  short-chain dehydrogenase                          331   2e-107   
ref|WP_017676854.1|  short-chain dehydrogenase                          330   3e-107   
ref|WP_037022257.1|  short-chain dehydrogenase                          330   3e-107   
ref|WP_027892061.1|  short-chain dehydrogenase                          330   3e-107   
ref|WP_013982835.1|  short-chain dehydrogenase                          330   4e-107   
ref|WP_006198195.1|  short-chain dehydrogenase                          330   4e-107   
ref|WP_039747436.1|  short-chain dehydrogenase                          330   6e-107   
ref|WP_027091724.1|  short-chain dehydrogenase                          330   7e-107   
ref|WP_025847183.1|  short-chain dehydrogenase                          330   7e-107   
ref|WP_028558398.1|  short-chain dehydrogenase                          330   8e-107   
ref|WP_012189908.1|  short-chain dehydrogenase                          330   8e-107   
ref|WP_003291252.1|  short-chain dehydrogenase                          329   1e-106   
gb|AIQ23017.1|  short-chain dehydrogenase                               329   1e-106   
ref|WP_035153476.1|  short-chain dehydrogenase                          328   1e-106   
ref|WP_011300494.1|  short-chain dehydrogenase                          328   1e-106   
ref|WP_013179236.1|  short-chain dehydrogenase                          329   2e-106   
ref|WP_019007547.1|  hypothetical protein                               329   2e-106   
ref|WP_025039483.1|  short-chain dehydrogenase                          328   2e-106   
ref|WP_026630266.1|  dehydrogenase                                      328   2e-106   
ref|WP_009523542.1|  short-chain dehydrogenase                          328   2e-106   
ref|WP_020307459.1|  short-chain dehydrogenase                          328   2e-106   
ref|WP_012628858.1|  short-chain dehydrogenase                          328   2e-106   
ref|XP_002517193.1|  short chain dehydrogenase, putative                327   3e-106   Ricinus communis
ref|WP_027460601.1|  short-chain dehydrogenase                          328   3e-106   
ref|WP_029282714.1|  short-chain dehydrogenase                          328   3e-106   
ref|WP_015126919.1|  3-oxoacyl-(acyl-carrier-protein) reductase         328   3e-106   
ref|WP_029565118.1|  short-chain dehydrogenase                          328   4e-106   
ref|WP_007222970.1|  short-chain dehydrogenase                          328   4e-106   
ref|WP_035410692.1|  short-chain dehydrogenase                          328   4e-106   
ref|WP_021208172.1|  short-chain dehydrogenase                          327   4e-106   
gb|AIQ34852.1|  short-chain dehydrogenase                               328   4e-106   
ref|WP_015188665.1|  3-oxoacyl-(acyl-carrier-protein) reductase         327   5e-106   
ref|WP_003246982.1|  short-chain dehydrogenase                          327   5e-106   
ref|WP_026235740.1|  short-chain dehydrogenase                          327   5e-106   
ref|WP_009619814.1|  putative short-chain dehydrogenase                 327   5e-106   
ref|WP_008567791.1|  short-chain dehydrogenase                          327   5e-106   
ref|WP_017444974.1|  hypothetical protein                               327   6e-106   
ref|WP_006579394.1|  short-chain dehydrogenase                          327   7e-106   
ref|WP_039805738.1|  short-chain dehydrogenase                          327   7e-106   
ref|WP_013556328.1|  short-chain dehydrogenase                          327   8e-106   
gb|KES25820.1|  short-chain dehydrogenase                               327   9e-106   
ref|WP_028394424.1|  short-chain dehydrogenase                          327   1e-105   
gb|AHF07123.1|  short-chain dehydrogenase                               327   1e-105   
ref|WP_026136235.1|  short-chain dehydrogenase                          326   1e-105   
ref|WP_011140423.1|  short-chain dehydrogenase                          326   1e-105   
ref|WP_015736983.1|  MULTISPECIES: short-chain dehydrogenase            326   1e-105   
gb|ESA23769.1|  hypothetical protein GLOINDRAFT_15099                   327   1e-105   
ref|WP_025701360.1|  short-chain dehydrogenase                          326   1e-105   
gb|AHV96657.1|  short-chain dehydrogenase/reductase SDR                 326   1e-105   
ref|WP_012018650.1|  short-chain dehydrogenase                          326   1e-105   
ref|WP_007417224.1|  short-chain dehydrogenase                          325   2e-105   
ref|WP_015205745.1|  dehydrogenase of unknown specificity, short-...    326   2e-105   
ref|WP_028599054.1|  short-chain dehydrogenase                          326   2e-105   
ref|WP_036988667.1|  short-chain dehydrogenase                          326   2e-105   
ref|WP_036587399.1|  short-chain dehydrogenase                          326   2e-105   
ref|WP_034405367.1|  short-chain dehydrogenase                          327   2e-105   
ref|WP_029390287.1|  short-chain dehydrogenase                          326   2e-105   
ref|WP_038569678.1|  short-chain dehydrogenase                          326   2e-105   
ref|WP_009630815.1|  dehydrogenase of unknown specificity               325   2e-105   
ref|WP_036678931.1|  short-chain dehydrogenase                          326   2e-105   
ref|WP_014852777.1|  short-chain dehydrogenase                          325   3e-105   
ref|WP_028554445.1|  short-chain dehydrogenase                          325   3e-105   
emb|CEG31342.1|  short-chain dehydrogenase/reductase SDR                325   3e-105   
ref|WP_010283432.1|  short-chain dehydrogenase                          325   3e-105   
ref|WP_034336900.1|  short-chain dehydrogenase                          325   4e-105   
ref|WP_012646298.1|  short-chain dehydrogenase                          325   4e-105   
ref|WP_039011187.1|  short-chain dehydrogenase                          325   4e-105   
ref|WP_027479707.1|  hypothetical protein                               326   4e-105   
ref|WP_012699761.1|  short-chain dehydrogenase                          325   4e-105   
ref|WP_025716681.1|  short-chain dehydrogenase                          325   5e-105   
ref|WP_011380524.1|  short-chain dehydrogenase                          325   5e-105   
ref|WP_039237543.1|  short-chain dehydrogenase                          325   5e-105   
ref|WP_007429699.1|  short-chain dehydrogenase                          325   5e-105   
ref|WP_004433959.1|  short-chain dehydrogenase                          325   5e-105   
ref|WP_025685059.1|  short-chain dehydrogenase                          325   6e-105   
ref|WP_026672728.1|  short-chain dehydrogenase                          325   6e-105   
ref|WP_026973700.1|  short-chain dehydrogenase                          324   6e-105   
gb|KIG07846.1|  oxidoreductase, short chain dehydrogenase/reducta...    324   9e-105   
ref|WP_011765465.1|  short-chain dehydrogenase                          324   9e-105   
ref|WP_039787471.1|  short-chain dehydrogenase                          324   1e-104   
ref|WP_034314579.1|  short-chain dehydrogenase                          324   1e-104   
dbj|GAM15766.1|  oxidoreductase, short chain dehydrogenase/reduct...    324   1e-104   
ref|WP_025676257.1|  short-chain dehydrogenase                          324   1e-104   
ref|WP_014280712.1|  short-chain dehydrogenase                          324   1e-104   
ref|WP_029514976.1|  short-chain dehydrogenase                          324   1e-104   
ref|WP_029516625.1|  short-chain dehydrogenase                          324   1e-104   
ref|WP_036653976.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_010897676.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_012566081.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_033099303.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_013309602.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_036580593.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_026903642.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_019140396.1|  hypothetical protein                               323   2e-104   
ref|WP_028237945.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_034763409.1|  short-chain dehydrogenase                          323   2e-104   
ref|WP_026899363.1|  short-chain dehydrogenase                          323   3e-104   
ref|WP_013370354.1|  short-chain dehydrogenase                          323   3e-104   
ref|WP_036645373.1|  short-chain dehydrogenase                          323   3e-104   
ref|WP_012695369.1|  short-chain dehydrogenase                          323   4e-104   
ref|WP_032089192.1|  short-chain dehydrogenase                          322   4e-104   
ref|WP_026370291.1|  short-chain dehydrogenase                          322   4e-104   
ref|WP_039307699.1|  short-chain dehydrogenase                          322   4e-104   
ref|WP_021657496.1|  oxidoreductase, short chain dehydrogenase/re...    322   6e-104   
ref|WP_025364514.1|  short-chain dehydrogenase                          322   6e-104   
gb|AIQ57520.1|  short-chain dehydrogenase                               322   8e-104   
ref|WP_009494038.1|  short-chain dehydrogenase                          322   1e-103   
ref|WP_017452317.1|  MULTISPECIES: short-chain dehydrogenase            322   1e-103   
ref|WP_026065349.1|  short-chain dehydrogenase                          322   1e-103   
ref|WP_014260908.1|  short-chain dehydrogenase                          322   1e-103   
gb|AIQ40491.1|  short-chain dehydrogenase                               322   1e-103   
ref|WP_017517855.1|  short-chain dehydrogenase                          321   1e-103   
ref|WP_010889623.1|  short chain dehydrogenase/reductase family o...    325   2e-103   
ref|WP_023987919.1|  MULTISPECIES: short-chain dehydrogenase            321   2e-103   
ref|WP_015262150.1|  short-chain dehydrogenase                          321   2e-103   
ref|WP_018705440.1|  hypothetical protein                               321   2e-103   
ref|WP_016819632.1|  short-chain dehydrogenase                          322   2e-103   
ref|WP_036823906.1|  short-chain dehydrogenase                          321   2e-103   
dbj|GAK38744.1|  putative general stress protein                        321   2e-103   
ref|WP_007127411.1|  short-chain dehydrogenase                          321   2e-103   
ref|WP_013055375.1|  MULTISPECIES: short-chain dehydrogenase            321   2e-103   
ref|WP_034386148.1|  short-chain dehydrogenase                          321   2e-103   
ref|WP_029036654.1|  short-chain dehydrogenase                          321   2e-103   
ref|WP_027462360.1|  short-chain dehydrogenase                          321   2e-103   
ref|WP_036609825.1|  short-chain dehydrogenase                          321   2e-103   
ref|WP_022802950.1|  short-chain dehydrogenase                          321   2e-103   
ref|WP_020617494.1|  short-chain dehydrogenase                          320   2e-103   
ref|WP_017689483.1|  short-chain dehydrogenase                          320   2e-103   
ref|WP_025707783.1|  short-chain dehydrogenase                          320   3e-103   
ref|WP_038588950.1|  short-chain dehydrogenase                          320   3e-103   
ref|WP_016763019.1|  MULTISPECIES: short-chain dehydrogenase            320   3e-103   
ref|WP_013628096.1|  short-chain dehydrogenase                          321   3e-103   
ref|WP_018212838.1|  short-chain dehydrogenase                          320   3e-103   
ref|WP_019393868.1|  hypothetical protein                               320   4e-103   
ref|WP_005808923.1|  short-chain dehydrogenase                          320   4e-103   
ref|WP_013081725.1|  short-chain dehydrogenase                          320   4e-103   
ref|WP_026561286.1|  short-chain dehydrogenase                          320   4e-103   
ref|WP_011175502.1|  short-chain dehydrogenase                          320   5e-103   
ref|WP_023112425.1|  short-chain dehydrogenase                          320   5e-103   
ref|WP_006038819.1|  short-chain dehydrogenase                          320   5e-103   
ref|WP_025691949.1|  short-chain dehydrogenase                          320   5e-103   
ref|WP_025911875.1|  short-chain dehydrogenase                          320   6e-103   
ref|WP_023615329.1|  MULTISPECIES: short-chain dehydrogenase            319   7e-103   
ref|WP_011459701.1|  short-chain dehydrogenase                          319   7e-103   
ref|WP_028403875.1|  short-chain dehydrogenase                          319   7e-103   
ref|WP_011968212.1|  short-chain dehydrogenase                          320   8e-103   
ref|WP_038091998.1|  short-chain dehydrogenase                          319   8e-103   
ref|WP_015254213.1|  short-chain dehydrogenase                          319   9e-103   
ref|WP_038694875.1|  short-chain dehydrogenase                          319   1e-102   
ref|WP_007084309.1|  short-chain dehydrogenase/reductase SDR            319   1e-102   
ref|WP_015615769.1|  dehydrogenase of unknown specificity, short-...    319   1e-102   
ref|WP_019850417.1|  short-chain dehydrogenase                          319   1e-102   
ref|WP_034043736.1|  short-chain dehydrogenase                          319   1e-102   
ref|WP_027367583.1|  short-chain dehydrogenase                          319   1e-102   
gb|AIQ46281.1|  short-chain dehydrogenase                               319   1e-102   
ref|WP_003100806.1|  MULTISPECIES: short-chain dehydrogenase            318   1e-102   
ref|WP_034012350.1|  short-chain dehydrogenase                          318   1e-102   
gb|AAT50995.1|  PA2142                                                  318   1e-102   
ref|WP_003113640.1|  short-chain dehydrogenase                          318   1e-102   
ref|WP_039358140.1|  short-chain dehydrogenase                          318   1e-102   
ref|WP_034009837.1|  short-chain dehydrogenase                          318   2e-102   
ref|WP_023464705.1|  short-chain dehydrogenase                          318   2e-102   
ref|WP_034054946.1|  short-chain dehydrogenase                          318   2e-102   
ref|WP_004343454.1|  short-chain dehydrogenase                          318   2e-102   
gb|KIC72077.1|  putative oxidoreductase YhdF                            318   2e-102   
ref|WP_012372871.1|  short-chain dehydrogenase                          318   2e-102   
ref|WP_031628920.1|  short-chain dehydrogenase                          318   2e-102   
ref|WP_036669971.1|  short-chain dehydrogenase                          318   2e-102   
emb|CBI36759.3|  unnamed protein product                                316   2e-102   
ref|WP_023112985.1|  short-chain dehydrogenase                          318   2e-102   
emb|CEI20604.1|  putative oxidoreductase yhxC                           318   2e-102   
ref|WP_014793928.1|  short-chain dehydrogenase                          318   2e-102   
ref|WP_003109865.1|  MULTISPECIES: short-chain dehydrogenase            318   2e-102   
ref|WP_034030196.1|  short-chain dehydrogenase                          318   2e-102   
ref|WP_019912025.1|  short-chain dehydrogenase                          318   3e-102   
ref|WP_013235683.1|  short-chain dehydrogenase                          321   3e-102   
gb|AIQ51864.1|  short-chain dehydrogenase                               318   3e-102   
ref|WP_008578832.1|  short-chain dehydrogenase                          318   3e-102   
ref|WP_039769713.1|  short-chain dehydrogenase                          318   3e-102   
ref|WP_033941825.1|  short-chain dehydrogenase                          318   3e-102   
ref|WP_018756071.1|  hypothetical protein                               318   3e-102   
ref|WP_003211351.1|  short-chain dehydrogenase                          318   3e-102   
ref|WP_015944098.1|  short-chain dehydrogenase                          318   3e-102   
emb|CEA02082.1|  short-chain dehydrogenase/reductase SDR                317   4e-102   
gb|AIQ12191.1|  short-chain dehydrogenase                               318   4e-102   
ref|WP_028412395.1|  MULTISPECIES: short-chain dehydrogenase            317   4e-102   
ref|XP_004356989.1|  seed maturation protein PM34, putative             318   4e-102   
ref|WP_017211803.1|  short-chain dehydrogenase                          318   4e-102   
ref|WP_017715928.1|  short-chain dehydrogenase                          317   4e-102   
ref|WP_024916226.1|  short-chain dehydrogenase                          317   4e-102   
emb|CEG26066.1|  short-chain dehydrogenase/reductase SDR                317   5e-102   
ref|WP_033968742.1|  short-chain dehydrogenase                          317   5e-102   
ref|WP_031688994.1|  short-chain dehydrogenase                          317   5e-102   
ref|WP_009876373.1|  short-chain dehydrogenase                          317   5e-102   
ref|WP_031218964.1|  short-chain dehydrogenase                          317   5e-102   
ref|WP_026574490.1|  short-chain dehydrogenase                          317   5e-102   
ref|WP_014602961.1|  MULTISPECIES: short-chain dehydrogenase            317   5e-102   
ref|WP_003450621.1|  short-chain dehydrogenase                          317   6e-102   
ref|WP_028543474.1|  short-chain dehydrogenase                          317   6e-102   
ref|WP_010192071.1|  short-chain dehydrogenase                          317   6e-102   
ref|WP_034663528.1|  short-chain dehydrogenase                          317   6e-102   
ref|WP_016204604.1|  short chain dehydrogenase                          317   7e-102   
ref|WP_003123487.1|  short-chain dehydrogenase                          317   7e-102   
ref|WP_033993703.1|  short-chain dehydrogenase                          317   7e-102   
ref|WP_023435562.1|  short-chain dehydrogenase                          317   8e-102   
ref|WP_034012927.1|  short-chain dehydrogenase                          317   8e-102   
ref|WP_027408970.1|  short-chain dehydrogenase                          317   8e-102   
ref|WP_039073469.1|  short-chain dehydrogenase                          317   8e-102   
gb|EKE03176.1|  hypothetical protein ACD_20C00235G0001                  317   9e-102   
gb|EPZ44144.1|  hypothetical protein N007_11515                         317   9e-102   
ref|WP_014461619.1|  short-chain dehydrogenase                          317   9e-102   
ref|WP_023973987.1|  short-chain dehydrogenase                          317   9e-102   
ref|WP_003162298.1|  Short-chain dehydrogenase/reductase SDR            316   9e-102   
ref|WP_027085541.1|  short-chain dehydrogenase                          317   1e-101   
ref|WP_018307323.1|  short-chain dehydrogenase                          317   1e-101   
ref|WP_027842599.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_026961297.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_033992376.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_039679178.1|  dehydrogenase                                      317   1e-101   
ref|WP_032124020.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_031754473.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_034000201.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_037015489.1|  short-chain dehydrogenase                          316   1e-101   
gb|AIE86768.1|  oxidoreductase                                          315   1e-101   
ref|WP_033968337.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_018749072.1|  hypothetical protein                               316   1e-101   
ref|WP_034351224.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_014416930.1|  short-chain dehydrogenase                          316   1e-101   
ref|WP_023063907.1|  short chain dehydrogenase family protein           316   2e-101   
ref|WP_003088901.1|  short-chain dehydrogenase                          316   2e-101   
ref|WP_014720729.1|  MULTISPECIES: short-chain dehydrogenase            316   2e-101   
ref|WP_024929569.1|  short-chain dehydrogenase                          316   2e-101   
ref|WP_023085225.1|  short-chain dehydrogenase                          316   2e-101   
ref|WP_036769516.1|  short-chain dehydrogenase                          316   2e-101   
ref|WP_034001531.1|  short-chain dehydrogenase                          316   2e-101   
ref|WP_027321804.1|  short-chain dehydrogenase                          316   2e-101   
ref|WP_012749398.1|  short-chain dehydrogenase                          315   2e-101   
ref|WP_036485899.1|  short-chain dehydrogenase                          315   2e-101   
gb|KGX92660.1|  short-chain dehydrogenase                               315   2e-101   
ref|WP_026585065.1|  short-chain dehydrogenase                          315   2e-101   
gb|EIJ46083.1|  short-chain dehydrogenase                               316   2e-101   
ref|WP_036352953.1|  short-chain dehydrogenase                          315   3e-101   
ref|WP_034015382.1|  short-chain dehydrogenase                          315   3e-101   
ref|WP_026295323.1|  short-chain dehydrogenase                          315   3e-101   
ref|WP_025150211.1|  dehydrogenase                                      315   3e-101   
ref|WP_016113193.1|  short chain dehydrogenase                          315   3e-101   
ref|WP_034050162.1|  short-chain dehydrogenase                          315   3e-101   
ref|WP_008276799.1|  short-chain dehydrogenase                          315   3e-101   
ref|WP_027448119.1|  short-chain dehydrogenase                          315   3e-101   
dbj|GAJ39603.1|  putative oxidoreductase                                315   3e-101   
ref|WP_028533057.1|  short-chain dehydrogenase                          315   3e-101   
ref|WP_013401480.1|  short-chain dehydrogenase                          315   3e-101   
ref|WP_011983735.1|  short-chain dehydrogenase                          315   3e-101   
ref|WP_029034160.1|  short-chain dehydrogenase                          315   4e-101   
ref|WP_019881552.1|  MULTISPECIES: hypothetical protein                 315   4e-101   
ref|WP_020209101.1|  hypothetical protein                               315   4e-101   
ref|WP_010329285.1|  short-chain dehydrogenase                          315   4e-101   
ref|WP_003252430.1|  short-chain dehydrogenase                          315   4e-101   
ref|WP_018886037.1|  short-chain dehydrogenase                          315   4e-101   
ref|WP_007060849.1|  short-chain dehydrogenase                          315   4e-101   
ref|WP_038456980.1|  short-chain dehydrogenase                          315   4e-101   
ref|WP_028989030.1|  short-chain dehydrogenase                          315   5e-101   
ref|WP_013632884.1|  short-chain dehydrogenase                          315   5e-101   
ref|WP_012958329.1|  short-chain dehydrogenase                          315   5e-101   
ref|WP_028446407.1|  short-chain dehydrogenase                          315   6e-101   
ref|WP_028035710.1|  short-chain dehydrogenase                          314   6e-101   
ref|WP_017419250.1|  short-chain dehydrogenase                          314   6e-101   
ref|WP_002116343.1|  short-chain dehydrogenase                          314   6e-101   
ref|WP_022626999.1|  short-chain dehydrogenase                          314   6e-101   
ref|WP_035327113.1|  short-chain dehydrogenase                          314   6e-101   
ref|WP_021169740.1|  short chain dehydrogenase/reductase family o...    314   7e-101   
ref|WP_002203375.1|  short-chain dehydrogenase                          314   7e-101   
ref|WP_021495102.1|  MULTISPECIES: short-chain dehydrogenase            314   7e-101   
ref|WP_034354616.1|  short-chain dehydrogenase                          314   7e-101   
ref|WP_022552605.1|  short chain dehydrogenase                          315   7e-101   
gb|EYB68959.1|  short-chain dehydrogenase/reductase SDR                 315   8e-101   
ref|WP_006835600.1|  short-chain dehydrogenase                          314   8e-101   
ref|WP_029148264.1|  short-chain dehydrogenase                          314   9e-101   
ref|WP_026677919.1|  dehydrogenase                                      314   9e-101   
ref|WP_015192834.1|  3-oxoacyl-(acyl-carrier-protein) reductase         314   9e-101   
ref|WP_033828968.1|  short-chain dehydrogenase                          314   9e-101   
ref|WP_002166350.1|  short-chain dehydrogenase                          314   9e-101   
gb|EEK74747.1|  Short-chain dehydrogenase/reductase SDR                 314   1e-100   
ref|WP_036576404.1|  short-chain dehydrogenase                          314   1e-100   
emb|CDO02692.1|  General stress protein 39                              314   1e-100   
ref|WP_036695842.1|  short-chain dehydrogenase                          314   1e-100   
ref|WP_008701278.1|  oxidoreductase, short chain dehydrogenase/re...    314   1e-100   
ref|WP_009226754.1|  short-chain dehydrogenase                          314   1e-100   



>ref|XP_006361858.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Solanum 
tuberosum]
Length=341

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/316 (79%), Positives = 280/316 (89%), Gaps = 5/316 (2%)
 Frame = -1

Query  1164  SLKTNGNSTVRLS-----VFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPS  1000
             S  TN N+  R S     + VRSMAS G  FPPQKQ++QPGKEH MDP P YSSQDYKP+
Sbjct  26    SFFTNNNTKRRRSYPPVNIIVRSMASGGQTFPPQKQETQPGKEHAMDPTPHYSSQDYKPA  85

Query  999   NKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGA  820
             NKL+GK+ALVTGGDSGIGRAVC CFALEGATVAFTYVKSQE+KDA+DTL++L +AK   A
Sbjct  86    NKLRGKIALVTGGDSGIGRAVCHCFALEGATVAFTYVKSQEEKDAQDTLKLLMQAKAADA  145

Query  819   KEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRT  640
             K+PMA+P DLGFD+NC++VV+ VVNSYGRIDILVNNAAEQ++  S+EEI+E RLERVFRT
Sbjct  146   KDPMAVPTDLGFDDNCKRVVDEVVNSYGRIDILVNNAAEQYEASSVEEINEERLERVFRT  205

Query  639   NIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVE  460
             NIFS FF+ +HALKHMKEGSSIINTTSV AYKG+ KLLDY+ATKGAIV+FTRGLALQLVE
Sbjct  206   NIFSYFFVTRHALKHMKEGSSIINTTSVNAYKGNAKLLDYTATKGAIVSFTRGLALQLVE  265

Query  459   RGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSY  280
             RGIRVNGVAPGP+WTPLIPASFSEEECA FGKQVPMKRA Q IEVAPSYVFLASCPESSY
Sbjct  266   RGIRVNGVAPGPVWTPLIPASFSEEECANFGKQVPMKRAAQPIEVAPSYVFLASCPESSY  325

Query  279   ITGQILHPNGGTIVNG  232
             ITGQ++HPNGGTIVN 
Sbjct  326   ITGQVIHPNGGTIVNA  341



>ref|XP_004230182.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Solanum 
lycopersicum]
Length=340

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/317 (78%), Positives = 280/317 (88%), Gaps = 4/317 (1%)
 Frame = -1

Query  1182  FSSTTFSLKTNGNSTVRLSVFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKP  1003
             F++TT      G S   +++  RSMAS G  FPPQKQ +QPGKEH MDP P YSSQDYKP
Sbjct  28    FTNTT----KRGRSYPPVNIIARSMASGGQTFPPQKQQTQPGKEHAMDPTPHYSSQDYKP  83

Query  1002  SNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEG  823
             +NKL+GK+ALVTGGDSGIGRAVC CFALEGATVAFTYVKSQE+KDA+DTL++L +AK   
Sbjct  84    ANKLRGKIALVTGGDSGIGRAVCHCFALEGATVAFTYVKSQEEKDAQDTLKLLMQAKAAD  143

Query  822   AKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFR  643
             AK+PMA+P DLGFD+NC++VV+ VV+SYGRIDILVNNAAEQ++  S+EEI+E RLERVFR
Sbjct  144   AKDPMAVPTDLGFDDNCKRVVDEVVSSYGRIDILVNNAAEQYEASSVEEINEERLERVFR  203

Query  642   TNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLV  463
             TNIFS FF+ +HALKHMKEGSSIINTTSV AYKG+ KLLDY+ATKGAIVAFTRGLALQLV
Sbjct  204   TNIFSYFFVTRHALKHMKEGSSIINTTSVNAYKGNAKLLDYTATKGAIVAFTRGLALQLV  263

Query  462   ERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESS  283
             ERGIRVNGVAPGP+WTPLIPASFSEEECA FGKQVPMKRA Q IEVAPSYVFLASCPESS
Sbjct  264   ERGIRVNGVAPGPVWTPLIPASFSEEECANFGKQVPMKRAAQPIEVAPSYVFLASCPESS  323

Query  282   YITGQILHPNGGTIVNG  232
             YITGQ++HPNGGTIVN 
Sbjct  324   YITGQVIHPNGGTIVNA  340



>ref|XP_009769381.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Nicotiana 
sylvestris]
Length=293

 Score =   520 bits (1339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/292 (83%), Positives = 270/292 (92%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G  FPPQKQ++QPGKEH MDP P++SSQDYKP+NKL+GKVALVTGGDSGIGRAVC 
Sbjct  1     MASGGQTFPPQKQETQPGKEHAMDPTPRHSSQDYKPANKLRGKVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVKSQE+KDA++TL +L++AK   AK+PMA+P DLGFD+NC+KVV+ V
Sbjct  61    CFALEGATVAFTYVKSQEEKDAQETLGLLRQAKAADAKDPMAVPTDLGFDDNCKKVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VNSYGRIDILVNNAAEQ++  SIEEI+E RLERVFRTNIFS FF+ +HALKHMKEGSSII
Sbjct  121   VNSYGRIDILVNNAAEQYEATSIEEINEERLERVFRTNIFSYFFVTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY+ATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF+
Sbjct  181   NTTSVNAYKGNAKLLDYTATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFT  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             EEECA FGKQVPMKRAGQ IEVAPSYVFLAS PESSYITGQ++HPNGGTIVN
Sbjct  241   EEECANFGKQVPMKRAGQPIEVAPSYVFLASSPESSYITGQVIHPNGGTIVN  292



>ref|XP_009629944.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Nicotiana 
tomentosiformis]
Length=293

 Score =   518 bits (1335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/293 (83%), Positives = 270/293 (92%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G  FPPQKQ++QPGKEH MDP P +SSQDYKP+NKL+ KVALVTGGDSGIGRAVC 
Sbjct  1     MASGGQTFPPQKQETQPGKEHAMDPTPHHSSQDYKPANKLRDKVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVKSQE+KDA+DTL++L++AK   AK+PMA+P DLGFD+NC+KVV+ V
Sbjct  61    CFALEGATVAFTYVKSQEEKDAQDTLELLRQAKAADAKDPMAVPIDLGFDDNCKKVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VNSYGRIDILVNNAAEQ++  S+EEI+E RLERVFRTNIFS FF+ +HA+KHMKEGSSII
Sbjct  121   VNSYGRIDILVNNAAEQYEATSVEEINEERLERVFRTNIFSYFFVTRHAVKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKG+ KLLDY+ATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF+
Sbjct  181   NTTSVTAYKGNAKLLDYTATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFT  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A FGKQVPMKRAGQ IEVAPSYVFLAS PESSYITGQ++HPNGGTIVNG
Sbjct  241   EEESANFGKQVPMKRAGQPIEVAPSYVFLASSPESSYITGQVIHPNGGTIVNG  293



>ref|XP_009772647.1| PREDICTED: glucose and ribitol dehydrogenase-like [Nicotiana 
sylvestris]
Length=293

 Score =   512 bits (1318),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 237/292 (81%), Positives = 266/292 (91%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G QFPPQKQ++QPGKEHVM+P PQ+SS +YKP+NKLQGK+ALV GGDSGIGRAVC 
Sbjct  1     MASGGQQFPPQKQETQPGKEHVMEPTPQHSSMEYKPANKLQGKIALVAGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVKSQE+KDA+DTL+IL+KAK   A EPMA+  DLGFD+NC+KVV+ V
Sbjct  61    CFALEGATVAFTYVKSQEEKDAQDTLEILRKAKAADAMEPMAVATDLGFDDNCKKVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VNSYGRIDILVNNAAEQ+KT S+EEIDE RLERVFRTNIFS FFL +H+LKHMKEGSSII
Sbjct  121   VNSYGRIDILVNNAAEQYKTTSVEEIDEERLERVFRTNIFSYFFLTRHSLKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             N+TSV AYKG+PKLLDY+ATKGAIV+FTRGLALQLVE+GIRVN VAPGP+WTPLIPASFS
Sbjct  181   NSTSVVAYKGNPKLLDYTATKGAIVSFTRGLALQLVEKGIRVNAVAPGPVWTPLIPASFS  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             EEE A FGK VPM+RAGQ IE APSYVFLAS P+SSYITGQ++HPNGG IVN
Sbjct  241   EEESANFGKDVPMRRAGQPIEAAPSYVFLASTPDSSYITGQVIHPNGGVIVN  292



>gb|EPS61688.1| hypothetical protein M569_13104, partial [Genlisea aurea]
Length=296

 Score =   503 bits (1295),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 234/295 (79%), Positives = 270/295 (92%), Gaps = 0/295 (0%)
 Frame = -1

Query  1116  RSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAV  937
             RSMA++G QFPPQ+Q++QPGKEH+M+P+P++SS DYKP+NKLQGKVALVTGGDSGIGRAV
Sbjct  2     RSMATEGQQFPPQRQETQPGKEHLMEPSPRHSSDDYKPANKLQGKVALVTGGDSGIGRAV  61

Query  936   CQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVE  757
               CFALEGATVAFTYVK QEDKDA DTL++LK+AK   AKEP+AI ADLG+D+NC++VV+
Sbjct  62    AHCFALEGATVAFTYVKGQEDKDASDTLRLLKEAKSGEAKEPIAIAADLGYDDNCKRVVQ  121

Query  756   SVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS  577
              VVNSYGRID++VNNAAEQ++  S+EEIDE RLERVFRTNIFS FF+ +HALKHMKEGSS
Sbjct  122   EVVNSYGRIDVVVNNAAEQYEASSVEEIDEPRLERVFRTNIFSYFFITRHALKHMKEGSS  181

Query  576   IINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPAS  397
             IINTTSV AYKG+ KLLDY++TKGAIVAFTRGLALQL  +GIRVNGVAPGPIWTPLIPAS
Sbjct  182   IINTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQLAGKGIRVNGVAPGPIWTPLIPAS  241

Query  396   FSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             F+EEE A FGKQVPM+RAGQ IEVAPSYVFLAS  +SSYITGQ++HPNGGTIVNG
Sbjct  242   FTEEETASFGKQVPMQRAGQPIEVAPSYVFLASNVDSSYITGQVIHPNGGTIVNG  296



>ref|XP_010025176.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Eucalyptus 
grandis]
 gb|KCW61772.1| hypothetical protein EUGRSUZ_H04480 [Eucalyptus grandis]
Length=293

 Score =   503 bits (1294),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 237/293 (81%), Positives = 262/293 (89%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G+QFPPQ+Q+ QPGKEH MDP PQ+SS DYKPSNKLQG+VALVTGGDSGIGRAVC 
Sbjct  1     MASGGDQFPPQRQERQPGKEHAMDPTPQFSSTDYKPSNKLQGRVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFA EGATVAFTYVK +EDKDA+D LQ+LK+AK   AK+PMA+ ADLGFDENCR+VV  V
Sbjct  61    CFAREGATVAFTYVKGREDKDAQDALQMLKQAKAPDAKDPMAVAADLGFDENCRRVVNEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
              N+YGRIDILVNNAAEQH+  ++EEIDE+RLERVFRTNIFS FF V+HALKHMKEG SII
Sbjct  121   ANAYGRIDILVNNAAEQHECSTVEEIDESRLERVFRTNIFSYFFTVRHALKHMKEGGSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY++TKGAIVAFTRGLALQLV+RGIRVNGVAPGPIWTPLIPASF+
Sbjct  181   NTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQLVDRGIRVNGVAPGPIWTPLIPASFT  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE   FGKQVPMKRAGQ IEVAPS+VFLA    SSYITGQ+LHPNGGTIVNG
Sbjct  241   EEETRNFGKQVPMKRAGQPIEVAPSFVFLACNHCSSYITGQVLHPNGGTIVNG  293



>gb|ACB55491.1| seed maturation-like protein precursor [Sesamum indicum]
Length=345

 Score =   498 bits (1282),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 236/298 (79%), Positives = 264/298 (89%), Gaps = 0/298 (0%)
 Frame = -1

Query  1125  VFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIG  946
             + +RSMAS G QFPPQKQ+ QPGKEH+MDP PQ ++ +YKP+NKL GKVALVTGGDSGIG
Sbjct  48    LVIRSMASSGQQFPPQKQEGQPGKEHIMDPTPQATTPEYKPANKLVGKVALVTGGDSGIG  107

Query  945   RAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRK  766
             RAV  CFALEGATVAFTYVK QEDKDA DTL +L KAK   AK+P+AIP DLG+DENCR+
Sbjct  108   RAVGHCFALEGATVAFTYVKGQEDKDANDTLGMLMKAKHADAKDPIAIPTDLGYDENCRR  167

Query  765   VVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
             VVE VVN+YGRIDILVNNAAEQ++  ++EEIDE RLERVFRTNIFS FF  +HALKHMKE
Sbjct  168   VVEEVVNNYGRIDILVNNAAEQYEASTVEEIDEPRLERVFRTNIFSYFFTSRHALKHMKE  227

Query  585   GSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLI  406
             GSSIINTTSV AYKG+ KLLDY+ATKGAIVAFTRGLALQ+VE+GIRVNGVAPGPIWTPLI
Sbjct  228   GSSIINTTSVNAYKGNAKLLDYTATKGAIVAFTRGLALQMVEKGIRVNGVAPGPIWTPLI  287

Query  405   PASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             PASF+E+E A+FG Q PMKRAGQ  EVAPSYVFLAS  +SSYITGQ+LHPNGGTIVNG
Sbjct  288   PASFTEDENAKFGSQTPMKRAGQPHEVAPSYVFLASNIDSSYITGQVLHPNGGTIVNG  345



>ref|XP_011092026.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Sesamum 
indicum]
Length=345

 Score =   497 bits (1280),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 235/298 (79%), Positives = 264/298 (89%), Gaps = 0/298 (0%)
 Frame = -1

Query  1125  VFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIG  946
             + +RSMAS G QFPPQKQ+ QPGKEH+MDP PQ ++ +YKP+NKL GKVALVTGGDSGIG
Sbjct  48    LVIRSMASSGQQFPPQKQEGQPGKEHIMDPTPQATTPEYKPANKLVGKVALVTGGDSGIG  107

Query  945   RAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRK  766
             RAV  CFALEGATVAFTYVK QEDKDA DTL +L KAK   AK+P+AIP DLG+DENCR+
Sbjct  108   RAVGHCFALEGATVAFTYVKGQEDKDANDTLGMLMKAKHADAKDPIAIPTDLGYDENCRR  167

Query  765   VVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
             +VE VVN+YGRIDILVNNAAEQ++  ++EEIDE RLERVFRTNIFS FF  +HALKHMKE
Sbjct  168   MVEEVVNNYGRIDILVNNAAEQYEASTVEEIDEPRLERVFRTNIFSYFFTSRHALKHMKE  227

Query  585   GSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLI  406
             GSSIINTTSV AYKG+ KLLDY+ATKGAIVAFTRGLALQ+VE+GIRVNGVAPGPIWTPLI
Sbjct  228   GSSIINTTSVNAYKGNAKLLDYTATKGAIVAFTRGLALQMVEKGIRVNGVAPGPIWTPLI  287

Query  405   PASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             PASF+E+E A+FG Q PMKRAGQ  EVAPSYVFLAS  +SSYITGQ+LHPNGGTIVNG
Sbjct  288   PASFTEDESAKFGTQTPMKRAGQPHEVAPSYVFLASNIDSSYITGQVLHPNGGTIVNG  345



>ref|XP_004135622.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
sativus]
Length=293

 Score =   492 bits (1266),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 233/293 (80%), Positives = 258/293 (88%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA++G  FPPQKQ +QPGKEHVMDP+PQ++S  YKPSNKL GKVALVTGGDSGIGRAVC 
Sbjct  1     MATEGQTFPPQKQQTQPGKEHVMDPSPQFTSSQYKPSNKLLGKVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVK QEDKDA+D L+IL++ +   AK+P+A+ ADLGFDE+C++VV+ V
Sbjct  61    CFALEGATVAFTYVKKQEDKDAKDMLEILRECQAPDAKQPIAVGADLGFDEDCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V +YGRIDILVN AAEQHKT S+EEIDE R+ERVFRTNIFSQFF+V+HALKHMKEGSSII
Sbjct  121   VKAYGRIDILVNAAAEQHKTNSVEEIDEQRIERVFRTNIFSQFFMVRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG P+LLDYSATKGAIVAFTRGLALQL  RGIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVVAYKGCPQLLDYSATKGAIVAFTRGLALQLATRGIRVNGVAPGPIWTPLIPASFD  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              EE   FG +VPMKRAGQ IEVAPSYVFLA    SSY TGQILHPNGGTIVNG
Sbjct  241   NEEIESFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQILHPNGGTIVNG  293



>ref|XP_003591094.1| Glucose and ribitol dehydrogenase [Medicago truncatula]
 gb|AES61345.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=293

 Score =   491 bits (1264),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 230/293 (78%), Positives = 261/293 (89%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQKQD+QPGKEHVMDP PQ++  DYKPSNKLQGKVA++TGGDSGIGRAVC 
Sbjct  1     MASGEQKFPPQKQDTQPGKEHVMDPLPQFTCPDYKPSNKLQGKVAVITGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              F+LEGATVAFTYVK  EDKDA+DTL++L+ AK   AK+PMA+ ADLGFDENC+KVV+ +
Sbjct  61    LFSLEGATVAFTYVKGDEDKDAKDTLEMLRNAKSADAKDPMAVAADLGFDENCKKVVDEI  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YG IDILVNNAAEQ++  S+EEIDE+RLERVFRTNIFS FF+ +HALKHMKEGSSII
Sbjct  121   VNAYGHIDILVNNAAEQYECSSVEEIDESRLERVFRTNIFSYFFMTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY++TKGAIVAFTRGL+LQLV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG QVPMKRAGQ IEVAPSYVFLAS   SSY TGQ+LHPNGGT+VNG
Sbjct  241   EEETAQFGGQVPMKRAGQPIEVAPSYVFLASNQCSSYFTGQVLHPNGGTVVNG  293



>ref|XP_002319022.2| hypothetical protein POPTR_0013s02480g [Populus trichocarpa]
 gb|EEE94945.2| hypothetical protein POPTR_0013s02480g [Populus trichocarpa]
Length=343

 Score =   493 bits (1268),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 236/298 (79%), Positives = 263/298 (88%), Gaps = 1/298 (0%)
 Frame = -1

Query  1125  VFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIG  946
             VFV  MAS G +FPPQKQ+SQPGKEHVMDP PQY++ DYKPSNKLQGKVA+VTGGDSGIG
Sbjct  47    VFV-GMASGGQKFPPQKQNSQPGKEHVMDPTPQYTNPDYKPSNKLQGKVAVVTGGDSGIG  105

Query  945   RAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRK  766
             RAVC+ F +EGATVAFTYVK+QEDKDA DTLQ+LKK K   AK+P+AIP DLGFDENC++
Sbjct  106   RAVCRSFVIEGATVAFTYVKAQEDKDADDTLQMLKKHKTADAKDPIAIPVDLGFDENCKR  165

Query  765   VVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
             VV+ VVN+YGRIDILVNNAAEQ++  S+EEIDE RLE+VFRTNIFS FF+ +HALKHMKE
Sbjct  166   VVDEVVNAYGRIDILVNNAAEQYECSSVEEIDEQRLEKVFRTNIFSYFFMTRHALKHMKE  225

Query  585   GSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLI  406
             GSSIINTTSV AY G+ +LLDY++TKGAIVAF RGLALQLV RGIRVNGVAPGPIWTPLI
Sbjct  226   GSSIINTTSVNAYMGNSQLLDYTSTKGAIVAFIRGLALQLVSRGIRVNGVAPGPIWTPLI  285

Query  405   PASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             PASF EEE A FGKQVPM+RAGQ  EVAPSYVFLA    SSYITGQ+LHPNGG IVNG
Sbjct  286   PASFKEEEVANFGKQVPMQRAGQPAEVAPSYVFLACNHCSSYITGQVLHPNGGVIVNG  343



>ref|XP_004166035.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
sativus]
Length=293

 Score =   489 bits (1260),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 256/293 (87%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA++G  FPPQKQ +QPGKEHVMDP+PQ++S  YKPSNKL GKVALVTGGDSGIGRAVC 
Sbjct  1     MATEGQTFPPQKQQTQPGKEHVMDPSPQFTSSQYKPSNKLLGKVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEG TVAFTYVK QEDKDA+D L+IL++ +   AK+P+A+ ADLGFDE C++VV+ V
Sbjct  61    CFALEGVTVAFTYVKKQEDKDAKDMLEILRECQAPDAKQPIAVGADLGFDEECKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V +YGRIDILVN AAEQHKT S+EEIDE R+ERVFRTNIFSQFF+V+HALKHMKEGSSII
Sbjct  121   VKAYGRIDILVNAAAEQHKTNSVEEIDEQRIERVFRTNIFSQFFMVRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG P+LLDYSATKGAIVAFTRGLALQL  RGIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVVAYKGCPQLLDYSATKGAIVAFTRGLALQLATRGIRVNGVAPGPIWTPLIPASFD  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              EE   FG +VPMKRAGQ IEVAPSYVFLA    SSY TGQILHPNGGTIVNG
Sbjct  241   NEEIESFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQILHPNGGTIVNG  293



>gb|AFK39537.1| unknown [Lotus japonicus]
Length=293

 Score =   489 bits (1258),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 227/293 (77%), Positives = 260/293 (89%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G +FPPQKQ++QPGKEH ++PAPQ++S +YKPSNKLQGK+AL+TGGDSGIGRAVC 
Sbjct  1     MASGGQKFPPQKQETQPGKEHALNPAPQFASPEYKPSNKLQGKIALITGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATV FTYV+ QEDKDARDT++++K+AK   AK+P+AIPAD GFDENC++VV+  
Sbjct  61    LFALEGATVIFTYVEGQEDKDARDTIEMIKRAKTADAKDPLAIPADFGFDENCKRVVDEA  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YGRIDILVNNAAEQ++  S+EEIDE RLERVFRTNIFS FFL +HALKHMKEGSSII
Sbjct  121   VNAYGRIDILVNNAAEQYECGSVEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG P LLDY+ATKGAIVAFTRGL+LQLV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVNAYKGHPTLLDYTATKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG  VPMKRAGQ +EVAPSYVFLA    SSYITGQ+LHPNGG +VNG
Sbjct  241   EEETAQFGADVPMKRAGQPVEVAPSYVFLACNQCSSYITGQVLHPNGGNVVNG  293



>gb|EYU34848.1| hypothetical protein MIMGU_mgv1a011082mg [Erythranthe guttata]
Length=293

 Score =   488 bits (1257),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 233/293 (80%), Positives = 257/293 (88%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G QFPPQKQD+QPGK+H+MDP P  ++ +YKPSNKL GKVALVTGGDSGIGRAV  
Sbjct  1     MASSGQQFPPQKQDTQPGKQHLMDPTPHSTTPEYKPSNKLLGKVALVTGGDSGIGRAVGH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVK QEDKDA D L +L KAK   AK+P+AIP DLGFDENC++VV+ V
Sbjct  61    CFALEGATVAFTYVKGQEDKDANDALGMLMKAKHPDAKDPVAIPTDLGFDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VNS+GRIDILVNNAAEQ++  SIEEID  RLERVFRTNIFS FF  +HALKHMKEGSSII
Sbjct  121   VNSFGRIDILVNNAAEQYEAGSIEEIDSDRLERVFRTNIFSYFFTTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY+ATKGAIVAFTRGLALQLVE+GIRVNGVAPGP+WTPLIPASF+
Sbjct  181   NTTSVNAYKGNAKLLDYTATKGAIVAFTRGLALQLVEKGIRVNGVAPGPVWTPLIPASFT  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             E+E A FG QVPMKRAGQ  EVAP YVFLAS  +SSYITGQ+LHPNGGTIVNG
Sbjct  241   EDESASFGAQVPMKRAGQPTEVAPCYVFLASNVDSSYITGQVLHPNGGTIVNG  293



>ref|XP_004495735.1| PREDICTED: glucose and ribitol dehydrogenase-like [Cicer arietinum]
Length=293

 Score =   488 bits (1256),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 229/293 (78%), Positives = 258/293 (88%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQKQD+QPGKEHVMDP PQ++S DY PSNKLQGK+A++TGGDSGIGRAVC 
Sbjct  1     MASGEQKFPPQKQDTQPGKEHVMDPLPQFTSPDYMPSNKLQGKIAVITGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              F+LEGATVAFTYVK  EDKD RDTL+I+K  K   AK+PMA+ ADLGFDENC++VV+ V
Sbjct  61    LFSLEGATVAFTYVKGDEDKDTRDTLEIIKNGKSTDAKDPMAVAADLGFDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YGRIDILVNNAAEQ++  S+EEIDE RLERVFRTNIFS FF+ +HALKHMKEGSSII
Sbjct  121   VNAYGRIDILVNNAAEQYECSSVEEIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY++TKGAIVAFTRGL+LQLV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFQ  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG QVPM RAGQ IEVAPSYVFLAS   SSY TGQ+LHPNGGT+VNG
Sbjct  241   EEETAQFGGQVPMNRAGQPIEVAPSYVFLASNQCSSYFTGQVLHPNGGTVVNG  293



>gb|AFK45385.1| unknown [Lotus japonicus]
Length=293

 Score =   487 bits (1254),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 227/292 (78%), Positives = 260/292 (89%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQKQD+QPGKEHVMDP PQ+++ DYKPSNKLQGK+A++TGGDSGIGRAVC 
Sbjct  1     MASGEQKFPPQKQDAQPGKEHVMDPVPQFTNPDYKPSNKLQGKIAVITGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATVAFTYVK  EDKDARDTL+++KKAK  GAK+P+AIPADLGFDENC+KVV+ V
Sbjct  61    LFALEGATVAFTYVKGSEDKDARDTLEMIKKAKTAGAKDPLAIPADLGFDENCKKVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V +YG+IDIL+NNAAEQ++  S+EEIDE RLERVFRTNIFS FF+ +HALKHMKEGSSII
Sbjct  121   VKAYGQIDILINNAAEQYECASVEEIDEKRLERVFRTNIFSYFFMTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY++TKGAIVAFTRGL+LQLV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIPASFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             EEE ++FG QVPMKRAGQ IEVAPSYVFLA      YI+GQ+LHPNGG +VN
Sbjct  241   EEETSQFGGQVPMKRAGQPIEVAPSYVFLACNACFFYISGQVLHPNGGNVVN  292



>ref|XP_008450654.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Cucumis 
melo]
Length=293

 Score =   486 bits (1250),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 230/293 (78%), Positives = 257/293 (88%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA++G   PPQKQ +QPGKEHVMDP+PQ++S  YKPSNKL GKVALVTGGDSGIGRAVC 
Sbjct  1     MATEGQTCPPQKQPTQPGKEHVMDPSPQFTSSQYKPSNKLLGKVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVK QEDKDA+D L+IL++ +   AK+P+A+ ADLGFDE C+ VV+ V
Sbjct  61    CFALEGATVAFTYVKKQEDKDAKDVLEILRECQAADAKQPIAVGADLGFDEECKHVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V +YGRIDILVN+AAEQHKT S+EEIDE R+ERVFRTNIFSQFF+V+HALKHMKEGSSII
Sbjct  121   VKAYGRIDILVNSAAEQHKTNSVEEIDEKRIERVFRTNIFSQFFMVRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+PKLLDY+ATKGAIVAFTRGLALQL  RGIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVVAYKGNPKLLDYTATKGAIVAFTRGLALQLANRGIRVNGVAPGPIWTPLIPASFD  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              E+   FG +VPMKRAGQ IEVAPSYVFLA    SSY TGQILHPNGG+IVNG
Sbjct  241   NEDIESFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQILHPNGGSIVNG  293



>ref|XP_002512366.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF49818.1| short chain dehydrogenase, putative [Ricinus communis]
Length=293

 Score =   486 bits (1250),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 228/293 (78%), Positives = 256/293 (87%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G  FPPQKQ SQPGKEH MDP PQY+  DYKPS+KL+GKVALVTGGDSGIGRAVC 
Sbjct  1     MASGGQSFPPQKQGSQPGKEHQMDPIPQYARSDYKPSDKLRGKVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              F LEGATVAFTYVK QED+DA DT+Q+LKK+K   AKEP+AI ADLG+DENC+KV++ V
Sbjct  61    SFVLEGATVAFTYVKKQEDRDAEDTIQLLKKSKTVDAKEPIAIAADLGYDENCKKVIDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN++GRIDILVNNAAEQHK  S++EIDE RLERVFRTN+FS FF  +HALKHMKEGSSII
Sbjct  121   VNAFGRIDILVNNAAEQHKAGSVQEIDEERLERVFRTNMFSYFFATRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTS+ AYKG+ KLLDY+ATKGAIVAFTRGLAL+LV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSINAYKGNAKLLDYTATKGAIVAFTRGLALELVNKGIRVNGVAPGPIWTPLIPASFD  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A FGK+VPM+RAGQ +EVAP YVFLA    SSYITGQ+LHPNGG I+NG
Sbjct  241   EEEVANFGKEVPMQRAGQPVEVAPCYVFLACNHCSSYITGQVLHPNGGAIING  293



>gb|KDP23528.1| hypothetical protein JCGZ_23361 [Jatropha curcas]
Length=293

 Score =   484 bits (1245),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 257/293 (88%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   QFPPQ+Q+ QPGKEHVMDP P Y+  D KPS+KL+GKVALVTGGDSGIGRAVC 
Sbjct  1     MASGEQQFPPQRQEKQPGKEHVMDPIPHYAMSDSKPSDKLRGKVALVTGGDSGIGRAVCY  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATVAFTYV+ QEDKDA+DT++ILKK K   AKEP+AI ADLGFD+NC+KVV+ V
Sbjct  61    SFALEGATVAFTYVRKQEDKDAQDTIEILKKNKTPDAKEPIAIAADLGFDDNCKKVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YGRIDILVNNAAEQ+K+ S+EEIDE RLERVFRTNIFS FF  +H LKHMKEGSSII
Sbjct  121   VNAYGRIDILVNNAAEQYKSSSVEEIDEERLERVFRTNIFSYFFTTRHCLKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY+ATKGAIVAFTRGLALQLV++GIRVNGVAPGPIWTPLIP+SFS
Sbjct  181   NTTSVNAYKGNKKLLDYTATKGAIVAFTRGLALQLVKKGIRVNGVAPGPIWTPLIPSSFS  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A FGKQ PM+RAGQ  EVAPSYVFLA    SSYITGQ+LHPNGG IVNG
Sbjct  241   EEEVANFGKQTPMQRAGQPSEVAPSYVFLACNHCSSYITGQVLHPNGGVIVNG  293



>ref|XP_010278084.1| PREDICTED: glucose and ribitol dehydrogenase [Nelumbo nucifera]
Length=293

 Score =   483 bits (1244),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/293 (77%), Positives = 260/293 (89%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G QFPPQ+Q++QPGKEH+M+P P  +S +YKP+NKL GKVALVTGGDSGIGRAVC 
Sbjct  1     MASGGQQFPPQRQETQPGKEHIMNPTPHAASCEYKPANKLHGKVALVTGGDSGIGRAVCY  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFA EGATVAFTYVK QEDKDA+DTLQ++ KAK    K+P+AI ADLGFDENC++VV+ V
Sbjct  61    CFAREGATVAFTYVKGQEDKDAQDTLQMITKAKTGEVKDPIAIAADLGFDENCKRVVDRV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN++GRIDILVNNAAEQ++  S+EEIDE RLERVFRTNIFS FF+ +H LKHMKEGSSII
Sbjct  121   VNAFGRIDILVNNAAEQYEAGSVEEIDEQRLERVFRTNIFSYFFMTRHCLKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG  KLLDY+ATKGAIVAFTRGLALQLV++GIRVNGVAPGP+WTPLIPASF+
Sbjct  181   NTTSVNAYKGHAKLLDYTATKGAIVAFTRGLALQLVQKGIRVNGVAPGPVWTPLIPASFT  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEEC++FG +VPM RAGQ  E+AP+YVFLAS   SSYITGQ+LHPNGGT+VNG
Sbjct  241   EEECSKFGSEVPMGRAGQPHEIAPAYVFLASPTCSSYITGQVLHPNGGTVVNG  293



>ref|XP_006433300.1| hypothetical protein CICLE_v10002055mg [Citrus clementina]
 ref|XP_006471972.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Citrus 
sinensis]
 gb|ESR46540.1| hypothetical protein CICLE_v10002055mg [Citrus clementina]
Length=291

 Score =   483 bits (1244),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 231/293 (79%), Positives = 261/293 (89%), Gaps = 2/293 (1%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS  N  PPQKQD+QPGKEHVM+P PQ++S DY PSNKL+G VALVTGGDSGIGRAVC 
Sbjct  1     MAS--NNQPPQKQDTQPGKEHVMNPIPQFTSPDYTPSNKLRGMVALVTGGDSGIGRAVCH  58

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFA EGATVAFTYVK QEDKDA++TL++L+KAK   AK+PMAI ADLGFDENC++VV+ V
Sbjct  59    CFAQEGATVAFTYVKPQEDKDAKETLEMLRKAKTPDAKDPMAISADLGFDENCKRVVDEV  118

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YG+IDILVNNAAEQ++  S+E+IDE+RLERVFRTNIFS FF+ +HALKHMK GSSII
Sbjct  119   VNAYGKIDILVNNAAEQYECGSVEDIDESRLERVFRTNIFSYFFMARHALKHMKAGSSII  178

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY++TKGAIVAFTRGLALQ VERGIRVNGVAPGPIWTPLIPASF+
Sbjct  179   NTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQQVERGIRVNGVAPGPIWTPLIPASFT  238

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG QVPMKRAGQ IEVAP +VFLA    SSYITGQ+LHPNGGTIVNG
Sbjct  239   EEETAQFGNQVPMKRAGQPIEVAPCFVFLACNHCSSYITGQVLHPNGGTIVNG  291



>emb|CDP20122.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   483 bits (1244),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 226/292 (77%), Positives = 256/292 (88%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G QFPPQKQD QPGK+HVMDP P+ +  +YKPSNKLQGK+ALVTGGDSGIGRAV  
Sbjct  1     MASSGQQFPPQKQDVQPGKQHVMDPTPKATCHEYKPSNKLQGKIALVTGGDSGIGRAVSH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVK  EDKDA DTL +L KAK   AK+PMA+PADLG+DENC++VV+ V
Sbjct  61    CFALEGATVAFTYVKGSEDKDATDTLGMLMKAKAPDAKDPMALPADLGYDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YGRIDILVNNAAEQ+K  ++EEIDE RLERVFRTNIF+ FF+ +HALKHMKEGS+II
Sbjct  121   VNNYGRIDILVNNAAEQYKAAAVEEIDEERLERVFRTNIFAYFFMTRHALKHMKEGSAII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             N+TS+ AYKG+ KLLDY++TKGAIVAFTRGLALQL+ RGIRVNGVAPGPIWTPLIPASFS
Sbjct  181   NSTSINAYKGNAKLLDYTSTKGAIVAFTRGLALQLISRGIRVNGVAPGPIWTPLIPASFS  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             +EE  +FG +VPM R GQ IEVAPSYVFLA    SSYITGQ+LHPNGGTIVN
Sbjct  241   DEEVQKFGSEVPMHRPGQPIEVAPSYVFLACNECSSYITGQVLHPNGGTIVN  292



>ref|XP_010528871.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 isoform 
X2 [Tarenaya hassleriana]
Length=335

 Score =   483 bits (1244),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 226/297 (76%), Positives = 265/297 (89%), Gaps = 2/297 (1%)
 Frame = -1

Query  1125  VFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIG  946
             V+VR+M++D  QFP QKQ++QPGKEHVMDP P+++S DYKPSNK +GKVAL+ GGDSGIG
Sbjct  40    VWVRAMSTD--QFPRQKQETQPGKEHVMDPIPKFASSDYKPSNKFRGKVALIAGGDSGIG  97

Query  945   RAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRK  766
             RAVC CFALEGATVAFTYVK QE+KDA+DTLQ+LK+AK + AK+P++I  DLGFDENC++
Sbjct  98    RAVCHCFALEGATVAFTYVKGQEEKDAQDTLQMLKEAKTDEAKDPISIATDLGFDENCKR  157

Query  765   VVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
             VV+ VVN+YGRID+L+NNAAEQ+++ +IEEIDE RLERVFRTNIFS FFL +HALKHMKE
Sbjct  158   VVDEVVNAYGRIDVLINNAAEQYESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKE  217

Query  585   GSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLI  406
             GSSIINTTSV AYKG+  LLDY+ATKGAIVAFTRGLALQL ++GIRVNGVAPGPIWTPLI
Sbjct  218   GSSIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAQKGIRVNGVAPGPIWTPLI  277

Query  405   PASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             PASF EE+  +FG++VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG IVN
Sbjct  278   PASFHEEKTQKFGEEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAIVN  334



>gb|KGN66084.1| hypothetical protein Csa_1G570090 [Cucumis sativus]
Length=287

 Score =   480 bits (1235),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 227/287 (79%), Positives = 252/287 (88%), Gaps = 0/287 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA++G  FPPQKQ +QPGKEHVMDP+PQ++S  YKPSNKL GKVALVTGGDSGIGRAVC 
Sbjct  1     MATEGQTFPPQKQQTQPGKEHVMDPSPQFTSSQYKPSNKLLGKVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVK QEDKDA+D L+IL++ +   AK+P+A+ ADLGFDE+C++VV+ V
Sbjct  61    CFALEGATVAFTYVKKQEDKDAKDMLEILRECQAPDAKQPIAVGADLGFDEDCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V +YGRIDILVN AAEQHKT S+EEIDE R+ERVFRTNIFSQFF+V+HALKHMKEGSSII
Sbjct  121   VKAYGRIDILVNAAAEQHKTNSVEEIDEQRIERVFRTNIFSQFFMVRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG P+LLDYSATKGAIVAFTRGLALQL  RGIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVVAYKGCPQLLDYSATKGAIVAFTRGLALQLATRGIRVNGVAPGPIWTPLIPASFD  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNG  250
              EE   FG +VPMKRAGQ IEVAPSYVFLA    SSY TGQILHPNG
Sbjct  241   NEEIESFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQILHPNG  287



>ref|XP_010528870.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 isoform 
X1 [Tarenaya hassleriana]
Length=349

 Score =   480 bits (1235),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 226/297 (76%), Positives = 265/297 (89%), Gaps = 2/297 (1%)
 Frame = -1

Query  1125  VFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIG  946
             V+VR+M++D  QFP QKQ++QPGKEHVMDP P+++S DYKPSNK +GKVAL+ GGDSGIG
Sbjct  54    VWVRAMSTD--QFPRQKQETQPGKEHVMDPIPKFASSDYKPSNKFRGKVALIAGGDSGIG  111

Query  945   RAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRK  766
             RAVC CFALEGATVAFTYVK QE+KDA+DTLQ+LK+AK + AK+P++I  DLGFDENC++
Sbjct  112   RAVCHCFALEGATVAFTYVKGQEEKDAQDTLQMLKEAKTDEAKDPISIATDLGFDENCKR  171

Query  765   VVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
             VV+ VVN+YGRID+L+NNAAEQ+++ +IEEIDE RLERVFRTNIFS FFL +HALKHMKE
Sbjct  172   VVDEVVNAYGRIDVLINNAAEQYESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKE  231

Query  585   GSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLI  406
             GSSIINTTSV AYKG+  LLDY+ATKGAIVAFTRGLALQL ++GIRVNGVAPGPIWTPLI
Sbjct  232   GSSIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAQKGIRVNGVAPGPIWTPLI  291

Query  405   PASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             PASF EE+  +FG++VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG IVN
Sbjct  292   PASFHEEKTQKFGEEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAIVN  348



>ref|XP_003626301.1| Glucose and ribitol dehydrogenase-like protein [Medicago truncatula]
 gb|ABD32398.1| Short-chain dehydrogenase/reductase SDR [Medicago truncatula]
 gb|AES82519.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=293

 Score =   478 bits (1229),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 219/292 (75%), Positives = 256/292 (88%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             M + G + PPQKQD+QPGKEH M+P PQ++  DYKP+NKLQGK+A+VTGGDSGIGRAVC 
Sbjct  1     MTTGGQKIPPQKQDTQPGKEHAMNPTPQFTCPDYKPANKLQGKIAVVTGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATV FTYVK  EDKDARDTL +LK AK   AK+PMAIPADLGFDENC++V++ +
Sbjct  61    LFALEGATVIFTYVKGHEDKDARDTLDMLKMAKTANAKDPMAIPADLGFDENCKRVIDEI  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +N+YGRIDILVNNAAEQ++  S+EEIDE RLERVFRTNIFS FF+ +HALKHMKEGS+II
Sbjct  121   INAYGRIDILVNNAAEQYECGSVEEIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSNII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+  L+DY++TKGAIVAFTR L+LQLV +GIRVNGVAPGPIWTPLIPASF+
Sbjct  181   NTTSVNAYKGNSTLIDYTSTKGAIVAFTRALSLQLVSKGIRVNGVAPGPIWTPLIPASFN  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             EE+ A+FG  VPMKRAGQ +EVAPS+VFLAS   SSYITGQ+LHPNGGT+VN
Sbjct  241   EEKTAQFGSDVPMKRAGQPVEVAPSFVFLASNQCSSYITGQVLHPNGGTVVN  292



>ref|XP_010674766.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Beta 
vulgaris subsp. vulgaris]
Length=356

 Score =   480 bits (1235),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 232/355 (65%), Positives = 273/355 (77%), Gaps = 8/355 (2%)
 Frame = -1

Query  1275  MFSRCFTSSRALAVtlrhlppppttahllpPFSSTTFSLKTNGNSTVRLSVFVRS-----  1111
             MF R    SRA+AV                 +S T +  +  G    R     +      
Sbjct  1     MFLRGVVQSRAVAVGTSTNNISVVGRAFSRSYSYTLYRNRIVGGGRRRRQQQQQQQEQLQ  60

Query  1110  ---MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRA  940
                MAS G++FP Q+Q +QPGKEH MDP PQ   QDY+P+NKLQGKVALVTGGDSGIGRA
Sbjct  61    TIRMASGGDKFPAQRQQAQPGKEHAMDPIPQALRQDYRPANKLQGKVALVTGGDSGIGRA  120

Query  939   VCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVV  760
             VCQCFALEGATVAFTYVK QEDKDA DTLQ++K  K   AK+P+AIPADLG+DENC++V+
Sbjct  121   VCQCFALEGATVAFTYVKGQEDKDAHDTLQMIKSNKSSDAKDPIAIPADLGYDENCKRVI  180

Query  759   ESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS  580
             + V N++GRIDILVNN AEQ++  ++EEIDE RL+RVFRTNI+S FF+ +HALKHM+EG+
Sbjct  181   DEVANAFGRIDILVNNCAEQYECTTVEEIDEPRLDRVFRTNIYSYFFMTRHALKHMREGA  240

Query  579   SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPA  400
             SIINTTSV AYKG+ KLLDY++TKGAIVAFTRGLALQLV++GIRVNGVAPGPIWTPLIPA
Sbjct  241   SIINTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQLVQKGIRVNGVAPGPIWTPLIPA  300

Query  399   SFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             SF E+E   FG QVPM RAGQ  EVAPS+VFLA   +SSYITGQ+LHPNGGTIVN
Sbjct  301   SFKEDEVKSFGGQVPMNRAGQPSEVAPSFVFLACNADSSYITGQVLHPNGGTIVN  355



>ref|XP_011023588.1| PREDICTED: LOW QUALITY PROTEIN: glucose and ribitol dehydrogenase 
homolog 1 [Populus euphratica]
Length=365

 Score =   476 bits (1226),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 229/297 (77%), Positives = 257/297 (87%), Gaps = 1/297 (0%)
 Frame = -1

Query  1125  VFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIG  946
             VFV  MAS G +FPPQKQ+SQPGKEHVMDP PQ+++ DYKPSNKLQGKVA+VTGGDSGIG
Sbjct  47    VFV-GMASGGQKFPPQKQNSQPGKEHVMDPTPQHTNPDYKPSNKLQGKVAVVTGGDSGIG  105

Query  945   RAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRK  766
             RAVC  F +EGATVAFTYVK+QEDKDA DTLQ+LK  K   AK+P+AIP DLGFDENC++
Sbjct  106   RAVCYSFVIEGATVAFTYVKAQEDKDADDTLQMLKXHKTADAKDPIAIPVDLGFDENCKR  165

Query  765   VVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
             VV+ VVN+YGRIDILVNNAAE ++  S+EEIDE R ERVFRTNIFS FF+ +HALKHMKE
Sbjct  166   VVDEVVNAYGRIDILVNNAAEXYECSSVEEIDEQRPERVFRTNIFSYFFMTRHALKHMKE  225

Query  585   GSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLI  406
             GSSIINTTSV AYKG+ KLLDY++TKGAIVAF RGLALQLV RGIRVNG+APGPIWTPLI
Sbjct  226   GSSIINTTSVNAYKGNSKLLDYTSTKGAIVAFIRGLALQLVSRGIRVNGIAPGPIWTPLI  285

Query  405   PASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             PASF EEE A FGKQVPM RAGQ  EVAPSYVFLA    SSYITGQ+LHPNG  +++
Sbjct  286   PASFKEEEVANFGKQVPMHRAGQLTEVAPSYVFLACNHCSSYITGQVLHPNGKFVLH  342



>ref|XP_004302437.1| PREDICTED: glucose and ribitol dehydrogenase-like [Fragaria vesca 
subsp. vesca]
Length=293

 Score =   473 bits (1217),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 220/292 (75%), Positives = 256/292 (88%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MASDG + PPQKQ++QPGKEH MDP PQ+S+ DY PSNKLQGKVALVTGGDSGIGR+VC 
Sbjct  1     MASDGRKMPPQKQEAQPGKEHAMDPNPQFSNPDYMPSNKLQGKVALVTGGDSGIGRSVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGATVAFTYVK QEDKDAR+TL+++K+ K   AK+P+A+ ADLGFDENC++VVE V
Sbjct  61    YFAQEGATVAFTYVKGQEDKDARETLEMIKQVKTSDAKDPIAVAADLGFDENCKRVVEEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V +Y RIDILVNNAAEQ+KT S+++IDE R+ERVFRTNIF+ FF+ +HALKHMKEGS+II
Sbjct  121   VKAYNRIDILVNNAAEQYKTGSVQDIDEARIERVFRTNIFAYFFMARHALKHMKEGSNII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
              TTSV AYKG+PKLLDY+ATKGAIVAF RGLAL+LV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   CTTSVVAYKGNPKLLDYTATKGAIVAFVRGLALELVNKGIRVNGVAPGPIWTPLIPASFD  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             EEE A+FG +VPM+R GQ  EVAP+YVFLAS   SSYITGQ++HPNGG IVN
Sbjct  241   EEETAKFGSEVPMQRPGQPCEVAPAYVFLASNAFSSYITGQVIHPNGGVIVN  292



>ref|XP_008388967.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Malus 
domestica]
Length=358

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 226/293 (77%), Positives = 252/293 (86%), Gaps = 1/293 (0%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G  QFPPQKQ +QPGKEH MDP PQ+++ DY PSNKLQGKVALVTGGDSGIGR+VC
Sbjct  1     MASGGKQQFPPQKQGAQPGKEHAMDPTPQFTNPDYXPSNKLQGKVALVTGGDSGIGRSVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               FA EGATVAFTY K QEDKDA+DT+Q++K+AK   AKEPMA+ ADLG+DENC+ VVE 
Sbjct  61    HLFAQEGATVAFTYXKEQEDKDAQDTIQMIKQAKTSDAKEPMALAADLGYDENCKNVVEK  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             V ++YGRIDILVNNAAEQ+K  S+EEIDE RLERVFRTNIFS FF  +HALKHMKEGSSI
Sbjct  121   VADAYGRIDILVNNAAEQYKASSVEEIDEPRLERVFRTNIFSYFFTTRHALKHMKEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             I TTSV AYKG+ KLLDY++TKGAIVAF RGLALQLV RGIRVNGVAPGPIWTPLIPASF
Sbjct  181   ICTTSVNAYKGNAKLLDYTSTKGAIVAFIRGLALQLVNRGIRVNGVAPGPIWTPLIPASF  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              EEE ++FG QVPM+RAGQ  EV PSYVFLAS   SSY TGQ+LHPNGGT+VN
Sbjct  241   DEEEVSQFGNQVPMQRAGQPCEVGPSYVFLASNAFSSYYTGQVLHPNGGTVVN  293



>ref|XP_010105843.1| Glucose and ribitol dehydrogenase-1-like protein [Morus notabilis]
 gb|EXC06577.1| Glucose and ribitol dehydrogenase-1-like protein [Morus notabilis]
Length=368

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 224/295 (76%), Positives = 261/295 (88%), Gaps = 2/295 (1%)
 Frame = -1

Query  1119  VRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRA  940
             +R MASDG QFPPQ+Q++QPGKEHVM+P PQ++S  YKPS+KL+ KVALVTGGDSGIGRA
Sbjct  40    LRRMASDGQQFPPQRQETQPGKEHVMEPTPQFTSPHYKPSDKLREKVALVTGGDSGIGRA  99

Query  939   VCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVV  760
             VC CFALEGATVAFTYVK  EDKDA+DTL+IL+++K   AK+P+ I ADLGFD NC+KVV
Sbjct  100   VCHCFALEGATVAFTYVKGHEDKDAQDTLRILRESKTPEAKDPIGIAADLGFDINCKKVV  159

Query  759   ESVVNSYGRIDILVNNAAEQHKTWS--IEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
             + VV  +GRIDILVNNAAEQ+KT +  ++EI E RLERVFRTNIF+ FF+VKHALKHM++
Sbjct  160   DEVVEIFGRIDILVNNAAEQYKTTTPTLDEITEDRLERVFRTNIFAHFFMVKHALKHMRQ  219

Query  585   GSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLI  406
             GSSIINTT++ AYKGSP+LLDY+ATKGAIVAFTRGLAL LVERGIRVNGVAPGP+WTPLI
Sbjct  220   GSSIINTTTIVAYKGSPELLDYTATKGAIVAFTRGLALHLVERGIRVNGVAPGPVWTPLI  279

Query  405   PASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTI  241
             PASFSEEE A+FG +VPMKRAGQ IEVAPSYVFLA    SSYITGQ++HPNGG +
Sbjct  280   PASFSEEETAKFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYITGQVIHPNGGLL  334



>ref|XP_007144740.1| hypothetical protein PHAVU_007G180800g [Phaseolus vulgaris]
 gb|ESW16734.1| hypothetical protein PHAVU_007G180800g [Phaseolus vulgaris]
Length=354

 Score =   474 bits (1219),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 221/297 (74%), Positives = 260/297 (88%), Gaps = 0/297 (0%)
 Frame = -1

Query  1122  FVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGR  943
             F  +MAS   +FPPQ+Q +QPGKEH+M P PQ++S DYKPSNKLQGK+AL+TGGDSGIGR
Sbjct  58    FFPTMASAEQKFPPQQQKTQPGKEHLMTPPPQFTSPDYKPSNKLQGKIALITGGDSGIGR  117

Query  942   AVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKV  763
             AV   F+LEGATVAFT+VK  E+KDA++TL+I+K+AK   AK+PMAIP DLG+DENC+KV
Sbjct  118   AVSNLFSLEGATVAFTFVKGSEEKDAKETLEIIKRAKTAEAKDPMAIPTDLGYDENCKKV  177

Query  762   VESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEG  583
             VE VV+++GRIDIL+NNAAEQ++  ++E+IDE RLERVFRTNIF+ FF+ +HALKHMKEG
Sbjct  178   VEEVVSAFGRIDILINNAAEQYECGTVEDIDEPRLERVFRTNIFAYFFMARHALKHMKEG  237

Query  582   SSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIP  403
             S+IINTTSV AYKG  KLLDY++TKGAIVAFTRGL+LQLV +GIRVNGVAPGPIWTPLIP
Sbjct  238   SNIINTTSVNAYKGHAKLLDYTSTKGAIVAFTRGLSLQLVSKGIRVNGVAPGPIWTPLIP  297

Query  402   ASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             ASF EEE AEFG  VPMKRAG  IEVAPS+VFLAS   SSYITGQ+LHPNGGTIVNG
Sbjct  298   ASFKEEETAEFGGHVPMKRAGHPIEVAPSFVFLASNSCSSYITGQVLHPNGGTIVNG  354



>gb|KFK35607.1| hypothetical protein AALP_AA4G013100 [Arabis alpina]
Length=288

 Score =   471 bits (1211),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/282 (78%), Positives = 254/282 (90%), Gaps = 0/282 (0%)
 Frame = -1

Query  1080  QKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVA  901
             +KQ +QPGKEHVMDP PQ+SS DYKPS+KL+GKVAL+TGGDSGIGRAV  CFALEGATVA
Sbjct  6     EKQHAQPGKEHVMDPTPQFSSPDYKPSDKLRGKVALITGGDSGIGRAVGYCFALEGATVA  65

Query  900   FTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDIL  721
             FTYVK QE+KDA++TLQ+LK+AKV  AK+P+AIP DLGFDENC++VV+ VVN++GRID+L
Sbjct  66    FTYVKGQEEKDAQETLQMLKEAKVSEAKDPIAIPTDLGFDENCKRVVDEVVNAFGRIDVL  125

Query  720   VNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKG  541
             +NNAAEQ+++ S+EEIDE+RLERVFRTNIFS FFL +HALKHMKEGSSIINTTSV AYKG
Sbjct  126   INNAAEQYESSSVEEIDESRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKG  185

Query  540   SPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQ  361
             +  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPASF+EE+   FG +
Sbjct  186   NASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSE  245

Query  360   VPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG IVN
Sbjct  246   VPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAIVN  287



>ref|XP_009349395.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Pyrus 
x bretschneideri]
Length=294

 Score =   471 bits (1211),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 224/293 (76%), Positives = 252/293 (86%), Gaps = 1/293 (0%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G  QFPPQKQ +QPGKEH MDP PQ+++ DYKPSNKLQGKVALVTGGDSGIGR+VC
Sbjct  1     MASGGKQQFPPQKQGAQPGKEHAMDPTPQFTNPDYKPSNKLQGKVALVTGGDSGIGRSVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               F+ EGATVAFTYVK QEDKDA+DT+Q++K+AK   AKEPMA+ ADLG+DENC+ VVE 
Sbjct  61    HLFSQEGATVAFTYVKEQEDKDAQDTIQMIKQAKTSDAKEPMALAADLGYDENCKNVVEK  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             V  +YGRIDILVNNAAEQ+K  S+EEIDE RLERVFRTNIFS FF  +HALKHMKEGSSI
Sbjct  121   VAAAYGRIDILVNNAAEQYKASSVEEIDEPRLERVFRTNIFSYFFTTRHALKHMKEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             I TTSV AYKG+ +LLDY++TKGAIVAF RGLALQLV RGIRVNGVAPGP+WTPLIPASF
Sbjct  181   ICTTSVNAYKGNAELLDYTSTKGAIVAFIRGLALQLVNRGIRVNGVAPGPVWTPLIPASF  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              E E ++FG QVPM+RAGQ  EV PSYVFLAS   SSY TGQ+LHPNGGT+VN
Sbjct  241   DEVEVSQFGNQVPMQRAGQPCEVGPSYVFLASNAFSSYYTGQVLHPNGGTVVN  293



>ref|NP_001242815.1| uncharacterized protein LOC100807147 [Glycine max]
 gb|ACU18271.1| unknown [Glycine max]
Length=293

 Score =   469 bits (1208),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 227/293 (77%), Positives = 261/293 (89%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G +FPPQ+Q +QPGKEH M+P PQ++S DYKPSNKLQGK+ALVTGGDSGIGRAVC 
Sbjct  1     MASGGKKFPPQQQQTQPGKEHAMNPVPQFASPDYKPSNKLQGKIALVTGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATV FTYVK  EDKDARDTL+++K+AK   AK+PMA+PADLG+DENC++VV+ V
Sbjct  61    LFALEGATVGFTYVKGHEDKDARDTLEMIKRAKTSDAKDPMAVPADLGYDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YG IDILVNNAAEQ++  ++E+IDE RLERVFRTNIFS FF+ +HALKHMKEGSSII
Sbjct  121   VNAYGCIDILVNNAAEQYECGTVEDIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY++TKGAIVA+TRGLALQLV +GIRVNGVAPGPIWTPLIP+SF 
Sbjct  181   NTTSVNAYKGNAKLLDYTSTKGAIVAYTRGLALQLVSKGIRVNGVAPGPIWTPLIPSSFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG QVPMKRAGQ IEVAPSYVFLA    SSYITGQ+LHPNGGT+VNG
Sbjct  241   EEETAQFGAQVPMKRAGQPIEVAPSYVFLACNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_006392477.1| hypothetical protein EUTSA_v10023627mg [Eutrema salsugineum]
 gb|ESQ29763.1| hypothetical protein EUTSA_v10023627mg [Eutrema salsugineum]
Length=289

 Score =   469 bits (1208),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 223/283 (79%), Positives = 251/283 (89%), Gaps = 1/283 (0%)
 Frame = -1

Query  1080  QKQDS-QPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATV  904
             QKQ   QPGKEHVMDP PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRAV  CFALEGATV
Sbjct  6     QKQGGVQPGKEHVMDPTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVSYCFALEGATV  65

Query  903   AFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDI  724
             AFTYVK QEDKDA++TLQ+LK+AK   AKEPMAIP DLGFDENC++VV+ VVN++GRID+
Sbjct  66    AFTYVKGQEDKDAQETLQMLKEAKTSEAKEPMAIPTDLGFDENCKRVVDEVVNAFGRIDV  125

Query  723   LVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYK  544
             L+NNAAEQ+++ SIEEIDE RLERVFRTNIFS FFL +HALKHMKEGSSIINTTSV AYK
Sbjct  126   LINNAAEQYESSSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYK  185

Query  543   GSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGK  364
             G+  LLDY+ATKGAIVAFTRGL+LQL E+GIRVNGVAPGPIWTPLIPASF+EE+   FG 
Sbjct  186   GNASLLDYTATKGAIVAFTRGLSLQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKSFGS  245

Query  363   QVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             +VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG +VN
Sbjct  246   EVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  288



>ref|XP_010043092.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Eucalyptus 
grandis]
 gb|KCW85151.1| hypothetical protein EUGRSUZ_B01992 [Eucalyptus grandis]
Length=295

 Score =   469 bits (1207),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 225/295 (76%), Positives = 254/295 (86%), Gaps = 2/295 (1%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G  QFPPQ+Q+ QPGKEH M+P PQ++S DYKPS KLQGKVALVTGGDSGIGRAVC
Sbjct  1     MASGGGEQFPPQRQERQPGKEHEMEPTPQFTSHDYKPSGKLQGKVALVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPA-DLGFDENCRKVVE  757
              C+  EGATVAFT+VK +E KDA D LQIL +AK    K+P+AI   DLG+DE C+KVV+
Sbjct  61    HCYVQEGATVAFTFVKDREHKDANDLLQILMQAKASNVKDPIAIAVPDLGYDETCKKVVD  120

Query  756   SVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS  577
              VVNS+GRIDILVNNAAEQ+K  +IEEIDE RLERVFRTNIF+QFF+ +HALKHMKEGS+
Sbjct  121   EVVNSFGRIDILVNNAAEQYKCSTIEEIDEARLERVFRTNIFAQFFITRHALKHMKEGSA  180

Query  576   IINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPAS  397
             IINTTS+ AYKG+P+LLDY+ATKGAIVAFTRGLALQLV +GIRVNGVAPGPIWTPLIPAS
Sbjct  181   IINTTSIVAYKGNPELLDYTATKGAIVAFTRGLALQLVSKGIRVNGVAPGPIWTPLIPAS  240

Query  396   FSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FSEEE  +FG +VPMKRAGQ IEVAP YVFLA    SSYITGQ+LHPNGG IVNG
Sbjct  241   FSEEEVKKFGSEVPMKRAGQPIEVAPCYVFLACNHCSSYITGQVLHPNGGAIVNG  295



>emb|CAN77025.1| hypothetical protein VITISV_015336 [Vitis vinifera]
Length=294

 Score =   469 bits (1206),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 220/293 (75%), Positives = 259/293 (88%), Gaps = 1/293 (0%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G  QFPPQ+Q+ QPGKEHVM P PQ+ + DY+P++KLQGKVALVTGGDSGIGRAVC
Sbjct  1     MASGGGQQFPPQRQERQPGKEHVMTPTPQFINPDYRPAHKLQGKVALVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               +ALEGATVAFTYVK+QED+DA++TLQ+++KAK + AKEP+AI ADLG+D+NCR+VVE 
Sbjct  61    YLYALEGATVAFTYVKAQEDRDAQETLQMIRKAKRDDAKEPIAIAADLGYDDNCRRVVEE  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             VV +YGRIDILVNNAAEQ+K+ S+EEIDE RLERVFRTNIFS F L +HALK+M+EGSSI
Sbjct  121   VVAAYGRIDILVNNAAEQYKSCSVEEIDEERLERVFRTNIFSYFLLTRHALKYMQEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             INTTS+ AYKG+ KL++Y++TKGAIVAF R LALQL  +GIRVNGVAPGPIWTPLIPASF
Sbjct  181   INTTSINAYKGNNKLIEYTSTKGAIVAFIRSLALQLAPKGIRVNGVAPGPIWTPLIPASF  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             SEEECA FG +VPM RAGQ  EVAPSYVFLAS  +SSYI+GQ+LHPNGG +VN
Sbjct  241   SEEECARFGSEVPMGRAGQPCEVAPSYVFLASHADSSYISGQVLHPNGGVVVN  293



>ref|XP_010480201.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Camelina 
sativa]
Length=337

 Score =   469 bits (1207),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 223/296 (75%), Positives = 258/296 (87%), Gaps = 5/296 (2%)
 Frame = -1

Query  1119  VRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRA  940
             VR+MAS+      Q+Q +QPGKEHVM+  PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRA
Sbjct  47    VRAMASE-----KQRQHAQPGKEHVMETTPQFSSSDYQPSNKLRGKVALITGGDSGIGRA  101

Query  939   VCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVV  760
             V  CFALEGATVAFTYVK QE+KDA++TLQ+LKKAK   AKEP+AIP DLGFDENC++VV
Sbjct  102   VGYCFALEGATVAFTYVKGQEEKDAQETLQMLKKAKTSDAKEPIAIPTDLGFDENCKRVV  161

Query  759   ESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS  580
             + VVN++GRID+L+NNAAEQ+++ SIEEIDE RLERVFRTNIFS FFL ++ALKHMKEGS
Sbjct  162   DEVVNAFGRIDVLINNAAEQYESSSIEEIDEPRLERVFRTNIFSYFFLTRYALKHMKEGS  221

Query  579   SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPA  400
             SIINTTSV AYKG+  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPA
Sbjct  222   SIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPA  281

Query  399   SFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             SF+EE+   FG +VPMKRAGQ +EVAPSYVFLA    SSY TGQ+LHPNGG +VN 
Sbjct  282   SFNEEKIKNFGSEVPMKRAGQPVEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  337



>ref|XP_010511227.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Camelina 
sativa]
 ref|XP_010414929.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Camelina 
sativa]
Length=337

 Score =   469 bits (1207),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 223/296 (75%), Positives = 258/296 (87%), Gaps = 5/296 (2%)
 Frame = -1

Query  1119  VRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRA  940
             VR+MAS+      Q+Q +QPGKEHVM+  PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRA
Sbjct  47    VRAMASE-----KQRQHAQPGKEHVMETTPQFSSSDYQPSNKLRGKVALITGGDSGIGRA  101

Query  939   VCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVV  760
             V  CFALEGATVAFTYVK QE+KDA++TLQ+LKKAK   AKEP+AIP DLGFDENC++VV
Sbjct  102   VGYCFALEGATVAFTYVKGQEEKDAQETLQMLKKAKTSDAKEPIAIPTDLGFDENCKRVV  161

Query  759   ESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS  580
             + VVN++GRID+L+NNAAEQ+++ SIEEIDE RLERVFRTNIFS FFL +HALK+MKEGS
Sbjct  162   DEVVNAFGRIDVLINNAAEQYESSSIEEIDEPRLERVFRTNIFSYFFLTRHALKYMKEGS  221

Query  579   SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPA  400
             SIINTTSV AYKG+  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPA
Sbjct  222   SIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPA  281

Query  399   SFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             SF+EE+   FG +VPMKRAGQ +EVAPSYVFLA    SSY TGQ+LHPNGG +VN 
Sbjct  282   SFNEEKIKNFGSEVPMKRAGQPVEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  337



>sp|Q5KTS5.1|GRDH_DAUCA RecName: Full=Glucose and ribitol dehydrogenase; AltName: Full=Carrot 
ABA-induced in somatic embryos 5 protein [Daucus carota]
 dbj|BAD86648.1| glucose and ribitol dehydrogenase protein [Daucus carota]
Length=291

 Score =   467 bits (1202),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 216/293 (74%), Positives = 260/293 (89%), Gaps = 2/293 (1%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G QFPPQKQ+SQPGKEH+MDP+PQ++S  YKP+NKLQGKVALVTGGDSGIGR+VC 
Sbjct  1     MAS-GGQFPPQKQESQPGKEHLMDPSPQHASPHYKPANKLQGKVALVTGGDSGIGRSVCY  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATVAFT+VK  EDKDA +TL++L+KAK   AK+P+AI ADLGFD+NC+KVV+ V
Sbjct  60    HFALEGATVAFTFVKGHEDKDANETLELLRKAKSSDAKDPIAIAADLGFDDNCKKVVDQV  119

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN++G ID+LVNNAAEQ+K  ++E+IDE RLERVFRTNIF+ FF+ +HALKHM+EGS+II
Sbjct  120   VNAFGSIDVLVNNAAEQYKASTVEDIDEERLERVFRTNIFAYFFMARHALKHMREGSTII  179

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTS+ AYKG+ KLLDY+ATKGAIVAFTRGL+LQL+ +GIRVNGVAPGP+WTPLIP+SF 
Sbjct  180   NTTSINAYKGNAKLLDYTATKGAIVAFTRGLSLQLISKGIRVNGVAPGPVWTPLIPSSFD  239

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE  +FG +VPMKRAGQ  E+A +YVFLASC +SSY +GQ+LHPNGG IVNG
Sbjct  240   EEEVKQFGSEVPMKRAGQPYEIATAYVFLASC-DSSYYSGQVLHPNGGAIVNG  291



>ref|NP_564670.2| glucose and ribitol dehydrogenase homolog 1 [Arabidopsis thaliana]
 gb|AEE33158.1| aldehyde reductase [Arabidopsis thaliana]
Length=335

 Score =   469 bits (1206),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 237/357 (66%), Positives = 278/357 (78%), Gaps = 33/357 (9%)
 Frame = -1

Query  1275  MFSRCFTSSRALAVtlrhlppppttahllpPFSSTTFSLKTNGNSTV-------RLS--V  1123
             +  R FTSSR L+                   S+ TFS     N+T        RLS  V
Sbjct  3     VLCRVFTSSRVLS-------------------SNVTFSFSQIPNNTKKPLLEKRRLSPRV  43

Query  1122  FVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGR  943
              +R+MAS+      QKQ +QPGKEHVM+ +PQ+SS DY+PSNKL+GKVAL+TGGDSGIGR
Sbjct  44    CLRAMASE-----KQKQHAQPGKEHVMESSPQFSSSDYQPSNKLRGKVALITGGDSGIGR  98

Query  942   AVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKV  763
             AV  CFA EGATVAFTYVK QE+KDA++TLQ+LK+ K   +KEP+AIP DLGFDENC++V
Sbjct  99    AVGYCFASEGATVAFTYVKGQEEKDAQETLQMLKEVKTSDSKEPIAIPTDLGFDENCKRV  158

Query  762   VESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEG  583
             V+ VVN++GRID+L+NNAAEQ+++ +IEEIDE RLERVFRTNIFS FFL +HALKHMKEG
Sbjct  159   VDEVVNAFGRIDVLINNAAEQYESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEG  218

Query  582   SSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIP  403
             SSIINTTSV AYKG+  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIP
Sbjct  219   SSIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIP  278

Query  402   ASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             ASF+EE+   FG +VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG +VN 
Sbjct  279   ASFNEEKIKNFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  335



>ref|XP_002284803.3| PREDICTED: glucose and ribitol dehydrogenase-like [Vitis vinifera]
Length=294

 Score =   467 bits (1202),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/293 (75%), Positives = 258/293 (88%), Gaps = 1/293 (0%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G  QFPPQ+Q+ QPGKEHVM P PQ+ + DY+P++KLQGKVALVTGGDSGIGRAVC
Sbjct  1     MASGGGQQFPPQRQERQPGKEHVMTPTPQFINPDYRPAHKLQGKVALVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               +ALEGATVAFTYVK QED+DA++TLQ+++KAK + AKEP+AI ADLG+D+NCR+VVE 
Sbjct  61    YLYALEGATVAFTYVKVQEDRDAQETLQMIRKAKRDDAKEPIAIAADLGYDDNCRRVVEE  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             VV +YGRIDILVNNAAEQ+K+ S+EEIDE RLERVFRTNIFS F L +HALK+M+EGSSI
Sbjct  121   VVAAYGRIDILVNNAAEQYKSCSVEEIDEERLERVFRTNIFSYFLLTRHALKYMQEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             INTTS+ AYKG+ KL++Y++TKGAIVAF R LALQL  +GIRVNGVAPGPIWTPLIPASF
Sbjct  181   INTTSINAYKGNNKLIEYTSTKGAIVAFIRSLALQLAPKGIRVNGVAPGPIWTPLIPASF  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             SEEECA FG +VPM RAGQ  EVAPSYVFLAS  +SSYI+GQ+LHPNGG +VN
Sbjct  241   SEEECARFGSEVPMGRAGQPCEVAPSYVFLASHADSSYISGQVLHPNGGVVVN  293



>ref|XP_006301375.1| hypothetical protein CARUB_v10021787mg [Capsella rubella]
 gb|EOA34273.1| hypothetical protein CARUB_v10021787mg [Capsella rubella]
Length=336

 Score =   469 bits (1206),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 222/296 (75%), Positives = 258/296 (87%), Gaps = 5/296 (2%)
 Frame = -1

Query  1119  VRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRA  940
             VR+MA++      Q+Q +QPGKEHVM+  PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRA
Sbjct  46    VRAMATE-----KQRQHAQPGKEHVMETTPQFSSSDYQPSNKLRGKVALITGGDSGIGRA  100

Query  939   VCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVV  760
             V  C+ALEGATVAFTYVK QE+KDA++TLQ+LKKAK   AKEP+AIP DLGFDENC++VV
Sbjct  101   VGYCYALEGATVAFTYVKGQEEKDAQETLQMLKKAKTSDAKEPIAIPTDLGFDENCKRVV  160

Query  759   ESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS  580
             + VVN++GRID+L+NNAAEQ+++ +IEEIDE RLERVFRTNIFS FFL +HALKHMKEGS
Sbjct  161   DEVVNAFGRIDVLINNAAEQYESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGS  220

Query  579   SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPA  400
             SIINTTSV AYKG+  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPA
Sbjct  221   SIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPA  280

Query  399   SFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             SF+EE+   FG +VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG +VN 
Sbjct  281   SFNEEKIKNFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  336



>ref|XP_004148135.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
sativus]
 ref|XP_004160870.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
sativus]
Length=295

 Score =   467 bits (1201),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/279 (78%), Positives = 247/279 (89%), Gaps = 1/279 (0%)
 Frame = -1

Query  1068  SQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYV  889
             +QPGK+H MDP PQ++S DY P+NKLQGKVALVTGGDSGIGRAVC CFALEGA VAFTYV
Sbjct  16    AQPGKQHAMDPTPQFTSPDYNPANKLQGKVALVTGGDSGIGRAVCYCFALEGAIVAFTYV  75

Query  888   KSQEDKDARDTLQILKKA-KVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNN  712
             K QEDKDA+DT++++KKA K    K+P+AIPADLGFDENC++VV+ VV +YGRIDIL+NN
Sbjct  76    KGQEDKDAKDTIEMIKKATKSSAVKDPLAIPADLGFDENCKRVVDEVVKAYGRIDILINN  135

Query  711   AAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPK  532
             AAEQ+K+ S+E+IDE RL RVFRTNIFS FF  +HALKHMKEGSSIINTTSV AYKG+ K
Sbjct  136   AAEQYKSSSVEDIDEERLLRVFRTNIFSYFFTTRHALKHMKEGSSIINTTSVNAYKGNAK  195

Query  531   LLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPM  352
             LLDY++TKGAIVAFTRGLALQL  +GIRVNGVAPGPIWTPLIPASF EEE A FG QVPM
Sbjct  196   LLDYTSTKGAIVAFTRGLALQLANKGIRVNGVAPGPIWTPLIPASFDEEETASFGSQVPM  255

Query  351   KRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             KRAGQ IEVAPSYVFLA   +SSYITGQ+LHPNGGT+VN
Sbjct  256   KRAGQPIEVAPSYVFLACNADSSYITGQVLHPNGGTVVN  294



>gb|KHN16133.1| Glucose and ribitol dehydrogenase like 1 [Glycine soja]
Length=293

 Score =   466 bits (1200),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 226/293 (77%), Positives = 260/293 (89%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQ+Q +QPGKEH M+P PQ++S DYKPSNKLQGK+ALVTGGDSGIGRAVC 
Sbjct  1     MASGEKKFPPQQQQTQPGKEHAMNPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATV FTYVK  EDKDARDTL+++K+AK   AK+PMA+PADLG+DENC++VV+ V
Sbjct  61    LFALEGATVGFTYVKGHEDKDARDTLEMIKRAKTSDAKDPMAVPADLGYDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YG IDILVNNAAEQ++  ++E+IDE RLERVFRTNIFS FF+ +HALKHMKEGSSII
Sbjct  121   VNAYGCIDILVNNAAEQYECGTVEDIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ KLLDY++TKGAIVA+TRGLALQLV +GIRVNGVAPGPIWTPLIP+SF 
Sbjct  181   NTTSVNAYKGNAKLLDYTSTKGAIVAYTRGLALQLVSKGIRVNGVAPGPIWTPLIPSSFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG QVPMKRAGQ IEVAPSYVFLA    SSYITGQ+LHPNGGT+VNG
Sbjct  241   EEETAQFGAQVPMKRAGQPIEVAPSYVFLACNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_004494625.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cicer 
arietinum]
Length=293

 Score =   466 bits (1200),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 217/292 (74%), Positives = 251/292 (86%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQKQ++QPGKEH M+P PQ++  DYKPSNKLQGK+A+VTGGDSGIGR+VC 
Sbjct  1     MASGEQKFPPQKQETQPGKEHAMNPTPQFTCPDYKPSNKLQGKIAVVTGGDSGIGRSVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATV FTYVK  EDKDARDTL ++K AK   AK+PMAIPADLGFDENC++VV+ +
Sbjct  61    LFALEGATVIFTYVKGHEDKDARDTLDMIKMAKTADAKDPMAIPADLGFDENCKRVVDEI  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +N+YGRIDILVNNAAEQ++  SIEEIDE RL RVF+TN FS  F+ +HALKHMKEGSSII
Sbjct  121   INTYGRIDILVNNAAEQYECGSIEEIDEPRLIRVFQTNFFSYVFMTRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG P LLDY++TKGAIVAFTR L+LQLV +GIRVNGVAPGPIWTPLIP+SF 
Sbjct  181   NTTSVNAYKGHPTLLDYTSTKGAIVAFTRALSLQLVSKGIRVNGVAPGPIWTPLIPSSFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             E++  +FG  VPMKRAGQ +EVAPS+VFLA    SSYITGQ+LHPNGGTIVN
Sbjct  241   EDKTTQFGSDVPMKRAGQPVEVAPSFVFLACNQCSSYITGQVLHPNGGTIVN  292



>ref|XP_003521711.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Glycine 
max]
Length=294

 Score =   465 bits (1196),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 216/290 (74%), Positives = 251/290 (87%), Gaps = 0/290 (0%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             S  N FPPQKQD+QPGKE++M+P PQY+S  YKPSNKLQGK+A+VTGGDSGIGRAVC  F
Sbjct  4     SSENNFPPQKQDTQPGKEYLMNPPPQYNSSQYKPSNKLQGKIAVVTGGDSGIGRAVCNLF  63

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             +LEGATV FTYVK QED+DA DTL+I+KKAK E AK+P+AIP D+G++ENC+KVV+ V+N
Sbjct  64    SLEGATVIFTYVKGQEDRDASDTLEIIKKAKTEDAKDPLAIPVDVGYEENCKKVVDEVIN  123

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
             +YGRIDILVNNAAEQ+++ S+E+ID+ RLERVFRTNIFS FF+ KHALKHMKEGSSIINT
Sbjct  124   AYGRIDILVNNAAEQYESDSLEDIDDARLERVFRTNIFSHFFMTKHALKHMKEGSSIINT  183

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
             TSV AY+G   L+DY++TKGAIV FTR LALQLV +GIRVNGVAPGPIWTPLI A+ +EE
Sbjct  184   TSVNAYQGDGTLVDYTSTKGAIVGFTRALALQLVSKGIRVNGVAPGPIWTPLIVATMNEE  243

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
                 FG  VPMKRAGQ IEVAPSYVFLAS   SSYITGQ+LHPNGG IVN
Sbjct  244   TIVRFGSDVPMKRAGQPIEVAPSYVFLASNICSSYITGQVLHPNGGIIVN  293



>ref|NP_001238285.1| seed maturation protein PM34 [Glycine max]
 gb|AAF89645.1|AF169018_1 seed maturation protein PM34 [Glycine max]
Length=293

 Score =   464 bits (1195),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 227/293 (77%), Positives = 259/293 (88%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQ+Q +QPGKEH M P PQ++S DYKPSNKLQGK+ALVTGGDSGIGRAVC 
Sbjct  1     MASGEQKFPPQQQQTQPGKEHAMTPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATVAFTYVK  EDKDARDTL+++K+AK   AK+PMAI +DLG+DENC++VV+ V
Sbjct  61    LFALEGATVAFTYVKGHEDKDARDTLEMIKRAKTSDAKDPMAIASDLGYDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V++YG IDILVNNAAEQ++  ++E+IDE RLERVFRTNIFS FF+ +HALKHMKEGSSII
Sbjct  121   VSAYGCIDILVNNAAEQYECGTVEDIDEPRLERVFRTNIFSYFFMARHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG  KLLDY++TKGAIVA+TRGLALQLV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVNAYKGHAKLLDYTSTKGAIVAYTRGLALQLVSKGIRVNGVAPGPIWTPLIPASFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG QVPMKRAGQ IEVAPSYVFLAS   SSYITGQ+LHPNGGT+VNG
Sbjct  241   EEETAQFGAQVPMKRAGQPIEVAPSYVFLASNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_008439102.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis 
melo]
Length=349

 Score =   466 bits (1199),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 266/316 (84%), Gaps = 3/316 (1%)
 Frame = -1

Query  1173  TTFSLKTNGNST-VRLSVFVRSMASDGNQFPPQKQDSQP-GKEHVMDPAPQYSSQDYKPS  1000
             T  S ++N NS+ V    +VRSMAS+G Q  P ++     GKEH MDP PQ++S DY P+
Sbjct  33    TGCSCRSNTNSSIVSRRCWVRSMASEGQQQFPPQKQQAQPGKEHAMDPTPQFTSPDYNPA  92

Query  999   NKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKA-KVEG  823
             NKLQGKVALVTGGDSGIGRAVC CFALEGATVAFTYVK QEDKDA+DT++++KKA K   
Sbjct  93    NKLQGKVALVTGGDSGIGRAVCYCFALEGATVAFTYVKGQEDKDAKDTIEMIKKATKSSA  152

Query  822   AKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFR  643
              K+P+AIPADLGFDENC++VV+ VV +YGRIDIL+NNAA Q+K+  +E+IDE RL RVFR
Sbjct  153   VKDPLAIPADLGFDENCKRVVDEVVKAYGRIDILINNAAVQYKSSFVEDIDEERLLRVFR  212

Query  642   TNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLV  463
             TNIFS FF  +HALKHMKEGSSIINTTSV AYKG+ KLLDY++TKGAIVAFTRGLALQL 
Sbjct  213   TNIFSYFFTTRHALKHMKEGSSIINTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQLA  272

Query  462   ERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESS  283
             ++GIRVNGVAPGPIWTPLIPASF EEE A FG QVPMKRAGQ IEVAPSYVFLA   +SS
Sbjct  273   DKGIRVNGVAPGPIWTPLIPASFEEEETASFGSQVPMKRAGQPIEVAPSYVFLACNADSS  332

Query  282   YITGQILHPNGGTIVN  235
             YITGQ+LHPNGGT+VN
Sbjct  333   YITGQVLHPNGGTVVN  348



>gb|KHN20212.1| Glucose and ribitol dehydrogenase [Glycine soja]
Length=293

 Score =   463 bits (1191),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 227/293 (77%), Positives = 258/293 (88%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQ+Q +QPGKEH M P PQ++S DYKPSNKLQGK+ALVTGGDSGIGRAVC 
Sbjct  1     MASGEQKFPPQQQQTQPGKEHAMTPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATVAFTYVK  EDKDARDTL+++K+AK   AK+PMAI +DLG+DENC++VV+ V
Sbjct  61    LFALEGATVAFTYVKGHEDKDARDTLEMIKRAKTSDAKDPMAIASDLGYDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V++YG IDILVNNAAEQ++  ++E+IDE RLERVFRTNIFS FF  +HALKHMKEGSSII
Sbjct  121   VSAYGCIDILVNNAAEQYECGTVEDIDEPRLERVFRTNIFSYFFTARHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG  KLLDY++TKGAIVA+TRGLALQLV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVNAYKGHAKLLDYTSTKGAIVAYTRGLALQLVSKGIRVNGVAPGPIWTPLIPASFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG QVPMKRAGQ IEVAPSYVFLAS   SSYITGQ+LHPNGGT+VNG
Sbjct  241   EEETAQFGAQVPMKRAGQPIEVAPSYVFLASNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_009119565.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Brassica 
rapa]
Length=289

 Score =   463 bits (1191),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 220/283 (78%), Positives = 250/283 (88%), Gaps = 1/283 (0%)
 Frame = -1

Query  1080  QKQDS-QPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATV  904
             QKQ   QPGKEHVMDP PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRAV  CFA+EGATV
Sbjct  6     QKQGGVQPGKEHVMDPTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVSYCFAVEGATV  65

Query  903   AFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDI  724
             AFTYVK QE+KDA++TLQ+LK+AK   AK+P+AIP DLGFDENC++VV+ VVN++GRID+
Sbjct  66    AFTYVKGQEEKDAQETLQMLKEAKTSEAKDPIAIPTDLGFDENCKRVVDEVVNAFGRIDV  125

Query  723   LVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYK  544
             L+NNAAEQ+++ SIEEIDE RLERVFRTNIFS FFL +HALKHMKEGSSIINTTSV AYK
Sbjct  126   LINNAAEQYESNSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYK  185

Query  543   GSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGK  364
             G   LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPASF+EE+   FG 
Sbjct  186   GHASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGT  245

Query  363   QVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             +VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG +VN
Sbjct  246   EVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  288



>ref|XP_004302438.1| PREDICTED: LOW QUALITY PROTEIN: glucose and ribitol dehydrogenase 
homolog 1-like [Fragaria vesca subsp. vesca]
Length=296

 Score =   462 bits (1190),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 223/295 (76%), Positives = 254/295 (86%), Gaps = 3/295 (1%)
 Frame = -1

Query  1110  MASDGNQ-FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS GNQ FPPQKQ SQPGKEH M+P PQYS+ DYKPSNK QGKVALVTGGDSGIGRAVC
Sbjct  1     MASGGNQNFPPQKQASQPGKEHAMNPNPQYSNPDYKPSNKFQGKVALVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
              CFA EGATVAFTYV+ QEDKDARDTL+++K+ K   +K+P+A+ ADLGFDENC++VV+ 
Sbjct  61    YCFAQEGATVAFTYVEGQEDKDARDTLEMIKQVKTPDSKDPIAVAADLGFDENCKRVVDE  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             V  +YG IDILVNNAAEQ+K  S+ EIDE RLERVFRTNIFS FF+ +HALKHMKEGSSI
Sbjct  121   VTKAYGCIDILVNNAAEQYKDSSVAEIDEPRLERVFRTNIFSYFFVTRHALKHMKEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPI--WTPLIPA  400
             I TTSV AYKG+ KLLDY++TKGAIVAF RGL+L+LV +GIRVNGVAPGPI  WTPLIPA
Sbjct  181   ICTTSVNAYKGNQKLLDYTSTKGAIVAFVRGLSLELVSKGIRVNGVAPGPIELWTPLIPA  240

Query  399   SFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             SF EEE A+FG +VPM+RAGQ  EVAPSYVFLAS   SSYITGQ++HPNGG +VN
Sbjct  241   SFDEEETAKFGSEVPMQRAGQPCEVAPSYVFLASNAFSSYITGQVIHPNGGVVVN  295



>ref|XP_008246486.1| PREDICTED: glucose and ribitol dehydrogenase-like [Prunus mume]
Length=294

 Score =   462 bits (1188),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 218/293 (74%), Positives = 249/293 (85%), Gaps = 1/293 (0%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G  QFPPQKQ++QPGKEH MDP PQ+++ DYKPSNKLQGK+ALVTGGDSGIGRAVC
Sbjct  1     MASGGKQQFPPQKQETQPGKEHAMDPTPQFTNPDYKPSNKLQGKIALVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               FA EGATVAFTYVK QEDKDARDT+Q++K+AK   AK+PMA+ AD+G+DENC+KVV+ 
Sbjct  61    HLFAQEGATVAFTYVKEQEDKDARDTMQMIKQAKTSDAKDPMALAADVGYDENCKKVVDE  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             V  +YG IDILVNNAAEQ+K  S+E+IDE RLERVFRTNIFS FF+ +H LKHMKEG SI
Sbjct  121   VAKAYGSIDILVNNAAEQYKASSVEDIDEPRLERVFRTNIFSYFFMTRHILKHMKEGGSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             I TTSV AYKG+ KLLDY+ATKGAIV+F RGLAL LV +GIRVNGVAPGPIWTPLIP+ F
Sbjct  181   ICTTSVVAYKGNDKLLDYTATKGAIVSFIRGLALHLVGKGIRVNGVAPGPIWTPLIPSCF  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              EEE A+FG +VPM+RAGQ  EV PSYVFLAS   SSY TGQ+ HPNGG IVN
Sbjct  241   DEEETAQFGSEVPMQRAGQPFEVGPSYVFLASNAFSSYYTGQVFHPNGGVIVN  293



>sp|Q9FZ42.1|GRDH1_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog 1 [Arabidopsis 
thaliana]
 gb|AAG00870.1|AC064840_1 Highly similar to dehydrogenase/reductases [Arabidopsis thaliana]
 gb|AAK50071.1|AF372931_1 At1g54870/F14C21_16 [Arabidopsis thaliana]
 gb|AAM70561.1| At1g54870/F14C21_16 [Arabidopsis thaliana]
Length=288

 Score =   462 bits (1188),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 216/282 (77%), Positives = 250/282 (89%), Gaps = 0/282 (0%)
 Frame = -1

Query  1080  QKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVA  901
             QKQ +QPGKEHVM+ +PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRAV  CFA EGATVA
Sbjct  6     QKQHAQPGKEHVMESSPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVGYCFASEGATVA  65

Query  900   FTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDIL  721
             FTYVK QE+KDA++TLQ+LK+ K   +KEP+AIP DLGFDENC++VV+ VVN++GRID+L
Sbjct  66    FTYVKGQEEKDAQETLQMLKEVKTSDSKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVL  125

Query  720   VNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKG  541
             +NNAAEQ+++ +IEEIDE RLERVFRTNIFS FFL +HALKHMKEGSSIINTTSV AYKG
Sbjct  126   INNAAEQYESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKG  185

Query  540   SPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQ  361
             +  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPASF+EE+   FG +
Sbjct  186   NASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSE  245

Query  360   VPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG +VN
Sbjct  246   VPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  287



>emb|CDY43488.1| BnaA01g21430D [Brassica napus]
Length=289

 Score =   461 bits (1187),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 219/283 (77%), Positives = 249/283 (88%), Gaps = 1/283 (0%)
 Frame = -1

Query  1080  QKQDS-QPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATV  904
             QKQ   QPGKEHVMDP PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRAV  CFA+EGATV
Sbjct  6     QKQGGVQPGKEHVMDPTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVSYCFAVEGATV  65

Query  903   AFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDI  724
             AFTYVK QE+KD ++TLQ+LK+AK   AK+P+AIP DLGFDENC++VV+ VVN++GRID+
Sbjct  66    AFTYVKGQEEKDTQETLQMLKEAKTSEAKDPIAIPTDLGFDENCKRVVDEVVNAFGRIDV  125

Query  723   LVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYK  544
             L+NNAAEQ+++ SIEEIDE RLERVFRTNIFS FFL +HALKHMKEGSSIINTTSV AYK
Sbjct  126   LINNAAEQYESNSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYK  185

Query  543   GSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGK  364
             G   LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPASF+EE+   FG 
Sbjct  186   GHASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGT  245

Query  363   QVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             +VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG +VN
Sbjct  246   EVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  288



>ref|XP_010674769.1| PREDICTED: glucose and ribitol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=293

 Score =   461 bits (1186),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 213/293 (73%), Positives = 252/293 (86%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA++G  FP Q+Q++QPGK+HVMDP P+ +   YKP+NKLQGKVALVTGGDSGIGRAVC 
Sbjct  1     MATNGRNFPAQRQETQPGKQHVMDPIPETARSQYKPANKLQGKVALVTGGDSGIGRAVCH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATVAFTYVK  EDKDA DTLQ++K AK  GAK+P+A+ ADLG+DE+C++VV+ V
Sbjct  61    HFALEGATVAFTYVKGHEDKDAVDTLQLIKSAKGTGAKDPIAVAADLGYDEHCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN++GRIDILVNN AEQ++  +IEE+ E +LERVFRTNIFS F + +HALKHM+EGSSII
Sbjct  121   VNAFGRIDILVNNCAEQYERSTIEEVSEQKLERVFRTNIFSHFLVTRHALKHMREGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTS+ A+KGSP LLDY++TKGAIVAFTRGLALQLV++GIRVN VAPGPIWTPLIPASF 
Sbjct  181   NTTSIVAFKGSPSLLDYTSTKGAIVAFTRGLALQLVQKGIRVNAVAPGPIWTPLIPASFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             E+E   FG +VPMKRAGQ  EVAPSYVFLA   +SSYITGQ +HPNGG IVNG
Sbjct  241   EDEVESFGSEVPMKRAGQPSEVAPSYVFLACNADSSYITGQTIHPNGGAIVNG  293



>ref|XP_010105844.1| Glucose and ribitol dehydrogenase-1-like protein [Morus notabilis]
 gb|EXC06578.1| Glucose and ribitol dehydrogenase-1-like protein [Morus notabilis]
Length=280

 Score =   460 bits (1183),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 222/292 (76%), Positives = 249/292 (85%), Gaps = 13/292 (4%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G QFPPQ+Q+ QPGKEHVMDP PQ+S+ +YKPSNKLQGK+ALVTGGDSGIGRAVC 
Sbjct  1     MASQGEQFPPQRQEKQPGKEHVMDPNPQFSAPEYKPSNKLQGKIALVTGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVK +EDKDA DTL+IL+++K   AK+PMA+ ADLG+D NC KVV+ V
Sbjct  61    CFALEGATVAFTYVKGEEDKDAMDTLRILRESKTPDAKDPMAVAADLGYDRNCMKVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YGRIDILVNNAAEQ+K  S+E+IDE RLERV             HALKHMKEGSSII
Sbjct  121   VNAYGRIDILVNNAAEQYKAASVEDIDEERLERV-------------HALKHMKEGSSII  167

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG+ K LDY+ATKGAIV++TRGLAL LV+RGIRVNGVAPGPIWTPL PASFS
Sbjct  168   NTTSVNAYKGNAKWLDYTATKGAIVSYTRGLALHLVDRGIRVNGVAPGPIWTPLTPASFS  227

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             EEE A+FG QVPMKRAGQ IEVAPS+VFLA    SSYITGQ+LHPNGGTIVN
Sbjct  228   EEETAKFGSQVPMKRAGQPIEVAPSFVFLACNHCSSYITGQVLHPNGGTIVN  279



>gb|ACU18973.1| unknown [Glycine max]
Length=293

 Score =   460 bits (1184),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 225/293 (77%), Positives = 257/293 (88%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQ+Q +QPGKEH M P PQ++S DYKPSNKLQGK+ALVTGGDSGIGRAVC 
Sbjct  1     MASGEQKFPPQQQQTQPGKEHAMTPVPQFTSPDYKPSNKLQGKIALVTGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FALEGATVAFTYVK  EDKDARDTL+++K+AK   AK+PMAI +DLG+DENC++VV+ V
Sbjct  61    LFALEGATVAFTYVKGHEDKDARDTLEMIKRAKTSDAKDPMAIASDLGYDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V++YG IDILVNNAAEQ++  ++ +IDE RLERVFRTNIFS FF+ +HALKHMKEGSSII
Sbjct  121   VSAYGCIDILVNNAAEQYECGTVGDIDEPRLERVFRTNIFSYFFMARHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG  KLLDY++TKGAIVA+TRG ALQLV +GIRVNGVAPGPIWTPLIPASF 
Sbjct  181   NTTSVNAYKGHAKLLDYTSTKGAIVAYTRGFALQLVSKGIRVNGVAPGPIWTPLIPASFK  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE A+FG QVPMKRAGQ IEVAPSYVFLAS   SSYITGQ+LHPNGGT+VNG
Sbjct  241   EEETAQFGAQVPMKRAGQPIEVAPSYVFLASNQCSSYITGQVLHPNGGTVVNG  293



>ref|XP_010418919.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like, 
partial [Camelina sativa]
Length=334

 Score =   461 bits (1186),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 220/290 (76%), Positives = 254/290 (88%), Gaps = 5/290 (2%)
 Frame = -1

Query  1119  VRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRA  940
             VR+MAS+      Q+Q +QPGKEHVM+  PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRA
Sbjct  47    VRAMASE-----KQRQHAQPGKEHVMETTPQFSSSDYQPSNKLRGKVALITGGDSGIGRA  101

Query  939   VCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVV  760
             V  CFALEGATVAFTYVK QE+KDA++TLQ+LKKAK   AKEP+AIP DLGFDENC++VV
Sbjct  102   VGYCFALEGATVAFTYVKGQEEKDAQETLQMLKKAKTSDAKEPIAIPTDLGFDENCKRVV  161

Query  759   ESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS  580
             + VVN++GRID+L+NNAAEQ+++ SIEEIDE RLERVFRTNIFS FFL +HALK+MKEGS
Sbjct  162   DEVVNAFGRIDVLINNAAEQYESSSIEEIDEPRLERVFRTNIFSYFFLTRHALKYMKEGS  221

Query  579   SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPA  400
             SIINTTSV AYKG+  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPA
Sbjct  222   SIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPA  281

Query  399   SFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNG  250
             SF+EE+   FG +VPMKRAGQ +EVAPSYVFLA    SSY TGQ+LHPNG
Sbjct  282   SFNEEKIKNFGSEVPMKRAGQPVEVAPSYVFLACNHCSSYFTGQVLHPNG  331



>emb|CDY17559.1| BnaC01g26830D [Brassica napus]
Length=287

 Score =   459 bits (1181),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 219/281 (78%), Positives = 248/281 (88%), Gaps = 1/281 (0%)
 Frame = -1

Query  1080  QKQDS-QPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATV  904
             QKQ   QPGKEHVMDP PQ+SS DY+PSNKL+GKVAL+TGGDSGIGRAV  CFALEGATV
Sbjct  6     QKQGGVQPGKEHVMDPTPQFSSSDYQPSNKLRGKVALITGGDSGIGRAVSYCFALEGATV  65

Query  903   AFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDI  724
             AFTYVK QE+KDA++TLQ+LK+AK   AK+P+AIP DLGFDENC++VV+ VVN++GRID+
Sbjct  66    AFTYVKGQEEKDAQETLQMLKEAKTSEAKDPIAIPTDLGFDENCKRVVDEVVNAFGRIDV  125

Query  723   LVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYK  544
             L+NNAAEQ+++ SIEEIDE RLERVFRTNIFS FFL +HALKHMKEGSSIINTTSV AYK
Sbjct  126   LINNAAEQYESNSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYK  185

Query  543   GSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGK  364
             G   LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPASF+EE+   FG 
Sbjct  186   GHASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGT  245

Query  363   QVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTI  241
             +VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNG +I
Sbjct  246   EVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGNSI  286



>gb|ACU23676.1| unknown [Glycine max]
Length=294

 Score =   459 bits (1180),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 213/290 (73%), Positives = 248/290 (86%), Gaps = 0/290 (0%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             S  N FPPQKQD+QPGKE++M+P PQY+S  YKPSNKLQGK+A+VTGGDSGIGRAVC  F
Sbjct  4     SSENNFPPQKQDTQPGKEYLMNPPPQYNSSQYKPSNKLQGKIAVVTGGDSGIGRAVCNLF  63

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             +LEGATV FTYVK QED+D  DTL+I+KKAK E AK+P+AIP D+G++ENC+KVV+ V+N
Sbjct  64    SLEGATVIFTYVKGQEDRDVSDTLEIIKKAKTEDAKDPLAIPVDVGYEENCKKVVDEVIN  123

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
             +YGRIDILVNNAAEQ+++ S+E+ID+ RLERVFRTNIFS FF+ KHALKHMKEGSSIINT
Sbjct  124   AYGRIDILVNNAAEQYESDSLEDIDDARLERVFRTNIFSHFFMTKHALKHMKEGSSIINT  183

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
             TSV AY+G   L+DY++TKGAIV FTR LALQLV +GIRVNGVAPGPIWTPLI A+ +EE
Sbjct  184   TSVNAYQGDGTLVDYTSTKGAIVGFTRALALQLVSKGIRVNGVAPGPIWTPLIVATMNEE  243

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
                 FG  VPMKRAGQ IEVAPSYVFL S   SSYIT Q+LHPNGG IVN
Sbjct  244   TIVRFGSDVPMKRAGQPIEVAPSYVFLGSNICSSYITDQVLHPNGGIIVN  293



>ref|XP_007147059.1| hypothetical protein PHAVU_006G092800g [Phaseolus vulgaris]
 gb|ESW19053.1| hypothetical protein PHAVU_006G092800g [Phaseolus vulgaris]
Length=292

 Score =   458 bits (1179),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 220/294 (75%), Positives = 251/294 (85%), Gaps = 3/294 (1%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS    FPPQKQ+ QPGKE++M+P PQYSS DYKPSNKLQ  +ALVTGGDSGIGRAVC 
Sbjct  1     MASGEYNFPPQKQEMQPGKEYIMNPPPQYSSPDYKPSNKLQ--IALVTGGDSGIGRAVCN  58

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              F+LEGAT+ FTYVK QED DARDTL+I++K K   AK+PMAIP D+GF+ NCR+VV+ V
Sbjct  59    LFSLEGATIIFTYVKGQEDIDARDTLEIIRKGKTADAKDPMAIPVDVGFEVNCRRVVDEV  118

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V++YGRIDILVNNAAEQ+++ S+EEIDETRLERVFRTNIFS FF+ KHA+KHMKEGS+II
Sbjct  119   VDAYGRIDILVNNAAEQYESESLEEIDETRLERVFRTNIFSHFFMTKHAVKHMKEGSNII  178

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG   L+DY++TKGAIVAFTR LALQLV +GIRVNGVAPGPIWTPLI A+  
Sbjct  179   NTTSVNAYKGDATLVDYTSTKGAIVAFTRALALQLVSKGIRVNGVAPGPIWTPLIVATMK  238

Query  390   EEECAEFGKQ-VPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EEE  +FG    PMKRAGQ IEVAPSYVFLAS   SSYITGQ+LHPNGGTIVNG
Sbjct  239   EEEIVKFGSDSTPMKRAGQPIEVAPSYVFLASNQCSSYITGQVLHPNGGTIVNG  292



>gb|KHN04002.1| Glucose and ribitol dehydrogenase like 1 [Glycine soja]
Length=300

 Score =   458 bits (1179),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 212/284 (75%), Positives = 247/284 (87%), Gaps = 0/284 (0%)
 Frame = -1

Query  1095  NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALE  916
             N FPPQKQD+QPGKE++M+P PQY+S  YKPSNKLQGK+A+VTGGDSGIGRAVC  F+LE
Sbjct  7     NNFPPQKQDTQPGKEYLMNPPPQYNSSQYKPSNKLQGKIAVVTGGDSGIGRAVCNLFSLE  66

Query  915   GATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYG  736
             GATV FTYVK QED+DA DTL+I+KKAK E AK+P+AIP D+G++ENC+KVV+ V+N+YG
Sbjct  67    GATVIFTYVKGQEDRDASDTLEIIKKAKTEDAKDPLAIPVDVGYEENCKKVVDEVINAYG  126

Query  735   RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSV  556
             RIDILVNNAAEQ+++ S+E+ID+ RLERVFRTNIFS FF+ KHALKHMKEGSSIINTTSV
Sbjct  127   RIDILVNNAAEQYESDSLEDIDDARLERVFRTNIFSHFFMTKHALKHMKEGSSIINTTSV  186

Query  555   TAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECA  376
              AY+G   L+DY++TKGAIV FTR LALQLV +GIRVNGVAPGPIWTPLI A+ +EE   
Sbjct  187   NAYQGDGTLVDYTSTKGAIVGFTRALALQLVSKGIRVNGVAPGPIWTPLIVATMNEETIV  246

Query  375   EFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGT  244
              FG  VPMKRAGQ IEVAPSYVFLAS   SSYITGQ+LHPNG T
Sbjct  247   RFGSDVPMKRAGQPIEVAPSYVFLASNICSSYITGQVLHPNGHT  290



>ref|XP_007205659.1| hypothetical protein PRUPE_ppa009407mg [Prunus persica]
 gb|EMJ06858.1| hypothetical protein PRUPE_ppa009407mg [Prunus persica]
Length=294

 Score =   457 bits (1176),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 216/288 (75%), Positives = 246/288 (85%), Gaps = 1/288 (0%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G  QFPPQKQ++QPGKEH MDP PQ+++ DYKPSNKLQGKVALVTGGDSGIGRAVC
Sbjct  1     MASGGKQQFPPQKQETQPGKEHAMDPTPQFTNPDYKPSNKLQGKVALVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               FA EGATVAFTYVK QEDKDARDT+Q++K+AK   AK+PMA+ ADLG+DENC+KVV+ 
Sbjct  61    HLFAQEGATVAFTYVKEQEDKDARDTMQMIKQAKTSDAKDPMALAADLGYDENCKKVVDE  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             V  +YGRIDILVNNAAEQ+K  S+E+IDE RLERVFRTNIFS FF+ +H LKHMKEG S+
Sbjct  121   VAKAYGRIDILVNNAAEQYKASSVEDIDEPRLERVFRTNIFSYFFVTRHVLKHMKEGGSL  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             I TTSV AYKG+ KLLDY+ATKGAIV+F RGLAL LV +GIRVNGVAPGPIWTPLIP+ F
Sbjct  181   ICTTSVVAYKGNDKLLDYTATKGAIVSFIRGLALHLVGKGIRVNGVAPGPIWTPLIPSCF  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNG  250
              EEE A+FG +VPM+RAGQ  EV PSYVFLAS   SSY TGQ+ HPNG
Sbjct  241   DEEETAQFGSEVPMQRAGQPFEVGPSYVFLASNAFSSYYTGQVFHPNG  288



>gb|KGN57282.1| hypothetical protein Csa_3G176290 [Cucumis sativus]
Length=310

 Score =   457 bits (1175),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 218/294 (74%), Positives = 247/294 (84%), Gaps = 16/294 (5%)
 Frame = -1

Query  1068  SQPGKEHVMDPAPQYSSQDYKPSNKLQ---------------GKVALVTGGDSGIGRAVC  934
             +QPGK+H MDP PQ++S DY P+NKLQ               GKVALVTGGDSGIGRAVC
Sbjct  16    AQPGKQHAMDPTPQFTSPDYNPANKLQALNFSFLSYLYFFFLGKVALVTGGDSGIGRAVC  75

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKA-KVEGAKEPMAIPADLGFDENCRKVVE  757
              CFALEGA VAFTYVK QEDKDA+DT++++KKA K    K+P+AIPADLGFDENC++VV+
Sbjct  76    YCFALEGAIVAFTYVKGQEDKDAKDTIEMIKKATKSSAVKDPLAIPADLGFDENCKRVVD  135

Query  756   SVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS  577
              VV +YGRIDIL+NNAAEQ+K+ S+E+IDE RL RVFRTNIFS FF  +HALKHMKEGSS
Sbjct  136   EVVKAYGRIDILINNAAEQYKSSSVEDIDEERLLRVFRTNIFSYFFTTRHALKHMKEGSS  195

Query  576   IINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPAS  397
             IINTTSV AYKG+ KLLDY++TKGAIVAFTRGLALQL  +GIRVNGVAPGPIWTPLIPAS
Sbjct  196   IINTTSVNAYKGNAKLLDYTSTKGAIVAFTRGLALQLANKGIRVNGVAPGPIWTPLIPAS  255

Query  396   FSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             F EEE A FG QVPMKRAGQ IEVAPSYVFLA   +SSYITGQ+LHPNGGT+VN
Sbjct  256   FDEEETASFGSQVPMKRAGQPIEVAPSYVFLACNADSSYITGQVLHPNGGTVVN  309



>ref|XP_008246487.1| PREDICTED: glucose and ribitol dehydrogenase-like [Prunus mume]
Length=294

 Score =   456 bits (1173),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 214/293 (73%), Positives = 247/293 (84%), Gaps = 1/293 (0%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G  QFPPQKQ +QPGKEHVMDP PQ+ + DYKPSNKLQGKVAL+TGGDSGIGRAVC
Sbjct  1     MASGGKQQFPPQKQGTQPGKEHVMDPNPQFKNPDYKPSNKLQGKVALITGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               F+ EGATVAFTYVK QEDKDA DT+Q++KK K   AK+P A+ ADLG+DENC+KVVE 
Sbjct  61    YLFSQEGATVAFTYVKEQEDKDANDTIQMIKKVKTSDAKDPKALAADLGYDENCKKVVEE  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             V  +YGRIDIL+NNAAEQ+K  S+EEIDE RLER FRTNIFS F++ +HALKHMKEGSSI
Sbjct  121   VTKAYGRIDILINNAAEQYKAGSVEEIDEPRLERFFRTNIFSHFYMTRHALKHMKEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             I TTSV AYKG  +LL+Y++TKGAIVAF R L+LQLV +GIRVNGVAPGPIWTPLIPASF
Sbjct  181   ICTTSVKAYKGHAQLLEYTSTKGAIVAFIRALSLQLVSKGIRVNGVAPGPIWTPLIPASF  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              EE+  +FG +VPM+RAGQ  EVAP+Y+FLA    SSY TGQ+LHPNGG +VN
Sbjct  241   DEEKITQFGSEVPMQRAGQPYEVAPAYIFLADNAFSSYYTGQVLHPNGGAVVN  293



>gb|AAN15136.1| putative TAG factor protein [Lupinus angustifolius]
 gb|AAN75426.1| putative TAG-associated factor [Lupinus angustifolius]
Length=294

 Score =   456 bits (1172),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 215/294 (73%), Positives = 249/294 (85%), Gaps = 1/294 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQD-YKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS   +FPPQKQ +QPGKEH+M P PQ++  D YKPS+KL+GK+A+VTGGDSGIGRAVC
Sbjct  1     MASSEQKFPPQKQYTQPGKEHLMYPTPQFTCPDEYKPSDKLKGKIAVVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               FALEGATV FTYVK  EDKDA+DTL+++++ K   +KEP AI  DLGFDENC+KV++ 
Sbjct  61    NLFALEGATVIFTYVKGHEDKDAKDTLELIRRVKTSDSKEPKAIAVDLGFDENCKKVIDE  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             V+N+YG IDILVNNAAEQ++  S+EEIDE RLERVFRTNIFS FF+ +HALKHMKEGSSI
Sbjct  121   VINAYGSIDILVNNAAEQYECGSVEEIDEPRLERVFRTNIFSYFFMTRHALKHMKEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             INTTSV AYKG P LLDY++TKGAIVAFTR LALQLV +GIRVNGVAPGPIWTPLIP+SF
Sbjct  181   INTTSVNAYKGHPSLLDYTSTKGAIVAFTRALALQLVNKGIRVNGVAPGPIWTPLIPSSF  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              EEE A+FG  VPMKR GQ  EVAPS+VFLA    SSYITGQ+LHPNGG +VNG
Sbjct  241   KEEETAQFGSDVPMKRPGQPSEVAPSFVFLACNICSSYITGQVLHPNGGNVVNG  294



>gb|AAG51119.1|AC069144_16 dormancy related protein, putative [Arabidopsis thaliana]
Length=286

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 214/282 (76%), Positives = 248/282 (88%), Gaps = 2/282 (1%)
 Frame = -1

Query  1080  QKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVA  901
             QKQ +QPGKEHVM+ +PQ+SS DY+PSNKL  +VAL+TGGDSGIGRAV  CFA EGATVA
Sbjct  6     QKQHAQPGKEHVMESSPQFSSSDYQPSNKL--RVALITGGDSGIGRAVGYCFASEGATVA  63

Query  900   FTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDIL  721
             FTYVK QE+KDA++TLQ+LK+ K   +KEP+AIP DLGFDENC++VV+ VVN++GRID+L
Sbjct  64    FTYVKGQEEKDAQETLQMLKEVKTSDSKEPIAIPTDLGFDENCKRVVDEVVNAFGRIDVL  123

Query  720   VNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKG  541
             +NNAAEQ+++ +IEEIDE RLERVFRTNIFS FFL +HALKHMKEGSSIINTTSV AYKG
Sbjct  124   INNAAEQYESSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSSIINTTSVNAYKG  183

Query  540   SPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQ  361
             +  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIPASF+EE+   FG +
Sbjct  184   NASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIPASFNEEKIKNFGSE  243

Query  360   VPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG +VN
Sbjct  244   VPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVN  285



>ref|XP_007030862.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY11364.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=287

 Score =   452 bits (1163),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 219/294 (74%), Positives = 249/294 (85%), Gaps = 8/294 (3%)
 Frame = -1

Query  1110  MASDGNQ-FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS G Q FPPQKQ +QPGKEHVM+P PQ++S DYKPSNK Q    +       +G A+C
Sbjct  1     MASGGQQQFPPQKQSTQPGKEHVMNPIPQFTSPDYKPSNKFQLLEVI-------LGLAIC  53

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
              CF  EGATVAFTYVKSQEDKDA+DTLQ+LKK K   +K+PMAI ADLGFDENC+KVV+ 
Sbjct  54    HCFIREGATVAFTYVKSQEDKDAQDTLQMLKKEKTPDSKDPMAIAADLGFDENCKKVVDE  113

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             VVN+YGRI+ILVNNAAEQ+K  S+E+IDE RLERVFRTNIFS FFL +HALKHMKEGSSI
Sbjct  114   VVNAYGRINILVNNAAEQYKASSVEDIDEERLERVFRTNIFSYFFLTRHALKHMKEGSSI  173

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             INTTS+ AYKG+ KLLDY+ATKGAIVAFTRGL+LQLV+RGIRVNGVAPGPIWTPLIPASF
Sbjct  174   INTTSINAYKGNDKLLDYTATKGAIVAFTRGLSLQLVKRGIRVNGVAPGPIWTPLIPASF  233

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              EEE ++FG +VPM+RAGQ IEVAPSYVFLA    SSYI+GQ+LHPNGG IVN 
Sbjct  234   DEEETSKFGSEVPMQRAGQPIEVAPSYVFLACNHCSSYISGQVLHPNGGAIVNA  287



>ref|NP_187177.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
 sp|Q9MA93.1|GRDH2_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog 2 [Arabidopsis 
thaliana]
 gb|AAF27032.1|AC009177_22 putative glucose and ribitol dehydrogenase homolog [Arabidopsis 
thaliana]
 gb|AEE74212.1| NAD(P)-binding Rossmann-fold superfamily protein [Arabidopsis 
thaliana]
Length=289

 Score =   451 bits (1159),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 213/285 (75%), Positives = 246/285 (86%), Gaps = 1/285 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQKQ++QPG +HVM+P P++SS +YKPSNKL GKVALVTGGDSGIG+AVC C+ALEGA
Sbjct  5     FPPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VAFTYVK +EDKDA +TL++L + K   AKEP+ I  DLGF+ENC++VVE VVNS+GRI
Sbjct  65    SVAFTYVKGREDKDAEETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVN AAEQH+  SIE+IDE RLERVFRTNIFSQFFLVK+ALKHMKEGSSIINTTSV A
Sbjct  125   DVLVNCAAEQHEV-SIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G+  LL+Y+ATKGAIV+FTRGLALQL  +GIRVNGVAPGP+WTPLIPASFSEE   +F
Sbjct  184   YAGNSSLLEYTATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLIPASFSEEAIKQF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             G + PMKRA Q +EVAPSYVFLA    SSY TGQILHPNGG IVN
Sbjct  244   GSETPMKRAAQPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVN  288



>gb|AAL16204.1|AF428435_1 AT3g05260/T12H1_23 [Arabidopsis thaliana]
Length=289

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 213/285 (75%), Positives = 246/285 (86%), Gaps = 1/285 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQKQ++QPG +HVM+P P++SS +YKPSNKL GKVALVTGGDSGIG+AVC C+ALEGA
Sbjct  5     FPPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VAFTYVK +EDKDA +TL++L + K   AKEP+ I  DLGF+ENC++VVE VVNS+GRI
Sbjct  65    SVAFTYVKGREDKDAEETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVN AAEQH+  SIE+IDE RLERVFRTNIFSQFFLVK+ALKHMKEGSSIINTTSV A
Sbjct  125   DVLVNCAAEQHEV-SIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G+  LL+Y+ATKGAIV+FTRGLALQL  +GIRVNGVAPGP+WTPLIPASFSEE   +F
Sbjct  184   YAGNSSLLEYTATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLIPASFSEEAIKQF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             G + PMKRA Q +EVAPSYVFLA    SSY TGQILHPNGG IVN
Sbjct  244   GSETPMKRAAQPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVN  288



>gb|KFK37931.1| hypothetical protein AALP_AA3G048700 [Arabis alpina]
Length=289

 Score =   450 bits (1158),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 213/285 (75%), Positives = 246/285 (86%), Gaps = 1/285 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FP QKQ++QPGKEHVMDP PQ+SS +YKPSNKL GKVALVTGGDSGIG+AVC C+ LEGA
Sbjct  5     FPAQKQETQPGKEHVMDPTPQFSSPNYKPSNKLHGKVALVTGGDSGIGKAVCHCYGLEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             TVAFTYVK QEDKDA +TL++L + K + AKEP+ I  DLGF+ENC++VV+ VVN++GRI
Sbjct  65    TVAFTYVKGQEDKDANETLRLLHQVKTKEAKEPIMIATDLGFEENCKRVVDEVVNAFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVN AAEQH+  SIE+IDE RLERVFRTNIFSQFFLVK+ALKHMKEGSSIINTTSV A
Sbjct  125   DVLVNCAAEQHE-GSIEDIDEPRLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G+P LLDY+ATKGAI++FTRGLALQL  +GIRVNGVAPGP+WTPLI ASFSE+   +F
Sbjct  184   YAGNPNLLDYTATKGAILSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSEDMIKQF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             G + PMKRA Q +EVAPSYVFLA    SSY TGQILHPNGG +VN
Sbjct  244   GSETPMKRAAQPVEVAPSYVFLACNHCSSYFTGQILHPNGGLVVN  288



>ref|XP_010906880.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Elaeis 
guineensis]
Length=354

 Score =   451 bits (1161),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 218/296 (74%), Positives = 247/296 (83%), Gaps = 3/296 (1%)
 Frame = -1

Query  1113  SMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             +MAS G QFPPQ Q  QPGKEHVM+P PQ    DYK +NKLQGKVALVTGGDSGIGRAVC
Sbjct  60    TMASGGQQFPPQTQKRQPGKEHVMEPTPQAVLHDYKAANKLQGKVALVTGGDSGIGRAVC  119

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGA--KEPMAIPADLGFDENCRKVV  760
              C A+EGATVAFTYVKSQE KDA DTLQ+L++ K +GA  K+P+AIPADLGF++NCRKVV
Sbjct  120   YCLAMEGATVAFTYVKSQEGKDAEDTLQMLREIK-KGADVKDPIAIPADLGFEDNCRKVV  178

Query  759   ESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS  580
             E V  +YGRIDILVNNAAEQ+    I  I E +LERVFRTNIFS F   KHA+K+MKEGS
Sbjct  179   EEVAGTYGRIDILVNNAAEQYVKTCITNITEEQLERVFRTNIFSYFLTTKHAVKYMKEGS  238

Query  579   SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPA  400
             SIINTTSV AYKG+  LLDY+ATKGAIV FTRGLALQL  +GIRVNGVAPGP+WTPLIPA
Sbjct  239   SIINTTSVNAYKGNAMLLDYTATKGAIVGFTRGLALQLAGKGIRVNGVAPGPVWTPLIPA  298

Query  399   SFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             S SEE  A FGK+VP+ RAGQ  E+APSYVFLA C +SSY+TGQ++HPNGGT+VNG
Sbjct  299   SMSEEMVANFGKEVPLGRAGQPHEIAPSYVFLACCQDSSYVTGQVIHPNGGTVVNG  354



>ref|XP_009397642.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Musa 
acuminata subsp. malaccensis]
Length=293

 Score =   447 bits (1151),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 214/293 (73%), Positives = 244/293 (83%), Gaps = 0/293 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS G   PPQ Q+ QPGKEH+M+P PQ  S +YKP+NKLQGKVALVTGGDSGIGRAVC 
Sbjct  1     MASGGQHLPPQTQELQPGKEHIMEPTPQPISDEYKPANKLQGKVALVTGGDSGIGRAVCY  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFA EGATVAFTYVKSQE KDA DTLQ+L++ K   AK+P+AIPA+LG++ENCRKVVE V
Sbjct  61    CFAQEGATVAFTYVKSQEFKDANDTLQMLRQIKKHDAKDPIAIPAELGYEENCRKVVEEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YGRIDILVNNAAEQ++   I +I E +LERVFRTNIFS   + K  +K MK G  II
Sbjct  121   VNAYGRIDILVNNAAEQYERSCITDITEEQLERVFRTNIFSYMHVSKFVVKQMKAGGCII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AYKG   LLDY++TKGAIVAFTR LALQL ++GIRVNGVAPGP+WTPLIPASF 
Sbjct  181   NTTSVNAYKGHKTLLDYTSTKGAIVAFTRALALQLADKGIRVNGVAPGPVWTPLIPASFP  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EE  A FGK+VPM RAGQ  E+APSYVFLAS P+SSYITGQ++HPNGGTIVNG
Sbjct  241   EEAVANFGKEVPMGRAGQPYEIAPSYVFLASTPDSSYITGQVIHPNGGTIVNG  293



>ref|XP_008790990.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1 [Phoenix 
dactylifera]
Length=350

 Score =   449 bits (1154),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 217/295 (74%), Positives = 244/295 (83%), Gaps = 1/295 (0%)
 Frame = -1

Query  1113  SMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             +MAS G QFPPQ Q+ QPGKEH+M+P PQ    DYK +NKLQGKVALVTGGDSGIGRAVC
Sbjct  56    TMASGGQQFPPQTQERQPGKEHIMEPTPQAVRHDYKAANKLQGKVALVTGGDSGIGRAVC  115

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKV-EGAKEPMAIPADLGFDENCRKVVE  757
              CFA+EGATVAFTYVKSQE KDA DTLQ+L+  K    AK+P+AIPADLGF++NCRKVVE
Sbjct  116   YCFAMEGATVAFTYVKSQEVKDAEDTLQMLRGIKKGTDAKDPIAIPADLGFEQNCRKVVE  175

Query  756   SVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS  577
              V  +YGRIDILVNNAAEQ     I EI E +LERVFRTNIFS F   K A+K+MKEGS 
Sbjct  176   EVAGTYGRIDILVNNAAEQSIKTCITEISEEQLERVFRTNIFSYFLTTKCAVKYMKEGSC  235

Query  576   IINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPAS  397
             IINTTSV AYKG+  LLDY+ATKGAIV FTRGLALQL E+GIRVNGVAPGP+WTPLIPAS
Sbjct  236   IINTTSVNAYKGNAMLLDYTATKGAIVGFTRGLALQLAEKGIRVNGVAPGPVWTPLIPAS  295

Query  396   FSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              SEE  A FGK+VP+ RAGQ  E+APSYVFLA   +SSYITGQ++HPNGGT+VNG
Sbjct  296   MSEEMVANFGKEVPLGRAGQPHEIAPSYVFLACSQDSSYITGQVIHPNGGTVVNG  350



>ref|XP_003553739.1| PREDICTED: glucose and ribitol dehydrogenase-like [Glycine max]
 gb|KHN43251.1| Glucose and ribitol dehydrogenase [Glycine soja]
Length=295

 Score =   445 bits (1145),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 218/294 (74%), Positives = 249/294 (85%), Gaps = 2/294 (1%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS  NQFP QKQD+QPGKE++M+P PQY+S DYKPSNKL GKVA+VTGGDSGIGRAVC 
Sbjct  1     MASGENQFPRQKQDTQPGKEYLMNPPPQYNSPDYKPSNKLHGKVAVVTGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPAD-LGFDENCRKVVES  754
              F+LEGATV FTYVK QE+ DARDTL+I++KAK E AK+PMA+  D LG++ENC++VV+ 
Sbjct  61    LFSLEGATVIFTYVKGQEEIDARDTLEIIRKAKTEDAKDPMAVAVDHLGYEENCKRVVDQ  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             VVN+YG I ILVNNAA Q+++ S+EEID+ RLE VFRTNIFS FF+ KHALKHMKEGSSI
Sbjct  121   VVNAYGSIHILVNNAAVQYESDSLEEIDDKRLEMVFRTNIFSYFFMTKHALKHMKEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             INTTSVTAY+G  KL+DYS+TKGAIV FTR LALQLV +GIRVNGVAPGPIWTPL  AS 
Sbjct  181   INTTSVTAYEGFAKLVDYSSTKGAIVGFTRSLALQLVSKGIRVNGVAPGPIWTPLEVASL  240

Query  393   SEEECAEFGKQV-PMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             + EE   FG  V PMKRAGQ IEVAPSYVFLAS   SSYITGQ+LHPNGG IVN
Sbjct  241   TVEEIVRFGSDVTPMKRAGQPIEVAPSYVFLASNICSSYITGQVLHPNGGIIVN  294



>ref|XP_006433301.1| hypothetical protein CICLE_v10003201mg, partial [Citrus clementina]
 gb|ESR46541.1| hypothetical protein CICLE_v10003201mg, partial [Citrus clementina]
Length=283

 Score =   444 bits (1143),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 213/297 (72%), Positives = 245/297 (82%), Gaps = 22/297 (7%)
 Frame = -1

Query  1125  VFVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIG  946
             V +R+MAS   QFPPQKQ++QPGKEHVM+P PQ++S DYKPSNKL+GKVALVTGGDSGIG
Sbjct  8     VIMRNMASGNQQFPPQKQEAQPGKEHVMEPTPQFTSHDYKPSNKLRGKVALVTGGDSGIG  67

Query  945   RAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRK  766
             RAV  C+ALEGATVAFTYVKSQE+KDA++TL+IL++AK   AK+PMAI ADLGFDENC++
Sbjct  68    RAVAHCYALEGATVAFTYVKSQEEKDAQETLEILREAKTSDAKDPMAISADLGFDENCKR  127

Query  765   VVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
             VV+ VVN+YG+IDILVNNAA Q+K  S+EEIDE RLERVFRTNIFS FF+ +H+L+HM E
Sbjct  128   VVDEVVNAYGKIDILVNNAAVQYKAGSVEEIDEERLERVFRTNIFSHFFMTRHSLRHMNE  187

Query  585   GSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLI  406
             GS+IINTTSV                       RGLALQLVERGIRVNGVAPGPIWTPLI
Sbjct  188   GSAIINTTSV----------------------ARGLALQLVERGIRVNGVAPGPIWTPLI  225

Query  405   PASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             P+SFSEEE A+FG +VPMKRAGQ IEVAP YVFLA    SSYITGQ+LHPNGG IVN
Sbjct  226   PSSFSEEESAQFGSEVPMKRAGQPIEVAPCYVFLACNHCSSYITGQVLHPNGGVIVN  282



>ref|XP_006298247.1| hypothetical protein CARUB_v10014308mg [Capsella rubella]
 gb|EOA31145.1| hypothetical protein CARUB_v10014308mg [Capsella rubella]
Length=289

 Score =   445 bits (1144),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 210/285 (74%), Positives = 245/285 (86%), Gaps = 1/285 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQKQ++QPG +HVMDP P++SS +YKPSNKL GKVALVTGGDSGIG+AVC C+ALEGA
Sbjct  5     FPPQKQETQPGIQHVMDPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VAFTYVK +EDKDA +TL++L + K   AKEP+ I  DLGF+ENC++VVE VVN++GRI
Sbjct  65    SVAFTYVKGREDKDADETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNAFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVN AAEQH+  SIE+IDE RLERVFRTNIFSQFFLVK+ALKHMKEGSSIINTTSV A
Sbjct  125   DVLVNCAAEQHEV-SIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G+  LL+Y++TKGAIV+FTRGLALQL  +GIRVNGVAPGP+WTPLI ASFS+E   +F
Sbjct  184   YGGNSSLLEYTSTKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSDEAIKQF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             G + PMKRA Q +EVAPSYVFLA    SSY TGQILHPNGG IVN
Sbjct  244   GSETPMKRAAQPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVN  288



>ref|XP_010464044.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2-like [Camelina 
sativa]
Length=289

 Score =   442 bits (1137),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 245/285 (86%), Gaps = 1/285 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQKQ++QPG +HVM+P P++SS +YKPSNKL GKVALVTGGDSGIG+AVC C+ALEGA
Sbjct  5     FPPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VAFTYVK +EDKDA +TL++L + K   AKEP+ I  DLGF+ENC++VVE VVN++GRI
Sbjct  65    SVAFTYVKGREDKDADETLRLLHEVKTSEAKEPIMIATDLGFEENCKRVVEEVVNAFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVN AAEQH+  SIE+IDE RLERVFRTNIFSQFFLVK+ALKHMKEGSSIINTTSV A
Sbjct  125   DVLVNCAAEQHEV-SIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G+  LL+Y++TKGAIV+FTRGLALQL  +GIRVNGVAPGP+WTPLI ASFS+E   +F
Sbjct  184   YGGNSSLLEYTSTKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSDEAIKQF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             G + PMKRA Q +EVAPSYVFLA    SSY TGQ+LHPNGG IVN
Sbjct  244   GSETPMKRAAQPVEVAPSYVFLACNHCSSYYTGQVLHPNGGLIVN  288



>ref|XP_009147260.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2 [Brassica 
rapa]
 emb|CDY27781.1| BnaA05g31900D [Brassica napus]
Length=289

 Score =   441 bits (1134),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 244/286 (85%), Gaps = 1/286 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQKQ++QPG +H MDP+PQ+SS +YKPSNKL GKVALVTGGDSGIGRAVC C+ LEGA
Sbjct  5     FPPQKQETQPGVQHAMDPSPQFSSPNYKPSNKLHGKVALVTGGDSGIGRAVCHCYVLEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VAFTYVK +EDKDA +TL++L +AK + AK+P+ I  DLGF+ENC++ V+ VVN++GRI
Sbjct  65    SVAFTYVKGREDKDADETLRLLHEAKTKDAKDPIMIATDLGFEENCKRTVDEVVNAFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVN AAEQH+  SI+EI+E RLERVFRTNIFSQFFL K+ALKHMKEGSSIINTTSV A
Sbjct  125   DVLVNCAAEQHEV-SIDEIEEARLERVFRTNIFSQFFLAKYALKHMKEGSSIINTTSVVA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y GS  LL+Y++TKGAIV+FTR LALQL  +GIRVNGVAPGP+WTPLI ASFSEE   +F
Sbjct  184   YAGSSSLLEYASTKGAIVSFTRALALQLASKGIRVNGVAPGPVWTPLITASFSEEAIKQF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G + PMKRA Q +EVAPSYVFLA    SSY TGQILHPNGG+IVN 
Sbjct  244   GSETPMKRAAQPVEVAPSYVFLACEHCSSYYTGQILHPNGGSIVNA  289



>ref|XP_010424987.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2 [Camelina 
sativa]
Length=289

 Score =   441 bits (1133),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 207/285 (73%), Positives = 244/285 (86%), Gaps = 1/285 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQKQ++QPG +HVM+P P++SS +YKPSNKL GKVALVTGGDSGIG+AVC C+ALEGA
Sbjct  5     FPPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VAFTYVK +EDKDA +TL++L + K   A EP+ I  DLGF+ENC++VVE VVN++GRI
Sbjct  65    SVAFTYVKGREDKDADETLRLLHEVKTREANEPIMIATDLGFEENCKRVVEEVVNAFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVN AAEQH+  SIE+IDE RLERVFRTNIFSQFFLVK+ALKHMKEGSSIINTTSV A
Sbjct  125   DVLVNCAAEQHEV-SIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVVA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G+  LL+Y++TKGAIV+FTRGLALQL  +GIRVNGVAPGP+WTPLI ASFS+E   +F
Sbjct  184   YGGNSSLLEYTSTKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSDEAIKQF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             G + PMKRA Q +EVAPSYVFLA    SSY TGQ+LHPNGG IVN
Sbjct  244   GSETPMKRAAQPVEVAPSYVFLACNHCSSYYTGQVLHPNGGLIVN  288



>ref|XP_002884497.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60756.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=291

 Score =   441 bits (1133),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 211/288 (73%), Positives = 244/288 (85%), Gaps = 3/288 (1%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQKQ++QPG +HVM+P P++SS +YKPSNKL GKVALVTGGDSGIG+AVC C+ALEGA
Sbjct  5     FPPQKQETQPGIQHVMEPTPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VAFTYVK +EDKDA +TL++L + K   AKEP+ I  DLGF+ENC++VVE VVNS+GRI
Sbjct  65    SVAFTYVKGREDKDADETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNSFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLV--KHALKHMKEGSSIINTTSV  556
             D+LVN AAEQH+  SIE+IDE RLERVFRTNIFSQFFLV  ++ALKHMKEGSSIINTTSV
Sbjct  125   DVLVNCAAEQHEV-SIEDIDEARLERVFRTNIFSQFFLVNYRYALKHMKEGSSIINTTSV  183

Query  555   TAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECA  376
              AY G   LL+Y+ATKGAIV+FTRGLALQL  +GIRVNGVAPGP+WTPLI ASFSEE   
Sbjct  184   VAYAGHSSLLEYTATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSEEAIK  243

Query  375   EFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             +FG + PMKRA Q +EVAPSYVFLA    SSY TGQILHPNGG IVN 
Sbjct  244   QFGSETPMKRAAQPVEVAPSYVFLACNHCSSYYTGQILHPNGGLIVNA  291



>ref|XP_010546674.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2 [Tarenaya 
hassleriana]
Length=286

 Score =   440 bits (1131),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 245/284 (86%), Gaps = 1/284 (0%)
 Frame = -1

Query  1083  PQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATV  904
             PQKQ++QPGKEHVM+P+PQ++S  YK  NKLQGKVALVTGGDSGIGRAVC  FALEGATV
Sbjct  4     PQKQETQPGKEHVMEPSPQFTSSHYKACNKLQGKVALVTGGDSGIGRAVCHTFALEGATV  63

Query  903   AFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDI  724
             AFTYVK +ED+DA DT++ L++AK   AK+P+ IP DLGF+ENC++V++ VVN++G ID+
Sbjct  64    AFTYVKGREDRDAEDTMRALQEAKTRDAKDPIMIPTDLGFEENCKRVIDEVVNAFGAIDV  123

Query  723   LVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYK  544
             LVN AAEQH+  SIE+I+E +LERVFRTNIFSQFFL K+ALKHMKEGSSIINTTSV AY 
Sbjct  124   LVNTAAEQHEV-SIEDIEEAKLERVFRTNIFSQFFLAKYALKHMKEGSSIINTTSVVAYS  182

Query  543   GSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGK  364
             G+P LL+Y+ATKGAIV+FTRGLALQLV++GIRVN VAPGP+WTPL+ ASFSEE   +FG+
Sbjct  183   GNPVLLEYAATKGAIVSFTRGLALQLVQKGIRVNAVAPGPVWTPLVTASFSEETIKKFGE  242

Query  363   QVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             + PMKRA Q +E+APSYVFLA    SSY TGQ+LHPNGG IVN 
Sbjct  243   ETPMKRAAQPVEIAPSYVFLACNHCSSYFTGQVLHPNGGMIVNA  286



>ref|XP_010485956.1| PREDICTED: glucose and ribitol dehydrogenase homolog 2-like [Camelina 
sativa]
Length=290

 Score =   436 bits (1122),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 244/286 (85%), Gaps = 2/286 (1%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQKQ++QPG +HVMDP P++SS +YKPSNKL GKVALVTGGDSGIG+AVC C+ALEGA
Sbjct  5     FPPQKQETQPGIQHVMDPPPEFSSSNYKPSNKLHGKVALVTGGDSGIGKAVCHCYALEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPM-AIPADLGFDENCRKVVESVVNSYGR  733
             +VAFTYVK +EDKDA +TL++L + K   A EP+  I  DLGF+ENC++VVE VVN++GR
Sbjct  65    SVAFTYVKGREDKDADETLRLLHEVKTREASEPIIMIATDLGFEENCKRVVEEVVNAFGR  124

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             ID+LVN AAEQH+  SIE+IDE RLERVFRTNIFSQFFLVK+ALKHMKEGSSIINTTSV 
Sbjct  125   IDVLVNCAAEQHEV-SIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSSIINTTSVV  183

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY G+  LL+Y++TKGAIV+FTRGLALQL  +GIRVNGVAPGP+WTPLI ASFS+E   +
Sbjct  184   AYGGNSSLLEYTSTKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLITASFSDEAIKQ  243

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             FG + PMKRA Q +EVAPSYVFLA    SSY TGQ+LHPNGG IVN
Sbjct  244   FGSETPMKRAAQPVEVAPSYVFLACNHCSSYYTGQVLHPNGGLIVN  289



>ref|XP_007154111.1| hypothetical protein PHAVU_003G091300g [Phaseolus vulgaris]
 gb|ESW26105.1| hypothetical protein PHAVU_003G091300g [Phaseolus vulgaris]
Length=294

 Score =   436 bits (1120),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/293 (70%), Positives = 244/293 (83%), Gaps = 1/293 (0%)
 Frame = -1

Query  1110  MASDGN-QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MA++ + +FPPQ Q +QPGKEHVMDP PQ   +DYKP+NKLQGKVALVTGGDSGIGRAVC
Sbjct  1     MATNKDSKFPPQSQKTQPGKEHVMDPLPQTIHKDYKPANKLQGKVALVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
              CFA EGATVAFTYVK  ED+D  DTL++L +AK  GA +P+AI AD+GFDENC++V++ 
Sbjct  61    LCFAKEGATVAFTYVKGHEDRDKDDTLKMLLEAKTGGADDPLAIAADIGFDENCKQVIDL  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             VV  YGR+D+LVNNAAEQH T S+EEI + ++ERVF TNIFSQFFLVKHALKHM++GSSI
Sbjct  121   VVKEYGRVDVLVNNAAEQHLTNSVEEITQQQIERVFGTNIFSQFFLVKHALKHMRKGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             IN+TSV AY G+P+ LDY+ATKGAIVAFTRGL+ QLV RGIRVN VAPGP+WTP+ PAS 
Sbjct  181   INSTSVNAYNGNPEALDYTATKGAIVAFTRGLSQQLVSRGIRVNAVAPGPVWTPIQPASK  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             S E     G +VPMKRA Q  E+AP Y+FLA+C +SSY TGQ+LHPNGG IVN
Sbjct  241   SGELVQNLGCEVPMKRAAQPSEIAPCYLFLATCQDSSYYTGQVLHPNGGEIVN  293



>gb|KDO59502.1| hypothetical protein CISIN_1g039897mg, partial [Citrus sinensis]
Length=272

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 239/286 (84%), Gaps = 14/286 (5%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   QFPPQKQ++QPGKEHVM+P PQ++S DYKPSNKL+GKVALVTGGDSGIGRAV  
Sbjct  1     MASGNQQFPPQKQEAQPGKEHVMEPTPQFTSHDYKPSNKLRGKVALVTGGDSGIGRAVAH  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             C+ALEGATVAFTYVKSQE+KDA++TL+IL++AK   AK+PMAI ADLGFDENC++VV+ V
Sbjct  61    CYALEGATVAFTYVKSQEEKDAQETLEILREAKTSDAKDPMAISADLGFDENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             VN+YG+IDILVNNAA Q+K  S+EEIDE RLERVFRTNIFS FF+ +H+L+HM EGS+II
Sbjct  121   VNAYGKIDILVNNAAVQYKAGSVEEIDEERLERVFRTNIFSHFFMTRHSLRHMNEGSAII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV     SP+               RGLALQLVERGIRVNGVAPGPIWTPLIP+SFS
Sbjct  181   NTTSVEPLWHSPE--------------ARGLALQLVERGIRVNGVAPGPIWTPLIPSSFS  226

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPN  253
             EEE A+FG +VPMKRAGQ IEVAP YVFLA    SSYITGQ+LHPN
Sbjct  227   EEESAQFGSEVPMKRAGQPIEVAPCYVFLACNHCSSYITGQVLHPN  272



>ref|XP_006408096.1| hypothetical protein EUTSA_v10022134mg [Eutrema salsugineum]
 gb|ESQ49549.1| hypothetical protein EUTSA_v10022134mg [Eutrema salsugineum]
Length=289

 Score =   427 bits (1098),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 236/286 (83%), Gaps = 1/286 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             F PQKQ++QPGKEHVMDP PQ    DYKPSNKL G VALVTGGDSGIG+AVC C+ALEGA
Sbjct  5     FRPQKQETQPGKEHVMDPTPQSCCPDYKPSNKLHGIVALVTGGDSGIGKAVCHCYALEGA  64

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VAFTYVK +EDKDA +TL++L + K   AKEP+ I  DLGF+ENC++VVE VVN++GRI
Sbjct  65    SVAFTYVKGREDKDADETLRLLHEVKTREAKEPIMIATDLGFEENCKRVVEEVVNAFGRI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVN AAEQH+  SI++IDE RLERVFRTNIFSQFFL K+ALKHMKEGSSIINTTSV A
Sbjct  125   DVLVNCAAEQHEV-SIDDIDEARLERVFRTNIFSQFFLAKYALKHMKEGSSIINTTSVVA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G   LL+Y++TKGAIV+FTR LALQL  + IRVNGVAPGP+WTPL+ ASFS+E   +F
Sbjct  184   YAGHSNLLEYASTKGAIVSFTRALALQLAPKNIRVNGVAPGPVWTPLVTASFSDEAIKKF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G + PMKRA Q  EVAPSYVFLA    SSY TGQILHPNGG IVN 
Sbjct  244   GSETPMKRAAQPGEVAPSYVFLACDHCSSYYTGQILHPNGGLIVNA  289



>ref|XP_009398932.1| PREDICTED: glucose and ribitol dehydrogenase-like [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   427 bits (1099),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 246/298 (83%), Gaps = 5/298 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   QFPPQ Q+ QPGKEH M+  P+ +S++YKP+NKLQGKVALVTGGDSGIGRAVC 
Sbjct  1     MASGSQQFPPQTQERQPGKEHAMEAVPRATSEEYKPANKLQGKVALVTGGDSGIGRAVCY  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
             CFALEGATVAFTYVKSQEDKDA DTLQ+L++ K   AK+P+AIPADLG++ENCRKVVE V
Sbjct  61    CFALEGATVAFTYVKSQEDKDANDTLQMLRQNKRSNAKDPIAIPADLGYEENCRKVVEEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +N+YG IDILVNN AEQ+    I EI E +LERVFRTNIFS FF+ K  +K+MK GSSII
Sbjct  121   MNTYGCIDILVNNDAEQYVRPLITEITEQQLERVFRTNIFSYFFVSKFVVKYMKAGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTT V AYKG+ KLLDY++TKGAIVAFTR LALQLVERGIRVNGVAPGP+WTPLIPASF 
Sbjct  181   NTTWVNAYKGNAKLLDYTSTKGAIVAFTRALALQLVERGIRVNGVAPGPVWTPLIPASFP  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPES-SYITGQILHPN----GGTIVNG  232
             +E+ A FGKQVPM RAGQ IE+APS+VFLA+ P+S  +I+   L       GGT+VNG
Sbjct  241   QEQVANFGKQVPMGRAGQPIEIAPSFVFLAATPDSWPWISYSSLASLLLCAGGTVVNG  298



>ref|XP_002891915.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68174.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score =   428 bits (1100),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 226/357 (63%), Positives = 258/357 (72%), Gaps = 34/357 (10%)
 Frame = -1

Query  1275  MFSRCFTSSRALAVtlrhlppppttahllpPFSSTTFSLKTNGNSTV-------RLS--V  1123
             +  R FTSSR L+                   S+ TFS     N T        RLS  V
Sbjct  3     VLCRVFTSSRVLS-------------------SNFTFSFSQIPNKTKKTLPEKRRLSQLV  43

Query  1122  FVRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGR  943
              VR+MA++      QKQ  QP K           +Q   P     GKVAL+TGGDSGIGR
Sbjct  44    CVRAMATE-----KQKQHGQPAKNMSWKKLHNSLAQITNPPTSF-GKVALITGGDSGIGR  97

Query  942   AVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKV  763
             AV  CFALEGATVAFTYVK QE+KDA +TLQ+LKK K   AKEP+AIP DLGFDENC++V
Sbjct  98    AVGYCFALEGATVAFTYVKGQEEKDAHETLQMLKKVKTSDAKEPIAIPTDLGFDENCKRV  157

Query  762   VESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEG  583
             V+ VVN++GRID+L+NNAAEQ+++ S+EEIDE RLERVFRTNIFS FFL +HALKHMKEG
Sbjct  158   VDEVVNAFGRIDVLINNAAEQYESSSVEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEG  217

Query  582   SSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIP  403
             SSIINTTSV AYKG+  LLDY+ATKGAIVAFTRGLALQL E+GIRVNGVAPGPIWTPLIP
Sbjct  218   SSIINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLIP  277

Query  402   ASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             ASF+EE+   FG +VPMKRAGQ IEVAPSYVFLA    SSY TGQ+LHPNGG +VN 
Sbjct  278   ASFNEEKIKNFGSEVPMKRAGQPIEVAPSYVFLACNHCSSYFTGQVLHPNGGAVVNA  334



>ref|NP_001241158.1| uncharacterized protein LOC100809384 [Glycine max]
 gb|ACU23410.1| unknown [Glycine max]
 gb|KHN03060.1| Glucose and ribitol dehydrogenase [Glycine soja]
Length=294

 Score =   425 bits (1093),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 200/293 (68%), Positives = 238/293 (81%), Gaps = 1/293 (0%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             MAS+  ++FP Q Q +QPGKEHVM+P PQ ++ D+K +NKLQGKVALVTGGDSGIGRAVC
Sbjct  1     MASNKESKFPAQSQKTQPGKEHVMNPLPQATNPDHKAANKLQGKVALVTGGDSGIGRAVC  60

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
              CFA EGATVAFTYVK  ED+D  DTL++L +AK  GA  P+AI AD+GFDENC++V++ 
Sbjct  61    LCFAKEGATVAFTYVKGHEDRDKDDTLKMLLEAKTSGADNPLAIAADIGFDENCKQVIDL  120

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             VV  YGR+D+LVNNAAEQH T S+EEI + +LERVF TNIFSQFFLVKHALKHMKEGS I
Sbjct  121   VVKEYGRLDVLVNNAAEQHLTNSVEEITQQQLERVFGTNIFSQFFLVKHALKHMKEGSCI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             IN+TSV AY G+P+ LDY+ATKGAIVAFTRGL+ QL  RGIRVNGVAPGP+WTP+ PAS 
Sbjct  181   INSTSVNAYNGNPEALDYTATKGAIVAFTRGLSQQLASRGIRVNGVAPGPVWTPIQPASK  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
               E     G +VPM R  Q  E+AP Y+FLA+C +SSY TGQ+LHPNGG +VN
Sbjct  241   PAEMIQNLGCEVPMNRVAQPCEIAPCYLFLATCQDSSYFTGQVLHPNGGMVVN  293



>ref|XP_007147090.1| hypothetical protein PHAVU_006G095500g [Phaseolus vulgaris]
 gb|ESW19084.1| hypothetical protein PHAVU_006G095500g [Phaseolus vulgaris]
Length=298

 Score =   424 bits (1089),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 201/287 (70%), Positives = 240/287 (84%), Gaps = 0/287 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQKQ +QPGKE++M+P PQYS+ DYKPSNKLQGK+A++TGGDSGIGRAVC 
Sbjct  1     MASTEYRFPPQKQYTQPGKEYLMNPPPQYSTPDYKPSNKLQGKIAVITGGDSGIGRAVCN  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              F+LEGATV FTYV+ QED DA++TL+I++ AK   AK+PMAIP +LG++ENC++VV+ V
Sbjct  61    LFSLEGATVIFTYVEGQEDIDAKETLEIIRNAKTADAKDPMAIPVNLGYEENCKRVVDEV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V++YG IDILVNNAA Q ++ S+EEID+ RL  VFRTNIFS FF+ K+ALKHMKEGS II
Sbjct  121   VSAYGCIDILVNNAAVQFQSDSLEEIDDKRLHMVFRTNIFSYFFMTKYALKHMKEGSGII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSV AY+G   L+DY++TKGAIV FTR LALQLV +GIRVNGVAPGPIWTPL  ASF+
Sbjct  181   NTTSVVAYEGHATLVDYASTKGAIVGFTRSLALQLVRKGIRVNGVAPGPIWTPLQVASFT  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNG  250
             EE+   FG    MKRAGQ IEVAPSYVFLAS   SSYITGQ+LHPNG
Sbjct  241   EEQIVVFGSDTTMKRAGQPIEVAPSYVFLASNQCSSYITGQVLHPNG  287



>dbj|BAJ85825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=347

 Score =   424 bits (1091),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 210/296 (71%), Positives = 240/296 (81%), Gaps = 4/296 (1%)
 Frame = -1

Query  1116  RSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAV  937
             R+MAS   +FPPQ+QD QPGKEH MDP P+   ++YK +NKLQGKVALVTGGDSGIGRAV
Sbjct  53    RAMASQ--KFPPQQQDCQPGKEHAMDPRPEAIIKNYKSANKLQGKVALVTGGDSGIGRAV  110

Query  936   CQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVV  760
             C C ALEGATV FTYVK  EDKDA +TLQ L+  K   GA EP A+  DLG++ENCR+VV
Sbjct  111   CLCLALEGATVNFTYVKGHEDKDAEETLQALRDIKSRTGAGEPKALSGDLGYEENCRRVV  170

Query  759   ESVVNSYG-RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEG  583
             E V N++G R+DILVNNAAEQ+    I EI E  LERVFRTNIFS F + K A+KHM  G
Sbjct  171   EEVANAHGGRVDILVNNAAEQYVRPCITEITEQDLERVFRTNIFSYFLMTKFAVKHMGPG  230

Query  582   SSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIP  403
             SSIINTTSV AYKG+  LLDY+ATKGAIVAFTR L++QL E+GIRVNGVAPGPIWTPLIP
Sbjct  231   SSIINTTSVNAYKGNATLLDYTATKGAIVAFTRALSMQLAEKGIRVNGVAPGPIWTPLIP  290

Query  402   ASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             ASF EE+  +FG +VPMKRAGQ  EVAPS+VFLAS  +SSYI+GQILHPNGGTIVN
Sbjct  291   ASFPEEKVKQFGSEVPMKRAGQPSEVAPSFVFLASEQDSSYISGQILHPNGGTIVN  346



>pir||T06212 glucose and ribitol dehydrogenase homolog - barley
Length=293

 Score =   421 bits (1081),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/294 (71%), Positives = 238/294 (81%), Gaps = 4/294 (1%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQ+QD QPGKEH MDP P+   ++YK +NKLQGKVALVTGGDSGIGRAVC 
Sbjct  1     MAS--QKFPPQQQDCQPGKEHAMDPRPEAIIKNYKSANKLQGKVALVTGGDSGIGRAVCL  58

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVVES  754
             C ALEGATV FTYVK  EDKDA +TLQ L+  K   GA EP A+  DLG++ENCR+VVE 
Sbjct  59    CLALEGATVNFTYVKGHEDKDAEETLQALRDIKSRTGAGEPKALSGDLGYEENCRRVVEE  118

Query  753   VVNSYG-RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS  577
             V N++G R+DILVNNAAEQ+    I EI E  LERVFRTNIFS F + K A+KHM  GSS
Sbjct  119   VANAHGGRVDILVNNAAEQYVRPCITEITEQDLERVFRTNIFSYFLMTKFAVKHMGPGSS  178

Query  576   IINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPAS  397
             IINTTSV AYKG+  LLDY+ATKGAIVAFTR L++QL E+GIRVNGVAPGPIWTPLIPAS
Sbjct  179   IINTTSVNAYKGNATLLDYTATKGAIVAFTRALSMQLAEKGIRVNGVAPGPIWTPLIPAS  238

Query  396   FSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             F EE+  +FG +VPMKRAGQ  EVAPS+VFLAS  +SSYI+GQILHPNGGTIVN
Sbjct  239   FPEEKVKQFGSEVPMKRAGQPSEVAPSFVFLASEQDSSYISGQILHPNGGTIVN  292



>ref|XP_003568968.1| PREDICTED: glucose and ribitol dehydrogenase homolog [Brachypodium 
distachyon]
Length=352

 Score =   423 bits (1087),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 239/301 (79%), Gaps = 7/301 (2%)
 Frame = -1

Query  1116  RSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAV  937
             R+MAS   QFPPQKQDSQPGKEH MDP P+   + YKP+NKLQGKVALVTGGDSGIGRAV
Sbjct  53    RAMASS-QQFPPQKQDSQPGKEHAMDPRPESLIKHYKPANKLQGKVALVTGGDSGIGRAV  111

Query  936   CQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKV-----EGAKEPMAIPADLGFDENC  772
             C C+ALEGA+VAFTYVK  EDKDA +TL  L+  K        A +P+AIPADLG++ENC
Sbjct  112   CLCYALEGASVAFTYVKGHEDKDAEETLNALRDIKKSHGHNNNAGDPIAIPADLGYEENC  171

Query  771   RKVVESVVNSYG-RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKH  595
             RKVVE V  ++G RIDILVNNAAEQ+   S+ +I E  L+RVFRTNIFS F   KHAL  
Sbjct  172   RKVVEQVAKAHGGRIDILVNNAAEQYVRPSLADIGEQDLDRVFRTNIFSYFLTTKHALNQ  231

Query  594   MKEGSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWT  415
             M  G SIINT+S+ AYKG+  LLDY+ATKGAIVAFTR LALQL E+GIRVNGVAPGPIWT
Sbjct  232   MPRGGSIINTSSINAYKGNATLLDYTATKGAIVAFTRALALQLAEKGIRVNGVAPGPIWT  291

Query  414   PLIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             PLIP+SF EE+  +FG +VPMKRAGQ  EVAPSYVFLAS  +SSY++GQ LH NGG IVN
Sbjct  292   PLIPSSFPEEKVKQFGSEVPMKRAGQPGEVAPSYVFLASEQDSSYMSGQFLHVNGGAIVN  351

Query  234   G  232
             G
Sbjct  352   G  352



>ref|XP_002517191.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45354.1| short chain dehydrogenase, putative [Ricinus communis]
Length=295

 Score =   420 bits (1080),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 200/285 (70%), Positives = 231/285 (81%), Gaps = 0/285 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ QD QPGK++VM P P   + DYKPSNKL GKVALVTGGDSGIGRAVC  F+LEGA
Sbjct  10    FPPQTQDQQPGKQYVMHPLPHSINPDYKPSNKLHGKVALVTGGDSGIGRAVCYYFSLEGA  69

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             TVAFTYVK  EDKD  D L+++++ KV+ AK+P+AI  D+ ++ENC+KVV+ VVN YGRI
Sbjct  70    TVAFTYVKGIEDKDKDDALEMVRRVKVKDAKDPIAIATDIRYEENCKKVVDEVVNGYGRI  129

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVNNAA +H T SIEEI E  LE +FRTNIFSQFFLV+HALKHMKEGSSIINTTSV A
Sbjct  130   DVLVNNAALEHYTCSIEEITEADLESLFRTNIFSQFFLVRHALKHMKEGSSIINTTSVLA  189

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G P LLDY +TKGAI++FTRGL+ QL+ +GIRVNGVAPGPIWTPL PAS   EE A  
Sbjct  190   YTGDPNLLDYCSTKGAILSFTRGLSTQLIGKGIRVNGVAPGPIWTPLQPASLPAEEVAIL  249

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             G   PM RAGQ  EVAP+YVFLAS   SSYITGQ++HPNGG I+N
Sbjct  250   GSDTPMDRAGQPYEVAPAYVFLASNECSSYITGQVIHPNGGMIIN  294



>gb|EMT30749.1| Glucose and ribitol dehydrogenase-like protein [Aegilops tauschii]
Length=293

 Score =   419 bits (1078),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 207/294 (70%), Positives = 239/294 (81%), Gaps = 4/294 (1%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   +FPPQ+QD QPGKEH MDP P+   ++YK +NKLQGKVALVTGGDSGIGRAVC 
Sbjct  1     MAS--QKFPPQQQDCQPGKEHAMDPRPETLIKNYKSANKLQGKVALVTGGDSGIGRAVCL  58

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVVES  754
             CFALEGATV FTYVK  EDKDA +TLQ L+  K   GA EP A+  DLG++ENCR+VVE 
Sbjct  59    CFALEGATVNFTYVKGHEDKDAEETLQALRDIKSRTGAGEPKALAGDLGYEENCRRVVEE  118

Query  753   VVNSYG-RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS  577
             V +++G R+DILVNNAAEQ+    I EI E  LERVFRTNIFS F + K A+KHM  GSS
Sbjct  119   VASAHGGRVDILVNNAAEQYVRPCITEISEQDLERVFRTNIFSYFLMAKFAVKHMGPGSS  178

Query  576   IINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPAS  397
             IINTTSV AYKG+  LLDY+ATKGAIVAFTR L++QL E+GIRVNGVAPGPIWTPLIPAS
Sbjct  179   IINTTSVNAYKGNATLLDYTATKGAIVAFTRALSMQLAEKGIRVNGVAPGPIWTPLIPAS  238

Query  396   FSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             F EE+  +FG +VPMKRAGQ  EVAPS+VFLAS  +SSYI+GQ++HPNGGTIVN
Sbjct  239   FPEEKVKQFGSEVPMKRAGQPSEVAPSFVFLASEQDSSYISGQVIHPNGGTIVN  292



>ref|XP_003610393.1| Glucose and ribitol dehydrogenase-like protein [Medicago truncatula]
 gb|AES92590.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=294

 Score =   419 bits (1077),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 202/294 (69%), Positives = 235/294 (80%), Gaps = 1/294 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             M S+  +FPPQ Q +QPGKEHVM+P PQ  + D+ P+NKL+GKVALVTGGDSGIGRAVC 
Sbjct  1     MTSNEAKFPPQTQQTQPGKEHVMEPLPQTINPDHNPTNKLRGKVALVTGGDSGIGRAVCL  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGATVAFTYVK  ED+D  DTL++L +AK   A+EP+AI AD+G+DENC++VVE V
Sbjct  61    IFAKEGATVAFTYVKGVEDRDKDDTLKMLLEAKTSDAQEPLAIAADIGYDENCKQVVELV  120

Query  750   VNSYGR-IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             V  YG  ID+LVNNAAEQH   SIEEI E +LERVFRTNIFS FFLV+HALKHMKEGSSI
Sbjct  121   VKEYGSSIDVLVNNAAEQHLRNSIEEITEQQLERVFRTNIFSHFFLVRHALKHMKEGSSI  180

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             IN+TSV AY G  + LDY++TKGAIVAFTRGLA QLV +GIRVN VAPGPIWTP+ PA+ 
Sbjct  181   INSTSVNAYTGKAETLDYTSTKGAIVAFTRGLAQQLVSKGIRVNAVAPGPIWTPVQPATM  240

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               E+    G  VPMKRAGQ  E+AP Y+FLAS  +SSY TGQ+LHPNGG IVN 
Sbjct  241   PYEKIQNLGSDVPMKRAGQPCEIAPCYLFLASLQDSSYFTGQVLHPNGGVIVNA  294



>ref|XP_002517192.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45355.1| short chain dehydrogenase, putative [Ricinus communis]
Length=295

 Score =   416 bits (1068),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 197/285 (69%), Positives = 229/285 (80%), Gaps = 0/285 (0%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ QD QPGK++VM P PQ  + DYKPSNKL GKVALVTGGDSGIGRAVC  F+LEGA
Sbjct  10    FPPQTQDQQPGKQYVMHPLPQSINPDYKPSNKLHGKVALVTGGDSGIGRAVCYYFSLEGA  69

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             TVAFTYVK  EDKD  D L++ ++ K + AK+P+AI  D+ ++ENC+KV++ VVN YGRI
Sbjct  70    TVAFTYVKGIEDKDKDDALEMFQEVKAKDAKDPIAIATDIRYEENCKKVIDEVVNEYGRI  129

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVNNA  QH T+SIEEI E  LE +FRTNIFSQFFLV+HALKHMKEGSSIINTTSV A
Sbjct  130   DVLVNNAGLQHYTYSIEEITEVDLESLFRTNIFSQFFLVRHALKHMKEGSSIINTTSVLA  189

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G P LLDY +TKGAI++FTRGL+ QL+ +GIRVNGVAPGP WTPL PAS   EE A  
Sbjct  190   YTGHPNLLDYCSTKGAILSFTRGLSAQLIGKGIRVNGVAPGPTWTPLQPASLPAEEVAIL  249

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             G   PM RAGQ  E+AP+YVFLAS   SS+ITGQ++HPNGG IVN
Sbjct  250   GSDTPMDRAGQPHEIAPAYVFLASNECSSFITGQVIHPNGGIIVN  294



>ref|XP_004507706.1| PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cicer 
arietinum]
Length=293

 Score =   415 bits (1067),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 204/292 (70%), Positives = 240/292 (82%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             M S+  +FPPQ QD+QPGKEH+M+P PQ    D+KP+NKL+GKVALVTGGDSGIGRAVC 
Sbjct  1     MTSNEPKFPPQSQDTQPGKEHLMEPLPQAIHPDHKPANKLRGKVALVTGGDSGIGRAVCV  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGATVAFTYVK QED+D  DTL++L +AK   A+EP+AI AD+G+DENC++VVE V
Sbjct  61    IFAKEGATVAFTYVKGQEDRDKDDTLKMLLEAKTSDAQEPLAIAADIGYDENCKQVVELV  120

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V  YGRID+LVNNAAEQH   SIEEI E +LERVFRTNIFSQFFLV+HALKHMKEGSSII
Sbjct  121   VKEYGRIDVLVNNAAEQHLKNSIEEITEPQLERVFRTNIFSQFFLVRHALKHMKEGSSII  180

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             N++SV AY G  + LDY++TKG IVAFTRGLA QLV+RGIRVN VAPGP+WTP+ PA+  
Sbjct  181   NSSSVNAYIGKAETLDYTSTKGGIVAFTRGLAQQLVKRGIRVNAVAPGPVWTPVQPATMP  240

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              E+    G +VPMKRAGQ  E+AP Y+FLAS  +SSY TGQ+LHPNGG IVN
Sbjct  241   SEKIQNLGSEVPMKRAGQPCEIAPCYLFLASLQDSSYFTGQVLHPNGGVIVN  292



>gb|EAY96497.1| hypothetical protein OsI_18399 [Oryza sativa Indica Group]
Length=300

 Score =   416 bits (1068),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/303 (69%), Positives = 244/303 (81%), Gaps = 13/303 (4%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   QFPPQKQ++QPGKEH MDP P+   Q YKP+NKL+ KVA+VTGGDSGIGRAVC 
Sbjct  1     MAS--QQFPPQKQETQPGKEHAMDPRPEAIIQSYKPANKLKDKVAIVTGGDSGIGRAVCL  58

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVVES  754
             CFALEGATVAFTYVK QE+KDA +TL+ L+  +   GAK+PMAIPADLG+D+NCRKVV+ 
Sbjct  59    CFALEGATVAFTYVKGQEEKDAEETLRALRDIRARTGAKDPMAIPADLGYDDNCRKVVDE  118

Query  753   VVNSYG-RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS-  580
             V  +YG  IDILVNNAAEQ++  SI +I E  LERVFRTNIFS FF+ KHA+K M++   
Sbjct  119   VAGAYGGAIDILVNNAAEQYERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDRRG  178

Query  579   -------SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPI  421
                    SIINT+S+ AYKG+  LLDY+ATKGAIVAFTR LALQL E GIRVNGVAPGPI
Sbjct  179   GAGAGGCSIINTSSINAYKGNKTLLDYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPI  238

Query  420   WTPLIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTI  241
             WTPLIPASF+EE+  +FG QVPM RAGQ  EVAPS+VFLAS  ++SY++GQ+LH NGG I
Sbjct  239   WTPLIPASFAEEKVRQFGSQVPMGRAGQPSEVAPSFVFLAS-DDASYMSGQMLHVNGGVI  297

Query  240   VNG  232
             VNG
Sbjct  298   VNG  300



>sp|Q75KH3.2|GRDH_ORYSJ RecName: Full=Glucose and ribitol dehydrogenase homolog [Oryza 
sativa Japonica Group]
 gb|EEE62275.1| hypothetical protein OsJ_17062 [Oryza sativa Japonica Group]
Length=300

 Score =   413 bits (1062),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/303 (68%), Positives = 243/303 (80%), Gaps = 13/303 (4%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MAS   QFPPQ Q++QPGKEH MDP P+   Q YKP+NKL+ KVA+VTGGDSGIGRAVC 
Sbjct  1     MAS--QQFPPQNQETQPGKEHAMDPRPEAIIQSYKPANKLKDKVAIVTGGDSGIGRAVCL  58

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVVES  754
             CFALEGATVAFTYVK QE+KDA +TL+ L+  +   GAK+PMAIPADLG+D+NCRKVV+ 
Sbjct  59    CFALEGATVAFTYVKGQEEKDAEETLRALRDIRARTGAKDPMAIPADLGYDDNCRKVVDE  118

Query  753   VVNSYG-RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS-  580
             V  +YG  IDILVNNAAEQ++  SI +I E  LERVFRTNIFS FF+ KHA+K M++   
Sbjct  119   VAGAYGGAIDILVNNAAEQYERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDRRG  178

Query  579   -------SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPI  421
                    SIINT+S+ AYKG+  LLDY+ATKGAIVAFTR LALQL E GIRVNGVAPGPI
Sbjct  179   GAGAGGCSIINTSSINAYKGNKTLLDYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPI  238

Query  420   WTPLIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTI  241
             WTPLIPASF+EE+  +FG QVPM RAGQ  EVAPS+VFLAS  ++SY++GQ+LH NGG I
Sbjct  239   WTPLIPASFAEEKVRQFGSQVPMGRAGQPSEVAPSFVFLAS-DDASYMSGQMLHVNGGVI  297

Query  240   VNG  232
             VNG
Sbjct  298   VNG  300



>ref|XP_011090772.1| PREDICTED: glucose and ribitol dehydrogenase-like [Sesamum indicum]
Length=282

 Score =   410 bits (1055),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 198/279 (71%), Positives = 230/279 (82%), Gaps = 1/279 (0%)
 Frame = -1

Query  1071  DSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTY  892
             + QPGKEH+MDP PQ  + DY+ +NKL GKVALVTGGDSGIGR+VC  FALEGATVAFTY
Sbjct  4     EQQPGKEHLMDPIPQALNPDYRQANKLHGKVALVTGGDSGIGRSVCYLFALEGATVAFTY  63

Query  891   VKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNN  712
             V  QE+KDA DTL+ +++ K   AK+P+A+PADLGFDENC+KVV+ VVN++GRIDILVNN
Sbjct  64    VPGQEEKDAHDTLKKIQELKSADAKDPIALPADLGFDENCKKVVDEVVNNFGRIDILVNN  123

Query  711   AAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPK  532
             AAEQH T +IEEIDE RLERVFRTNIFS FF+ +HALKHMKEGSS+IN+TSV AY GS  
Sbjct  124   AAEQHMTSTIEEIDENRLERVFRTNIFSHFFMTRHALKHMKEGSSVINSTSVVAYCGSDI  183

Query  531   LLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPM  352
             LLDY +TKGAIV+FTRGLALQLVE+GIRVN VA GP+WTPL  ++  EE   + G + PM
Sbjct  184   LLDYCSTKGAIVSFTRGLALQLVEKGIRVNAVAAGPVWTPLQVSTKPEELIKKIGSETPM  243

Query  351   KRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              RA Q  E+APSYVFLAS  ESSY TGQ LHPNGG IVN
Sbjct  244   GRAAQPHEIAPSYVFLAS-DESSYFTGQALHPNGGMIVN  281



>ref|NP_001054600.1| Os05g0140800 [Oryza sativa Japonica Group]
 gb|AAS90638.1| putative NAD-/NADP-dependent oxidoreductase [Oryza sativa Japonica 
Group]
 gb|AAU10779.1| putative NAD-/NADP-dependent oxidoreductase [Oryza sativa Japonica 
Group]
 dbj|BAF16514.1| Os05g0140800 [Oryza sativa Japonica Group]
Length=365

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/297 (69%), Positives = 240/297 (81%), Gaps = 11/297 (4%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             QFPPQ Q++QPGKEH MDP P+   Q YKP+NKL+ KVA+VTGGDSGIGRAVC CFALEG
Sbjct  70    QFPPQNQETQPGKEHAMDPRPEAIIQSYKPANKLKDKVAIVTGGDSGIGRAVCLCFALEG  129

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVVESVVNSYG  736
             ATVAFTYVK QE+KDA +TL+ L+  +   GAK+PMAIPADLG+D+NCRKVV+ V  +YG
Sbjct  130   ATVAFTYVKGQEEKDAEETLRALRDIRARTGAKDPMAIPADLGYDDNCRKVVDEVAGAYG  189

Query  735   -RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGS-------  580
               IDILVNNAAEQ++  SI +I E  LERVFRTNIFS FF+ KHA+K M++         
Sbjct  190   GAIDILVNNAAEQYERPSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDRRGGAGAGG  249

Query  579   -SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIP  403
              SIINT+S+ AYKG+  LLDY+ATKGAIVAFTR LALQL E GIRVNGVAPGPIWTPLIP
Sbjct  250   CSIINTSSINAYKGNKTLLDYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTPLIP  309

Query  402   ASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             ASF+EE+  +FG QVPM RAGQ  EVAPS+VFLAS  ++SY++GQ+LH NGG IVNG
Sbjct  310   ASFAEEKVRQFGSQVPMGRAGQPSEVAPSFVFLAS-DDASYMSGQMLHVNGGVIVNG  365



>gb|KDP40130.1| hypothetical protein JCGZ_02128 [Jatropha curcas]
Length=295

 Score =   404 bits (1039),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 231/292 (79%), Gaps = 0/292 (0%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             +   G +FPPQ QD QPG E+VM P P+  +  YKPSNKL GKVAL+TGGDSGIGRAV  
Sbjct  3     LTEPGYRFPPQTQDRQPGLEYVMHPLPESINPHYKPSNKLHGKVALITGGDSGIGRAVAY  62

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              F LEGATVAFTYVK +EDKD   TL+IL + K EG+K+P+AIP D+GF+ENC+KVV+ V
Sbjct  63    YFTLEGATVAFTYVKPREDKDKDHTLKILHEIKTEGSKDPIAIPTDVGFEENCKKVVDQV  122

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             ++ YG+IDILVN  A Q  + SI++I E RLERVFRTNIFS FF+ K ALK+MKEGS II
Sbjct  123   MSEYGQIDILVNCTAVQFYSHSIQDITEARLERVFRTNIFSYFFMAKEALKYMKEGSCII  182

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTS+ AY+G  +LLDYS+TKGAIV+FTR LAL L+ERGIRVNGVAPGP+WTPL PAS  
Sbjct  183   NTTSLVAYRGYAELLDYSSTKGAIVSFTRSLALHLIERGIRVNGVAPGPVWTPLQPASLP  242

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              E  A  G +VPM RAGQ  E+APS+VFLA+   SSYITGQ++HPNGG I+N
Sbjct  243   AEVVASLGSEVPMDRAGQPFEIAPSFVFLAANECSSYITGQVVHPNGGAIIN  294



>ref|XP_006654977.1| PREDICTED: LOW QUALITY PROTEIN: glucose and ribitol dehydrogenase 
homolog [Oryza brachyantha]
Length=351

 Score =   401 bits (1030),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 201/300 (67%), Positives = 236/300 (79%), Gaps = 18/300 (6%)
 Frame = -1

Query  1119  VRSMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRA  940
             +R MAS   QFPPQ+Q+SQPGKEH MDP P+   Q+YKP+ KLQ KVA+VTGGDSGIGRA
Sbjct  66    IRGMAS--QQFPPQQQESQPGKEHAMDPRPEAIIQNYKPAKKLQDKVAIVTGGDSGIGRA  123

Query  939   VCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVE--GAKEPMAIPADLGFDENCRK  766
             VC CFALEGATVAFTYVK QE+KDA +TL+ L+  +V   GA+EPMAIPADLG++EN R+
Sbjct  124   VCLCFALEGATVAFTYVKGQEEKDAEETLRALRDIRVRTGGAREPMAIPADLGYEENWRR  183

Query  765   VVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE  586
                          ILVNNAAEQ++   I +I E  LERVFRTNIFS FF+ KHA+K M  
Sbjct  184   X------------ILVNNAAEQYERPCITDITEDDLERVFRTNIFSYFFMSKHAVKRMPA  231

Query  585   GS--SIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTP  412
             G   SIINT+S+ AYKG+  LLDY+ATKGAIVAFTR LALQLV++GIRVNGVAPGPIWTP
Sbjct  232   GGGGSIINTSSINAYKGNKTLLDYTATKGAIVAFTRALALQLVDKGIRVNGVAPGPIWTP  291

Query  411   LIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             LIPASF  E+  +FG QVPM+RAGQ  EVAPSYVFLAS  +SSY++GQ+LH NGG +VNG
Sbjct  292   LIPASFPPEKVKQFGSQVPMQRAGQPSEVAPSYVFLASEQDSSYMSGQMLHVNGGAVVNG  351



>ref|XP_002439250.1| hypothetical protein SORBIDRAFT_09g003150 [Sorghum bicolor]
 gb|EES17680.1| hypothetical protein SORBIDRAFT_09g003150 [Sorghum bicolor]
Length=327

 Score =   398 bits (1023),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 230/291 (79%), Gaps = 4/291 (1%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             QFPPQ+Q SQPGKEH MDP P+   Q+YK +NKL+ KVALVTGGDSGIGRAVC  FA EG
Sbjct  37    QFPPQQQGSQPGKEHAMDPRPEAILQNYKAANKLKNKVALVTGGDSGIGRAVCLLFAAEG  96

Query  912   ATVAFTYVKSQEDKDARDTLQILKK-AKVEGAKEPMAIPADLGFDENCRKVVESVVNSYG  736
             A+VAFTYVK  EDKDA +TL+ L+  +   GA+ PMA+ ADLG++++CR VVE V +++G
Sbjct  97    ASVAFTYVKGHEDKDAEETLRALRDISSRTGARPPMALAADLGYEDSCRSVVEEVASAHG  156

Query  735   -RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKE--GSSIINT  565
              RID+LVNNAAEQH+  SI E+ E  L+RVFRTNIFS F   KHA+  M    G S+INT
Sbjct  157   GRIDVLVNNAAEQHERRSITEVAEPDLDRVFRTNIFSYFLTTKHAVARMAPHGGGSVINT  216

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
              SV AYKG   LLDY++TKGAIV+FTR LALQL ++GIRVNGVAPGPIWTPLIPASF EE
Sbjct  217   ASVNAYKGHKTLLDYTSTKGAIVSFTRALALQLADKGIRVNGVAPGPIWTPLIPASFGEE  276

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             +  +FG +VPMKRAGQ  EVAPSYVFLAS  +SSYITGQ LH NGG IVNG
Sbjct  277   KVEQFGSEVPMKRAGQPAEVAPSYVFLASEQDSSYITGQFLHVNGGVIVNG  327



>ref|NP_001140439.1| uncharacterized protein LOC100272498 [Zea mays]
 gb|ACF83842.1| unknown [Zea mays]
 gb|ACG49026.1| general stress protein 39 [Zea mays]
 gb|ACZ54904.1| short-chain dehydrogenase/reductase SDR family protein [Zea mays]
Length=304

 Score =   397 bits (1019),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 231/281 (82%), Gaps = 2/281 (1%)
 Frame = -1

Query  1071  DSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTY  892
             +SQPGKEH MDP P+   QDYK +NKL+ KVALVTGGDSGIGRAVC CFA EGATVAFT+
Sbjct  23    ESQPGKEHAMDPRPEAIVQDYKAANKLKDKVALVTGGDSGIGRAVCLCFAKEGATVAFTF  82

Query  891   VKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVVESVVNSYG-RIDILV  718
             V+ QE+KDA +TL+ L+    E GA+EPMA+PADLG++ NCR+VVE V ++YG RID++V
Sbjct  83    VRGQEEKDAEETLRALRDIGSETGAREPMALPADLGYEANCREVVERVASAYGGRIDVVV  142

Query  717   NNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGS  538
             NNAAEQ++  SI ++ E  LERVFRTNIFS F + KHA+  M+ G+ IINT+SV AYKG+
Sbjct  143   NNAAEQYERESIGDVTEADLERVFRTNIFSYFLVSKHAVPRMEPGACIINTSSVNAYKGN  202

Query  537   PKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQV  358
               LLDY+ATKGAIVAFTR L+LQL +RGIRVNGVAPGP+WTPLIPASF +E+  +FG QV
Sbjct  203   KTLLDYTATKGAIVAFTRALSLQLADRGIRVNGVAPGPVWTPLIPASFGKEKVEQFGSQV  262

Query  357   PMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             PMKRA Q  E+APS+VFLAS  +SSY++GQILH NGG IVN
Sbjct  263   PMKRAAQPAEIAPSFVFLASNQDSSYMSGQILHVNGGVIVN  303



>tpg|DAA41374.1| TPA: general stress protein 39Short-chain dehydrogenase/reductase 
SDR family protein [Zea mays]
Length=358

 Score =   396 bits (1017),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 190/281 (68%), Positives = 231/281 (82%), Gaps = 2/281 (1%)
 Frame = -1

Query  1071  DSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTY  892
             +SQPGKEH MDP P+   QDYK +NKL+ KVALVTGGDSGIGRAVC CFA EGATVAFT+
Sbjct  77    ESQPGKEHAMDPRPEAIVQDYKAANKLKDKVALVTGGDSGIGRAVCLCFAKEGATVAFTF  136

Query  891   VKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVVESVVNSYG-RIDILV  718
             V+ QE+KDA +TL+ L+    E GA+EPMA+PADLG++ NCR+VVE V ++YG RID++V
Sbjct  137   VRGQEEKDAEETLRALRDIGSETGAREPMALPADLGYEANCREVVERVASAYGGRIDVVV  196

Query  717   NNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGS  538
             NNAAEQ++  SI ++ E  LERVFRTNIFS F + KHA+  M+ G+ IINT+SV AYKG+
Sbjct  197   NNAAEQYERESIGDVTEADLERVFRTNIFSYFLVSKHAVPRMEPGACIINTSSVNAYKGN  256

Query  537   PKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQV  358
               LLDY+ATKGAIVAFTR L+LQL +RGIRVNGVAPGP+WTPLIPASF +E+  +FG QV
Sbjct  257   KTLLDYTATKGAIVAFTRALSLQLADRGIRVNGVAPGPVWTPLIPASFGKEKVEQFGSQV  316

Query  357   PMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             PMKRA Q  E+APS+VFLAS  +SSY++GQILH NGG IVN
Sbjct  317   PMKRAAQPAEIAPSFVFLASNQDSSYMSGQILHVNGGVIVN  357



>ref|XP_004960440.1| PREDICTED: glucose and ribitol dehydrogenase homolog [Setaria 
italica]
Length=357

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 188/278 (68%), Positives = 227/278 (82%), Gaps = 3/278 (1%)
 Frame = -1

Query  1056  KEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQE  877
             KEH MDP P+   + YK + KL+ KVALVTGGDSGIGRAVC CFALEGATVAFTYVK  E
Sbjct  80    KEHAMDPRPEAIIKSYKAAGKLKDKVALVTGGDSGIGRAVCLCFALEGATVAFTYVKGHE  139

Query  876   DKDARDTLQILK--KAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYG-RIDILVNNAA  706
             +KDA +TL  L+  K++   A++PMA+PADLG++ENCR+VVE V  +YG RID+LVNNAA
Sbjct  140   EKDAEETLHALRGIKSRTGAARDPMAVPADLGYEENCRRVVEEVAGAYGGRIDVLVNNAA  199

Query  705   EQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLL  526
             EQ++  S+ +I E  L+RVFRTNI+S F + KHAL HM+EGSS+INT+SV AYKG+  L 
Sbjct  200   EQYERPSLSDITEANLDRVFRTNIYSYFLVTKHALPHMREGSSVINTSSVNAYKGNKTLT  259

Query  525   DYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKR  346
             DY+ATKGAIVAFTR LALQL ++GIRVNGVAPGPIWTPLIPASF +E+  +FG +VPMKR
Sbjct  260   DYTATKGAIVAFTRALALQLADKGIRVNGVAPGPIWTPLIPASFGKEKVEQFGSEVPMKR  319

Query  345   AGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             AGQ  EVAPS+VFLAS  +SSY++GQ LH NGG IVNG
Sbjct  320   AGQPAEVAPSFVFLASEQDSSYMSGQFLHVNGGVIVNG  357



>ref|XP_002517190.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45353.1| short chain dehydrogenase, putative [Ricinus communis]
Length=290

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/283 (65%), Positives = 222/283 (78%), Gaps = 0/283 (0%)
 Frame = -1

Query  1098  GNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFAL  919
             G +FPPQ QD QPGKE++M P P++ +  YKPSNKLQ KVALVTGGDSGIGRAV   F L
Sbjct  6     GYRFPPQSQDKQPGKEYLMHPLPEFINPHYKPSNKLQDKVALVTGGDSGIGRAVSYYFTL  65

Query  918   EGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSY  739
             EGATVAFTYVK +EDKD    L+IL + K EGAK+P+AIP D+GF+ENCRKV++ +++ Y
Sbjct  66    EGATVAFTYVKGREDKDKDHILKILHEVKAEGAKDPIAIPTDVGFEENCRKVIDQIMSEY  125

Query  738   GRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTS  559
             G+IDILVNNA E H + +IE+I +  LERVFRTNIF  FF+ +HALKHMKEG  IINT S
Sbjct  126   GKIDILVNNAGEAHYSTTIEDITDPMLERVFRTNIFGHFFMSRHALKHMKEGGCIINTAS  185

Query  558   VTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEEC  379
             V AY G   ++DYS+TKGA+VAFTR LALQL++RGIRVN VAPG +WTP  P++ S E+ 
Sbjct  186   VAAYAGFSFMVDYSSTKGAVVAFTRSLALQLIDRGIRVNAVAPGSVWTPFQPSTLSAEQV  245

Query  378   AEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNG  250
             A+ G  VPM RA Q  E+APS+VFLAS   SSY TGQ+LHPNG
Sbjct  246   AQVGSGVPMDRAAQPYEIAPSFVFLASNDCSSYFTGQVLHPNG  288



>ref|XP_008363981.1| PREDICTED: LOW QUALITY PROTEIN: glucose and ribitol dehydrogenase-like 
[Malus domestica]
Length=279

 Score =   389 bits (999),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/294 (65%), Positives = 223/294 (76%), Gaps = 18/294 (6%)
 Frame = -1

Query  1110  MASDG-NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQ-GKVALVTGGDSGIGRAV  937
             MAS G  QFPPQ+Q +QPGKEH MDP PQ+++ DYKPSNKLQ   + L++          
Sbjct  1     MASGGKQQFPPQRQGTQPGKEHAMDPTPQFTNPDYKPSNKLQVHHIVLLS----------  50

Query  936   CQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVE  757
               C         F Y + ++DKDA++TLQ +K+ K   AKEPMA+ ADLGFDENC+KVV+
Sbjct  51    --CLTXHN----FHYHRFKQDKDAKETLQAIKQVKASDAKEPMALAADLGFDENCKKVVD  104

Query  756   SVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS  577
              V N+YGRIDILVNNAAEQ+K  S+E+IDE RLERVFRTNIFS FF+  HALKHMKEG S
Sbjct  105   EVANAYGRIDILVNNAAEQYKAGSVEDIDEARLERVFRTNIFSCFFMTGHALKHMKEGGS  164

Query  576   IINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPAS  397
             +I TTS+ AYKGS  LLDY ATKGAIVAF RGLALQ V+RGIRVNGVAPGPIWTPLIPAS
Sbjct  165   VICTTSIVAYKGSDSLLDYCATKGAIVAFIRGLALQQVKRGIRVNGVAPGPIWTPLIPAS  224

Query  396   FSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             F EEE   FG +VPM+RAGQ  EV P+YVFLAS   SSY TGQ+ HP+GG IVN
Sbjct  225   FDEEEVQRFGNEVPMQRAGQPYEVGPTYVFLASEAFSSYYTGQVFHPBGGVIVN  278



>ref|XP_011021590.1| PREDICTED: glucose and ribitol dehydrogenase-like [Populus euphratica]
Length=295

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/290 (64%), Positives = 224/290 (77%), Gaps = 0/290 (0%)
 Frame = -1

Query  1101  DGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFA  922
             D  +FP Q Q  QPGKE++M P PQ  +  Y+PSNKL GKVALVTGGDSGIGR+VC  FA
Sbjct  6     DQFRFPLQTQPQQPGKEYLMHPLPQAINPKYQPSNKLHGKVALVTGGDSGIGRSVCYHFA  65

Query  921   LEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNS  742
             LEGATVAFTYV+  ED+D  +TLQ+L KAK   AKEP+AI  D+ F+ENC+KVV+ VV+ 
Sbjct  66    LEGATVAFTYVEGIEDRDKDETLQMLLKAKSNVAKEPIAIATDVKFEENCKKVVDQVVSE  125

Query  741   YGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTT  562
             +G+IDILVNNAAEQ+   +IEEI E+RLER+FRTNIFSQFF+ +H+LK+MKEGS IINT 
Sbjct  126   FGQIDILVNNAAEQYYVTAIEEITESRLERIFRTNIFSQFFMARHSLKYMKEGSCIINTA  185

Query  561   SVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEE  382
             S  AY G  + LDYS+TKGAIV FTRGL+  L+ +GIRVN V+PGP+WTP+ PAS   E+
Sbjct  186   SANAYTGGSQFLDYSSTKGAIVTFTRGLSQLLISKGIRVNAVSPGPVWTPIQPASLPAEK  245

Query  381   CAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              A  G  VPM RA Q  E+APSYVFLAS   SSY  GQ+LHPNGG IVN 
Sbjct  246   VASLGSDVPMDRAAQPYEIAPSYVFLASNECSSYFNGQVLHPNGGLIVNA  295



>tpg|DAA41375.1| TPA: hypothetical protein ZEAMMB73_293728 [Zea mays]
Length=353

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/276 (67%), Positives = 227/276 (82%), Gaps = 2/276 (1%)
 Frame = -1

Query  1071  DSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTY  892
             +SQPGKEH MDP P+   QDYK +NKL+ KVALVTGGDSGIGRAVC CFA EGATVAFT+
Sbjct  77    ESQPGKEHAMDPRPEAIVQDYKAANKLKDKVALVTGGDSGIGRAVCLCFAKEGATVAFTF  136

Query  891   VKSQEDKDARDTLQILKKAKVE-GAKEPMAIPADLGFDENCRKVVESVVNSYG-RIDILV  718
             V+ QE+KDA +TL+ L+    E GA+EPMA+PADLG++ NCR+VVE V ++YG RID++V
Sbjct  137   VRGQEEKDAEETLRALRDIGSETGAREPMALPADLGYEANCREVVERVASAYGGRIDVVV  196

Query  717   NNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGS  538
             NNAAEQ++  SI ++ E  LERVFRTNIFS F + KHA+  M+ G+ IINT+SV AYKG+
Sbjct  197   NNAAEQYERESIGDVTEADLERVFRTNIFSYFLVSKHAVPRMEPGACIINTSSVNAYKGN  256

Query  537   PKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQV  358
               LLDY+ATKGAIVAFTR L+LQL +RGIRVNGVAPGP+WTPLIPASF +E+  +FG QV
Sbjct  257   KTLLDYTATKGAIVAFTRALSLQLADRGIRVNGVAPGPVWTPLIPASFGKEKVEQFGSQV  316

Query  357   PMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNG  250
             PMKRA Q  E+APS+VFLAS  +SSY++GQILH NG
Sbjct  317   PMKRAAQPAEIAPSFVFLASNQDSSYMSGQILHVNG  352



>ref|XP_001752356.1| predicted protein [Physcomitrella patens]
 gb|EDQ83089.1| predicted protein [Physcomitrella patens]
Length=302

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 183/281 (65%), Positives = 222/281 (79%), Gaps = 1/281 (0%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             Q  PQ QD+ PGKE  MDP P +    YKP+ KL+GKVALVTGGDSGIGR+V   FA+EG
Sbjct  4     QREPQVQDTHPGKEFEMDPLPNHMRPVYKPAGKLEGKVALVTGGDSGIGRSVGHHFAMEG  63

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             ATVAFTY+   EDKDA +T+ ILKK++    K+P+ IP DL +DENC+KV++ VV  YGR
Sbjct  64    ATVAFTYLPGPEDKDADETIDILKKSQGPNGKDPLKIPVDLRYDENCKKVIDEVVKKYGR  123

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             IDILVNNA EQH   +IE+++  ++ER FR+NIFS F+LV+H L HMKEGS+IIN+TSV 
Sbjct  124   IDILVNNAGEQHTVQNIEDLEPEQIERTFRSNIFSMFYLVRHVLPHMKEGSAIINSTSVN  183

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             A+KG+  LLDY+ATKGAI AFTRGLALQLV+RGIRVN VAPGP+WTPLIP+SF  E+  +
Sbjct  184   AFKGNATLLDYTATKGAITAFTRGLALQLVKRGIRVNSVAPGPVWTPLIPSSFPAEKTEK  243

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNG  250
             FG QVPM RAG+  E+A SYVFLAS  +SSY TGQ LHPNG
Sbjct  244   FGSQVPMGRAGEPAEIATSYVFLAS-EDSSYFTGQTLHPNG  283



>ref|XP_011025991.1| PREDICTED: glucose and ribitol dehydrogenase-like [Populus euphratica]
Length=295

 Score =   379 bits (973),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 188/277 (68%), Positives = 219/277 (79%), Gaps = 1/277 (0%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             GKE+VM P P   + DYKPS KL GKVALVTGGDSGIGR+VC  FALEGATVAFTYV+  
Sbjct  19    GKEYVMCPLPLAINPDYKPSEKLNGKVALVTGGDSGIGRSVCYHFALEGATVAFTYVQGI  78

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             ED+D  DTL++L KAK   A +P+AI  D+  +E+C++VVE V + YGRIDILVNNA  Q
Sbjct  79    EDRDKDDTLKMLLKAKSSDADDPIAIATDVSSEEDCKRVVEQVASKYGRIDILVNNAGVQ  138

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSP-KLLD  523
             H T  +EEI E  L R+FRTNIF  FF+ KH+LKHMKEGS IINTTSVTAY GSP +LLD
Sbjct  139   HYTNLVEEITEDWLVRLFRTNIFGCFFMTKHSLKHMKEGSCIINTTSVTAYAGSPHQLLD  198

Query  522   YSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRA  343
             Y +TKG+IV+FTRGLAL+LV++GIRVNGVAPGPIWTPL PAS    E    G  VPM+RA
Sbjct  199   YLSTKGSIVSFTRGLALRLVDKGIRVNGVAPGPIWTPLQPASLPAYEVEYLGSDVPMRRA  258

Query  342   GQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             GQ  E+APSYVFLAS   SSY+TGQ+LHPNGGTI+NG
Sbjct  259   GQPYEMAPSYVFLASNQCSSYMTGQVLHPNGGTIING  295



>ref|XP_002311602.2| hypothetical protein POPTR_0008s14850g [Populus trichocarpa]
 gb|EEE88969.2| hypothetical protein POPTR_0008s14850g [Populus trichocarpa]
Length=295

 Score =   378 bits (971),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 187/277 (68%), Positives = 219/277 (79%), Gaps = 1/277 (0%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             GKE+VM P P   + DYKPS KL GKVALVTGGDSGIGR+VC  FALEGATVAFTYV+  
Sbjct  19    GKEYVMCPLPLAINPDYKPSEKLNGKVALVTGGDSGIGRSVCYHFALEGATVAFTYVQGI  78

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             ED+D  DTL++L KAK   A++P+AI  D+  +E+C++VVE V + YGRIDILVNNA  Q
Sbjct  79    EDRDKDDTLKMLLKAKSSDAEDPIAIATDVSSEEDCKRVVEQVASKYGRIDILVNNAGVQ  138

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSP-KLLD  523
             H T  +EEI E  L R+FRTNIF  FF+ KH+LKHMKEGS IINT SVTAY GSP +LLD
Sbjct  139   HYTNLVEEITEEWLVRMFRTNIFGYFFMTKHSLKHMKEGSCIINTASVTAYAGSPHQLLD  198

Query  522   YSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRA  343
             Y +TKG+IV+FTRGLAL+LV++GIRVNGVAPGPIWTPL PAS    E    G  VPM+RA
Sbjct  199   YLSTKGSIVSFTRGLALRLVDKGIRVNGVAPGPIWTPLQPASLPAYEVEYLGSDVPMRRA  258

Query  342   GQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             GQ  E+APSYVFLAS   SSY+TGQ+LHPNGGTI+NG
Sbjct  259   GQPYEMAPSYVFLASNQCSSYMTGQVLHPNGGTIING  295



>gb|EYU41520.1| hypothetical protein MIMGU_mgv1a0189502mg, partial [Erythranthe 
guttata]
Length=252

 Score =   375 bits (962),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 206/251 (82%), Gaps = 0/251 (0%)
 Frame = -1

Query  987  GKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPM  808
            GKV LV GGD+GIGRAVC  FALEGATVAFTYV+ QE+KDA DTL+ +++ K   AK+P+
Sbjct  1    GKVCLVIGGDTGIGRAVCYHFALEGATVAFTYVQGQEEKDAEDTLKKIQELKTPDAKDPI  60

Query  807  AIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFS  628
            A+ AD+GFDENC+ VV+ VVN +GRIDILVNNAAEQH T ++EEIDE RLER FRTNIFS
Sbjct  61   ALAADVGFDENCKMVVDGVVNKFGRIDILVNNAAEQHMTHTVEEIDENRLERTFRTNIFS  120

Query  627  QFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIR  448
             FF+ +HALKHMKEGS+IIN+TSV AY GSP LLDY ATKGAIV+FTR LALQLVE+GIR
Sbjct  121  HFFMTRHALKHMKEGSTIINSTSVAAYCGSPMLLDYCATKGAIVSFTRALALQLVEKGIR  180

Query  447  VNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQ  268
            VN VAPGP+WTPL  A+  EE  A+ G + PM RA Q  E+APSYVFLAS   SSY TGQ
Sbjct  181  VNAVAPGPVWTPLQVATMPEEAAAKVGAETPMGRAAQPHEIAPSYVFLASDESSSYFTGQ  240

Query  267  ILHPNGGTIVN  235
            +LHPNGG IVN
Sbjct  241  VLHPNGGMIVN  251



>ref|XP_001752921.1| predicted protein [Physcomitrella patens]
 gb|EDQ82425.1| predicted protein [Physcomitrella patens]
Length=289

 Score =   367 bits (942),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/284 (67%), Positives = 222/284 (78%), Gaps = 8/284 (3%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             P Q+Q   PG+EH+MDP P++   +YK + KL  K+ALVTGGDSGIGRAV   F  EGAT
Sbjct  6     PAQEQSQHPGEEHLMDPVPRHHGTNYKAAGKL--KIALVTGGDSGIGRAVGVLFTREGAT  63

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKE--PMAIPADLGFDENCRKVVESVVNSYGR  733
             VAFTYVK  E+KDA DT+ +LK+ K EG  E  P+AIP DLGFDE C+KVV+ VV  YGR
Sbjct  64    VAFTYVKGAEEKDAVDTINLLKQYKAEGGGEGEPLAIPCDLGFDEQCKKVVDKVVEKYGR  123

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             IDILVNNAAEQH   +IE++   +LER FRTNIFSQF+LV+HALKHMKEGS IINTTSV 
Sbjct  124   IDILVNNAAEQHVVENIEDLQPEQLERTFRTNIFSQFYLVRHALKHMKEGSCIINTTSVN  183

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF---SEEE  382
             A+KG+  LLDY++TKGAI+AFTRGLALQLV+RGIRVN VAPGPIWTPLIPAS    S E+
Sbjct  184   AFKGNTTLLDYTSTKGAILAFTRGLALQLVKRGIRVNAVAPGPIWTPLIPASMGQGSPEK  243

Query  381   CAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNG  250
                FG Q PM RAG+  E+A +YVFLAS  +SSY TGQ LHPNG
Sbjct  244   MKSFGSQCPMGRAGEPEEIATAYVFLAS-EDSSYFTGQTLHPNG  286



>gb|ADE76781.1| unknown [Picea sitchensis]
Length=288

 Score =   360 bits (925),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/282 (63%), Positives = 217/282 (77%), Gaps = 2/282 (1%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ Q++QPG E++M+P P   +  YKP++KL+GKVA+VTGGDSGIGRAVC  FALEGA
Sbjct  3     FPPQNQETQPGLEYLMEPRPLSVAPHYKPADKLKGKVAVVTGGDSGIGRAVCYHFALEGA  62

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIP-ADLGFDENCRKVVESVVNSYGR  733
             TVAF Y+   E+ DA +TLQ L++ K   AK+PM IP ADLG+DE C+KVV  VV +YG 
Sbjct  63    TVAFVYLSPAEEVDAEETLQRLREYKTADAKDPMKIPVADLGYDEACKKVVNDVVVTYGG  122

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             IDILVN AAE H   +IE++   +LER FRTN+FSQFF+V HA+K M EGS+IINT S  
Sbjct  123   IDILVNCAAEIHVVDNIEDMKAEQLERTFRTNVFSQFFMVSHAVKFMGEGSNIINTLSRQ  182

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY G+P  LDY++TKGAI+ FTRGLA QLV+RGIRVNGVAPGPIWTP+   + +  E A 
Sbjct  183   AYLGAPSTLDYASTKGAILTFTRGLAKQLVKRGIRVNGVAPGPIWTPINAVALNPNEIAH  242

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGG  247
              G+  PM RAGQ  EVAPSYVFLAS  ++SY+ GQ+LHPNGG
Sbjct  243   LGEDTPMGRAGQPCEVAPSYVFLAS-QDASYMIGQVLHPNGG  283



>ref|WP_014247477.1| short-chain dehydrogenase [Azospirillum lipoferum]
 ref|YP_005038692.1| putative short-chain dehydrogenase/reductase [Azospirillum lipoferum 
4B]
 emb|CBS86455.1| putative short-chain dehydrogenase/reductase [Azospirillum lipoferum 
4B]
Length=286

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 220/294 (75%), Gaps = 9/294 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA   ++ PPQ QDS+PG +  MDP P  +   Y+ S KL+ KVAL+TGGDSGIGRA+  
Sbjct  1     MAQQESRQPPQHQDSRPGHQAPMDPQPSETRPGYRGSGKLRDKVALITGGDSGIGRAIAV  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAI-PADLGFDENCRKVVES  754
              +A EGA V   Y+   ED+DAR+T ++     VE   +P  I   D+G +E CRK VES
Sbjct  61    LYAREGAKVGILYLN--EDEDARETRRL-----VEAEGQPCTILSGDVGQEETCRKAVES  113

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
             ++  +GRIDIL+NNAAEQH   SIE+I   +LER FRTNIF QFF+VK AL HM EG+ I
Sbjct  114   MIGEHGRIDILINNAAEQHPQTSIEDITAEQLERTFRTNIFGQFFMVKAALPHMNEGACI  173

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             +NTTSVTAYKGSP+LLDYSATKGAIVAFTR L++ L +RGIRVN VAPGPIWTPLIP++F
Sbjct  174   VNTTSVTAYKGSPELLDYSATKGAIVAFTRSLSMALADRGIRVNAVAPGPIWTPLIPSTF  233

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              EE+   FG  VPMKRAGQ  EVAP +VFLAS  +SSY++GQ+LHPNGGT+VNG
Sbjct  234   DEEKVESFGGNVPMKRAGQPDEVAPCFVFLAS-DDSSYMSGQVLHPNGGTVVNG  286



>ref|XP_002961003.1| hypothetical protein SELMODRAFT_402549 [Selaginella moellendorffii]
 gb|EFJ38542.1| hypothetical protein SELMODRAFT_402549 [Selaginella moellendorffii]
Length=278

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/287 (61%), Positives = 219/287 (76%), Gaps = 15/287 (5%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FP QKQ+SQPG +HVMDP P+    DYKPS+KL+ KVAL+TGGDSGIGRAV   ++LEGA
Sbjct  4     FPAQKQESQPGVQHVMDPHPRTKRSDYKPSDKLKNKVALITGGDSGIGRAVAYFYSLEGA  63

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VA TYV  +E+KDA + + ++K+AK   AK+P+ IPAD+            VV +YGRI
Sbjct  64    SVAITYVPGKEEKDAEEAIHMIKEAKTAHAKDPIMIPADI------------VVKAYGRI  111

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS-IINTTSVT  553
             DILVNNAAEQ++   IE++   +LERVFRTNIFS F+L ++A+ HMKEG   IINTTSV 
Sbjct  112   DILVNNAAEQYRVQKIEDLKPEQLERVFRTNIFSHFYLSRYAVPHMKEGEGCIINTTSVN  171

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AYKG+  L+DY++TKGAIV FTR LAL LV+RGIRVNGVAPGP+W PLIPAS  E E  E
Sbjct  172   AYKGNKTLIDYTSTKGAIVGFTRSLALNLVDRGIRVNGVAPGPVWAPLIPASSPEPEQTE  231

Query  372   -FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              FG+Q PM +A Q  ++APSYVFLAS  ++++ TGQ+LHPNGG IVN
Sbjct  232   HFGEQCPMGKAAQPDDIAPSYVFLAS-EDAAFFTGQVLHPNGGMIVN  277



>ref|WP_009459400.1| MULTISPECIES: short-chain dehydrogenase [Fischerella]
 gb|EHC09356.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Fischerella sp. JSC-11]
Length=286

 Score =   353 bits (905),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/285 (61%), Positives = 217/285 (76%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q+ QPG E  M P P+     Y+ S KL+ KVAL+TGGDSGIGRAV   FA EGA 
Sbjct  9     PPQHQEKQPGIESEMTPKPKADDSQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGAD  68

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   E  DA++T  +++       ++ + I  D+G +  C++ ++  ++ +G++D
Sbjct  69    VAIAYLN--EHNDAKETKHLVEAQ----GRKAVTISGDIGDETFCQQAIQQTIDEFGKLD  122

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   SIE+I + +LER FRTNIFS FFL K AL+H++EGSSIINTTSVTAY
Sbjct  123   ILVNNAAEQHPQKSIEDISKEQLERTFRTNIFSMFFLTKAALQHLQEGSSIINTTSVTAY  182

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KGSP+LLDYS+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLIPA+F E++ A FG
Sbjct  183   KGSPELLDYSSTKGAIVAFTRSLSQGLVEKGIRVNAVAPGPIWTPLIPATFPEDKVANFG  242

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             KQVPM+RAGQ  E+APSYVFLAS  ++SYITGQ+LH NGGTIVNG
Sbjct  243   KQVPMQRAGQPEEIAPSYVFLASD-DASYITGQVLHTNGGTIVNG  286



>ref|XP_002967005.1| hypothetical protein SELMODRAFT_230991 [Selaginella moellendorffii]
 gb|EFJ31604.1| hypothetical protein SELMODRAFT_230991 [Selaginella moellendorffii]
Length=278

 Score =   351 bits (900),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/287 (60%), Positives = 218/287 (76%), Gaps = 15/287 (5%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FP QKQ+SQPG +HVMDP P+    DYKPS+KL+ KVAL+TGGDSGIGRAV   ++LEGA
Sbjct  4     FPAQKQESQPGVQHVMDPHPRTRRSDYKPSDKLKNKVALITGGDSGIGRAVAYFYSLEGA  63

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
             +VA TYV  +E+KDA + + ++K+AK   AK+P+ IP D+            VV +YGRI
Sbjct  64    SVAITYVPGKEEKDAEEAIHMIKEAKTAHAKDPIMIPGDI------------VVKAYGRI  111

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS-IINTTSVT  553
             DILVNNAAEQ++   IE++   +LERVFRTNIFS F+L ++A+ HMKEG   IINTTSV 
Sbjct  112   DILVNNAAEQYRVQKIEDLKPEQLERVFRTNIFSHFYLSRYAVPHMKEGEGCIINTTSVN  171

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AYKG+  L+DY++TKGAIV FTR LAL LV+RGIRVNGVAPGP+W PLIPAS  E +  E
Sbjct  172   AYKGNKTLIDYTSTKGAIVGFTRSLALNLVDRGIRVNGVAPGPVWAPLIPASSPEPQQTE  231

Query  372   -FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              FG+Q PM +A Q  ++APSYVFLAS  ++++ TGQ+LHPNGG IVN
Sbjct  232   HFGEQCPMGKAAQPDDIAPSYVFLAS-EDAAFFTGQVLHPNGGMIVN  277



>ref|WP_026841337.1| short-chain dehydrogenase [Geobacter bremensis]
Length=286

 Score =   350 bits (899),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 178/290 (61%), Positives = 221/290 (76%), Gaps = 8/290 (3%)
 Frame = -1

Query  1101  DGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFA  922
             +G QFPPQ+Q +QPGKE  M P PQ    +Y+ + KLQGK AL+TGGDSGIGRAV   FA
Sbjct  5     EGKQFPPQRQ-AQPGKEAEMTPRPQSGEFEYRGAGKLQGKTALITGGDSGIGRAVAIAFA  63

Query  921   LEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNS  742
              EGA +AF Y+  +ED+DA++T  I+++   EG +  +A   D+G ++ C  +V+  V +
Sbjct  64    REGAYIAFGYL--EEDQDAKETRDIVER---EGVR-CLAFRGDVGQEQFCLDIVKKTVEA  117

Query  741   YGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTT  562
             +GR+DI+VNNAAEQH   SIEEI   +LER FRTNIFS F+LVK ALKH++EGS IINTT
Sbjct  118   FGRLDIVVNNAAEQHYRESIEEISSEQLERTFRTNIFSYFYLVKAALKHLQEGSRIINTT  177

Query  561   SVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEE  382
             SVTAY+G+P LLDYS+TKGAIVAFTR LAL L ++GI VN VAPGPIWTPLIP +F EE+
Sbjct  178   SVTAYRGNPNLLDYSSTKGAIVAFTRSLALSLADKGILVNAVAPGPIWTPLIPGTFPEEK  237

Query  381   CAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               +FG  V +KRAGQ +EVA SYVFLAS    SY+TGQ+LHPNGGTIV G
Sbjct  238   TEQFGGNVLLKRAGQPVEVAHSYVFLAS-EGGSYMTGQVLHPNGGTIVGG  286



>ref|WP_012528577.1| short-chain dehydrogenase [Geobacter bemidjiensis]
 ref|YP_002136965.1| short-chain dehydrogenase/reductase family oxidoreductase [Geobacter 
bemidjiensis Bem]
 gb|ACH37169.1| oxidoreductase, short-chain dehydrogenase/reductase family [Geobacter 
bemidjiensis Bem]
Length=286

 Score =   350 bits (897),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 218/290 (75%), Gaps = 8/290 (3%)
 Frame = -1

Query  1101  DGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFA  922
             +G QFPPQ+Q +QPGKE  M P PQ    +Y+ + KLQGK AL+TGGDSGIGRAV   FA
Sbjct  5     EGKQFPPQRQ-AQPGKEAEMTPRPQSGEFEYRGAGKLQGKTALITGGDSGIGRAVAIAFA  63

Query  921   LEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNS  742
              EGA +AF Y+  +ED+DA++T  I+++  V      +A   D+G ++ C  +V+  + +
Sbjct  64    REGANIAFGYL--EEDQDAKETRDIVEREGVR----CLAFRGDVGQEQFCLDIVKKTLEA  117

Query  741   YGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTT  562
             +GR+DI+VNNAAEQH   SIEEI   +LER FRTNIFS F+LVK ALKH++EGS IINTT
Sbjct  118   FGRLDIVVNNAAEQHYRESIEEISSEQLERTFRTNIFSYFYLVKAALKHLQEGSRIINTT  177

Query  561   SVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEE  382
             SVTAYKG+P LLDYS+TKGAIVAFTR LAL L  +GI VN VAPGPIWTPLIP +F EE+
Sbjct  178   SVTAYKGNPNLLDYSSTKGAIVAFTRSLALSLAGKGILVNAVAPGPIWTPLIPGTFPEEK  237

Query  381   CAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               +FG  V +KRAGQ +EVA SYVFLAS    SY+TGQ+LHPNGGTIV G
Sbjct  238   TEQFGGNVLLKRAGQPVEVAHSYVFLAS-EGGSYMTGQVLHPNGGTIVGG  286



>ref|WP_019491234.1| short-chain dehydrogenase [Calothrix sp. PCC 7103]
Length=284

 Score =   350 bits (897),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 175/285 (61%), Positives = 214/285 (75%), Gaps = 8/285 (3%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q+  PG E  M P PQ     Y+ S KL+ KVAL+TG DSGIGRAV   +A EGA 
Sbjct  8     PPQSQEL-PGSEAQMTPKPQADDSKYRGSGKLENKVALITGADSGIGRAVAIAYAKEGAN  66

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   E +DA++T  +++K         + I  D+G +  C++ V+  V+ +G++D
Sbjct  67    VAILYLS--EHEDAKETKHLVEKY----GGRAVTIAGDIGSESFCQQAVQQTVDEFGKLD  120

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   SIE+I E +LE+ FRTNIFS FF+ K A+KH+ EGS+IINTTSVTAY
Sbjct  121   ILVNNAAEQHPQESIEDITEEQLEKTFRTNIFSMFFMTKAAMKHLHEGSAIINTTSVTAY  180

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KGSP+LLDYS+TKGAIVAFTR L+  LVE+GIRVNGVAPGPIWTPLIPA+F EE+ A FG
Sbjct  181   KGSPELLDYSSTKGAIVAFTRSLSQNLVEKGIRVNGVAPGPIWTPLIPATFPEEKVASFG  240

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             KQVPM+R GQ  EVAPSYVFLAS  +SSYITGQ+LHPNGG +VNG
Sbjct  241   KQVPMQRPGQPEEVAPSYVFLASD-DSSYITGQVLHPNGGAVVNG  284



>ref|WP_012773835.1| short-chain dehydrogenase [Geobacter sp. M21]
 ref|YP_003019965.1| short-chain dehydrogenase/reductase SDR [Geobacter sp. M21]
 gb|ACT16207.1| short-chain dehydrogenase/reductase SDR [Geobacter sp. M21]
Length=286

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 221/290 (76%), Gaps = 8/290 (3%)
 Frame = -1

Query  1101  DGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFA  922
             +G QFPPQ+Q +QPGKE  M P P+    +Y+ + KLQGK AL+TGGDSGIGRAV   FA
Sbjct  5     EGKQFPPQRQ-AQPGKEAEMTPRPKSGEFEYRGAGKLQGKTALITGGDSGIGRAVAIAFA  63

Query  921   LEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNS  742
              EGA VAF Y+  +ED+DA++T  I+++   EG +  +A   D+G ++ C  +V+  + +
Sbjct  64    REGANVAFGYL--EEDQDAKETRDIVER---EGGR-CLAFRGDVGQEQFCLDIVKKTLEA  117

Query  741   YGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTT  562
             +GR+DI+VNNAAEQH    IEEI   +LER FRTNIFS F+LVK ALKH++EGS IINTT
Sbjct  118   FGRLDIVVNNAAEQHYREGIEEISSEQLERTFRTNIFSYFYLVKAALKHLQEGSRIINTT  177

Query  561   SVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEE  382
             SVTAYKG+P LLDYS+TKGAIVAFTR LAL L ++GI VN VAPGPIWTPLIP +F EE+
Sbjct  178   SVTAYKGNPNLLDYSSTKGAIVAFTRSLALSLADKGILVNAVAPGPIWTPLIPGTFPEEK  237

Query  381   CAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               +FG+ V +KRAGQ +EVA SYVFLAS    SY+TGQ+LHPNGGTIV G
Sbjct  238   TEQFGENVLLKRAGQPVEVAHSYVFLAS-EGGSYMTGQVLHPNGGTIVGG  286



>ref|WP_012974033.1| short-chain dehydrogenase [Azospirillum lipoferum]
 ref|YP_003448598.1| short-chain dehydrogenase/reductase SDR [Azospirillum sp. B510]
 dbj|BAI72054.1| short-chain dehydrogenase/reductase SDR [Azospirillum sp. B510]
Length=288

 Score =   347 bits (891),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 175/293 (60%), Positives = 216/293 (74%), Gaps = 7/293 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA   ++ PPQ Q  QPG +  M P P      Y+ S KL+ KVAL+TGGDSGIGR++  
Sbjct  3     MAQLESRQPPQHQSIQPGHQAPMTPQPSDGGPTYRGSGKLRDKVALITGGDSGIGRSIAV  62

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              +A EGA +   Y+   ED DAR+T ++++    EG +    +  D+G +E CRK VE +
Sbjct  63    LYAREGAKIGILYLN--EDDDARETRRLVE---AEG-QTCTILSGDVGQEETCRKAVERL  116

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V  +GRIDIL+NNAAEQH   SIE+I   +LER FRTNIF QF++VK AL HM EG+ II
Sbjct  117   VGDHGRIDILINNAAEQHPRRSIEDITAEQLERTFRTNIFGQFYMVKAALPHMNEGAVII  176

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSP+LLDYSATKGAIVAFTR L++ L +RGIRVN VAPGPIWTPLIP++F 
Sbjct  177   NTTSVTAYKGSPELLDYSATKGAIVAFTRSLSMALSDRGIRVNAVAPGPIWTPLIPSTFD  236

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EE+   FG  VPMKRAGQ  EVAP+YVFLAS  +SSY++GQ+LHPNGGT+VNG
Sbjct  237   EEKVENFGGNVPMKRAGQPDEVAPAYVFLAS-DDSSYMSGQVLHPNGGTVVNG  288



>ref|WP_014095754.1| short-chain dehydrogenase [Bacillus coagulans]
 ref|YP_004858375.1| short-chain dehydrogenase/reductase SDR [Bacillus coagulans 36D1]
 gb|AEO99594.1| short-chain dehydrogenase/reductase SDR [Bacillus coagulans 36D1]
 gb|KGB30840.1| short-chain dehydrogenase [Bacillus coagulans]
Length=290

 Score =   347 bits (889),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 221/286 (77%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q Q+ QPG E  M+P P+    +YK S KL GK+AL+TGGDSGIG++V   FA EGA
Sbjct  12    LPAQHQNRQPGTETEMNPQPKNVKDNYKGSGKLDGKIALITGGDSGIGKSVAIYFAKEGA  71

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   E++DA+ T ++++K   EG ++ + IP D+G +++CR  VE VV+++GR+
Sbjct  72    HVAICYLN--ENEDAKQTKELVEK---EG-RQCLIIPGDIGDEQHCRDAVEKVVSTFGRL  125

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   SI +I E +L R FRTNIFSQFF+VK AL H+KEGSSIINTTS+TA
Sbjct  126   DILVNNAAEQHPQKSILDISEEQLVRTFRTNIFSQFFMVKAALPHLKEGSSIINTTSITA  185

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GSP+LLDYSATKGAI AF R L+  LV +GIRVNGVAPGPIWTPLIP++F+ ++  +F
Sbjct  186   YQGSPQLLDYSATKGAIAAFIRSLSQALVSKGIRVNGVAPGPIWTPLIPSTFTADQVEKF  245

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G  VPMKR GQ  E+AP+YV+LAS  +SSY+TGQ++H NGGT++NG
Sbjct  246   GSDVPMKRPGQPSELAPAYVYLAS-DDSSYVTGQVIHVNGGTVING  290



>ref|WP_023172258.1| short-chain dehydrogenase/reductase SDR [Gloeobacter kilaueensis]
 ref|YP_008710902.1| short-chain dehydrogenase/reductase SDR [Gloeobacter kilaueensis 
JS1]
 gb|AGY57195.1| short-chain dehydrogenase/reductase SDR [Gloeobacter kilaueensis 
JS1]
Length=288

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/294 (59%), Positives = 215/294 (73%), Gaps = 7/294 (2%)
 Frame = -1

Query  1113  SMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             + A    Q PPQKQ+ QPG E  M P P Y +++Y  +NKL  KVAL+TGGDSGIGRAV 
Sbjct  2     TQAQSKAQQPPQKQEHQPGSEAQMTPQPVYDNENYHGANKLLNKVALITGGDSGIGRAVA  61

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
               FA E A +A  Y+   E +DA+ T Q++++      +  + I  D+G +  C++ VE 
Sbjct  62    VFFAKEKADIAIVYLD--EHEDAQKTKQLVEQQ----GRRCVTIAGDIGDEAFCKQAVER  115

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
              +  +G+++ILVNNAAEQH   SI +I   +LER FRTNIF+QF+LVK AL H+K GS+I
Sbjct  116   TIQEFGQLNILVNNAAEQHPQESIADITSEQLERTFRTNIFAQFYLVKAALPHLKSGSAI  175

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             INTTSVTAYKGSPKLLDY+ TKGAIVAFTR L+  L+++GIRVNGVAPGPIWTPLIPASF
Sbjct  176   INTTSVTAYKGSPKLLDYATTKGAIVAFTRSLSQALIDKGIRVNGVAPGPIWTPLIPASF  235

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               E+ A  G   PM+RAGQ  EVAPSYVFLAS  +SSYI+GQILHPNGG +VNG
Sbjct  236   GPEKTASHGSNAPMERAGQPAEVAPSYVFLAS-EDSSYISGQILHPNGGEVVNG  288



>ref|WP_006634949.1| short-chain dehydrogenase [Microcoleus vaginatus]
 gb|EGK85165.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Microcoleus vaginatus 
FGP-2]
Length=286

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/285 (61%), Positives = 213/285 (75%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q+ QPG E  M P PQ  ++ Y+ S+KL+ KVAL+TGGDSGIGRAV   FA EGA 
Sbjct  9     PPQHQEQQPGIESQMTPQPQSFAEGYRGSDKLRDKVALITGGDSGIGRAVAIAFAKEGAN  68

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             V  +Y+   ED DA+ T    K+A  +  +  +AI  D+G +  C+ +VE  V  +G +D
Sbjct  69    VVISYLN--EDDDAKKT----KEAIEQQGRRCIAIAGDIGDENLCQNLVEQTVKEFGSLD  122

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   SIE+I   +LER FRTNIFS F+L K ALKH+KEGS+IINTTSVTAY
Sbjct  123   ILVNNAAEQHPQESIEDITAEQLERTFRTNIFSMFYLTKAALKHLKEGSAIINTTSVTAY  182

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+ +LLDYS+TKGAIVAFTR L+  L E+GIRVNGVAPGPIWTPLIPA+F EE+  +FG
Sbjct  183   KGNQQLLDYSSTKGAIVAFTRSLSQSLAEKGIRVNGVAPGPIWTPLIPATFPEEKVEKFG  242

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
                 + RAGQ  EVAPS+VFLAS  +SSY+TGQILHPNGG+++NG
Sbjct  243   ADTALGRAGQPDEVAPSFVFLAS-KDSSYMTGQILHPNGGSVING  286



>ref|WP_035189366.1| short-chain dehydrogenase [Bacillus coagulans]
 gb|KGT38702.1| short-chain dehydrogenase [Bacillus coagulans P38]
Length=290

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 219/286 (77%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q Q+ QPG E  M+P P+    +YK S KL GKVAL+TGGDSGIG++V   FA EGA
Sbjct  12    LPAQHQNRQPGTETEMNPQPENVKDNYKGSGKLDGKVALITGGDSGIGKSVAIYFAKEGA  71

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   E++DA+ T ++++K   EG ++ + IP D+G +++CR  VE V  ++GR+
Sbjct  72    HVAICYLN--ENEDAKQTKELVEK---EG-RQCLIIPGDIGEEQHCRDAVEKVAGTFGRL  125

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   SI +I E +L + FRTNIFSQFF+VK AL H+KEGSSIINTTS+TA
Sbjct  126   DILVNNAAEQHPQKSILDISEEQLVKTFRTNIFSQFFMVKAALPHLKEGSSIINTTSITA  185

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GSP+LLDYSATKGAI AF R L+  LV +GIRVNGVAPGPIWTPLIP++F+ ++  +F
Sbjct  186   YQGSPQLLDYSATKGAIAAFIRSLSQALVSKGIRVNGVAPGPIWTPLIPSTFTADQVEKF  245

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G  VPMKR GQ  E+AP+YV+LAS  +SSY+TGQ++H NGGT++NG
Sbjct  246   GSDVPMKRPGQPSELAPAYVYLAS-DDSSYVTGQVIHVNGGTVING  290



>ref|WP_009674322.1| MULTISPECIES: short-chain dehydrogenase [Paenibacillus]
 gb|EGL17227.1| oxidoreductase, short chain dehydrogenase/reductase family protein 
[Paenibacillus sp. HGF7]
 gb|EPD81015.1| hypothetical protein HMPREF1207_04772 [Paenibacillus sp. HGH0039]
Length=289

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 216/286 (76%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ Q++QPG E  M P PQ+    Y+P+ KL+GKVAL+TGGDSGIGRAV   +A EGA
Sbjct  11    FPPQHQNNQPGIETQMTPQPQFEDSKYRPAGKLKGKVALITGGDSGIGRAVAVAYAQEGA  70

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   E  DA  T  ++++   EG K  + IP DLG +  C+KV++  V+  G++
Sbjct  71    DVAIVYLS--EHSDAEKTKSLVEQ---EGRK-CLLIPGDLGDESFCKKVIDQTVSGLGKL  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNA EQH   S+E+I   +LE+ FRTNIFS FFL K AL H+K GS++INT S+TA
Sbjct  125   DILVNNAGEQHPQNSLEDITAEQLEKTFRTNIFSMFFLTKAALPHLKRGSAVINTASITA  184

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P L+DYS+TKGAIV+FTR L+  ++E+GIRVNGVAPGPIWTPLIP++F++++ A F
Sbjct  185   YKGNPTLIDYSSTKGAIVSFTRSLSQSVIEKGIRVNGVAPGPIWTPLIPSTFTKDKVAAF  244

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PM+RAGQ  E+APSYVFLAS  +SSY++GQILH NGGT+VNG
Sbjct  245   GSDTPMQRAGQPEELAPSYVFLAS-DDSSYMSGQILHVNGGTVVNG  289



>ref|WP_015182467.1| dehydrogenase [Microcoleus sp. PCC 7113]
 ref|YP_007121724.1| dehydrogenase [Microcoleus sp. PCC 7113]
 gb|AFZ18318.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Microcoleus sp. PCC 7113]
Length=289

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 171/284 (60%), Positives = 213/284 (75%), Gaps = 7/284 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ QD +PG E  M P PQ    +Y+ + KL+GKVAL+TGGDSGIGR+V   +A EGA 
Sbjct  12    PPQHQDQRPGSESKMTPKPQAQGSNYRAAGKLEGKVALITGGDSGIGRSVAILYAKEGAD  71

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   EDKDA +T ++++    EG K  + +  D+G ++ C++ V+  V   G++D
Sbjct  72    VAIMYLS--EDKDAEETKRLVE---AEG-KRCVMLKGDVGDEQFCQQAVQQTVQELGQLD  125

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             IL+NNAAEQH   SIE+I   +LER FRTNIF  FF+ K AL H+KEGS+IINTTSVTAY
Sbjct  126   ILINNAAEQHPQESIEKITAEQLERTFRTNIFGMFFMAKAALPHLKEGSAIINTTSVTAY  185

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+P+LLDYS+TKGAIVAFTR L+  LVE+ IRVNGVAPGPIWTPLIP++F EE+   FG
Sbjct  186   KGNPQLLDYSSTKGAIVAFTRSLSKSLVEKKIRVNGVAPGPIWTPLIPSTFPEEKVESFG  245

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              QVPM RAGQ  EVAP YVFLAS  +SSY++GQILHPNGG +VN
Sbjct  246   AQVPMHRAGQPEEVAPCYVFLAS-DDSSYMSGQILHPNGGEVVN  288



>ref|WP_026236114.1| short-chain dehydrogenase [Pontibacter roseus]
Length=286

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 216/291 (74%), Gaps = 7/291 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA+     PPQKQ+ QPG EH M P P+Y  ++YK S+KL+GKVAL+TGGDSGIGRAV  
Sbjct  1     MANKPESLPPQKQEKQPGDEHKMTPQPEYIRENYKGSDKLKGKVALITGGDSGIGRAVAV  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   EDKDA+DTL +++K   +G    + I  D+G +  C+K V+  
Sbjct  61    HFAREGADVAIVYL--NEDKDAKDTLGLIEKEGRKG----LIIAGDIGDEAFCKKAVQQA  114

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V   G++DILVNNAAEQH+   +++I + +L+R F+TNIFS F++ K AL+HMKEGS+I+
Sbjct  115   VKELGKLDILVNNAAEQHEQSDLKDISKDQLQRTFQTNIFSMFYMTKAALEHMKEGSTIV  174

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             N+TSVT+Y+GS  L+DY++TKGAI AFTR L+  L E+ IRVN VAPGPIWTPLIPASF 
Sbjct  175   NSTSVTSYRGSDHLMDYASTKGAITAFTRSLSANLAEKNIRVNAVAPGPIWTPLIPASFD  234

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIV  238
             E++  EFG+ VP+KR GQ  EVAP+YV LAS  + SYITGQ++H NGG  V
Sbjct  235   EDKVKEFGQNVPLKRPGQPSEVAPAYVLLAS-EDGSYITGQVIHVNGGEQV  284



>ref|WP_026100139.1| short-chain dehydrogenase [Microchaete sp. PCC 7126]
Length=285

 Score =   343 bits (879),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 219/293 (75%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             M ++    PPQ Q+   G E  M P P+     Y+ S+KL+ KVAL+TGGDSGIGRAV  
Sbjct  1     MPTETQLQPPQHQEPA-GVESKMTPKPKADDAQYRGSDKLKDKVALITGGDSGIGRAVAI  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA V  +Y+   ED  A++T Q+++K      ++ + IP D+  +  C+++VE  
Sbjct  60    AFAKEGANVVISYLNEHED--AKETKQLVEKY----GRQALIIPGDITDESFCQQLVEQT  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V  +G++DILVNNAAEQH   +IE+I + +LER FRTNIFS F+L K A+KH+  GS+II
Sbjct  114   VKEFGKLDILVNNAAEQHPQKNIEDISKEQLERTFRTNIFSMFYLTKAAIKHLHGGSAII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSP+LLDYS+TKGAIVAFTR L+  L+E+GIRVN VAPGPIWTPLIP++F 
Sbjct  174   NTTSVTAYKGSPQLLDYSSTKGAIVAFTRALSQNLIEKGIRVNAVAPGPIWTPLIPSTFP  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EE+ A FGKQVPM+RAGQ  EVAPSYVFLAS  ++SYI+GQ+LHPNGG ++NG
Sbjct  234   EEKVATFGKQVPMQRAGQPEEVAPSYVFLASD-DASYISGQVLHPNGGEVING  285



>ref|WP_015152646.1| short-chain dehydrogenase/reductase SDR [Chroococcidiopsis thermalis]
 ref|YP_007089964.1| short-chain dehydrogenase/reductase SDR [Chroococcidiopsis thermalis 
PCC 7203]
 gb|AFY86095.1| short-chain dehydrogenase/reductase SDR [Chroococcidiopsis thermalis 
PCC 7203]
Length=286

 Score =   342 bits (877),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/278 (59%), Positives = 213/278 (77%), Gaps = 7/278 (3%)
 Frame = -1

Query  1065  QPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVK  886
             +PGKE  M P P+     Y+ S KLQGKVAL+TGGDSGIGRAV   +A EGA VA  Y+ 
Sbjct  16    RPGKESEMTPQPKADDSKYRGSGKLQGKVALITGGDSGIGRAVAIAYAKEGADVAILYL-  74

Query  885   SQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAA  706
               E  DA++T ++++    E  K+ +AI  D+G +  C++ ++  ++ +G++DILVNNAA
Sbjct  75    -NEHDDAKETKRLVE----EQGKKAVAIAGDIGDENFCKQAIQQTIDEFGKLDILVNNAA  129

Query  705   EQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLL  526
             EQH   SIE+I   +LER FRTNIFS FF+ K A+ H+KEGS+I+NTTSVTAY+G+P LL
Sbjct  130   EQHPQESIEQISAEQLERTFRTNIFSMFFMTKAAMPHLKEGSAIVNTTSVTAYQGNPTLL  189

Query  525   DYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKR  346
             DYS+TKGAIVAFTR L+  L+E+GIRVN VAPGP+WTPLIP++F E++ A FGKQVPM+R
Sbjct  190   DYSSTKGAIVAFTRSLSKSLIEKGIRVNAVAPGPVWTPLIPSTFPEDKVANFGKQVPMQR  249

Query  345   AGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              GQ  E+APSYVFLAS  +SSYI GQ++HPNGGT+VNG
Sbjct  250   PGQPEEIAPSYVFLASD-DSSYIAGQVIHPNGGTVVNG  286



>ref|WP_015235209.1| dehydrogenase [Deinococcus peraridilitoris]
 ref|YP_007180667.1| dehydrogenase [Deinococcus peraridilitoris DSM 19664]
 gb|AFZ66901.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Deinococcus peraridilitoris DSM 19664]
Length=310

 Score =   343 bits (880),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 172/290 (59%), Positives = 215/290 (74%), Gaps = 7/290 (2%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             +DG   PPQ QD QPG E  M P P Y    YK + KL+GKVAL+TGGDSGIGRAV   F
Sbjct  27    NDGKTLPPQHQDRQPGLETEMTPRPIYIKDSYKAAGKLEGKVALITGGDSGIGRAVAVHF  86

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             A EGA V   Y+   E++DA +T ++++    EG +  +AI  D+G ++ C+  VE  V+
Sbjct  87    AREGADVCIMYLN--ENQDAEETKRLVE---AEG-RRCLAIAGDVGDEQFCQSAVERTVS  140

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
               GR+D LVNNAAEQH   S+ +I   +LE+ FRTNIF  F++ K AL H++ GS+IINT
Sbjct  141   ELGRLDCLVNNAAEQHPQESLTDISSEQLEKTFRTNIFGYFYMAKAALPHLQAGSTIINT  200

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
             +SVT YKGSP+LLDYS+TKGAIVAFTR L++ LVE+GIRVNGVAPGPIWTPLIPA+FSE+
Sbjct  201   SSVTDYKGSPQLLDYSSTKGAIVAFTRSLSMNLVEKGIRVNGVAPGPIWTPLIPATFSED  260

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             + AEFG  VPMKR GQ  EVAP +VFLAS  +SSYI+GQ+LHPNGG +VN
Sbjct  261   KVAEFGASVPMKRPGQPAEVAPCFVFLAS-DDSSYISGQMLHPNGGEVVN  309



>ref|WP_015176884.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Oscillatoria nigro-viridis]
 ref|YP_007116029.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ07613.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Oscillatoria nigro-viridis 
PCC 7112]
Length=286

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 215/293 (73%), Gaps = 7/293 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             M ++    P Q Q+ QPG E  M P PQ  ++ Y+ S+KL+ K+AL+TGGDSGIGRAV  
Sbjct  1     MPTEQKIHPAQHQEQQPGIESQMTPQPQSFAEGYRGSDKLRDKIALITGGDSGIGRAVAI  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA V  +Y+   E+ DA+ T    K+A  +  +  MAI  D+G +  C+ +VE  
Sbjct  61    AFAKEGANVVISYLN--ENDDAKKT----KEAIEQQGRRCMAIAGDIGDETVCQNLVEQT  114

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V  +G +DILVNNAAEQH   SIE I   +LER FRTNIFS F+L K ALKH+KEGS+II
Sbjct  115   VKEFGGLDILVNNAAEQHPQESIENITAEQLERTFRTNIFSMFYLTKAALKHLKEGSAII  174

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKG+ +LLDYS+TKGAIVAFTR L+  L E+GIRVNGVAPGPIWTPLIPA+F 
Sbjct  175   NTTSVTAYKGNQQLLDYSSTKGAIVAFTRSLSQSLAEKGIRVNGVAPGPIWTPLIPATFP  234

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EE+ A+FG    + RAGQ  EVAPSYVFLAS  +SSY+TGQILHPNGG+++NG
Sbjct  235   EEKVAKFGADTALGRAGQPDEVAPSYVFLAS-KDSSYMTGQILHPNGGSVING  286



>ref|WP_017291127.1| short-chain dehydrogenase [Leptolyngbya boryana]
Length=290

 Score =   342 bits (877),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/295 (60%), Positives = 219/295 (74%), Gaps = 15/295 (5%)
 Frame = -1

Query  1092  QFPPQKQDSQP--------GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAV  937
             Q  P+KQ SQP        G E  M PAPQ   + Y+ + KL GKVAL+TGGDSGIGRAV
Sbjct  3     QASPEKQKSQPPQQQDQQPGHESQMTPAPQSYGERYQAAGKLSGKVALITGGDSGIGRAV  62

Query  936   CQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVE  757
                FA EGA VA  Y+   E  DA++T +++++   EG +  +A+P D+G +  C+ +V+
Sbjct  63    AILFAKEGADVAIAYLN--EHDDAKETARLVEQ---EG-RRCLALPGDIGDESLCQSIVK  116

Query  756   SVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSS  577
               ++ +G +DILVNNAAEQH   SIE I   +LER FRTNIFS FFL K A+ H+KEGSS
Sbjct  117   KTIDEFGHLDILVNNAAEQHPQESIENITSEQLERTFRTNIFSMFFLTKAAVPHLKEGSS  176

Query  576   IINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPAS  397
             IINTTSVTAY+GSP+LLDYS+TKGAIVAFTR L+  L+E+ IRVNGVAPGPIWTPLIP++
Sbjct  177   IINTTSVTAYQGSPQLLDYSSTKGAIVAFTRSLSQSLIEKRIRVNGVAPGPIWTPLIPST  236

Query  396   FSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             F EE+   FGKQVPM+R GQ  EVAPSYVFLAS  +SSY++GQILHPNGG +VNG
Sbjct  237   FPEEKVESFGKQVPMQRVGQPDEVAPSYVFLASS-DSSYMSGQILHPNGGNVVNG  290



>ref|WP_026733559.1| short-chain dehydrogenase [Fischerella sp. PCC 9605]
Length=286

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 210/276 (76%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P P+     Y+ S+KL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPKADDSQYQGSSKLKNKIALITGGDSGIGRAVAIAFAKEGADVAIVYLN--  75

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T  +++       +  + I  D+G +  C++ V+  V+ +G++DIL+NNAAEQ
Sbjct  76    EHDDAKETKHLVEAQ----GRRAVTISGDIGDESFCQQAVQQTVDEFGKLDILINNAAEQ  131

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I + +LER FRTNIFS FFL K A+KH+KEGS+IINTTSVTAYKGSP+LLDY
Sbjct  132   HPQKSIEDISKEQLERTFRTNIFSMFFLTKAAMKHLKEGSAIINTTSVTAYKGSPELLDY  191

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLIPA+F EE+ A FG+QVPMKRAG
Sbjct  192   SSTKGAIVAFTRSLSQSLVEKGIRVNAVAPGPIWTPLIPATFPEEKVASFGEQVPMKRAG  251

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  E+APSYVFLAS  +SSY++GQ+LHPNGG +VNG
Sbjct  252   QPEEIAPSYVFLAS-DDSSYMSGQVLHPNGGVVVNG  286



>ref|WP_016859210.1| short-chain dehydrogenase [Fischerella muscicola]
Length=286

 Score =   342 bits (876),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 209/276 (76%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P PQ     Y+ S KL+ KVAL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPQADDSQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIVYLN--  75

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T  +++       ++   I  D+G +  C++ ++  ++ +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVEAQ----GRKAFTISGDVGDENFCQQAIQQTIDEFGKLDILVNNAAEQ  131

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I + +LER FRTNIFS FFL K ALK++KEGS+IINTTSVTAYKGS +LLDY
Sbjct  132   HPQKSIEDISQEQLERTFRTNIFSMFFLTKAALKYLKEGSNIINTTSVTAYKGSQELLDY  191

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLIPA+F EE+ A FGKQVPM+RAG
Sbjct  192   SSTKGAIVAFTRSLSQNLVEKGIRVNAVAPGPIWTPLIPATFPEEKVANFGKQVPMQRAG  251

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  E+APSYVFLAS  ++SYITGQ+LHPNGGT+VNG
Sbjct  252   QPEEIAPSYVFLAS-DDASYITGQVLHPNGGTVVNG  286



>ref|WP_015217262.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Anabaena cylindrica]
 ref|YP_007159559.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Anabaena cylindrica 
PCC 7122]
 gb|AFZ60649.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Anabaena cylindrica 
PCC 7122]
Length=285

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 217/285 (76%), Gaps = 8/285 (3%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q++ PG E  M+P P+  + +Y+ S KL+ K+AL+TGGDSGIGRAV   FA EGA 
Sbjct  9     PPQTQEA-PGVESKMEPKPKADNAEYRGSGKLKDKIALITGGDSGIGRAVAIAFAKEGAD  67

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+  QE  DA +T  +++K      ++ + I  D+  ++ C++ +E  V+ +G++D
Sbjct  68    VAIVYL--QEHGDATETKNLVEKH----GRKAVTITGDITHEDFCQQAIEQTVDEFGKLD  121

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   SIE+I + +LER FRTNIFS FFL K A+KH+++GSSIINTTSVTAY
Sbjct  122   ILVNNAAEQHPQNSIEDISQEQLERTFRTNIFSMFFLTKAAMKHLRQGSSIINTTSVTAY  181

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KGS +LLDYS+TKGAIVAFTR L+  LV +GIRVN VAPGPIWTPLIP++F EE+   FG
Sbjct  182   KGSAQLLDYSSTKGAIVAFTRSLSQNLVSKGIRVNAVAPGPIWTPLIPSTFPEEKVENFG  241

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              QVPM+RAGQ  EVAPS+VFLAS  +SSY++GQ+LHPNGG IVNG
Sbjct  242   AQVPMERAGQPEEVAPSFVFLAS-DDSSYMSGQVLHPNGGEIVNG  285



>ref|WP_017318827.1| short-chain dehydrogenase [Mastigocladopsis repens]
Length=284

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/276 (61%), Positives = 212/276 (77%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P P+     Y+ S+KL+ KVAL+TGGDSGIGRAV   FA EGA VA +Y+   
Sbjct  16    GVESQMTPKPKADDPQYQGSDKLKDKVALITGGDSGIGRAVAIAFAKEGADVAISYLN--  73

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T  +++       +  +AI  D+G +  C++V++  V+ +G++DILVNNAAEQ
Sbjct  74    EHDDAKETKHLVESL----GRRAVAIAGDIGDEAFCQQVIQQTVDEFGKLDILVNNAAEQ  129

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I + +LER FRTNIFS FF+ K A+KH++EGSSIINTTSVTAYKG+P+LLDY
Sbjct  130   HPQKSIEDISKEQLERTFRTNIFSMFFMTKAAMKHLREGSSIINTTSVTAYKGNPQLLDY  189

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLIP++F EE+   FGKQVPM+RAG
Sbjct  190   SSTKGAIVAFTRALSQSLVEKGIRVNAVAPGPIWTPLIPSTFPEEKVETFGKQVPMQRAG  249

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  EVAPSYVFLAS  +SSY +GQ+LHPNGGT+VNG
Sbjct  250   QPEEVAPSYVFLAS-DDSSYFSGQVLHPNGGTVVNG  284



>ref|WP_007358209.1| MULTISPECIES: short-chain dehydrogenase [Kamptonema]
 emb|CBN59038.1| oxidoreductase [ [[Oscillatoria] sp. PCC 6506]
Length=286

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 215/293 (73%), Gaps = 7/293 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             M +     P Q Q+ +PG E  M P P+  + +Y+ S+KL+GKVAL+TGGDSGIGRAV  
Sbjct  1     MPTQEQTLPAQHQEQRPGSEAQMTPPPESQAAEYRGSDKLRGKVALITGGDSGIGRAVAI  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   ED  A+ T Q+++    E  +  +AI  D+G +  C+K+VE  
Sbjct  61    AFAKEGAEVAIAYLNEHED--AKQTQQLIE----EQGRRCLAIAGDVGDESFCQKLVEQT  114

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V ++G +DIL+NNAAEQH   SIE+I   +LER FRTNIFS F+L K ALKH+KEGS+II
Sbjct  115   VKAFGHLDILINNAAEQHPQESIEDITAEQLERTFRTNIFSMFYLTKAALKHLKEGSAII  174

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKG+ +LLDYS+TKGAIVAFTR L+  L ++ IRVNGVAPGPIWTPLIP++F 
Sbjct  175   NTTSVTAYKGNQQLLDYSSTKGAIVAFTRSLSGSLAKKEIRVNGVAPGPIWTPLIPSTFP  234

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EE+  +FG   P+ RAGQ  EVAP YVFLAS  +SSY+TGQILHPNGG ++NG
Sbjct  235   EEKVEKFGANTPLGRAGQPDEVAPCYVFLAS-KDSSYMTGQILHPNGGDVING  286



>ref|WP_036011125.1| short-chain dehydrogenase [Leptolyngbya sp. JSC-1]
Length=287

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 172/285 (60%), Positives = 215/285 (75%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             P Q Q+ +PG E  M P P+   + YK S+KL+ KVAL+TGGDSGIGRAV   +A EGA 
Sbjct  10    PKQHQEQRPGVEAEMTPRPKSQDKQYKGSDKLRNKVALITGGDSGIGRAVAIAYAKEGAD  69

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   E +DA++T +++++   EG K  +AI  D+G +  C++ V+  V   G++D
Sbjct  70    VAIVYLN--EHEDAKETQRLVEQ---EGRK-CVAIAGDIGVESFCQQAVQKTVQELGKLD  123

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   SIE I   +LER FRTNIFS F+L K AL H+KEGS+IIN+TSVTAY
Sbjct  124   ILVNNAAEQHPQESIENISAEQLERTFRTNIFSMFYLTKAALPHLKEGSAIINSTSVTAY  183

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+P+LLDYS TKGAIVAFTR L+  LV +GIRVNGVAPGPIWTPLIP++F EE+   FG
Sbjct  184   KGNPQLLDYSTTKGAIVAFTRSLSQALVGKGIRVNGVAPGPIWTPLIPSTFPEEKVESFG  243

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              QVPM+RAGQ  E+APSYVFLAS  +SSY++GQILHPNGG +VNG
Sbjct  244   AQVPMQRAGQPEEIAPSYVFLAS-DDSSYMSGQILHPNGGEVVNG  287



>gb|AHL75688.1| short-chain dehydrogenase [Pseudomonas stutzeri]
Length=285

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/293 (56%), Positives = 218/293 (74%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA +    PPQ+Q  +PGKE +M+P P++  +DYK + KLQGKVA++TGGDSGIGR+V  
Sbjct  1     MADENQTLPPQEQ-PEPGKEGLMNPRPEFRGEDYKAAGKLQGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   +D D  +T ++++    E  ++ +    D+   + CRKV++  
Sbjct  60    LFAREGADVAILYLDQHQDAD--ETRRVVE----EQGRQCLTFAGDVADRDVCRKVIDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +  +G++DILVNNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+KEG+SII
Sbjct  114   LAKFGKLDILVNNAAEQHPQKGLEDISEEQWEQTFRTNIFGMFQMTKAALPHLKEGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSP+LLDYSATKGAI AFTR L++ L ERGIRVNGVAPGPIWTPLIP++F 
Sbjct  174   NTTSVTAYKGSPQLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             EE+  +FG  VPM+R GQ  EVAP+YV+LAS  ++SY++GQ++H NGGT+VNG
Sbjct  234   EEKVQKFGANVPMERPGQPDEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>ref|WP_039713375.1| short-chain dehydrogenase [Scytonema millei]
 gb|KIF21032.1| short-chain dehydrogenase [Scytonema millei VB511283]
Length=286

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/276 (60%), Positives = 210/276 (76%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             GKE  M P P+     Y+ S KLQGKVAL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  18    GKESEMTPQPKADDSKYRGSGKLQGKVALITGGDSGIGRAVAIAYAKEGADVAILYL--N  75

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T ++++    E  K+ +AI  D+G +  C++ V+  V+ +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKRLVE----EQGKKAVAIAGDIGDENFCKQAVQQTVDEFGKLDILVNNAAEQ  131

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I   +LER FRTNIF  FFL K A+ H+KEGS+I+NTTSVTAY+G+P LLDY
Sbjct  132   HPQESIEQISAEQLERTFRTNIFGMFFLTKAAMPHLKEGSAIVNTTSVTAYQGNPTLLDY  191

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  L+E+GIRVN VAPGP+WTPLIP++F E++ A FGKQVPMKR G
Sbjct  192   SSTKGAIVAFTRSLSKSLIEKGIRVNAVAPGPVWTPLIPSTFPEDKVANFGKQVPMKRPG  251

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  E+APSYVFLAS  +SSYI GQ++HPNGGT+VNG
Sbjct  252   QPEEIAPSYVFLAS-DDSSYIAGQVIHPNGGTVVNG  286



>ref|WP_026964919.1| short-chain dehydrogenase [Alicyclobacillus pomorum]
Length=288

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/286 (59%), Positives = 214/286 (75%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ Q  QPG E  M+P P Y +     S KLQGK A+VTGGDSGIGRAV   FA EGA
Sbjct  10    FPPQHQQRQPGLEIEMNPRPFYDNPQAHGSGKLQGKTAIVTGGDSGIGRAVAVAFAKEGA  69

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  ++   E +DA +T + +++      +  ++I AD+G +E+C+ VV  V+N++GRI
Sbjct  70    DVAIVFLD--EHQDAEETARAVQQY----GRMCLSIAADIGVEEHCKNVVRDVMNTFGRI  123

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVNNAAEQH   S+E I   ++E+ FRTN+FS F++ K AL HM+ GSSI+NTTS+TA
Sbjct  124   DVLVNNAAEQHPQNSLEYITAEQIEKTFRTNVFSFFYMTKAALPHMQSGSSIVNTTSITA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG  +L+DYSATKGAIVAFTR L+ QLV RGIRVN VAPGPIWTPLIP++F  E+ A+F
Sbjct  184   YKGHEQLIDYSATKGAIVAFTRSLSQQLVGRGIRVNAVAPGPIWTPLIPSTFPAEQVAKF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKRAGQ IEVAPSYVFLAS  ++SY++GQ+LH NGGT+VNG
Sbjct  244   GSDTPMKRAGQPIEVAPSYVFLAS-DDASYMSGQVLHVNGGTVVNG  288



>ref|WP_026722248.1| short-chain dehydrogenase [Fischerella sp. PCC 9431]
Length=286

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 209/276 (76%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P PQ   + Y+ S KL+ K+AL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPQADDRQYQGSGKLKNKIALITGGDSGIGRAVAIAFAKEGADVAIVYLN--  75

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T  +++       ++   I  D+G +  C++ ++  V+ +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVEAQ----GRKAFTIAGDVGDENFCQQAIQQTVDEFGKLDILVNNAAEQ  131

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   +IE+I + +LER FRTNIFS FFL K AL+H+KEGSSI+NTTSVTAYKGS +LLDY
Sbjct  132   HPQKNIEDISKEQLERTFRTNIFSMFFLTKAALQHLKEGSSIVNTTSVTAYKGSQELLDY  191

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLIPA+F EE+ A FGKQVPM+R G
Sbjct  192   SSTKGAIVAFTRSLSQNLVEKGIRVNAVAPGPIWTPLIPATFPEEKVANFGKQVPMQRPG  251

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  E+APSYVFLAS  ++SYITGQ+LHPNGGT+VNG
Sbjct  252   QPEEIAPSYVFLAS-DDASYITGQVLHPNGGTVVNG  286



>ref|WP_016877040.1| short-chain dehydrogenase [Chlorogloeopsis fritschii]
Length=286

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/276 (60%), Positives = 210/276 (76%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P P+     Y+ S KL+ KVAL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPKAEDSQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIAYLN--  75

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T  +++       +  + +  D+G +  C+++V+  V+ +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVEAQ----GRRAVTVAGDIGDETFCQQLVQQTVDEFGKLDILVNNAAEQ  131

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I + +LER FRTNIFS FFL K A+KH+KEGS+IINTTSVTAYKGSP+LLDY
Sbjct  132   HPQKSIEDISKDQLERTFRTNIFSMFFLTKAAIKHLKEGSAIINTTSVTAYKGSPQLLDY  191

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLIPA+F E++ A FGKQVPM+RAG
Sbjct  192   SSTKGAIVAFTRSLSESLVEKGIRVNAVAPGPIWTPLIPATFPEDKVANFGKQVPMQRAG  251

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  E+APSYVFLAS  ++SY++GQ+LHPNGG +VNG
Sbjct  252   QPEEIAPSYVFLAS-DDASYMSGQVLHPNGGVVVNG  286



>ref|WP_029007658.1| short-chain dehydrogenase [Azospirillum halopraeferens]
Length=286

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/293 (58%), Positives = 213/293 (73%), Gaps = 7/293 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA      P Q QD QPG+E  M P P  +   Y+ S KL+GKVAL+TGGDSGIGRAV  
Sbjct  1     MAQQEGGQPAQHQDVQPGREGPMRPHPSETRPGYRGSGKLEGKVALITGGDSGIGRAVAV  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA V   Y+  +ED+DARDT ++++    EG    + I  D+G ++ CR+ V  +
Sbjct  61    LFAREGARVGIVYL--EEDEDARDTAELVR---AEGQTCTL-IRGDVGNEDICRRAVAQM  114

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +  +GR+DILVNNAAEQH     E+I   +LER FRTNIF+ F+L + AL HMKEG++I+
Sbjct  115   IEEHGRLDILVNNAAEQHPQERFEDITAEQLERTFRTNIFAYFYLTRAALPHMKEGATIV  174

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKG+P L+DYS+TKGAIVAFTR LALQL ERGIRVN VAPGPIWTPLIP++F 
Sbjct  175   NTTSVTAYKGNPTLVDYSSTKGAIVAFTRSLALQLAERGIRVNAVAPGPIWTPLIPSTFP  234

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              E+   FG  VP+ R GQ  EVAP+YVFLA   +SSY++GQ+LHPNGG+++NG
Sbjct  235   PEKVESFGTDVPLGRPGQPDEVAPAYVFLAGN-DSSYMSGQVLHPNGGSVING  286



>ref|WP_017310770.1| short-chain dehydrogenase [Fischerella sp. PCC 9339]
Length=286

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 209/276 (76%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P PQ     Y+ S KL+ KVAL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMTPKPQADDPQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIAYLN--  75

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T  +++       ++   I  D+G +  C++ ++  V+ +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVEAQ----GRKAFTISGDVGDENFCQQAIQQTVDEFGKLDILVNNAAEQ  131

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I + +LE+ FRTNIFS FFL K ALK++KEGS+IINTTSVTAYKGS +LLDY
Sbjct  132   HPQKSIEDISKEQLEKTFRTNIFSMFFLTKAALKYLKEGSNIINTTSVTAYKGSQELLDY  191

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLIPA+F EE+ A FGKQVPM+RAG
Sbjct  192   SSTKGAIVAFTRSLSQNLVEKGIRVNAVAPGPIWTPLIPATFPEEKVANFGKQVPMQRAG  251

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  E+APSYVFLAS  ++SYITGQ+LHPNGGT+VNG
Sbjct  252   QPEEIAPSYVFLAS-DDASYITGQVLHPNGGTVVNG  286



>ref|WP_006528898.1| dehydrogenase of unknown specificity [Gloeocapsa sp. PCC 73106]
 gb|ELR98244.1| dehydrogenase of unknown specificity [Gloeocapsa sp. PCC 73106]
Length=289

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 216/285 (76%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q+ +PG E  M PAP+     Y+ S KL+ KVAL+TGGDSGIGR+V   FA EGA 
Sbjct  12    PPQHQEHRPGIESEMTPAPKADDSKYRGSEKLKNKVALITGGDSGIGRSVAIFFAKEGAN  71

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             V   Y+   ED  A++T ++++K   EG K  +AI  D+G +  C++ V+  +  +G++D
Sbjct  72    VVILYLDEHED--AQETQRLVEK---EGQK-CLAIAGDIGDESFCQQAVQKTIEEFGQLD  125

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             IL+NNAAEQH   SIE+I   +LER FRTNIF  FFL K A+ ++K+G++IINTTSVTAY
Sbjct  126   ILINNAAEQHPQDSIEDITAEQLERTFRTNIFGMFFLTKMAMPYLKKGAAIINTTSVTAY  185

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             +GSP+LLDYS+TKGAIVAFTR L+  L+E+ IRVNGVAPGPIWTPLIP++FSEE+ A FG
Sbjct  186   QGSPQLLDYSSTKGAIVAFTRSLSQALIEKEIRVNGVAPGPIWTPLIPSTFSEEKVANFG  245

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             KQVPM+R GQ  EVAP YVFLAS  +SSY++GQILHPNGG +VNG
Sbjct  246   KQVPMQRVGQPEEVAPCYVFLAS-DDSSYMSGQILHPNGGNVVNG  289



>ref|WP_015148322.1| dehydrogenase [Oscillatoria acuminata]
 ref|YP_007085598.1| dehydrogenase [Oscillatoria acuminata PCC 6304]
 gb|AFY81678.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Oscillatoria acuminata PCC 6304]
Length=286

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 219/293 (75%), Gaps = 7/293 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA+   Q P Q Q+ QPG E  M+P P+  + +YK S KL+ KVAL+TGGDSGIGR+V  
Sbjct  1     MATQEKQRPAQHQNQQPGLESEMNPRPKARASEYKGSGKLENKVALITGGDSGIGRSVAI  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   ED  A+ T ++++    EG +  + I  D+G    C +VV+  
Sbjct  61    LFAREGADVAIIYLNEHED--AKKTQEMVE---AEG-RRCLPIAGDIGEKSFCEQVVKQT  114

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V+++G +DIL+NNAAEQH   +IE+I + +LE+ FRTNIFS F+L + A+ H+KEGS+I+
Sbjct  115   VDAFGHLDILINNAAEQHPQENIEDITQEQLEKTFRTNIFSMFYLTQAAMPHLKEGSAIV  174

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKG+  LLDYS+TKGAIVAFTR L+ ++V +GIRVNGVAPGPIWTPLIPA+F 
Sbjct  175   NTTSVTAYKGNETLLDYSSTKGAIVAFTRALSQKVVSKGIRVNGVAPGPIWTPLIPATFP  234

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              E+ A FG+QVPMKRAG+  EVA SYVFLAS  +SSY+TGQILHPNGGT+V G
Sbjct  235   PEKVASFGQQVPMKRAGEPEEVATSYVFLAS-DDSSYMTGQILHPNGGTVVGG  286



>ref|WP_016865637.1| short-chain dehydrogenase [Fischerella muscicola]
Length=286

 Score =   337 bits (865),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 208/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P PQ     Y+ S KL+ KVAL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GIESEMSPKPQADDPQYQGSGKLKNKVALITGGDSGIGRAVAIAFAKEGADVAIAYLN--  75

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T  +++       ++ + I  D+G +  C++ ++  ++ +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKHLVEAQ----GRKAVTISGDVGDETFCQQAIQQTIDEFGKLDILVNNAAEQ  131

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I + +LE+ FRTNIFS FFL K ALKH++EG SIINTTSVTAYKGSP+LLDY
Sbjct  132   HPQKSIEDISKEQLEQTFRTNIFSMFFLTKAALKHLQEGGSIINTTSVTAYKGSPELLDY  191

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLIPA+F EE+ A FGKQVPM+R G
Sbjct  192   SSTKGAIVAFTRSLSQSLVEKGIRVNAVAPGPIWTPLIPATFPEEKVANFGKQVPMQRPG  251

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  E+APSYVFLAS  ++SYITGQ+LHPNGG +VNG
Sbjct  252   QPEEIAPSYVFLAS-DDASYITGQVLHPNGGVVVNG  286



>ref|WP_015204565.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Crinalium epipsammum]
 ref|YP_007143970.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Crinalium epipsammum 
PCC 9333]
 gb|AFZ14460.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Crinalium epipsammum 
PCC 9333]
Length=285

 Score =   337 bits (865),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 167/276 (61%), Positives = 209/276 (76%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P PQ     Y+ S KL+GKVAL+TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  17    GIESEMTPKPQADDDKYRGSGKLEGKVALITGGDSGIGRAVAIAFAKEGANVAIAYLN--  74

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++  Q++++      ++   I  D+G +  C++ V+  V++ G++DILVNNAAEQ
Sbjct  75    EHDDAKEAKQLVEQQ----GRKCFTIAGDIGDESFCQQAVQQTVDALGQLDILVNNAAEQ  130

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I   +LER FRTNIF+ F+L K A+KH+KEGS+IINTTSVTAYKG+ +LLDY
Sbjct  131   HPQESIEDITAEQLERTFRTNIFAMFYLTKAAMKHLKEGSAIINTTSVTAYKGNQQLLDY  190

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIV FTR L+  L+E+GIRVNGVAPGPIWTPLIPA+F EE+ A FGK+VPM+RAG
Sbjct  191   SSTKGAIVTFTRSLSQSLIEKGIRVNGVAPGPIWTPLIPATFPEEKVASFGKEVPMQRAG  250

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  E+APSYVFLAS  +SSYI+GQILHPNGG +VNG
Sbjct  251   QPEEIAPSYVFLAS-DDSSYISGQILHPNGGVVVNG  285



>ref|WP_014820194.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 ref|YP_006457654.1| short-chain dehydrogenase [Pseudomonas stutzeri CCUG 29243]
 gb|AFM33231.1| short-chain dehydrogenase [Pseudomonas stutzeri CCUG 29243]
Length=285

 Score =   337 bits (864),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 215/293 (73%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQ+Q  +PGKE +M+P P+Y  +DYK + KL+GKVA++TGGDSGIGR+V  
Sbjct  1     MAEDNQTLPPQEQ-PEPGKEGLMNPRPEYRGKDYKAAGKLEGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              +A EGA VA  Y+   +D  A +T  ++++      +  +    D+   E CRKV++  
Sbjct  60    LYAREGADVAILYLDQHQD--AEETRTVVEQY----GRRCLTFAGDVADREVCRKVIDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             + ++G++DILVNNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+ +G+SII
Sbjct  114   LAAFGKLDILVNNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSP+LLDYSATKGAI AFTR L++ L ERGIRVNGVAPGPIWTPLIP++F 
Sbjct  174   NTTSVTAYKGSPQLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              +E AEFG   PMKR GQ  EVAP+YV+LAS  +++Y++GQ++H NGGT+VNG
Sbjct  234   ADEVAEFGSNTPMKRPGQPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_038072904.1| short-chain dehydrogenase [Tolypothrix bouteillei]
 gb|KIE07269.1| short-chain dehydrogenase [Tolypothrix bouteillei VB521301]
Length=285

 Score =   337 bits (864),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 171/284 (60%), Positives = 208/284 (73%), Gaps = 8/284 (3%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q+  PG+E  M P PQ  +  YK S+KL+GKVAL+TG DSGIGRA    FA EGA 
Sbjct  9     PPQHQNP-PGREGEMTPKPQSQNPQYKGSSKLEGKVALITGADSGIGRATAILFAREGAD  67

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+  Q+D +    L      + EG +  + I  D+G +  C++ V+  VN  G +D
Sbjct  68    VAVVYLSEQQDAEETKRL-----VEAEG-RRCLLIKGDVGGEPFCQEAVQQTVNQLGHLD  121

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             IL+NNAAEQH   SIE+I   +LER FRTNIF  FF+ K AL H+KEGS+IINTTSVTAY
Sbjct  122   ILINNAAEQHPQQSIEDISAEQLERTFRTNIFGMFFITKAALPHLKEGSAIINTTSVTAY  181

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+P+LLDYSATKGAIVAFTR L+  LVE+GIRVNGVAPGPIWTPLIP++F E++   FG
Sbjct  182   KGNPQLLDYSATKGAIVAFTRSLSQSLVEKGIRVNGVAPGPIWTPLIPSTFPEDKVKSFG  241

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              QVPM+RAGQ  EVAP YVFLAS  +SSY++GQILHPNGG +VN
Sbjct  242   AQVPMQRAGQPEEVAPCYVFLASH-DSSYMSGQILHPNGGEVVN  284



>ref|WP_038088120.1| short-chain dehydrogenase [Tumebacillus flagellatus]
 gb|KEO83213.1| short-chain dehydrogenase [Tumebacillus flagellatus]
Length=287

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 209/288 (73%), Gaps = 9/288 (3%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             + PPQ QD QPG E VM+P P +   D   S KLQGKVAL+TGGDSGIGRAV   FA EG
Sbjct  8     RVPPQTQDRQPGFETVMEPRPVFEYPDAVGSGKLQGKVALITGGDSGIGRAVALAFAREG  67

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEG-AKEPMAIPADLGFDENCRKVVESVVNSYG  736
             A VA  Y+   ED  A +T+     A+VE   +  +AI  D+G +E CR +V++V+ ++G
Sbjct  68    ADVAIAYLDEHED--AAETV-----ARVEAKGRRCLAISGDIGLEETCRSIVDAVIETFG  120

Query  735   RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSV  556
             R+DILVNNA EQH    +E+I   +L R + TNIF+ FFL K AL H+K G+SIINT S+
Sbjct  121   RLDILVNNAGEQHVQERLEDISAAQLIRTYATNIFAMFFLTKAALPHLKRGASIINTASI  180

Query  555   TAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECA  376
             TAY G+ KL+DYS+TKGA+VAFTR L++ L  RGIRVN VAPGPIWTPLIPASFS E+  
Sbjct  181   TAYCGNEKLIDYSSTKGAVVAFTRSLSINLEPRGIRVNAVAPGPIWTPLIPASFSAEDVG  240

Query  375   EFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              FG  VPM R GQ +EVAPSY+FLAS  ++SY++GQ+LHPNGG IVNG
Sbjct  241   NFGDDVPMNRPGQPVEVAPSYLFLAS-DDASYMSGQVLHPNGGYIVNG  287



>ref|WP_012409849.1| short-chain dehydrogenase [Nostoc punctiforme]
 ref|YP_001866818.1| short-chain dehydrogenase/reductase SDR [Nostoc punctiforme PCC 
73102]
 gb|ACC81875.1| short-chain dehydrogenase/reductase SDR [Nostoc punctiforme PCC 
73102]
Length=312

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 211/285 (74%), Gaps = 8/285 (3%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ+Q+  PG E  M P P+     Y+ S KLQ KVAL+TG DSGIGRAV   FA EGA 
Sbjct  36    PPQQQEV-PGVESEMTPKPKADDAQYRGSGKLQDKVALITGADSGIGRAVAIAFAKEGAD  94

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   E  DA++T  +++K      +  + I  D+G +  C++ ++  V  +G++D
Sbjct  95    VAILYLN--EHDDAKETKHLVEKQ----GRRAVTIAGDIGDETFCQQAIQQTVGEFGKLD  148

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             IL+NNAAEQH   SIEEI + +LER FRTNIFS FF+ K ALKH++ GS+IINTTSVTAY
Sbjct  149   ILINNAAEQHPKQSIEEITKEQLERTFRTNIFSMFFMTKAALKHLQTGSAIINTTSVTAY  208

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KGSP+LLDYS+TKGAIVAFTR L+  LV +GIRVN VAPGPIWTPLIP++F EE+   FG
Sbjct  209   KGSPQLLDYSSTKGAIVAFTRSLSQNLVSKGIRVNAVAPGPIWTPLIPSTFPEEKVESFG  268

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             KQVPM+RAGQ  EVAPSYVFLAS  ++SY++GQ+LH NGG +VNG
Sbjct  269   KQVPMQRAGQPEEVAPSYVFLAS-DDASYVSGQVLHVNGGEVVNG  312



>ref|WP_007960687.1| short-chain dehydrogenase [Pelosinus fermentans]
 gb|EIW46987.1| short chain dehydrogenase/reductase family oxidoreductase [Pelosinus 
fermentans JBW45]
Length=284

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/286 (59%), Positives = 210/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ Q+ QPG E  M+P P   S +Y+ S+KL+ KVAL++GGDSGIGRAV   FA EGA
Sbjct  6     FPPQHQNQQPGVESQMNPRPISISDNYRSSSKLENKVALISGGDSGIGRAVALAFAREGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   E  DA +T    KK   E  K  + I  D+G +  C++VV   +  +G++
Sbjct  66    NVAIAYLN--EHADAGET----KKLVEETGKRCLIIAGDIGNETFCQQVVAETIKEFGQL  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   S++ I   +LER FRTNIFS F+L K AL H+K GSSIINT SVTA
Sbjct  120   DILVNNAAEQHVQTSLQNISALQLERTFRTNIFSYFYLSKAALPHLKYGSSIINTASVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+G+ +L+DYSATKGAIV+FTR L+  L+ +GIRVNGVAPGPIWTPLIPASF+++  A+F
Sbjct  180   YEGNEQLIDYSATKGAIVSFTRSLSQSLIGQGIRVNGVAPGPIWTPLIPASFNDQHVAQF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G+  PMKRAGQ  EVAP YVFLAS  +SSY++GQILH NGGTIVNG
Sbjct  240   GQNTPMKRAGQPAEVAPCYVFLASV-DSSYMSGQILHVNGGTIVNG  284



>ref|WP_023445357.1| short-chain dehydrogenase [Pseudomonas chloritidismutans]
 gb|ESQ99282.1| short-chain dehydrogenase [Pseudomonas chloritidismutans AW-1]
 emb|CEG51652.1| Uncharacterized oxidoreductase YhxC [Pseudomonas xanthomarina]
Length=285

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 215/293 (73%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQ+Q  +PGKE +M+P P+Y  +DYK + KL+GKVA++TGGDSGIGR+V  
Sbjct  1     MAEDNQTLPPQEQ-PEPGKEGLMNPRPEYRGEDYKAAGKLEGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              +A EGA VA  Y+   +D  A +T  ++++      +  +    D+   + CRKV++  
Sbjct  60    LYAREGADVAILYLDQHQD--AEETRTVVEQY----GRRCLTFAGDVADRDVCRKVIDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             + ++G++DILVNNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+ +G+SII
Sbjct  114   LAAFGKLDILVNNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSP+LLDYSATKGAI AFTR L++ L ERGIRVNGVAPGPIWTPLIP++F 
Sbjct  174   NTTSVTAYKGSPQLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              +E AEFG   PMKR GQ  EVAP+YV+LAS  +++Y++GQ++H NGGT+VNG
Sbjct  234   ADEVAEFGSNTPMKRPGQPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_003292953.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EWC40891.1| short-chain dehydrogenase [Pseudomonas stutzeri KOS6]
Length=285

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 215/293 (73%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA +    PPQ+Q  +PGKE +M+P P+Y  +DYK + KL+GKVAL+TGGDSGIGR+V  
Sbjct  1     MADENQTLPPQEQ-PEPGKEGLMNPRPEYRGEDYKAAGKLEGKVALITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   + +DA  T +++++      +  +    D+   E CR  +E  
Sbjct  60    LFAREGADVAILYL--DQHQDAEQTREVVEQY----GRRCLTFAGDVADREVCRNAIEET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             ++ +G++DILVNNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+ +G+SII
Sbjct  114   LSKFGKLDILVNNAAEQHPQNGLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSPKLLDYSATKGAI AFTR L++ L ERGIRVNGVAPGPIWTPLIP++F+
Sbjct  174   NTTSVTAYKGSPKLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFA  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              +E AEFG   PMKR GQ  +VAP+YV+LAS  +++Y++GQ++H NGGT+VNG
Sbjct  234   ADEVAEFGSNTPMKRPGQPDDVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_022539629.1| short-chain dehydrogenase [Ralstonia pickettii]
 ref|YP_008600344.1| short-chain dehydrogenase [Ralstonia pickettii DTP0602]
 gb|AGW94910.1| short-chain dehydrogenase [Ralstonia pickettii DTP0602]
Length=291

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/285 (60%), Positives = 205/285 (72%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ QD QPG E  M P P   + DY  S +L+G+VALVTGGDSGIGRA+   FA EGA 
Sbjct  14    PPQHQDRQPGLEAPMRPQPDSGADDYVGSGRLKGRVALVTGGDSGIGRAIAVAFAREGAD  73

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   E  DAR T+++++ A     ++ +AI  DL    +   V    +  YG++D
Sbjct  74    VAIAYLN--EHADARATVELVEAA----GRKCLAIAGDLADHAHAEAVARQTLQQYGKLD  127

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   S+E+ID  ++E  FRTN+F+ F L +  L HMK GSSI+NTTSVTAY
Sbjct  128   ILVNNAAEQHPKESLEDIDAEQVEATFRTNVFAMFHLTRALLPHMKPGSSILNTTSVTAY  187

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             +GS  LLDYSATKGAIV+FTR LALQ+VERGIRVNGVAPGPIWTPLIP++F+ EE AEFG
Sbjct  188   RGSKHLLDYSATKGAIVSFTRSLALQVVERGIRVNGVAPGPIWTPLIPSTFTPEEVAEFG  247

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             K+ PM R GQ  EVA  YVFLAS   +SYITGQILH NGG +VNG
Sbjct  248   KKTPMGRPGQPFEVAGGYVFLASD-AASYITGQILHINGGEVVNG  291



>ref|WP_015138394.1| dehydrogenase [Nostoc sp. PCC 7524]
 ref|YP_007075545.1| dehydrogenase [Nostoc sp. PCC 7524]
 gb|AFY47948.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Nostoc sp. PCC 7524]
Length=285

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/285 (60%), Positives = 211/285 (74%), Gaps = 8/285 (3%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ+Q+  PG E  M P P+     Y+ S KLQ KVAL+TGGDSGIGRAV   FA EGA 
Sbjct  9     PPQEQEL-PGVESKMQPRPKAEDAQYRGSGKLQDKVALITGGDSGIGRAVAIAFAKEGAD  67

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VAF Y+K  E  DA +T    K    E  +  ++I  D+  +  C++VV+  V+ +G++D
Sbjct  68    VAFVYLK--EHSDAEET----KNRVEEHGRRALSIAGDITDEGFCQRVVQQTVDEFGKLD  121

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             IL+NNAAEQH   SIE+I   +LER FRTNIFS F+L K A+KH+++GS+IINTTSVTAY
Sbjct  122   ILINNAAEQHPQNSIEDITSEQLERTFRTNIFSMFYLTKAAIKHLQKGSAIINTTSVTAY  181

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+ +LLDYS+TKGAIVAFTR L+  L+ +GIRVN VAPGPIWTPLIPA+F  ++ A FG
Sbjct  182   KGNQQLLDYSSTKGAIVAFTRSLSQNLISKGIRVNAVAPGPIWTPLIPATFPADKVANFG  241

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             KQVPM RAGQ  EVAPSYVFLA   +SSY++GQ+LHPNGG IVNG
Sbjct  242   KQVPMGRAGQPEEVAPSYVFLA-ADDSSYMSGQVLHPNGGEIVNG  285



>ref|WP_010810657.1| MULTISPECIES: short-chain dehydrogenase [Burkholderiaceae]
 ref|YP_841851.1| short chain dehydrogenase [Ralstonia eutropha H16]
 emb|CAJ97121.1| short chain dehydrogenase [Ralstonia eutropha H16]
 gb|EON19967.1| short chain dehydrogenase [Ralstonia sp. GA3-3]
Length=285

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 206/287 (72%), Gaps = 9/287 (3%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q  QPG E  M P P   + DY  S +L+G+ AL+TGGDSGIGRA+   FA EGA
Sbjct  7     IPPQHQSRQPGLESAMRPQPDSGADDYVGSGRLRGRAALITGGDSGIGRAIAVAFAREGA  66

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGA-KEPMAIPADLGFDENCRKVVESVVNSYGR  733
              VA  Y+   E  DAR+T+++     VEGA ++ +AI  DL    +   V    +  YG+
Sbjct  67    DVAIAYL--DEHADARETVEL-----VEGAGRKCLAIAGDLADRAHAEAVARQALQQYGK  119

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNAAEQH   S+EE+D +++E  FRTN+F+ F L +  L H+K G+SI+NTTSVT
Sbjct  120   LDILVNNAAEQHSKASLEEVDASQVEATFRTNVFAMFHLTRAVLPHLKSGASILNTTSVT  179

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+GS  LLDYSATKGAIV+FTR LALQ+VERGIRVNGVAPGPIWTPLIP++F+ EE AE
Sbjct  180   AYRGSKHLLDYSATKGAIVSFTRSLALQVVERGIRVNGVAPGPIWTPLIPSTFTAEEVAE  239

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FGK+ PM R GQ  EVA  +VFLAS   +SYITGQILH NGG +VNG
Sbjct  240   FGKKTPMGRPGQPFEVAAGFVFLAS-DAASYITGQILHINGGEVVNG  285



>ref|WP_029045306.1| short-chain dehydrogenase [Cupriavidus sp. amp6]
Length=285

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/285 (58%), Positives = 209/285 (73%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ QD QPG E  M P P   + DY  S +LQG+VAL+TGGDSGIGRA+   FA EGA 
Sbjct  8     PPQHQDRQPGLEAPMRPQPDSGADDYVGSGRLQGRVALITGGDSGIGRAIAVAFAREGAD  67

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             +A  Y+   E  DAR+T+++++ +     ++ +A+  DL    +   V    ++ YG++D
Sbjct  68    IAIAYL--DEHADARETVELVEAS----GRKCLAVAGDLADCSHAEGVARQTLHQYGKLD  121

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   S+E++DE+++E  FRTN+F+ F L +  L HMK G+SI+NTTSVTAY
Sbjct  122   ILVNNAAEQHPEKSLEDVDESQVEATFRTNVFAMFHLTRAVLPHMKPGASILNTTSVTAY  181

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             +GS  LLDYSATKGAIV+FTR LALQ+VERGIRVNGVAPGPIWTPLIP++F+ EE AEFG
Sbjct  182   RGSKHLLDYSATKGAIVSFTRSLALQVVERGIRVNGVAPGPIWTPLIPSTFTAEEVAEFG  241

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             K+ PM R GQ  EVA  +VFLAS   +SYITGQILH NGG +VNG
Sbjct  242   KKTPMGRPGQPFEVAAGFVFLAS-DAASYITGQILHINGGEVVNG  285



>gb|KIF81345.1| short-chain dehydrogenase [Herbaspirillum sp. TSA66]
Length=286

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/293 (56%), Positives = 221/293 (75%), Gaps = 7/293 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA +     PQ QD QPG E  M P PQ   ++YK S KL+GKVAL+TGGDSGIGRAV  
Sbjct  1     MAQEKPNITPQHQDHQPGSEAAMSPPPQAEGKNYKGSGKLKGKVALITGGDSGIGRAVAI  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA V  +Y+  +E +DA++T ++++    EG +E + +  D+G    C+K+V++ 
Sbjct  61    AFAKEGANVVISYL--EEHQDAQETRRLIE---AEG-RECVTLAGDVGDSSFCKKMVDTT  114

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V+S+G++DILVNNAA+Q+   SI +I + +LE+ FRTNIFS F+ V+ AL H+K G+ II
Sbjct  115   VSSFGKLDILVNNAAQQYPQQSITDISDEQLEKTFRTNIFSMFYAVRAALPHLKPGARII  174

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAY+GS  LLDYSATKGAIVAFTR L+ QL E+GI VN VAPGP+WTPLIP++FS
Sbjct  175   NTTSVTAYRGSSHLLDYSATKGAIVAFTRSLSQQLAEKGIYVNAVAPGPVWTPLIPSTFS  234

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              E+ ++FG++VP+ R GQ  E+AP+YV+LA C ++SY+TGQ+LHPNGG ++NG
Sbjct  235   PEQVSKFGEKVPLGRPGQPDEIAPAYVYLA-CDDASYMTGQVLHPNGGEVING  286



>ref|WP_007937306.1| MULTISPECIES: short-chain dehydrogenase [Pelosinus]
 gb|EIW16327.1| short chain dehydrogenase/reductase family oxidoreductase [Pelosinus 
fermentans B4]
 gb|EIW22693.1| short-chain dehydrogenase/reductase SDR [Pelosinus fermentans 
A11]
 gb|EIW29720.1| short chain dehydrogenase/reductase family oxidoreductase [Pelosinus 
fermentans DSM 17108]
Length=284

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/286 (59%), Positives = 211/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ QD QPG E  M+P P   S +Y+ S+KL+ KVAL++GGDSGIGRAV   FA EGA
Sbjct  6     FPPQHQDQQPGIESQMNPRPISISDNYRSSSKLENKVALISGGDSGIGRAVALAFAKEGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V  +Y+   E  DA +T  +++    E  K  + I  D+G +  C++VV   V  +G++
Sbjct  66    NVVISYLN--EHADAGETKNLVE----ETGKRCLIIAGDIGNETFCQQVVAETVKEFGQL  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   S++ I   +LER FRTNIFS F+L K AL H+K GS+IINT SVTA
Sbjct  120   DILVNNAAEQHVQTSLQNISALQLERTFRTNIFSYFYLSKAALPHLKYGSAIINTASVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+G+ +L+DYSATKGAIV+FTR L+  L+ +GIRVNGVAPGPIWTPLIPASF+++  A+F
Sbjct  180   YEGNEQLIDYSATKGAIVSFTRSLSQSLIGQGIRVNGVAPGPIWTPLIPASFNDQHVAQF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G+  PMKRAGQ  EVAP YVFLAS  +SSY++GQILH NGGTIVNG
Sbjct  240   GQNTPMKRAGQPAEVAPCYVFLASA-DSSYMSGQILHVNGGTIVNG  284



>ref|WP_038668342.1| short-chain dehydrogenase [Pelosinus sp. UFO1]
 gb|AIF50429.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Pelosinus sp. UFO1]
Length=290

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/289 (58%), Positives = 210/289 (73%), Gaps = 7/289 (2%)
 Frame = -1

Query  1098  GNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFAL  919
             G  FPPQ Q+ QPG E  M P P +   +Y+ S KL+ KVA+++GGDSGIGRAV   FA 
Sbjct  9     GTSFPPQHQNQQPGIESQMKPLPIFMDANYRASGKLENKVAIISGGDSGIGRAVALAFAK  68

Query  918   EGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSY  739
             EGA V  TY+   E  DA +T +++++      K  + I  D+G +  C++VV   V+ +
Sbjct  69    EGANVTITYLN--EHDDAAETKKLIEQMN----KSCLTIAGDIGDERFCQQVVADTVSKF  122

Query  738   GRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTS  559
             G++DILVNNAAEQH   S++ I   +LE+ FRTNIFS FFL K AL H+K+GS IINT S
Sbjct  123   GQLDILVNNAAEQHVQTSLQNISAAQLEKTFRTNIFSYFFLSKAALSHLKKGSVIINTAS  182

Query  558   VTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEEC  379
             VTAYKG+ +L+DYSATKGAIVAFTR L+L L+ +GIRVNGVAPGPIWTPLIPASF + + 
Sbjct  183   VTAYKGNEQLIDYSATKGAIVAFTRSLSLSLIPQGIRVNGVAPGPIWTPLIPASFPDPDI  242

Query  378   AEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               FG+  PMKRAGQ +EVAP YVFLAS  +S Y++GQILH NGGTIVNG
Sbjct  243   TTFGQDTPMKRAGQPVEVAPCYVFLAS-QDSVYMSGQILHVNGGTIVNG  290



>dbj|BAP79673.1| general stress protein 39 [Pseudomonas sp. MT-1]
Length=285

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/290 (56%), Positives = 216/290 (74%), Gaps = 7/290 (2%)
 Frame = -1

Query  1101  DGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFA  922
             D NQ  P +Q ++PGKE  M P P+Y  +DYK + KLQ KVA++TGGDSGIGR+V   FA
Sbjct  3     DENQTLPPQQQAEPGKESEMTPRPEYRGEDYKAAGKLQDKVAIITGGDSGIGRSVAVLFA  62

Query  921   LEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNS  742
              EGA VA  Y+   +D  A +T    K+A  E  ++ +A   D+   + CRKV++  V++
Sbjct  63    REGADVAILYLDQHQD--AEET----KRAVEEQGRKCLAFAGDVADRDVCRKVIDETVSA  116

Query  741   YGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTT  562
             +G++DILVNNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+K+G+SIINTT
Sbjct  117   FGKLDILVNNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLKKGASIINTT  176

Query  561   SVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEE  382
             SVTAYKGSP+LLDYS+TKGAI AFTR L++ + +RGIRVNGVAPGPIWTPLIP++F E++
Sbjct  177   SVTAYKGSPQLLDYSSTKGAITAFTRSLSMNIADRGIRVNGVAPGPIWTPLIPSTFDEDK  236

Query  381   CAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               +FG  VPM+R GQ  EVAP+YV+LAS  ++SY++GQ++H NGGT+VNG
Sbjct  237   VEKFGANVPMERPGQPDEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>ref|WP_013916625.1| short-chain dehydrogenase [Paenibacillus mucilaginosus]
 ref|YP_004641334.1| hypothetical protein KNP414_02906 [Paenibacillus mucilaginosus 
KNP414]
 gb|AEI41464.1| YhxC [Paenibacillus mucilaginosus KNP414]
Length=285

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 209/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ Q++QPG E  M+P P +    YKP+ KL+ K A++TGGDSGIGRAV   +A EGA
Sbjct  7     FPPQHQNTQPGIESRMNPRPVFEDDRYKPAGKLKDKTAIITGGDSGIGRAVAVTYAKEGA  66

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V   Y+   ED  A++T    K+ + EG++  + +  D+G +  C  +VE  +   G++
Sbjct  67    DVLIVYLNEHED--AQETK---KQVEAEGSRCEL-LAGDIGDEAFCISIVEETIRRLGKL  120

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             D+LVNNAAEQH    +E+I   +LER FRTNIFS F+L K AL H++EGS+IINT S+TA
Sbjct  121   DVLVNNAAEQHPQQKLEDITSEQLERTFRTNIFSFFYLTKAALPHLQEGSAIINTASITA  180

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+G+P LLDYSATKGAIV FTR L+ QLV RGIRVN VAPGPIWTPLIP++F E++ A F
Sbjct  181   YEGNPTLLDYSATKGAIVTFTRSLSQQLVSRGIRVNAVAPGPIWTPLIPSTFDEQKVASF  240

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKRAGQ  E+APSYVFLA C +SSY+TGQ+LH NGGTIVNG
Sbjct  241   GTNTPMKRAGQPEELAPSYVFLA-CGDSSYMTGQVLHVNGGTIVNG  285



>ref|WP_018987439.1| hypothetical protein [Methylophilus methylotrophus]
Length=296

 Score =   335 bits (860),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 163/285 (57%), Positives = 209/285 (73%), Gaps = 5/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             P Q QD QPG E  M+P PQY   +YK + KL+GKV L+TGGDSGIGRAV   FA EGA 
Sbjct  17    PSQHQDHQPGTEAEMEPRPQYIDPNYKAARKLEGKVGLITGGDSGIGRAVAVHFAAEGAN  76

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             V   Y+  QE +DA  T+ ++     +G    +A+  D+     C+ +V+  + ++G++D
Sbjct  77    VVINYLSEQEKQDAEKTISLITSNGGQG----LAVQGDISDASFCQSLVDKTIETFGQLD  132

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ++VNNAA+Q+   SIE+ID+ +LE+ F+TN+FS F+LVK ALKH+KEG+ IINT SVTAY
Sbjct  133   VVVNNAAQQYPQSSIEDIDQAQLEKTFKTNLFSMFYLVKSALKHLKEGARIINTASVTAY  192

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+  L+DYSATKGAIV+FTR LA QL +R I VN VAPGPIWTPLIPASFS E+  +FG
Sbjct  193   KGNKMLVDYSATKGAIVSFTRSLAQQLADRHIYVNAVAPGPIWTPLIPASFSPEKVEDFG  252

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               V +KR GQ  EVAP YVFLAS  +SSYITGQ++HPNGGT+VNG
Sbjct  253   TDVLLKRPGQPSEVAPVYVFLASN-DSSYITGQVIHPNGGTVVNG  296



>ref|WP_038660057.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|AHY42989.1| short-chain dehydrogenase [Pseudomonas stutzeri]
Length=285

 Score =   335 bits (858),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 214/293 (73%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQ+Q  +PGKE +M+P P++  +DYK + KL+GKVA++TGGDSGIGR+V  
Sbjct  1     MAEDNQTLPPQEQ-PEPGKEGLMNPRPEFRGEDYKAAGKLEGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              +A EGA VA  Y+   +D  A +T  +++       +  +    D+   E CRKV++  
Sbjct  60    LYAREGADVAILYLDQHQD--AEETRTVVEHY----GRRCLTFAGDVADREVCRKVIDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             + ++G++DILVNNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+ +G+SII
Sbjct  114   LAAFGKLDILVNNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSP+LLDYSATKGAI AFTR L++ L ERGIRVNGVAPGPIWTPLIP++F 
Sbjct  174   NTTSVTAYKGSPQLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              +E AEFG   PMKR GQ  EVAP+YV+LAS  +++Y++GQ++H NGGT+VNG
Sbjct  234   ADEVAEFGSNTPMKRPGQPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_015842620.1| short-chain dehydrogenase [Paenibacillus sp. JDR-2]
 ref|YP_003009760.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp. JDR-2]
 gb|ACS99673.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp. JDR-2]
Length=290

 Score =   335 bits (859),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/286 (55%), Positives = 204/286 (71%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ Q+ QPG E  M+P P Y +  YK +NKL+ K A++TGGDSGIGRAV   FALEG 
Sbjct  12    FPPQHQNQQPGIESEMNPLPVYKTDQYKAANKLENKAAIITGGDSGIGRAVAVAFALEGC  71

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V+  Y    ED       +++++   +  +  + IP D+G +  CR  VE  V ++G++
Sbjct  72    DVSIVYYNEHEDA------KLVQQEIEQAGRRCLLIPGDIGDEAFCRNAVEQTVMTFGKL  125

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH    +E+I   +LE+ FRTN+F  FFL + AL HMK+G+S+INT S+TA
Sbjct  126   DILVNNAAEQHVQQRLEDITAKQLEKTFRTNVFGMFFLTRAALPHMKQGASVINTASITA  185

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P L+DYSATKGAIV+FTR LA  L  RGIR+NG+APGPIWTPLIP++F E+  + F
Sbjct  186   YKGNPTLIDYSATKGAIVSFTRALATNLAGRGIRINGIAPGPIWTPLIPSTFDEQSVSTF  245

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKRAGQ  E+AP+YV+LAS  +SSY+TGQ +H NGG +VNG
Sbjct  246   GSDTPMKRAGQPYELAPAYVYLAS-QDSSYVTGQFIHINGGEVVNG  290



>ref|WP_024308204.1| short-chain dehydrogenase [Pseudomonas sp. P818]
Length=284

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/286 (57%), Positives = 211/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q Q+ QPG EH M P P Y + DY+ + KL GKVA++TGGDSGIGRAV   +ALEGA
Sbjct  6     LPAQHQERQPGVEHAMHPEPIYLADDYRAAGKLTGKVAIITGGDSGIGRAVAVHYALEGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   ED+DA+ TL  + +       E +A+  D+G    C+ VV++V+  +GRI
Sbjct  66    KVALVYL--DEDEDAQKTLDEVNRH----GGEAIALAGDVGDGSFCQCVVDAVIAKWGRI  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNA EQH   ++E +DE + E+ FRTNIF+ F L K AL+HM+ GSSIINT+SVTA
Sbjct  120   DILINNAGEQHPEHNLEALDEAQWEQTFRTNIFAMFHLTKVALQHMQPGSSIINTSSVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P LLDYS+TKGAI +FTR L++ L  RGIRVNGVAPGPIWTPLIP++FS E+ +EF
Sbjct  180   YKGNPMLLDYSSTKGAITSFTRSLSINLAPRGIRVNGVAPGPIWTPLIPSTFSAEKVSEF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   P+ R GQ  EVAP++V+LAS  ++SYITGQ+LH NGG++VNG
Sbjct  240   GADTPLGRPGQPSEVAPAFVYLASN-DASYITGQMLHVNGGSVVNG  284



>ref|WP_003460153.1| short-chain dehydrogenase [Pseudomonas pseudoalcaligenes]
 emb|CCH37570.1| short-chain dehydrogenase/reductase SDR [Pseudomonas pseudoalcaligenes 
CECT 5344]
 emb|CDM40639.1| short-chain dehydrogenase/reductase SDR [Pseudomonas pseudoalcaligenes 
CECT 5344]
 emb|CDR91269.1| short-chain dehydrogenase/reductase SDR [Pseudomonas pseudoalcaligenes]
Length=284

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 212/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q  QPG EH M P P Y + DY+ + KL GKVA++TGGDSGIGRAV   +ALEGA
Sbjct  6     LPPQHQQRQPGVEHTMHPEPIYLADDYRAAGKLTGKVAIITGGDSGIGRAVAVHYALEGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   ED+DA+ TL  +K        E +A+  D+G    C+ VV++V+  +GRI
Sbjct  66    KVALVYLN--EDEDAQQTLDEVKHH----GGEAIALAGDVGDSGFCQCVVDAVIAKWGRI  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNA EQH   ++E +D+ + E+ FRTNIF+ F L K AL+H++ GSSIINT+SVTA
Sbjct  120   DILINNAGEQHPEHNLEALDQAQWEQTFRTNIFAMFHLTKVALEHLQPGSSIINTSSVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P LLDYS+TKGAI +FTR L++ L  RGIRVNGVAPGPIWTPLIP++FS+E+ ++F
Sbjct  180   YKGNPMLLDYSSTKGAITSFTRSLSINLAPRGIRVNGVAPGPIWTPLIPSTFSDEKVSKF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   P+ R GQ  EVAP++V+LAS  ++SY+TGQ+LH NGG++VNG
Sbjct  240   GADTPLGRHGQPAEVAPAFVYLASN-DASYVTGQMLHVNGGSVVNG  284



>ref|WP_013715546.1| short-chain dehydrogenase [Pseudomonas mendocina]
 ref|YP_004380209.1| short-chain dehydrogenase/reductase SDR [Pseudomonas mendocina 
NK-01]
 gb|AEB58457.1| short-chain dehydrogenase/reductase SDR [Pseudomonas mendocina 
NK-01]
Length=284

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/286 (57%), Positives = 210/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q Q+ QPG EH M P P Y + DY+ + KL GKVA++TGGDSGIGRAV   +ALEGA
Sbjct  6     LPAQHQERQPGVEHAMHPEPVYLADDYRAAGKLAGKVAIITGGDSGIGRAVAVHYALEGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   ED DA+ TL  + +       E +A+  D+G    C+ VV++V+  +GRI
Sbjct  66    KVALVYLN--EDADAQKTLDEVNRH----GGEAVALAGDVGDGSFCQCVVDAVIAKWGRI  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNA EQH   ++E +DE + ER FRTNIF+ F L K AL+H++ GSSIINT+SVTA
Sbjct  120   DILINNAGEQHPEHNLEALDEAQWERTFRTNIFAMFHLTKVALQHLQPGSSIINTSSVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P LLDYS+TKGAI +FTR L++ L  RGIRVNGVAPGPIWTPLIP++FS E+ +EF
Sbjct  180   YKGNPMLLDYSSTKGAITSFTRSLSINLAPRGIRVNGVAPGPIWTPLIPSTFSAEKVSEF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   P+ R GQ  EVAP++V+LAS  ++SY+TGQ+LH NGG++VNG
Sbjct  240   GADTPLGRPGQPSEVAPAFVYLASN-DASYVTGQMLHVNGGSVVNG  284



>ref|WP_013953926.1| short-chain dehydrogenase [Cupriavidus necator]
 ref|YP_004682484.1| hypothetical protein CNE_2c23040 [Cupriavidus necator N-1]
 gb|AEI81253.1| hypothetical protein CNE_2c23040 [Cupriavidus necator N-1]
Length=285

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/286 (57%), Positives = 207/286 (72%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q  QPG E  M P P   ++DY  S +L+G+VAL+TGGDSGIGRA+   FA EGA
Sbjct  7     IPPQHQPRQPGLEAAMRPQPDSGAEDYVGSGRLRGRVALITGGDSGIGRAIAVAFAREGA  66

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   E  DAR+T+++++ A     ++ +AI  DL    +   V    +  YG++
Sbjct  67    DVAIAYL--DEHADARETVELVEAA----GRKCLAIAGDLADHAHAEAVARQALQQYGKL  120

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   S+EE+D +++E  FRTN+F+ F L +  L H+K G+SI+NTTSVTA
Sbjct  121   DILVNNAAEQHPKASLEEVDPSQVEATFRTNVFAMFHLTRAVLPHLKAGASILNTTSVTA  180

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GS  LLDYSATKGAIV+FTR LALQ+VERGIRVNGVAPGPIWTPLIP++F+ EE AEF
Sbjct  181   YRGSKHLLDYSATKGAIVSFTRSLALQVVERGIRVNGVAPGPIWTPLIPSTFTAEEVAEF  240

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G++ PM R GQ  EVA  +VFLAS   +SYITGQILH NGG +VNG
Sbjct  241   GRKTPMGRPGQPFEVAAGFVFLAS-DAASYITGQILHINGGEVVNG  285



>ref|XP_001773923.1| predicted protein [Physcomitrella patens]
 gb|EDQ61271.1| predicted protein [Physcomitrella patens]
Length=297

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/290 (59%), Positives = 211/290 (73%), Gaps = 7/290 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKE-HVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
              P Q Q   PG E  +  P PQY S  Y P+ KL+GKVA+VTGGDSGIGR+V   FA EG
Sbjct  9     IPAQTQKHHPGVEAEIQGPKPQYYSDKYVPAGKLEGKVAIVTGGDSGIGRSVSVLFAAEG  68

Query  912   A-TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYG  736
             A  V   Y   +ED D   T++ +++  + G  +   I  DLG D+NC+  +++VV  +G
Sbjct  69    AEAVVIVYKAPEEDIDGEHTVKDIERVSL-GKCKARVIRTDLGHDDNCKLTIDAVVKEFG  127

Query  735   RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSV  556
             RID+LVNNA+EQ    SIEEI+  +LER FR+NIFS F++ +HA+KHMKEG+ IINTTS+
Sbjct  128   RIDVLVNNASEQFYKESIEEIEPEQLERTFRSNIFSMFYMTRHAVKHMKEGACIINTTSI  187

Query  555   TAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE--E  382
             TAY+G+P LLDYSATKGAI+AFTRGLALQLV+RGIRVNGVAPGPIWTP IPASF  E  E
Sbjct  188   TAYQGAPMLLDYSATKGAILAFTRGLALQLVKRGIRVNGVAPGPIWTPFIPASFPAEQTE  247

Query  381   CAEFGKQ-VPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
              A++G   VPM RAGQ  E   +YVFLAS  +SSY TGQ+LHPNGG +VN
Sbjct  248   GAKWGTSTVPMARAGQPFECGTAYVFLAS-EDSSYYTGQVLHPNGGAVVN  296



>ref|WP_011319210.1| short-chain dehydrogenase [Anabaena variabilis]
 ref|YP_322940.1| short-chain dehydrogenase/reductase SDR [Anabaena variabilis 
ATCC 29413]
 gb|ABA22045.1| Short-chain dehydrogenase/reductase SDR [Anabaena variabilis 
ATCC 29413]
Length=285

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/293 (58%), Positives = 212/293 (72%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA      PPQ+Q + PG E  M P PQ     Y  S KL+ KVAL+TGGDSGIGRAV  
Sbjct  1     MAEKQTLQPPQQQKT-PGTESKMQPKPQADDARYLGSGKLKDKVALITGGDSGIGRAVAI  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              +A EGA VAF Y+   E  DA +T  +++    E  +  ++I  D+  +  C++ ++  
Sbjct  60    AYAKEGADVAFVYLS--EHGDAEETKNLVE----EQGRRAVSIAGDITDEAFCQRAIQQT  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V+ +G++DIL+NNAAEQH   SIE+I + +LER F TNIFS F+L K ALKH+K+GS+II
Sbjct  114   VDEFGKLDILINNAAEQHPQESIEDITKEQLERTFSTNIFSMFYLTKAALKHLKQGSAII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGS  LLDYSATKGAIVAFTR L+  L+ +GIRVN VAPGPIWTPLIP++F 
Sbjct  174   NTTSVTAYKGSSHLLDYSATKGAIVAFTRSLSQNLISKGIRVNAVAPGPIWTPLIPSTFP  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              E+   FGKQVPM+RAGQ  EVAPSYVFLAS  +SSY++GQ+LHPNGG +VNG
Sbjct  234   TEKVETFGKQVPMQRAGQPEEVAPSYVFLAS-DDSSYMSGQVLHPNGGEVVNG  285



>ref|WP_015436274.1| short-chain dehydrogenase family protein [Azoarcus sp. KH32C]
 ref|YP_007551945.1| short-chain dehydrogenase family protein [Azoarcus sp. KH32C]
 dbj|BAL24969.1| short-chain dehydrogenase family protein [Azoarcus sp. KH32C]
Length=291

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 209/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ QD QPG+E  M P PQ   +DY+ + KL+GKVA+VTGGDSGIGRAV   FA EGA
Sbjct  13    LPPQHQDVQPGREAPMRPQPQDHMKDYRGAGKLEGKVAIVTGGDSGIGRAVAIGFAKEGA  72

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+  +E +DA DT + ++ A     +  + I  D+G ++  + VV  V+  +GR+
Sbjct  73    DVAVVYL--EEHEDAEDTRRSVEAA----GRRCLLIAGDVGNEDFTKDVVGQVIKEFGRL  126

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DI+VNNAAEQH   S+E I   +LER FRTN+F+ F L KH+L H+KEG+ IINTTSVTA
Sbjct  127   DIVVNNAAEQHPQESLEGITREQLERTFRTNLFAMFDLTKHSLSHLKEGACIINTTSVTA  186

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GS  L+DYSATKGAIV+FTR LA  L  +GIRVN VAPGPIWTPLIP++F EE+ A F
Sbjct  187   YRGSAHLIDYSATKGAIVSFTRSLAQSLASKGIRVNAVAPGPIWTPLIPSTFEEEKVASF  246

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G + P+ R GQ  EVAPSY+FLAS  +SSY+TGQ+LHPNGG I+NG
Sbjct  247   GAKEPLGRPGQPDEVAPSYIFLASS-DSSYMTGQVLHPNGGEIING  291



>ref|WP_035826078.1| short-chain dehydrogenase [Cupriavidus sp. SK-4]
 gb|EYS85741.1| short-chain dehydrogenase [Cupriavidus sp. SK-4]
Length=285

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 206/287 (72%), Gaps = 9/287 (3%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q  QPG E  M P P   + DY  S +L+G+ AL+TGGDSGIGRA+   FA EGA
Sbjct  7     IPPQHQSRQPGLESAMRPQPDSGADDYVGSGRLRGRAALITGGDSGIGRAIAVAFAREGA  66

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGA-KEPMAIPADLGFDENCRKVVESVVNSYGR  733
              VA  Y+   E  DAR+T+++     VEGA ++ +AI  DL    +   V    +  YG+
Sbjct  67    DVAIAYL--DEHADARETVEL-----VEGAGRKCLAIAGDLADRAHAEAVARQALQQYGK  119

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNAAEQH   S+EE+D +++E  FRTN+F+ F L +  L H+K G+SI+NTTSVT
Sbjct  120   LDILVNNAAEQHPKASLEEVDASQVEATFRTNVFAMFHLTRAVLPHLKAGASILNTTSVT  179

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+GS  LLDYSATKGAIV+FTR LALQ+VERGIRVNGVAPGPIWTPLIP++F+ EE AE
Sbjct  180   AYRGSKHLLDYSATKGAIVSFTRSLALQVVERGIRVNGVAPGPIWTPLIPSTFTAEEVAE  239

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG++ PM R GQ  EVA  +VFLAS   +SYITGQILH NGG +VNG
Sbjct  240   FGRKTPMGRPGQPFEVAAGFVFLAS-DAASYITGQILHINGGEVVNG  285



>ref|WP_014370097.1| short-chain dehydrogenase [Paenibacillus mucilaginosus]
 ref|YP_005313151.1| hypothetical protein PM3016_3147 [Paenibacillus mucilaginosus 
3016]
 ref|YP_006189954.1| short-chain dehydrogenase [Paenibacillus mucilaginosus K02]
 gb|AFC30002.1| YhxC [Paenibacillus mucilaginosus 3016]
 gb|AFH62189.1| short-chain dehydrogenase [Paenibacillus mucilaginosus K02]
Length=285

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/287 (57%), Positives = 206/287 (72%), Gaps = 9/287 (3%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ Q++QPG E  M+P P +    YKP+ KL+ K A++TGGDSGIGRAV   +A EGA
Sbjct  7     FPPQHQNTQPGIESRMNPRPVFEDDRYKPAGKLKDKTAIITGGDSGIGRAVAVTYAKEGA  66

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEG-AKEPMAIPADLGFDENCRKVVESVVNSYGR  733
              V   Y+   ED  A++T     K +VE   +    +  D+G +  C  +VE  +   G+
Sbjct  67    DVLIVYLNEHED--AQET-----KMQVEAEGRRCELLAGDIGDEAFCSSIVEETIRRLGK  119

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +D+LVNNAAEQH    +E+I   +LER FRTNIFS F+L K AL H++EGS+IINT S+T
Sbjct  120   LDVLVNNAAEQHPQQKLEDITSEQLERTFRTNIFSFFYLTKAALPHLQEGSAIINTASIT  179

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+G+P LLDYSATKGAIV FTR L+ QLV RGIRVN VAPGPIWTPLIP++F E++ A 
Sbjct  180   AYEGNPTLLDYSATKGAIVTFTRSLSQQLVSRGIRVNAVAPGPIWTPLIPSTFDEQKVAS  239

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG   PMKRAGQ  E+APSYVFLA C +SSY+TGQ+LH NGGTIVNG
Sbjct  240   FGTNTPMKRAGQPEELAPSYVFLA-CGDSSYMTGQVLHVNGGTIVNG  285



>ref|WP_024028192.1| short-chain dehydrogenase/reductase sdr [Bacillus vireti]
 gb|ETI69078.1| short-chain dehydrogenase/reductase sdr [Bacillus vireti LMG 
21834]
Length=289

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 214/287 (75%), Gaps = 6/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             + P Q+Q  QPG E  M PAP+  + +YK S KL+GK  ++TGGDSGIGRAV   FA EG
Sbjct  9     KLPAQEQKQQPGIEREMTPAPETINPEYKGSGKLKGKNVIITGGDSGIGRAVSIAFAKEG  68

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A +A  ++   E  DA +T  ++++ +V+     + +  D+G +  C++ V+  V+ +G 
Sbjct  69    ANIAIVFLN--ESHDAEETKHLVEEERVKC----LLLTGDIGDETFCQQAVQQTVDEFGG  122

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNA EQH   SI +I   +LE+ FRTNIFS F L K AL H+KEGS+IINT+S+T
Sbjct  123   LDILVNNAGEQHPQESILDISTEQLEQTFRTNIFSMFHLTKAALPHLKEGSAIINTSSIT  182

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AYKG+PKL+DYS+TKGAI +FTR LA+QLVE+GIRVNGVAPGPIWTPLIP++FSE E ++
Sbjct  183   AYKGNPKLIDYSSTKGAITSFTRSLAIQLVEKGIRVNGVAPGPIWTPLIPSTFSEGEVSK  242

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG+  PMKR GQ  E+AP+YV+LAS  +SSY+TGQILH NGGTIVNG
Sbjct  243   FGQNSPMKRPGQPEELAPAYVYLASNIDSSYVTGQILHVNGGTIVNG  289



>emb|CDZ80776.1| General stress protein 39 [Chlamydia sp. 'Rubis']
Length=280

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/281 (60%), Positives = 211/281 (75%), Gaps = 7/281 (2%)
 Frame = -1

Query  1074  QDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFT  895
             Q  QPG E +M P P+   +DYK +NKL+GKVA++TGGDSGIG+AV   FA EGA +AF 
Sbjct  7     QKKQPGHETIMQPKPEAIKKDYKAANKLEGKVAVITGGDSGIGKAVALAFAKEGADIAFI  66

Query  894   YVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVN  715
             Y+   E KDA +T + ++K      K+   I  D+G ++NC K V+ ++  Y +IDIL+N
Sbjct  67    YL--DEHKDAEETKKEVEKI----GKKCFIISTDIGVEKNCIKAVQDIIKKYKKIDILIN  120

Query  714   NAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSP  535
             NAAEQH   SIE+I E +LE+ FRTN++S FFL K  LKH+KEGS+I+NTTSVTAY+GSP
Sbjct  121   NAAEQHSQESIEDITEKQLEKTFRTNVYSMFFLTKAVLKHLKEGSTIVNTTSVTAYRGSP  180

Query  534   KLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVP  355
             KLLDYS+TKGAIVAFTR LA  L E+ IRVN VAPGPIWTPLIPA+F +++   FGK   
Sbjct  181   KLLDYSSTKGAIVAFTRSLAKNLAEKKIRVNAVAPGPIWTPLIPATFPQDKVDSFGKDTE  240

Query  354   MKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             MKRAGQ  EV+P YVFLAS  +SSYITGQ+LHPNGG I+NG
Sbjct  241   MKRAGQPSEVSPCYVFLAS-DDSSYITGQVLHPNGGDIING  280



>ref|WP_003300330.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EME00411.1| short-chain dehydrogenase [Pseudomonas stutzeri NF13]
Length=285

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 213/293 (73%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQ+Q  +PGKE +M+P P+Y  +DYK + KL+GKVA++TGGDSGIGR+V  
Sbjct  1     MAEDKQTLPPQEQ-PEPGKEGLMNPRPEYRGEDYKAAGKLEGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              +A EGA V   Y+   +D  A  T  ++++      +  +    D+   E CRKV++  
Sbjct  60    LYAREGADVTILYLDQHQD--AEQTRSVVERY----GRRCLTFAGDVADREVCRKVIDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             + ++G++DIL+NNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+ +G+SII
Sbjct  114   LAAFGKLDILINNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NT+SVTAYKGSP+LLDYSATKGAI AFTR L++ L ERGIRVNGVAPGPIWTPLIP++F 
Sbjct  174   NTSSVTAYKGSPQLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              ++ AEFG   PMKR GQ  EVAP+YV+LAS  +++Y++GQ+LH NGGT+VNG
Sbjct  234   ADKVAEFGSNTPMKRPGQPDEVAPAYVYLASS-DAAYVSGQVLHVNGGTVVNG  285



>ref|WP_035348378.1| short-chain dehydrogenase [Bacillus ginsengihumi]
 gb|KHD85924.1| short-chain dehydrogenase [Bacillus ginsengihumi]
Length=280

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 166/286 (58%), Positives = 213/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FP Q Q+ QPG E +M+P P+  +  YK S KL GK AL+TGGDSGIG++V   FA EGA
Sbjct  2     FPKQSQNQQPGIETIMNPQPESVNTYYKGSGKLAGKTALITGGDSGIGKSVAIYFAKEGA  61

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+  +E +DA +T    KK   +  +E + +  D+G +++C++ V  V+  +G +
Sbjct  62    NVAICYL--EEHEDAENT----KKQIEQEGQECLLVSGDIGDEQHCQQAVNKVIAQFGAL  115

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   SI  I + +LER F+TNIFSQFF+VK A  H+K+GSSIINT S+TA
Sbjct  116   DILVNNAAEQHPQQSILNITKEQLERTFKTNIFSQFFMVKAAFPHLKKGSSIINTASITA  175

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P+LLDYS+TKGAIV+FTR LAL LV +GIRVNGVAPGPIWTPLIP++FS E+ A F
Sbjct  176   YKGNPQLLDYSSTKGAIVSFTRSLALSLVSQGIRVNGVAPGPIWTPLIPSTFSPEQVATF  235

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKR GQ  E+AP++VFLAS  +SS+ITGQ++H NGG IVNG
Sbjct  236   GSDTPMKRPGQPSELAPAFVFLAS-DDSSFITGQMIHINGGEIVNG  280



>ref|WP_018662428.1| short-chain dehydrogenase [Bacillus acidiproducens]
Length=290

 Score =   333 bits (853),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 217/286 (76%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q Q  QPG E  M+P P+     Y  S KL GKVAL+TGGDSGIG++V   FA EGA
Sbjct  12    MPGQTQSRQPGVETEMNPQPENVKGSYHGSGKLDGKVALITGGDSGIGKSVAIYFAKEGA  71

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   E++DA++T ++++K   EG +E + I  D+G +E+C+  V+ V++ + ++
Sbjct  72    NVAICYLS--ENEDAKNTKELVEK---EG-RECLIISGDIGSEEHCQNAVQQVISQFSKL  125

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   SI +I E ++ + FRTNIFSQFF+VK AL H+K+GSSIINT SVTA
Sbjct  126   DILVNNAAEQHPQKSILDITEEQMIKTFRTNIFSQFFMVKAALPHLKKGSSIINTASVTA  185

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P+LLDYS+TKGAIV+FTR L+  LV +GIRVNGVAPGPIWTPLIP++FS E+  +F
Sbjct  186   YKGNPQLLDYSSTKGAIVSFTRSLSASLVSQGIRVNGVAPGPIWTPLIPSTFSAEQVKKF  245

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G  VPM+R GQ  E+AP+YV+LAS  +SSY+TGQ++H NGGTI+NG
Sbjct  246   GANVPMQRPGQPSELAPAYVYLAS-DDSSYVTGQMIHVNGGTILNG  290



>ref|WP_006212031.1| MULTISPECIES: short-chain dehydrogenase [Paenibacillus]
 gb|EFU39141.1| short-chain dehydrogenase/reductase SDR [Paenibacillus vortex 
V453]
 gb|ETT32072.1| short-chain dehydrogenase/reductase SDR [Paenibacillus sp. FSL 
R5-808]
Length=288

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 210/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ QD +PG E  M P P++ S +YK + KLQGKVAL+TGGDSGIGRAV   +A EGA
Sbjct  10    LPPQHQDHRPGTESEMHPKPEFESNEYKAAGKLQGKVALITGGDSGIGRAVAVHYAKEGA  69

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V+  Y+   E KDA +T    K+   +  ++ + I  D+G D  CR  V   V   G++
Sbjct  70    DVSIVYLS--EHKDAEET----KRQVEQEGRKCLLISGDVGDDAFCRDAVTETVEKLGKL  123

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH    IE+I + +LER FRTNIF  F+L + A+ H+ +GSSIINTTS+TA
Sbjct  124   DILVNNAAEQHPQKKIEDISKEQLERTFRTNIFGMFYLTQAAMPHLSKGSSIINTTSITA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GSP+LLDY++TKGAIVAFTR L++ +VE+GIRVN VAPGPIWTPLIP++F E++ +EF
Sbjct  184   YRGSPQLLDYASTKGAIVAFTRSLSMNIVEQGIRVNAVAPGPIWTPLIPSTFPEDQVSEF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKR GQ  E+AP+YV+LAS  +SSY++GQ++H NGG ++NG
Sbjct  244   GATQPMKRPGQPEELAPAYVYLAST-DSSYVSGQVIHVNGGEVING  288



>ref|WP_006838474.1| short-chain dehydrogenase [Bacillus sp. SG-1]
 gb|EDL62985.1| oxidoreductase (short-chain dehydrogenase:reductase family) protein 
[Bacillus sp. SG-1]
Length=286

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 165/293 (56%), Positives = 213/293 (73%), Gaps = 7/293 (2%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             M+ + N FPPQ QD QPG E  M P P+Y   +YK S KL GKVAL+TGGDSGIG+AV  
Sbjct  1     MSQNNNNFPPQHQDHQPGTEKEMHPQPKYMDDNYKGSGKLDGKVALITGGDSGIGKAVAL  60

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA +A  Y+  +ED+DA++T  +++K   EG +  +    DLG      +VV+  
Sbjct  61    YFAKEGADIAIAYL--EEDQDAQETKNLIEK---EG-RTCLLFAGDLGSSSYSAEVVKKT  114

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             V+ YG++DILVNNAAEQH   S+ +I + +LE+ FRTN+FS F+L K AL H+K GSSII
Sbjct  115   VDHYGKLDILVNNAAEQHPQTSLLDITDEQLEKTFRTNVFSFFYLTKAALPHLKSGSSII  174

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAY G+ +LLDYS+TKGAIV+FTR L+  L  + IRVNGVAPGPIWTPLIP++F 
Sbjct  175   NTTSVTAYAGNDQLLDYSSTKGAIVSFTRSLSQSLASKNIRVNGVAPGPIWTPLIPSTFP  234

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             E++ A+FG   P+ RAGQ  E+AP+YV+LAS  +S Y TGQ++H NGG IVNG
Sbjct  235   EDKVAKFGADTPLGRAGQPYELAPAYVYLAS-DDSQYTTGQVIHVNGGKIVNG  286



>ref|WP_012356893.1| short-chain dehydrogenase [Cupriavidus taiwanensis]
 ref|YP_002008732.1| oxidoreductase, nad(p)-binding domain [Cupriavidus taiwanensis 
LMG 19424]
 emb|CAQ72680.1| putative oxidoreductase, NAD(P)-binding domain [Cupriavidus taiwanensis 
LMG 19424]
Length=285

 Score =   332 bits (851),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/285 (59%), Positives = 206/285 (72%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q  QPG E  M P P   + DY  S +L G+VALVTGGDSGIGRA+   FA EGA 
Sbjct  8     PPQHQSRQPGLEAPMRPQPDSGADDYVGSGRLNGRVALVTGGDSGIGRAIAVAFAREGAD  67

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   E  DAR+T+ ++++A     ++ +AI  DL   ++   V    +  YG++D
Sbjct  68    VAIAYL--DEHADARETVNLVEQA----GRKCLAIAGDLADCDHAEAVARQTLQQYGKLD  121

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   S+EE++ +++E  FRTN+F+ F L +  L H+K G+SI+NTTSVTAY
Sbjct  122   ILVNNAAEQHPKESLEEVEASQVEATFRTNVFAMFHLTRAVLPHLKAGASILNTTSVTAY  181

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             +GS  LLDYSATKGAIV+FTR LALQ+VERGIRVNGVAPGPIWTPLIP++FS EE AEFG
Sbjct  182   RGSKHLLDYSATKGAIVSFTRSLALQVVERGIRVNGVAPGPIWTPLIPSTFSPEEVAEFG  241

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             K+ PM R GQ  EVA  YVFLAS   +SYITGQILH NGG +VNG
Sbjct  242   KKTPMGRPGQPFEVAGGYVFLAS-DAASYITGQILHINGGEVVNG  285



>ref|WP_010999306.1| short-chain dehydrogenase [Nostoc sp. PCC 7120]
 ref|NP_489222.1| oxidoreductase [Nostoc sp. PCC 7120]
 dbj|BAB76881.1| oxidoreductase [Nostoc sp. PCC 7120]
Length=285

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 162/276 (59%), Positives = 207/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P PQ     Y+ S KL+ KVAL+TGGDSGIGRAV   +A EGA VAF Y+   
Sbjct  17    GTESKMQPKPQADDAQYRGSGKLKDKVALITGGDSGIGRAVAIAYAKEGADVAFVYLS--  74

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA +T  +++    E  +  ++I  D+  +  C++ ++  V+ +G++DIL+NNAAEQ
Sbjct  75    EHDDAEETKNLVE----EQGRRAVSIAGDITDEAFCQRAIQQTVDEFGKLDILINNAAEQ  130

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I + +LER FRTNIFS F+L K A+KH+K+GS+IINTTSVTAYKGSP+LLDY
Sbjct  131   HPQESIEDITKEQLERTFRTNIFSMFYLTKAAIKHLKKGSAIINTTSVTAYKGSPQLLDY  190

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  L+ +GIRVN VAPGPIWTPLIP++F  E+   FGKQVPM+RAG
Sbjct  191   SSTKGAIVAFTRSLSQNLISKGIRVNAVAPGPIWTPLIPSTFPAEKVETFGKQVPMQRAG  250

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  EVAPSYVFLAS  +SSY++GQ+LHPNGG +VNG
Sbjct  251   QPEEVAPSYVFLAS-DDSSYMSGQVLHPNGGEVVNG  285



>ref|WP_012598459.1| short-chain dehydrogenase [Cyanothece sp. PCC 7424]
 ref|YP_002376381.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7424]
 gb|ACK69513.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7424]
Length=284

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 203/285 (71%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ QD QPG E  M P P+     +K S KL  KVAL+TGGDSGIGRAV   FA EGA 
Sbjct  7     PPQHQDRQPGLESEMQPLPKSDDAQHKGSGKLYQKVALITGGDSGIGRAVAIAFAKEGAD  66

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   ED       Q  K+   E  +  + +  D+G ++ C++ V+  V  + R+D
Sbjct  67    VAIVYLNEHEDA------QKTKEQVEEYGRRCVTLAGDVGDEQFCQQAVQKTVQEFNRLD  120

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNA EQH   SIE I + +LER FRTNIFS F+L K AL H+++GS+IINTTSVTAY
Sbjct  121   ILVNNAGEQHPQDSIENITQEQLERTFRTNIFSMFYLTKAALPHLQKGSAIINTTSVTAY  180

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+P LLDYS+TKGAIVAFTR L+  LVE+ IRVNGVAPGPIWTPLIPA+F E++   FG
Sbjct  181   KGNPMLLDYSSTKGAIVAFTRALSQSLVEKEIRVNGVAPGPIWTPLIPATFPEDKVESFG  240

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              QVPM+RAGQ  EVA SYVFLAS  ++SY TGQILHPNGG +VNG
Sbjct  241   AQVPMQRAGQPEEVASSYVFLASN-DASYFTGQILHPNGGVVVNG  284



>ref|WP_013322819.1| short-chain dehydrogenase [Cyanothece sp. PCC 7822]
 ref|YP_003887989.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7822]
 gb|ADN14714.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7822]
Length=286

 Score =   332 bits (851),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 168/285 (59%), Positives = 208/285 (73%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q+ +PG E  M P P+  ++ Y  S KL  KVAL+TGGDSGIGRAV   FA EGA 
Sbjct  9     PPQHQEIRPGLESEMTPQPESENEQYTGSGKLNHKVALITGGDSGIGRAVAIAFAKEGAD  68

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             +A  Y+   E +DA  T Q ++    E  +  + +  D+G ++ C+K V+  V+ + ++D
Sbjct  69    IAIVYLN--EHEDANQTKQRVE----ELGRRCVTLAGDIGDEQFCQKAVQKTVDEFKQLD  122

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   SIE+I   +LER FRTNIFS FF+ K AL H+K+GS+IINTTSVTAY
Sbjct  123   ILVNNAAEQHPQQSIEDISAAQLERTFRTNIFSMFFMTKAALPHLKKGSTIINTTSVTAY  182

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+  LLDYS+TKGAIVAFTR L+  LVE+GIRVNGVAPGPIWTPLIP++F EE+   FG
Sbjct  183   KGNQTLLDYSSTKGAIVAFTRSLSQALVEKGIRVNGVAPGPIWTPLIPSTFPEEKVESFG  242

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              QVPM+R  Q  EVAPSYVFLAS  +SSY +GQILHPNGG +VNG
Sbjct  243   AQVPMQRPAQPDEVAPSYVFLASN-DSSYFSGQILHPNGGEVVNG  286



>ref|WP_018005530.1| short-chain dehydrogenase [Cupriavidus taiwanensis]
Length=285

 Score =   332 bits (851),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 165/285 (58%), Positives = 208/285 (73%), Gaps = 7/285 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q  QPG E  M P P   + DY  S +L+G+VAL+TGGDSGIGRA+   FA EGA 
Sbjct  8     PPQHQSRQPGLEAPMRPQPDSGADDYVGSGRLEGRVALITGGDSGIGRAIAVAFAREGAD  67

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   E  DAR+T++++++A     ++ +AI  DL   ++   V    +  YG++D
Sbjct  68    VAIAYL--DEHADARETVELVEQA----GRKCLAIAGDLADCDHAEAVARQTLQQYGKLD  121

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             ILVNNAAEQH   S+E+++ +++E  FRTN+F+ F L +  L H+K G+SI+NTTSVTAY
Sbjct  122   ILVNNAAEQHPKESLEDVEASQVEATFRTNVFAMFHLTRAVLPHLKAGASILNTTSVTAY  181

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             +GS  LLDYSATKGAIV+FTR LALQ+VERGIRVNGVAPGPIWTPLIP++FS EE AEFG
Sbjct  182   RGSKHLLDYSATKGAIVSFTRSLALQVVERGIRVNGVAPGPIWTPLIPSTFSPEEVAEFG  241

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             K+ PM R GQ  EVA  YVFLAS   +SYITGQILH NGG +VNG
Sbjct  242   KKTPMGRPGQPFEVAGGYVFLAS-DAASYITGQILHINGGEVVNG  285



>ref|WP_016836613.1| hypothetical protein [Herbaspirillum lusitanum]
Length=285

 Score =   332 bits (851),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 211/291 (73%), Gaps = 7/291 (2%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             SD N  PPQ Q  QPG E++MDP P  + +   P  +L  KVAL+TGGDSGIGRAV   F
Sbjct  2     SDTNTMPPQHQQHQPGDEYLMDPKPHSTPRLQAPGTRLSQKVALITGGDSGIGRAVALAF  61

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             A EGAT+A  Y+   ED  A +T ++++    E   E +  P D+G ++ CR  V++VV+
Sbjct  62    AGEGATIAVIYLDEHED--AVETQRLVR----EAGAECLLYPGDVGSEKFCRDAVKAVVD  115

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
              +GR+DILVNNAA+Q  +  IE+I E +LE+ FRTNIFS F++VK AL ++  G+ IINT
Sbjct  116   QFGRLDILVNNAAQQFPSNDIEKITEEQLEKTFRTNIFSMFYMVKAALPYLVSGARIINT  175

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
              SVTAY+GS  L+DYS+TKGAIVAFTR LA QLV+  I VN VAPGP+WTPLIPASFS E
Sbjct  176   ASVTAYRGSAHLVDYSSTKGAIVAFTRSLAQQLVKHEIHVNAVAPGPVWTPLIPASFSAE  235

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             E A+FG  VPM+R GQ  E+APSY+FLA+   +SY+TGQ+LHPNGG I+NG
Sbjct  236   EVAKFGANVPMQRPGQPDEIAPSYLFLAT-EGASYMTGQVLHPNGGEIING  285



>ref|WP_018315257.1| short-chain dehydrogenase [Cupriavidus sp. UYPR2.512]
Length=285

 Score =   332 bits (850),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 165/287 (57%), Positives = 207/287 (72%), Gaps = 9/287 (3%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q  QPG E  M P P   + DY  S +L+G+V+L+TGGDSGIGRA+   FA EGA
Sbjct  7     IPPQHQSHQPGLEAAMRPQPDSGADDYVGSGRLRGRVSLITGGDSGIGRAIAVAFAREGA  66

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGA-KEPMAIPADLGFDENCRKVVESVVNSYGR  733
              VA  Y+   E  DAR+T+++     VEGA ++ +AI  DLG   +   V    +  YG+
Sbjct  67    DVAIAYL--DEHADARETVEL-----VEGAGRKCLAIAGDLGDHAHAEAVARQALQQYGK  119

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNAAEQH   S+E++D  ++E  FRTN+F+ F L +  L H+K G+SI+NTTSVT
Sbjct  120   LDILVNNAAEQHPKASLEDVDAGQVEATFRTNVFAMFHLTRAVLPHLKAGASILNTTSVT  179

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+GS  LLDYSATKGAIV+FTR LALQ+V+RGIRVNGVAPGPIWTPLIP++F+ EE AE
Sbjct  180   AYRGSKHLLDYSATKGAIVSFTRSLALQVVDRGIRVNGVAPGPIWTPLIPSTFTAEEVAE  239

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG++ PM R GQ  EVA  +VFLAS   +SYITGQILH NGG +VNG
Sbjct  240   FGRKTPMGRPGQPFEVAAGFVFLAS-DAASYITGQILHINGGEVVNG  285



>ref|WP_027482598.1| short-chain dehydrogenase [Deinococcus pimensis]
Length=288

 Score =   332 bits (851),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 163/290 (56%), Positives = 212/290 (73%), Gaps = 7/290 (2%)
 Frame = -1

Query  1101  DGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFA  922
             +G   P Q+QD QPG+E  M+P P Y   DYK + KLQGKVA++TGGDSGIGRAV   +A
Sbjct  6     EGKTVPAQQQDQQPGRESEMNPRPVYIKPDYKAAGKLQGKVAVITGGDSGIGRAVAVHYA  65

Query  921   LEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNS  742
              EGA VA  Y+   E  DA++T +++++A     +  + +  D+G +  C++ V+  V+ 
Sbjct  66    REGADVAIVYL--DEGDDAQETKRLVEEA----GRRCLTLAGDVGDEAFCQQAVQRTVSE  119

Query  741   YGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTT  562
              GR+D+LVNNAAEQH   SI +I   +LER FRTNIF  F++ K A+ H+ EG +IINTT
Sbjct  120   LGRLDVLVNNAAEQHPQESITDITREQLERTFRTNIFGYFYMAKAAVNHIPEGGTIINTT  179

Query  561   SVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEE  382
             SVT YKGSP+LLDYS+TKGAIVAFTR L++ L E+GIRVNGVAPGPIWTPLIP++F  ++
Sbjct  180   SVTDYKGSPQLLDYSSTKGAIVAFTRSLSMSLAEKGIRVNGVAPGPIWTPLIPSTFPPDK  239

Query  381   CAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              A FG  VPMKR GQ  EVA  +VFLAS  +SSY++GQ+LHPNGG +VNG
Sbjct  240   VATFGADVPMKRPGQPAEVATCFVFLAS-DDSSYMSGQVLHPNGGEVVNG  288



>ref|WP_026567649.1| short-chain dehydrogenase [Bacillus sp. UNC41MFS5]
Length=289

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 210/287 (73%), Gaps = 6/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             + P Q+Q+ QPG E  M P P   + +YK SNKLQG+ A++TGGDSGIGR+V   +A EG
Sbjct  9     KLPSQEQNQQPGIEKDMRPLPDTENTNYKESNKLQGQNAIITGGDSGIGRSVSIAYAKEG  68

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A VA  Y+   E  DA +T Q++++   EG +  + I  D+G +  C++ V+  V+  G 
Sbjct  69    ANVAIIYLN--ESNDAEETKQLVEE---EGGR-CLLIAGDIGDESFCKEAVQQTVDELGG  122

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             IDILVNNAAEQH   SI +I+  +LE+ FRTNI S F L + AL H+K GS+IINTTS+T
Sbjct  123   IDILVNNAAEQHPQESIMDIETEQLEKTFRTNILSMFHLTRAALPHLKRGSAIINTTSIT  182

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+G PKLLDYS+TKGAI  FTR LA QL E+GIRVNGVAPGPIWTPLIP++F+ EE ++
Sbjct  183   AYQGHPKLLDYSSTKGAITTFTRSLASQLAEKGIRVNGVAPGPIWTPLIPSTFTAEEVSQ  242

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG+  PMKR GQ  EVAP+YV+LAS  +SSY++GQILH NGG +VNG
Sbjct  243   FGQDTPMKRPGQPEEVAPAYVYLASNADSSYVSGQILHVNGGKVVNG  289



>ref|WP_023959633.1| oxidoreductase, short chain dehydrogenase/reductase family [Paenibacillus 
sp. JCM 10914]
 dbj|GAE05886.1| oxidoreductase, short chain dehydrogenase/reductase family [Paenibacillus 
sp. JCM 10914]
Length=288

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/286 (57%), Positives = 209/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ QD +PG E  M P P++ S +YK + KLQGKVAL+TGGDSGIGRAV   +A EGA
Sbjct  10    LPPQHQDHRPGTESEMHPKPEFESNEYKAAGKLQGKVALITGGDSGIGRAVAVHYAKEGA  69

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V+  Y+   E +DA +T    ++ + EG K  + I  D+G D  CR  V   V   G++
Sbjct  70    DVSIVYLS--EHQDAEETK---RQVEQEGHK-CLLIAGDIGNDAFCRDAVTETVEKLGKL  123

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH    IE+I + +LER FRTNIF  F+L + A+ H+ +GSSIINTTS+TA
Sbjct  124   DILVNNAAEQHTQKKIEDISKEQLERTFRTNIFGMFYLTQAAMPHLSKGSSIINTTSITA  183

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GSP+LLDYS+TKGAIVAFTR L++ +V +GIRVN VAPGPIWTPLIP++FSE+  A F
Sbjct  184   YRGSPELLDYSSTKGAIVAFTRSLSMNVVGQGIRVNAVAPGPIWTPLIPSTFSEDHVANF  243

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKR GQ  E+AP+YV+LAS  +SSY++GQ++H NGG ++NG
Sbjct  244   GASQPMKRPGQPEELAPAYVYLAST-DSSYVSGQVIHINGGEVING  288



>ref|WP_017360894.1| short-chain dehydrogenase [Pseudomonas mendocina]
 gb|KER99790.1| short-chain dehydrogenase [Pseudomonas mendocina]
 gb|KFB14872.1| short-chain dehydrogenase [Pseudomonas mendocina S5.2]
Length=284

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 209/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q Q+ QPG EH M P P Y + DY+ + KL GKVA++TGGDSGIGRAV   +ALEGA
Sbjct  6     LPAQHQERQPGVEHAMHPEPVYLADDYRAAGKLAGKVAIITGGDSGIGRAVAVHYALEGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   ED DA+ TL  + +       E +A+  D+G    C+ VV++V+  +GRI
Sbjct  66    KVALVYLN--EDADAQKTLDEVNRH----GGEAVALAGDVGDGNFCQCVVDAVIAKWGRI  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNA EQH   + E +DE + E+ FRTNIF+ F L K AL+H++ GSSIINT+SVTA
Sbjct  120   DILINNAGEQHPEHNFEALDEAQWEQTFRTNIFAMFHLTKVALQHLQPGSSIINTSSVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P LLDYS+TKGAI +FTR L++ L  RGIRVNGVAPGPIWTPLIP++FS E+ +EF
Sbjct  180   YKGNPMLLDYSSTKGAITSFTRSLSINLAPRGIRVNGVAPGPIWTPLIPSTFSAEKVSEF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   P+ R GQ  EVAP++V+LAS  ++SY+TGQ+LH NGG++VNG
Sbjct  240   GADTPLGRPGQPSEVAPAFVYLASN-DASYVTGQMLHVNGGSVVNG  284



>ref|WP_019339147.1| short-chain dehydrogenase [Pseudomonas stutzeri]
Length=285

 Score =   331 bits (849),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 215/290 (74%), Gaps = 7/290 (2%)
 Frame = -1

Query  1101  DGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFA  922
             D NQ  P +Q  +PGKE  M P P+Y  +DYK + KLQGKVA++TGGDSGIGR+V   FA
Sbjct  3     DENQTLPPQQQPEPGKESEMRPRPEYRGEDYKAAGKLQGKVAIITGGDSGIGRSVAVLFA  62

Query  921   LEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNS  742
              EGA VA  Y+   +D  A +T +++++      ++ +    D+   + CRKV++  + +
Sbjct  63    REGADVAILYLDQHQD--AEETKRVVEQQ----GRKCLTFAGDVADRDVCRKVIDETLGA  116

Query  741   YGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTT  562
             +G++D+LVNNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+K+G+SIINTT
Sbjct  117   FGQLDLLVNNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLKKGASIINTT  176

Query  561   SVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEE  382
             SVTAYKGSP+LLDYS+TKGAI AFTR L++ + +RGIRVNGVAPGPIWTPLIP++F E++
Sbjct  177   SVTAYKGSPQLLDYSSTKGAITAFTRSLSMNIADRGIRVNGVAPGPIWTPLIPSTFDEDK  236

Query  381   CAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               +FG  VPM+R GQ  EVAP+YV+LAS  +SSY++GQ++H NGGT+VNG
Sbjct  237   VEKFGANVPMERPGQPDEVAPAYVYLASS-DSSYVSGQVIHVNGGTVVNG  285



>ref|WP_011913295.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 ref|YP_001172670.1| short-chain dehydrogenase [Pseudomonas stutzeri A1501]
 ref|YP_005938824.1| short-chain dehydrogenase [Pseudomonas stutzeri DSM 4166]
 gb|ABP79828.1| probable short-chain dehydrogenase [Pseudomonas stutzeri A1501]
 gb|AEA84082.1| short-chain dehydrogenase [Pseudomonas stutzeri DSM 4166]
Length=285

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/293 (56%), Positives = 211/293 (72%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQKQ ++PGKE +M+P PQY  +DYK + KL GKVA++TGGDSGIGR+V  
Sbjct  1     MADDNQTLPPQKQ-AEPGKEGLMNPRPQYRGEDYKAAGKLAGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   +D +     Q  K  +  G +  +    D+   + CRKVV+  
Sbjct  60    LFAREGADVAILYLDQHQDAE-----QTRKDVEQHG-RRCLTFAGDVADRDVCRKVVDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +  +G++DILVNNAAEQH     E+I   + E+ FRTN+F  F L + AL H++EG+SII
Sbjct  114   LAQFGKLDILVNNAAEQHPRDRFEDIPPEQWEQTFRTNVFGMFQLTQVALPHLQEGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NT+SVTAYKG+P L+DYS+TKGAIVAFTR LA+ L ERGIRVN VAPGPIWTPLIP++F 
Sbjct  174   NTSSVTAYKGNPMLIDYSSTKGAIVAFTRALAMSLAERGIRVNSVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              ++ AEFG  VPMKR GQ  EVAP+YV+LAS  ++SY++GQ++H NGGT+VNG
Sbjct  234   ADKVAEFGSNVPMKRPGQPEEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>ref|WP_003285036.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EHY79276.1| short-chain dehydrogenase [Pseudomonas stutzeri ATCC 14405 = 
CCUG 16156]
Length=285

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 212/293 (72%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQ+Q  +PGKE +M+P P+Y  +DY  + KL+GK A++TGGDSGIGR+V  
Sbjct  1     MAEDNQTLPPQEQ-PEPGKEGLMNPRPEYRGEDYNAAGKLEGKTAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              +A EGA VA  Y+   +D  A +T  ++++      +  +    D+     CRKV++  
Sbjct  60    LYAREGADVAILYLDQHQD--AEETRTVVEQY----GRRCLTFAGDVADRGVCRKVIDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             + ++G++DILVNNAAEQH    +E+I E + E+ FRTNIF  F + K AL H+ +G+SII
Sbjct  114   LAAFGKLDILVNNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAALPHLGKGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSP+LLDYSATKGAI AFTR L++ L ERGIRVNGVAPGPIWTPLIP++F 
Sbjct  174   NTTSVTAYKGSPQLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              +E AEFG   PMKR GQ  EVAP+YV+LAS  +++Y++GQ++H NGGT+VNG
Sbjct  234   ADEVAEFGSNTPMKRPGQPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_029193233.1| short-chain dehydrogenase [Paenibacillus alginolyticus]
Length=289

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/286 (58%), Positives = 204/286 (71%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
             FPPQ QD QPG E  M+P P +    YK + KL+ KVAL+TGGDSGIGRAV   +A EGA
Sbjct  11    FPPQHQDQQPGIEAKMNPLPVFEHSGYKAAGKLKDKVALITGGDSGIGRAVAIAYAKEGA  70

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V   Y+   E  DA +T + ++KA     ++ + +  D+G +  C +++E  V  +G++
Sbjct  71    DVVLVYLN--EHTDAEETQRHVEKA----GRKCLHVAGDMGDENFCMQIIEQAVGKFGKL  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   SIE I   +LER FRTNIFS F+L K AL H+K GS+IINT S+TA
Sbjct  125   DILVNNAAEQHPQPSIENITSEQLERTFRTNIFSFFYLTKAALPHLKSGSAIINTASITA  184

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G  +LLDYSATKGAIV FTR L+LQL  +GIRVNGVAPGPIWTPLIP++F+ EE A F
Sbjct  185   YHGHEQLLDYSATKGAIVTFTRSLSLQLNAKGIRVNGVAPGPIWTPLIPSTFTAEEVATF  244

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKRAGQ  E+A SYVFLAS  +SSY+ GQILH NGG IVNG
Sbjct  245   GSTTPMKRAGQPSELAASYVFLAS-EDSSYMAGQILHVNGGAIVNG  289



>gb|KGK84870.1| short-chain dehydrogenase [Pseudomonas sp. HMP271]
Length=284

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/291 (55%), Positives = 212/291 (73%), Gaps = 8/291 (3%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             +D    PPQ+Q  +PGKE +M P P+Y  +DYK + KL GKVA++TGGDSGIGR+V   F
Sbjct  2     ADNQTLPPQQQ-PEPGKEGLMHPRPEYRGEDYKAAGKLAGKVAIITGGDSGIGRSVAVLF  60

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             A EGA VA  Y+   + +DA +T +++++      +  +    D+   + CR+VV+  + 
Sbjct  61    AREGADVAILYLD--QHQDAEETRKVVEQH----GRRCLTFAGDVAEKDVCRRVVDETLA  114

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
               GR+DILVNNAAEQH     E++ + + E+ FRTN+F  F + + AL H++EG+SIINT
Sbjct  115   QLGRLDILVNNAAEQHPQERFEDVSQQQWEKTFRTNVFGMFQMTQAALPHLREGASIINT  174

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
             TSVTAYKG+P L+DYS+TKGAIV FTR LA+ L ERGIRVNGVAPGPIWTPLIP++F  +
Sbjct  175   TSVTAYKGNPMLIDYSSTKGAIVGFTRALAMHLAERGIRVNGVAPGPIWTPLIPSTFDAD  234

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             + AEFG  VPMKR GQ  EVAP+YV+LAS  +SSY++GQ+LH NGGT+VNG
Sbjct  235   KVAEFGSNVPMKRPGQPEEVAPAYVYLASS-DSSYVSGQVLHVNGGTVVNG  284



>ref|WP_021489020.1| short-chain dehydrogenase [Pseudomonas mendocina]
 gb|ERH50525.1| short-chain dehydrogenase [Pseudomonas mendocina EGD-AQ5]
Length=284

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/286 (56%), Positives = 211/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q  QPG EH M P P Y + DY+ + KL GKVA++TGGDSGIGRAV   +ALEGA
Sbjct  6     LPPQHQQRQPGVEHAMHPEPIYLADDYRAAGKLTGKVAIITGGDSGIGRAVAVHYALEGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   ED+DA+ TL    +    G  E +A+  D+G    C+ VV++V+  +GR+
Sbjct  66    KVALVYLN--EDEDAQKTLD---EVTYHGG-EAIALAGDVGDGGFCQCVVDAVIAKWGRL  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNA EQH   ++E +DE + E+ FRTNIF+ F L K AL+H++ G+SIINT+SVTA
Sbjct  120   DILINNAGEQHPEHNLEALDEAQWEQTFRTNIFAMFHLTKVALQHLQPGASIINTSSVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P LLDYS+TKGAI +FTR L++ L  RGIRVNGVAPGPIWTPLIP++FS E+ +EF
Sbjct  180   YKGNPMLLDYSSTKGAITSFTRSLSINLAPRGIRVNGVAPGPIWTPLIPSTFSAEKVSEF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   P+ R GQ  EVAP++V+LAS  ++SY+TGQ+LH NGG++VNG
Sbjct  240   GADTPLGRPGQPAEVAPAFVYLASN-DASYVTGQMLHVNGGSVVNG  284



>ref|WP_015276966.1| dehydrogenase [Pseudomonas stutzeri]
 ref|YP_007240312.1| dehydrogenase [Pseudomonas stutzeri RCH2]
 gb|AGA86682.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Pseudomonas stutzeri RCH2]
Length=285

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 212/293 (72%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQ+Q  +PGKE +M+P P+Y  +DYK + KL+GK A++TGGDSGIGR+V  
Sbjct  1     MAEDNQTLPPQEQ-PEPGKEGLMNPRPEYRGEDYKAAGKLEGKTAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   +D  A +T  ++++      +  +    D+   + CRKV++  
Sbjct  60    LFAREGADVAILYLDQHQD--AEETRTVVEQY----GRRCLTFAGDVADRDVCRKVIDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             + ++G++DILVNNAAEQH    +E+I E + E+ FRTNIF  F + K  L H+ +G+SII
Sbjct  114   LAAFGKLDILVNNAAEQHPQEKLEDISEEQWEKTFRTNIFGMFQMTKAVLPHLGKGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAYKGSP+LLDYSATKGAI AFTR L++ L ERGIRVNGVAPGPIWTPLI ++F 
Sbjct  174   NTTSVTAYKGSPQLLDYSATKGAITAFTRSLSMNLAERGIRVNGVAPGPIWTPLISSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              +E AEFG   PMKR GQ  EVAP+YV+LAS  +++Y++GQ++H NGGT+VNG
Sbjct  234   ADEVAEFGSNTPMKRPGQPDEVAPAYVYLASS-DAAYVSGQVIHVNGGTVVNG  285



>ref|WP_017244544.1| short-chain dehydrogenase [Pseudomonas stutzeri]
Length=285

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/293 (55%), Positives = 212/293 (72%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQKQ ++PGKE +M+P P+Y  +DYK + KL+GKVA++TGGDSGIGR+V  
Sbjct  1     MADDNQTLPPQKQ-AEPGKEGLMNPRPEYRGEDYKAAGKLEGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   +D +     Q  K  +  G +  +    D+   + CRKVV+  
Sbjct  60    LFAREGADVAILYLDQHQDAE-----QTRKDVEQHG-RRCLTFAGDVADRDVCRKVVDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +  +G++DILVNNAAEQH     E+I   + E+ FRTN+F  F L + AL H++EG+SII
Sbjct  114   LAQFGKLDILVNNAAEQHPRDRFEDIPPEQWEQTFRTNVFGMFQLTQVALPHLQEGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NT+SVTAYKG+P L+DYS+TKGAIVAFTR LA+ L ERGIRVN VAPGPIWTPLIP++F 
Sbjct  174   NTSSVTAYKGNPMLIDYSSTKGAIVAFTRALAMSLAERGIRVNSVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              ++ AEFG  VPMKR GQ  EVAP+YV+LAS  ++SY++GQ++H NGGT+VNG
Sbjct  234   ADKVAEFGSNVPMKRPGQPEEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>ref|WP_017676854.1| short-chain dehydrogenase [Pseudomonas alcaliphila]
Length=284

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 211/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q  QPG EH M P P Y + DY+ + K  GKVA++TGGDSGIGRAV   +ALEGA
Sbjct  6     LPPQHQQRQPGVEHAMHPEPVYLADDYRAAGKPTGKVAIITGGDSGIGRAVAVHYALEGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   ED+DA+ TL  +K        E +A+  D+G    C+ VV++V+  +GR+
Sbjct  66    KVALVYLN--EDEDAQKTLDEVKHH----GGEAIALAGDVGDGGFCQCVVDAVIAKWGRL  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNA EQH   ++E +DE++ E+ FRTNIF+ F L K AL+H++ G+SIINT+SVTA
Sbjct  120   DILINNAGEQHPEHNLEALDESQWEQTFRTNIFAMFHLTKVALEHLQPGASIINTSSVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P LLDYS+TKGAI +FTR L++ L  RGIRVNGVAPGPIWTPLIP++FS E+ +EF
Sbjct  180   YKGNPMLLDYSSTKGAITSFTRSLSINLAPRGIRVNGVAPGPIWTPLIPSTFSAEKVSEF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   P+ R GQ  EVAP++V+LAS  ++SY+TGQ+LH NGG++VNG
Sbjct  240   GADTPLGRPGQPAEVAPAFVYLASN-DASYVTGQMLHVNGGSVVNG  284



>ref|WP_037022257.1| short-chain dehydrogenase [Pseudomonas sp. 20_BN]
 emb|CDZ93381.1| short-chain dehydrogenase [Pseudomonas sp. 20_BN]
Length=285

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 214/293 (73%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQ Q  +PGKE  M P P++  +DYK + KLQGKVA++TGGDSGIGR+V  
Sbjct  1     MAEDSQTLPPQHQ-PEPGKESEMTPRPEFRGEDYKAAGKLQGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   ED  A +T ++++    E  ++ +    D+  +  C+K++E  
Sbjct  60    LFAREGADVAILYLDQHED--AEETRRVVQ----EHGRQCLTFAGDVADETVCKKLIEET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             ++++G++DILVNNAAEQH     E+I + + E+ FRTN+F  F + + A+ H+ EG+SII
Sbjct  114   LSTFGKLDILVNNAAEQHPQERFEDITQQQWEKTFRTNVFGMFQMTQAAMPHLGEGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NT SVTAYKG+P L+DYS+TKGAIV+FTR LA+ L ERGIRVNGVAPGPIWTPLIP++F 
Sbjct  174   NTASVTAYKGNPMLIDYSSTKGAIVSFTRALAMHLAERGIRVNGVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              ++ AEFG  VP+KR GQ  EVAP+YV+LAS  +SSY++GQI+H NGGT+VNG
Sbjct  234   PDKVAEFGASVPLKRPGQPEEVAPAYVYLASS-DSSYVSGQIIHVNGGTVVNG  285



>ref|WP_027892061.1| short-chain dehydrogenase [Meiothermus chliarophilus]
Length=283

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 173/292 (59%), Positives = 210/292 (72%), Gaps = 10/292 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA   +Q PP +    PG E  M P P+     Y+   KL+GKVALVTGGDSGIGRAV  
Sbjct  1     MAQQKSQEPPMEP---PGLESQMQPKPKAEDPGYRGCGKLKGKVALVTGGDSGIGRAVAI  57

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+  QE  DA +T    K+   E  +  +AI  DLG +  CR+VV+ V
Sbjct  58    AFAKEGADVAIAYL--QEHSDAEET----KRRVEEYGRRCIAIAGDLGDEMVCRQVVQRV  111

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             ++ +GR+D+LVNNAAEQ     +E+I   +LER FRTNIF+ F+L K AL H+KEGS++I
Sbjct  112   IDVFGRLDVLVNNAAEQTPQERLEDISAEQLERTFRTNIFAYFYLTKAALPHLKEGSAVI  171

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NTTSVTAY+GSP LLDYSATKGAIVAFTR LA  LV+RGIRVNGVAPGPIWTPLIP++F 
Sbjct  172   NTTSVTAYRGSPHLLDYSATKGAIVAFTRSLAGNLVKRGIRVNGVAPGPIWTPLIPSTFP  231

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
             EE+  +FG+ VPM R GQ  EVAPSYVFLAS  ++SY  GQILHPNGG ++N
Sbjct  232   EEKVEKFGEDVPMGRPGQPEEVAPSYVFLAS-DDASYFAGQILHPNGGEVIN  282



>ref|WP_013982835.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 ref|YP_004714421.1| short-chain dehydrogenase [Pseudomonas stutzeri ATCC 17588 = 
LMG 11199]
 gb|AEJ05332.1| short-chain dehydrogenase [Pseudomonas stutzeri ATCC 17588 = 
LMG 11199]
Length=285

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/293 (56%), Positives = 211/293 (72%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQKQ ++PGKE +M+P PQY  +DYK + KL GKVA++TGGDSGIGR+V  
Sbjct  1     MADDNQTLPPQKQ-AEPGKEGLMNPRPQYRGEDYKAAGKLAGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   +D +     Q  K  +  G +  +    D+   + CRKVV+  
Sbjct  60    LFAREGADVAILYLDQLQDAE-----QTRKDVEQHG-RRCLTFAGDVADRDVCRKVVDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +  +G++DILVNNAAEQH     E+I   + E+ FRTN+F  F L + AL H++EG+SII
Sbjct  114   LAQFGKLDILVNNAAEQHPRDRFEDIPPEQWEQTFRTNVFGMFQLTQVALPHLQEGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NT+SVTAYKG+P L+DYS+TKGAIVAFTR LA+ L ERGIRVN VAPGPIWTPLIP++F 
Sbjct  174   NTSSVTAYKGNPMLIDYSSTKGAIVAFTRALAMSLAERGIRVNSVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              ++ AEFG  VPMKR GQ  EVAP+YV+LAS  ++SY++GQ++H NGGT+VNG
Sbjct  234   ADKVAEFGSNVPMKRPGQPEEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>ref|WP_006198195.1| short-chain dehydrogenase [Nodularia spumigena]
 gb|EAW43641.1| oxidoreductase [Nodularia spumigena CCY9414]
 gb|AHJ27233.1| oxidoreductase [Nodularia spumigena CCY9414]
Length=299

 Score =   330 bits (847),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 169/285 (59%), Positives = 208/285 (73%), Gaps = 8/285 (3%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ+Q   PGKE  M P P+     Y+ S KL  KVAL+TGGDSGIGRAV   FA EGA 
Sbjct  23    PPQEQKP-PGKESEMKPKPKADDPQYQGSGKLNNKVALITGGDSGIGRAVAIAFAKEGAD  81

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             VA  Y+   E  DA++T  +++       +  +AI  D+  +  C++ VE  V   G++D
Sbjct  82    VALVYL--MEHDDAKETKHLVENL----GRRVVAIAGDITDETFCQQAVEQTVEQLGKLD  135

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             IL+NNAAEQH   SIE+I + +LER FRTNIFS F+L K A+KH+K GSSIIN+TSVTAY
Sbjct  136   ILINNAAEQHPQESIEDISKEQLERTFRTNIFSMFYLTKAAMKHLKAGSSIINSTSVTAY  195

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             KG+ KLLDYS+TKGAIVAFTR L+  LV + IRVN VAPGPIWTPLIP++F  ++ A FG
Sbjct  196   KGNAKLLDYSSTKGAIVAFTRSLSQNLVSKEIRVNAVAPGPIWTPLIPSTFPADQVATFG  255

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             KQVPM RAGQ  EVAPSYVFLAS  ++SY+TGQ+LHPNGG+IVNG
Sbjct  256   KQVPMGRAGQPEEVAPSYVFLASD-DASYMTGQVLHPNGGSIVNG  299



>ref|WP_039747436.1| short-chain dehydrogenase [Hassallia byssoidea]
 gb|KIF33310.1| short-chain dehydrogenase [Hassallia byssoidea VB512170]
Length=284

 Score =   330 bits (845),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 162/276 (59%), Positives = 207/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             GKE  M P P+     Y+ S KL+ KVAL+TGGDSGIGRAV   +A EGA VA  Y+   
Sbjct  16    GKESEMTPKPKADDSSYQGSGKLKDKVALITGGDSGIGRAVAIAYAKEGADVAIVYL--N  73

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T  +++K      +  +AI  D+G +  C++ V+  V+  G++DILVNNAAEQ
Sbjct  74    EHDDAKETKNLVEKH----GRRAVAIAGDIGDESFCQQAVQQTVDELGKLDILVNNAAEQ  129

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I  ++LER FRTNIFS FF+ K A+KH+ EGS+I+NTTSVTAYKG+P+LLDY
Sbjct  130   HPQESIEDISASQLERTFRTNIFSMFFMTKAAMKHLHEGSAIVNTTSVTAYKGNPQLLDY  189

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+ IRVN VAPGPIWTPLIP++F E++   FGKQVPM+R G
Sbjct  190   SSTKGAIVAFTRSLSQSLVEKKIRVNAVAPGPIWTPLIPSTFPEDKVETFGKQVPMERPG  249

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  EVAPS+VFLAS  +SSY +GQ+LHPNGG++VNG
Sbjct  250   QPEEVAPSFVFLAS-DDSSYFSGQVLHPNGGSVVNG  284



>ref|WP_027091724.1| short-chain dehydrogenase [Cohnella thermotolerans]
Length=298

 Score =   330 bits (846),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 166/288 (58%), Positives = 208/288 (72%), Gaps = 7/288 (2%)
 Frame = -1

Query  1095  NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALE  916
             + FPPQ QD QPG E  M P P+  S  Y+P+ KL GKVA++TGGDSGIGRAV   FA E
Sbjct  18    DHFPPQHQDRQPGLESDMYPRPEAESPVYRPAGKLAGKVAVITGGDSGIGRAVAIAFAKE  77

Query  915   GATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYG  736
             GA VA  Y+   E  DAR+T + +++   EG +    I  D+G    CR+ +  +V + G
Sbjct  78    GADVAIVYLS--EFTDARETQRQVEQ---EG-RRCHIIAGDIGDPAFCRQAIADIVQALG  131

Query  735   RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSV  556
             R+DI+VNNAAEQH T  +E+I   +LE+ FRTN+F  F+L + A+ H+K GS++INT SV
Sbjct  132   RLDIVVNNAAEQHPTDKLEQIAPAQLEKTFRTNVFGMFYLTQAAMPHLKSGSAVINTASV  191

Query  555   TAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECA  376
             TAYKGSP LLDYSATKGAIVAFTR  AL +V +GIRVN VAPGPIWTPLIP++F   E A
Sbjct  192   TAYKGSPTLLDYSATKGAIVAFTRSFALNVVGQGIRVNAVAPGPIWTPLIPSTFGASEVA  251

Query  375   EFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             +FG   PMKRAGQ  E+AP+YV+LAS  +SSY+TGQ+LH NGG IVNG
Sbjct  252   KFGSDTPMKRAGQPDELAPAYVYLAS-EDSSYVTGQVLHVNGGAIVNG  298



>ref|WP_025847183.1| short-chain dehydrogenase [Paenibacillus ehimensis]
Length=289

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/294 (56%), Positives = 214/294 (73%), Gaps = 7/294 (2%)
 Frame = -1

Query  1113  SMASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVC  934
             ++ +D    P Q QD QPG E  M P P+   + YK S KLQGKVA++TGGDSGIGRA  
Sbjct  3     TLQTDKQTMPAQHQDRQPGIESRMTPRPRAVDRKYKGSGKLQGKVAVITGGDSGIGRAAA  62

Query  933   QCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVES  754
              CFA EGA +A  Y+   E  DA +T ++++    EG K  + I  D+G +  C++ V+ 
Sbjct  63    VCFAAEGADLAIVYLN--ETGDAEETKRLIE---AEGRK-CLLIQGDIGDEPFCQETVKR  116

Query  753   VVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSI  574
              V ++GR+DILVNNAAEQH    I++I + +LER FRTN+FS F++ K A+ H+KEGSSI
Sbjct  117   TVETFGRLDILVNNAAEQHPQRRIDDISQEQLERTFRTNLFSFFYMTKAAMPHLKEGSSI  176

Query  573   INTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASF  394
             INT S+TAY+G+P+L+DYSATKGAIV+FTR L++ LV +GIRVNG+APGPIWTPLIP++F
Sbjct  177   INTASITAYRGNPELIDYSATKGAIVSFTRSLSMNLVGKGIRVNGIAPGPIWTPLIPSTF  236

Query  393   SEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              EE+ AEFG   PMKR GQ  E+ P+YVFLAS  +SSY++GQ LH NGG IV G
Sbjct  237   DEEKVAEFGGDSPMKRPGQPEELGPAYVFLAS-DDSSYMSGQFLHINGGEIVGG  289



>ref|WP_028558398.1| short-chain dehydrogenase [Paenibacillus sp. URHA0014]
Length=289

 Score =   330 bits (845),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 210/287 (73%), Gaps = 9/287 (3%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q+ QPG E  M+P P + +  YK + KL+ +VAL+TGGDSGIGRA+   +A EGA
Sbjct  11    IPPQHQNQQPGIESQMEPIPVFDNTAYKAAGKLKDRVALITGGDSGIGRAIAIAYAKEGA  70

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGA-KEPMAIPADLGFDENCRKVVESVVNSYGR  733
              V   ++   E+ DA +T     K  VE A  + + +  D+G +  C+++++  V  +G+
Sbjct  71    DVVLVFLN--ENGDAEET-----KRHVENAGSKCLHVAGDIGDENFCQQIIDQTVQEFGK  123

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNAAEQH   +IE+I   +LER FRTNIFS F+L K A+KH+K GS+IINTTSVT
Sbjct  124   LDILVNNAAEQHPQQNIEDITSEQLERTFRTNIFSFFYLTKAAIKHLKPGSAIINTTSVT  183

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY G  KLLDYSATKGAIV FTR L+LQL ++GIRVN VAPGPIWTPLIP++F+E++ A 
Sbjct  184   AYHGHEKLLDYSATKGAIVTFTRSLSLQLHDKGIRVNAVAPGPIWTPLIPSTFTEQDVAA  243

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG Q PMKRAGQ  E+A SYVFLA C +SSY++GQ+LH NGG IVNG
Sbjct  244   FGSQTPMKRAGQPSELAASYVFLA-CEDSSYMSGQVLHVNGGAIVNG  289



>ref|WP_012189908.1| short-chain dehydrogenase [Herpetosiphon aurantiacus]
 ref|YP_001545133.1| short-chain dehydrogenase/reductase SDR [Herpetosiphon aurantiacus 
DSM 785]
 gb|ABX05005.1| short-chain dehydrogenase/reductase SDR [Herpetosiphon aurantiacus 
DSM 785]
Length=288

 Score =   330 bits (845),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 211/287 (74%), Gaps = 7/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             QFP Q QD QPG E  M P P+   + Y+ S KL+ KVAL+TGGDSGIGRAV   +A EG
Sbjct  9     QFPAQTQDQQPGIESAMQPKPKAHDRSYRGSGKLKDKVALITGGDSGIGRAVAIVYAKEG  68

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A VA  Y+   ED  A++T ++++    EG +  ++   D+G +  C+ +VE  V ++G+
Sbjct  69    ADVAINYLNEHED--AQETKRLVE---AEGQRCWLS-AGDIGDEAYCQGLVEQTVATFGQ  122

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DIL+NNAAEQH+  SI +I   +LER FRTNIF+ F+L K AL H+K GSSIINT SVT
Sbjct  123   LDILINNAAEQHQQKSITDISAEQLERTFRTNIFAMFYLTKAALPHLKAGSSIINTASVT  182

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+GSP+LLDYSATKGAIVAFTR L+  L+++ IRVNGVAPGPIWTPLIPA+F  E+ A 
Sbjct  183   AYRGSPQLLDYSATKGAIVAFTRSLSQALIDQKIRVNGVAPGPIWTPLIPATFEAEKVAP  242

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG  VPM+RAGQ  EVA  YVFLAS  ++SY+ GQILHPNGG ++NG
Sbjct  243   FGSDVPMQRAGQPEEVANCYVFLAS-DDASYMAGQILHPNGGEVING  288



>ref|WP_003291252.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EIK51415.1| short-chain dehydrogenase [Pseudomonas stutzeri TS44]
Length=284

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/291 (55%), Positives = 211/291 (73%), Gaps = 8/291 (3%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             +D    PPQ+Q  +PGKE +M P P+Y  +DYK + KL GKVA++TGGDSGIGR+V   F
Sbjct  2     ADNQTLPPQQQ-PEPGKEGLMHPRPEYRGEDYKSAGKLAGKVAIITGGDSGIGRSVAVLF  60

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             A EGA VA  Y+   + +DA +T +++++      +  +    D+   + CR+VV+  + 
Sbjct  61    AREGADVAILYLD--QHQDAEETRKVVEQH----GRRCLTFAGDVAEKDVCRRVVDETLA  114

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
               GR+DILVNNAAEQH     E++ + + E+ FRTN+F  F + + AL H+ EG+SIINT
Sbjct  115   QLGRLDILVNNAAEQHPQERFEDVSQQQWEKTFRTNVFGMFQMTQAALPHLPEGASIINT  174

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
             TSVTAYKG+P L+DYS+TKGAIV FTR LA+ L ERGIRVNGVAPGPIWTPLIP++F  +
Sbjct  175   TSVTAYKGNPMLIDYSSTKGAIVGFTRALAMHLAERGIRVNGVAPGPIWTPLIPSTFDAD  234

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             + AEFG  VPMKR GQ  EVAP+YV+LAS  +SSY++GQ+LH NGGT+VNG
Sbjct  235   KVAEFGSNVPMKRPGQPEEVAPAYVYLASS-DSSYVSGQVLHVNGGTVVNG  284



>gb|AIQ23017.1| short-chain dehydrogenase [Paenibacillus sp. FSL H7-0737]
Length=289

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/286 (55%), Positives = 208/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ+Q  QPG E  M P P+Y   +YK + KLQGK AL+TGGDSGIGRAV   FA EGA
Sbjct  11    LPPQEQHHQPGIESEMKPLPKYEPANYKAAGKLQGKAALITGGDSGIGRAVAVLFAKEGA  70

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V  +Y+   E  DA +T    K+   +  ++ + IP D+G +  C+ +++  V   G++
Sbjct  71    DVVISYLN--EHSDAEET----KRQVEQEGRKCILIPGDIGVETFCKDLIKQTVEGLGKL  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNAAEQH    IE+I   +LER FRTNIF+ F+L K A+ H+K GS+IINTTS+TA
Sbjct  125   DILINNAAEQHPQAKIEDITSEQLERTFRTNIFAMFYLTKAAMPHLKAGSAIINTTSITA  184

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GSP+LLDYS+TKGAI++FTR L+  L E+GIRVNGVAPGPIWTPLIP++F  ++ +EF
Sbjct  185   YRGSPQLLDYSSTKGAILSFTRSLSTNLAEKGIRVNGVAPGPIWTPLIPSTFDAKQVSEF  244

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKR GQ  E+AP+YV+LAS  +SSY+TGQ++H NGG +VNG
Sbjct  245   GGTQPMKRPGQPEELAPAYVYLAS-DDSSYVTGQVIHVNGGEVVNG  289



>ref|WP_035153476.1| short-chain dehydrogenase [Calothrix sp. 336/3]
 gb|KFB83669.1| short-chain dehydrogenase [Calothrix sp. 336/3]
Length=279

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 171/282 (61%), Positives = 207/282 (73%), Gaps = 7/282 (2%)
 Frame = -1

Query  1077  KQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAF  898
             +Q  Q  KE  M P P    + Y+ S KLQ KVAL+TGGDSGIGRAV   +A EGA V  
Sbjct  5     QQPIQTNKESEMSPRPAAERRAYQGSGKLQDKVALITGGDSGIGRAVAVMYAKEGADVVI  64

Query  897   TYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILV  718
              Y+K  ED DA++T Q+++K   EG +  ++I  D+G +  CR+ VE  V  +G +DILV
Sbjct  65    MYLK--EDDDAQETKQLVEK---EG-RRCLSIAGDVGDENFCRQAVERTVKEFGHLDILV  118

Query  717   NNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGS  538
             NNAAEQH   S+EEI   +LER FRTNIFS F+L K AL H+KEGS+IINTTSVTAY+GS
Sbjct  119   NNAAEQHLQPSLEEISAEQLERTFRTNIFSMFYLSKAALPHLKEGSTIINTTSVTAYEGS  178

Query  537   PKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQV  358
             P+LLDYSATKGAIVAFTR L+  L+++ IRVNGVAPGPIWTPLI ++F EE+  + G  V
Sbjct  179   PQLLDYSATKGAIVAFTRSLSQSLIDKHIRVNGVAPGPIWTPLITSTFPEEKITKHGSNV  238

Query  357   PMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             PM+R GQ  EVAP YVFLAS  +SSYI GQILHPNGG IVNG
Sbjct  239   PMQRVGQPDEVAPCYVFLAS-DDSSYIAGQILHPNGGKIVNG  279



>ref|WP_011300494.1| short-chain dehydrogenase [Cupriavidus pinatubonensis]
 ref|YP_298572.1| short-chain dehydrogenase [Ralstonia eutropha JMP134]
 gb|AAZ63728.1| Short-chain dehydrogenase/reductase SDR [Ralstonia eutropha JMP134]
Length=285

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 209/287 (73%), Gaps = 7/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             + PPQ Q+ QPG E  M P P   + DY  S +L  KVALVTGGDSGIGRA+   FA EG
Sbjct  6     ELPPQHQERQPGLESAMHPKPDSGADDYVGSGRLNNKVALVTGGDSGIGRAIAVAFAREG  65

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A VA  Y+   E  DAR+T+++++ A     ++ +++  DL    +   V   VV+++GR
Sbjct  66    ADVAIAYL--DEHSDARETVRLVEDA----GRKCVSLAGDLADVSHAETVAARVVDAFGR  119

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNAAEQH   S+E+++  ++E  FRTN+F+ F L +  L H+++G++I+NTTSVT
Sbjct  120   LDILVNNAAEQHPQPSLEDVEAEQVEATFRTNVFAMFHLTRALLPHLQKGAAILNTTSVT  179

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+GS  LLDYSATKGAIV+FTR LALQ+V+RGIRVNGVAPGPIWTPLIP++F+ EE AE
Sbjct  180   AYRGSAHLLDYSATKGAIVSFTRSLALQVVKRGIRVNGVAPGPIWTPLIPSTFTAEEVAE  239

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FGK+ PM R GQ  EVA  YVFLAS   +SYITGQILH NGG +VNG
Sbjct  240   FGKKTPMGRPGQPFEVAAGYVFLAS-DAASYITGQILHINGGEVVNG  285



>ref|WP_013179236.1| short-chain dehydrogenase [Truepera radiovictrix]
 ref|YP_003706420.1| short-chain dehydrogenase/reductase SDR [Truepera radiovictrix 
DSM 17093]
 gb|ADI15877.1| short-chain dehydrogenase/reductase SDR [Truepera radiovictrix 
DSM 17093]
Length=290

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 203/291 (70%), Gaps = 7/291 (2%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             +D    PPQ QD QPG E  M PAP +   DY+ S KL GKVAL+TGGDSGIGRAV   F
Sbjct  7     ADDQTLPPQTQDQQPGLESAMTPAPAFEGPDYRGSGKLAGKVALITGGDSGIGRAVAVHF  66

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             A EGA VA  Y+   ED +     +  ++ + EG +  + +  D+G +  CR+ VE  V 
Sbjct  67    AREGADVAVLYLSEHEDAE-----ETKRQVEAEG-RRCLLLAGDVGDEAFCREAVEKTVA  120

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
             + G++D+LVNNAAEQH    IE+I   +LER FRTN+F  FF+ K A+KH+ EGS+IIN+
Sbjct  121   TLGKLDVLVNNAAEQHPQKRIEDITAAQLERTFRTNVFGTFFMTKAAVKHLGEGSTIINS  180

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
              SVTA++GS  LLDY+ATKGAIVAFTR LA  L ++GIRVN VAPGPIWTPLIP++F EE
Sbjct  181   CSVTAFRGSGGLLDYAATKGAIVAFTRSLAQNLADKGIRVNSVAPGPIWTPLIPSTFDEE  240

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             + A FG    + R GQ  EVAPSYVFLAS  +SSYITGQ LHPNGG IV G
Sbjct  241   KVASFGADTLLGRPGQPEEVAPSYVFLASS-DSSYITGQTLHPNGGDIVGG  290



>ref|WP_019007547.1| hypothetical protein [Cohnella laeviribosi]
Length=294

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/288 (56%), Positives = 209/288 (73%), Gaps = 7/288 (2%)
 Frame = -1

Query  1095  NQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALE  916
             NQFPPQ QD QPG E  M P P+  S  YKP+ KL GKVA+++GGDSGIGRAV   FA E
Sbjct  14    NQFPPQHQDRQPGLESDMTPLPEAESPIYKPAGKLSGKVAVISGGDSGIGRAVAIAFAKE  73

Query  915   GATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYG  736
             GA VA  Y+   E  DAR+T + ++    E  +  + +  D+G    C K V+ +V + G
Sbjct  74    GADVAVLYLN--EFTDARETQRQVE----EEGRRCLILDGDIGDPAFCAKAVKEIVQTLG  127

Query  735   RIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSV  556
             ++DI+VNNAAEQH    +E+I   +LER F+TNIF  F+L + A+ H+K GS+I+NT SV
Sbjct  128   KLDIVVNNAAEQHPQNKLEQITPQQLERTFKTNIFGMFYLTQAAMPHLKSGSAIVNTASV  187

Query  555   TAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECA  376
             TAY+GSP LLDYS+TKGA+VAFTR LAL L ++GIRVNGVAPGP+WTPLIP++F  ++ A
Sbjct  188   TAYRGSPTLLDYSSTKGAVVAFTRSLALNLADQGIRVNGVAPGPVWTPLIPSTFDAQQVA  247

Query  375   EFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             +FG   P+KRA Q  E+AP+YV+LAS  +SSY+TGQILH NGG IVNG
Sbjct  248   KFGSNTPLKRAAQPDEIAPAYVYLAS-EDSSYMTGQILHVNGGEIVNG  294



>ref|WP_025039483.1| short-chain dehydrogenase [Nitrosospira briensis]
Length=284

 Score =   328 bits (842),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/287 (59%), Positives = 208/287 (72%), Gaps = 7/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             + P Q Q  QPG +  M+P P  + + Y+ S KLQ +VA++TGGDSGIGRAV   FA EG
Sbjct  5     EIPRQHQRKQPGLQAEMEPQPDSTLEGYRGSGKLQARVAIITGGDSGIGRAVAVAFAKEG  64

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A +A  Y+   E  DA DT    KK   +  ++ + I  D+G ++ C +VV + ++ +G 
Sbjct  65    ADIAIAYLN--EHGDANDT----KKEIEQCGRKCLLIAGDVGKEQFCAEVVATAISVFGH  118

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             IDILVNNAAEQH   SI +I   +LE+ FRTNIFS F +VK AL H+K+G+ IINTTSVT
Sbjct  119   IDILVNNAAEQHVRNSIMDIGNAQLEKTFRTNIFSMFHMVKAALPHLKKGARIINTTSVT  178

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AYKGSP LLDYSATKGAIVAFTR L+LQL+E+GI VNGVAPGPIWTPLIP++F  E+   
Sbjct  179   AYKGSPHLLDYSATKGAIVAFTRSLSLQLIEQGILVNGVAPGPIWTPLIPSTFPPEKVGS  238

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FGK VPMKR GQ  EVA  YVFLAS  E SY++GQ+LHPNGGT+VNG
Sbjct  239   FGKDVPMKRPGQPDEVATCYVFLASG-ECSYMSGQVLHPNGGTVVNG  284



>ref|WP_026630266.1| dehydrogenase [Dyadobacter alkalitolerans]
Length=285

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/284 (59%), Positives = 204/284 (72%), Gaps = 9/284 (3%)
 Frame = -1

Query  1080  QKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVA  901
             Q Q SQPG EH+MDPAP     +Y+ S KL+GK AL+TGGDSGIGRAV   FA EGA VA
Sbjct  10    QTQGSQPGIEHIMDPAPVIIRDNYRGSGKLEGKAALITGGDSGIGRAVAVHFAREGADVA  69

Query  900   FTYVKSQEDKDARDTLQILKKAKVEG-AKEPMAIPADLGFDENCRKVVESVVNSYGRIDI  724
               Y+  +ED+DA++T     KA VE   K  + +P D+  +  C+  V  VV+ +G++++
Sbjct  70    IVYL--EEDQDAQET-----KALVEAEGKRCLLVPGDIRDESFCKDAVAQVVSEFGKLNV  122

Query  723   LVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYK  544
             LVNNAAEQH    I EI   +L   F TNIFS FF  + AL H+ EG +IINTTSVTAY 
Sbjct  123   LVNNAAEQHPKEDIREITAEQLHVTFATNIFSFFFFTQAALPHLAEGDNIINTTSVTAYH  182

Query  543   GSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGK  364
             GSP LLDYS+TKGAIVA+TR LAL L E+ IRVN VAPGPIWTPLIPA+F  E+  +FGK
Sbjct  183   GSPALLDYSSTKGAIVAYTRSLALALAEKKIRVNAVAPGPIWTPLIPATFDAEKVEKFGK  242

Query  363   QVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
               PM+R GQ  EVAPSYVFLA C ++SYI+GQ+LHPNGG +VNG
Sbjct  243   DTPMERPGQPAEVAPSYVFLA-CEDASYISGQVLHPNGGQVVNG  285



>ref|WP_009523542.1| short-chain dehydrogenase [Ralstonia sp. PBA]
 gb|EIZ02751.1| short chain dehydrogenase [Ralstonia sp. PBA]
Length=285

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/286 (57%), Positives = 205/286 (72%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ Q  QPG+EH M P P+  ++DY     L GK AL+TGGDSGIGRAV   FA EGA
Sbjct  7     LPPQHQAQQPGREHAMQPQPESGARDYVGHGLLTGKTALITGGDSGIGRAVAIAFAREGA  66

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+  +E  DA++T ++++ A     ++ + +P DLG   + + VVE+ + S+G I
Sbjct  67    DVAVAYL--EEHADAQETARLVEAA----GRQCLLLPGDLGIRAHAQAVVETTLASFGHI  120

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   ++E+IDE +LE  FRTN+F+ F + + AL  M  GS I+NTTSVTA
Sbjct  121   DILVNNAAEQHPREALEDIDEAQLEATFRTNVFAMFHVTQAALPGMSAGSVILNTTSVTA  180

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GS  LLDY+ATKGAIVA+TR LALQ+VERGIRVNGVAPGPIWTPLIP++F  E  A F
Sbjct  181   YRGSKHLLDYAATKGAIVAWTRSLALQVVERGIRVNGVAPGPIWTPLIPSTFPPEHVATF  240

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             GK  PM R GQ  EVA  +VFLAS   +SYITGQILH NGG ++NG
Sbjct  241   GKDTPMGRPGQPEEVAGGFVFLAS-EAASYITGQILHINGGEVING  285



>ref|WP_020307459.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EPL61921.1| short-chain dehydrogenase [Pseudomonas stutzeri B1SMN1]
Length=285

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/293 (55%), Positives = 211/293 (72%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA D    PPQ+Q ++PGKE +M+P P+Y  +DYK + KL GKVA++TGGDSGIGR+V  
Sbjct  1     MADDNQTLPPQQQ-AEPGKEGLMNPRPEYRGEDYKAAGKLAGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   +D +     Q  K  +  G +  +    D+   + CRKVV+  
Sbjct  60    LFAREGADVAILYLDQHQDAE-----QTRKDVEQHG-RRCLTFAGDVADRDVCRKVVDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +  +G++DILVNNAAEQH     E+I   + E+ FRTN+F  F L + AL H++EG+SII
Sbjct  114   LAQFGKLDILVNNAAEQHPRDRFEDIPPEQWEQTFRTNVFGMFQLTQVALPHLQEGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NT+SVTAYKG+P L+DYS+TKGAIVAFTR LA+ L ERGIRVN VAPGPIWTPLIP++F 
Sbjct  174   NTSSVTAYKGNPMLIDYSSTKGAIVAFTRALAMSLAERGIRVNSVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              ++ AEFG  VPMKR GQ  EVAP+YV+LAS  ++SY++GQ++H NGGT+VNG
Sbjct  234   ADKVAEFGSNVPMKRPGQPEEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>ref|WP_012628858.1| short-chain dehydrogenase [Cyanothece sp. PCC 7425]
 ref|YP_002484159.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7425]
 gb|ACL45798.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7425]
Length=285

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/283 (59%), Positives = 209/283 (74%), Gaps = 8/283 (3%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             PPQ Q + PG E  M P P+  + +Y+ S KL+GKVAL+TGGDSGIGRAV   +A EGA 
Sbjct  9     PPQHQ-TPPGLESEMTPTPKSQASNYRGSGKLEGKVALITGGDSGIGRAVAVLYAREGAD  67

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             +A  Y   +E +DA  T Q+++    EG K  + +  D+G +  C++ V+  VN +G +D
Sbjct  68    LAIVY--KEEKEDAGQTQQMVE---AEG-KRCLTLQGDIGDESFCQQAVQQTVNEFGHLD  121

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             IL+NNAAEQH   SIE+I   +LER FRTNIF  FF+ K AL  +KEGS+IINTTSVTAY
Sbjct  122   ILINNAAEQHPQPSIEQISAEQLERTFRTNIFGMFFMTKAALPQLKEGSAIINTTSVTAY  181

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             +GS +LLDYSATKGAIVAFTR L+  L++RGIRVNGVAPGPIWTPLIP++F E++   FG
Sbjct  182   QGSSQLLDYSATKGAIVAFTRSLSQSLLDRGIRVNGVAPGPIWTPLIPSTFPEDKVKSFG  241

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIV  238
              QVPM+RAGQ  EVAP YVFLAS  +SSY+ GQILHPNGG +V
Sbjct  242   AQVPMQRAGQPEEVAPCYVFLASS-DSSYMAGQILHPNGGEVV  283



>ref|XP_002517193.1| short chain dehydrogenase, putative [Ricinus communis]
 gb|EEF45356.1| short chain dehydrogenase, putative [Ricinus communis]
Length=244

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 186/238 (78%), Gaps = 1/238 (0%)
 Frame = -1

Query  993  LQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKE  814
            + GK +     DSGIGRAVC  FALE A+VAFTYV+  E+KD  DTLQ+L   +  GA++
Sbjct  1    MAGKDSFSDRKDSGIGRAVCYHFALESASVAFTYVEGIEEKDKDDTLQMLYSVQATGARD  60

Query  813  PMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNI  634
            P+A+P DLGFDENC +VV+ VV  YGR+DILVNNAAEQH T S+++I   RLERVFRTNI
Sbjct  61   PIAVP-DLGFDENCERVVDQVVTEYGRVDILVNNAAEQHLTKSMDDITAPRLERVFRTNI  119

Query  633  FSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERG  454
            FSQFF+ +H LKHMKEGSS+IN+TSVTAY G  ++LDYS+TKGAIVAFTRGLALQLV RG
Sbjct  120  FSQFFMTRHCLKHMKEGSSVINSTSVTAYTGGSEILDYSSTKGAIVAFTRGLALQLVGRG  179

Query  453  IRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSY  280
            IRVNGVAPGP+WTPL PAS   E     G QVPM RA Q  E+APSYVFLAS   SSY
Sbjct  180  IRVNGVAPGPVWTPLQPASMPPEMVKRLGSQVPMGRAAQPYEIAPSYVFLASNECSSY  237



>ref|WP_027460601.1| short-chain dehydrogenase [Deinococcus murrayi]
Length=303

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/287 (59%), Positives = 208/287 (72%), Gaps = 7/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             + P + QD+QPG E  M  AP    + Y+ S KL+GKVAL++GGDSGIGRAV   FA EG
Sbjct  24    EVPGETQDTQPGSEAEMSLAPVVIREGYRGSGKLEGKVALISGGDSGIGRAVAVHFAREG  83

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A VA  Y+   ED  A+DT  +++    EG +  +AI  D+G  E CR+ VE  V   G 
Sbjct  84    ADVAILYLNEHED--AQDTASMVQ---AEG-RRAVAIAGDIGDPEFCRQAVERTVKELGS  137

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNAAEQ    SI +I   +LER FRTNIF  F+L + A+ H+ EG+SIINTTSVT
Sbjct  138   LDILVNNAAEQTPQDSITDITPQQLERTFRTNIFGMFYLTQAAMPHLGEGASIINTTSVT  197

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AYKGSP+LLDYS+TKGAIVAFTR L+  L E+ IRVNGVAPGPIWTPLIPA+F +E  AE
Sbjct  198   AYKGSPQLLDYSSTKGAIVAFTRSLSQNLAEKKIRVNGVAPGPIWTPLIPATFDQERVAE  257

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              G+ VP++R GQ  EVAP+YVFLAS  +SSYI+GQ+LHPNGG +VNG
Sbjct  258   HGQNVPLERPGQPAEVAPAYVFLAS-EDSSYISGQVLHPNGGEVVNG  303



>ref|WP_029282714.1| short-chain dehydrogenase [Bacillus indicus]
 gb|KEZ52227.1| short-chain dehydrogenase [Bacillus indicus LMG 22858]
Length=289

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/286 (57%), Positives = 210/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q QD QPG E  M+P P++ S  YK S KL  K A++TGGDSGIGR+V   FA EGA
Sbjct  11    MPAQHQDVQPGHEDQMNPKPEFDSHQYKGSGKLSDKTAIITGGDSGIGRSVAVHFAREGA  70

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V  +Y+   E  DA +T +++++   EG ++ + IP D+G +  C +VV   V+ +G+I
Sbjct  71    DVVISYL--DEHDDANETKRLVEQ---EG-RQCLLIPGDIGDEAFCGQVVNETVSKFGKI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH    IEEI + +LER F+TNIFS F++ K AL H+K+GSSIINT+S+TA
Sbjct  125   DILVNNAAEQHPQAGIEEISKEQLERTFKTNIFSFFYMTKAALPHLKQGSSIINTSSITA  184

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G+ +L+DYSATKGAI  FTR L++ LV++GIRVNGVAPGPIWTPLIP++F  E+ +EF
Sbjct  185   YAGNEQLIDYSATKGAITTFTRSLSMSLVKKGIRVNGVAPGPIWTPLIPSTFDAEKVSEF  244

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PM R GQ  E+APSYVFLAS  +SSYITGQ++H NGG I+NG
Sbjct  245   GADTPMGRPGQPDELAPSYVFLASS-DSSYITGQMIHVNGGKIING  289



>ref|WP_015126919.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Calothrix sp. PCC 
7507]
 ref|YP_007063928.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Calothrix sp. PCC 
7507]
 gb|AFY31094.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Calothrix sp. PCC 
7507]
Length=285

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/276 (58%), Positives = 208/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M+P P+    +Y+ S KLQ KVA++TGGDSGIGRA+   FA EGA VA  Y+  Q
Sbjct  17    GMESEMNPKPKADDANYRGSGKLQDKVAIITGGDSGIGRAIAIAFAKEGADVAIVYL--Q  74

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T + ++       +  + I  D+  +  C+++V+  V+ +G++DIL+NNAAEQ
Sbjct  75    EHDDAKETQEGVENQ----GRRALTIAGDITDETFCQQIVQKTVDEFGKLDILINNAAEQ  130

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   SIE+I + +LER FRTNIFS F+L K A+KH+  GS+IINTTSVTAYKG+P+LLDY
Sbjct  131   HPQKSIEDISKEQLERTFRTNIFSMFYLTKAAIKHLHPGSAIINTTSVTAYKGNPQLLDY  190

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LVE+GIRVN VAPGPIWTPLI ++F EE+ A FG+QVPMKR G
Sbjct  191   SSTKGAIVAFTRSLSQNLVEKGIRVNAVAPGPIWTPLITSTFPEEKVATFGQQVPMKRPG  250

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  EVAPSYVFLAS  ++SYI+GQ+LHPNGG ++NG
Sbjct  251   QPEEVAPSYVFLAS-DDASYISGQVLHPNGGEVING  285



>ref|WP_029565118.1| short-chain dehydrogenase [Bacillus cibi]
 gb|KEZ53424.1| short-chain dehydrogenase [Bacillus cibi]
Length=289

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/286 (57%), Positives = 209/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q QD QPG E  M P P++ S  YK S KL  K A++TGGDSGIGR+V   FA EGA
Sbjct  11    MPAQHQDVQPGHEDQMHPKPEFDSHQYKGSGKLSDKTAIITGGDSGIGRSVAVHFAREGA  70

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V  +Y+   E  DA +T +++++   EG ++ + IP D+G +  C +VV   V+ +G+I
Sbjct  71    DVVISYL--DEHDDANETKRLVEQ---EG-RQCLLIPGDIGDEAFCGQVVNETVSKFGKI  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH    IEEI + +LER F+TNIFS F++ K AL H+K+GSSIINT+S+TA
Sbjct  125   DILVNNAAEQHPQAGIEEISKEQLERTFKTNIFSFFYMTKAALSHLKQGSSIINTSSITA  184

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y G+ +L+DYSATKGAI  FTR L++ LV++GIRVNGVAPGPIWTPLIP++F  E+ +EF
Sbjct  185   YAGNEQLIDYSATKGAITTFTRSLSMSLVKKGIRVNGVAPGPIWTPLIPSTFDAEKVSEF  244

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PM R GQ  E+APSYVFLAS  +SSYITGQ++H NGG I+NG
Sbjct  245   GADTPMGRPGQPDELAPSYVFLASS-DSSYITGQMIHVNGGKIING  289



>ref|WP_007222970.1| short-chain dehydrogenase [planctomycete KSU-1]
 dbj|GAB63887.1| oxidoreductase [planctomycete KSU-1]
Length=288

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/287 (58%), Positives = 209/287 (73%), Gaps = 7/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             ++PPQ Q+ QPGKEH M P P+   ++Y+  +KLQ KVAL+TGGDSGIGRA    FA EG
Sbjct  9     KYPPQHQEQQPGKEHQMQPKPKSQMKEYRGCDKLQDKVALITGGDSGIGRAAAIAFAKEG  68

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A V+  Y    E KDA +T ++++K   EG +  + I  D+G    C + V+  VN  G+
Sbjct  69    AQVSVVY--HNEHKDAEETRRLIEK---EG-RRCLLIAGDVGDGVFCSQAVKKTVNELGK  122

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNAA Q    SIE I E +L   FRTNIFS FF+ + ALKH+ +GS+IINTTSVT
Sbjct  123   LDILVNNAAVQFVQESIENITEEQLVTTFRTNIFSYFFMTRAALKHLGKGSTIINTTSVT  182

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+GS  LLDYS+TKGAIV+FTR LAL L+++GIRVN VAPGP+WTPLIPASF EE+   
Sbjct  183   AYRGSLHLLDYSSTKGAIVSFTRSLALSLIKKGIRVNAVAPGPVWTPLIPASFPEEKVES  242

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG QVPM+RA +  E+AP YVFLAS  +SSYITGQ+LHPNGG +V G
Sbjct  243   FGAQVPMERAAEPDEIAPCYVFLAS-DDSSYITGQVLHPNGGEMVGG  288



>ref|WP_035410692.1| short-chain dehydrogenase [Bacillus sp. SJS]
 gb|KEZ55686.1| short-chain dehydrogenase [Bacillus sp. SJS]
Length=289

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 162/286 (57%), Positives = 212/286 (74%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q+QD QPG+E +M+PAP+++   YK S KL+GK A++TGGDSGIGRAV   FA EGA
Sbjct  11    MPAQEQDVQPGQETLMNPAPKFAGDFYKGSGKLEGKTAIITGGDSGIGRAVAVFFAREGA  70

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V   Y+   E  DA +T ++++K   EG +    I  D+G +  C++VV   +  +G++
Sbjct  71    DVTIAYL--NEHDDASETKRLVEK---EG-RSCFIIAGDIGDEGFCKQVVRETIVKFGKL  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DILVNNAAEQH   + E+I   +LER F+TNIFS F L K +L H+KEGSSIINTTS+TA
Sbjct  125   DILVNNAAEQHPQDNFEDITAEQLERTFKTNIFSMFHLTKASLPHLKEGSSIINTTSITA  184

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y GSP L+DYSATKGAI +FTR L+  L+++GIRVNGVAPGPIWTPLIP++F E++ AEF
Sbjct  185   YAGSPGLIDYSATKGAITSFTRSLSGNLIKKGIRVNGVAPGPIWTPLIPSTFPEDKVAEF  244

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PM+R GQ  E+APSYV+LAS  +S+Y+TGQ+LH NGG +VNG
Sbjct  245   GADTPMQRPGQPEELAPSYVYLASA-DSTYVTGQVLHVNGGKVVNG  289



>ref|WP_021208172.1| short-chain dehydrogenase [Pseudomonas stutzeri]
 gb|EQM77273.1| short-chain dehydrogenase [Pseudomonas stutzeri MF28]
Length=285

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/293 (54%), Positives = 210/293 (72%), Gaps = 8/293 (3%)
 Frame = -1

Query  1110  MASDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQ  931
             MA +    PPQ+Q  +PGKE +M+P P++  +DYK + KLQGKVA++TGGDSGIGR+V  
Sbjct  1     MADENQTLPPQQQ-PEPGKEGLMNPRPEFRGEDYKAAGKLQGKVAIITGGDSGIGRSVAV  59

Query  930   CFALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESV  751
              FA EGA VA  Y+   +D D        +K   E  +  +    D+   + CRKVV+  
Sbjct  60    LFAREGADVAILYLDQHQDADQ------TRKVVEEQGRTCLTFAGDVADRDVCRKVVDET  113

Query  750   VNSYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSII  571
             +  +G++DILVNNAAEQH   S E+I   + E+ FRTN+F  F + + AL H+KEG+SII
Sbjct  114   LAKFGKLDILVNNAAEQHPQKSFEDISPEQWEKTFRTNVFGMFQMTQAALPHLKEGASII  173

Query  570   NTTSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFS  391
             NT+SVTAYKG+P L+DYS+TKGAIVAFTR L++ L ER IRVN VAPGPIWTPLIP++F 
Sbjct  174   NTSSVTAYKGNPMLIDYSSTKGAIVAFTRALSMSLAERRIRVNSVAPGPIWTPLIPSTFD  233

Query  390   EEECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
              ++ AEFG  VP+KR GQ  EVAP+YV+LAS  ++SY++GQ++H NGGT+VNG
Sbjct  234   ADKVAEFGANVPLKRPGQPEEVAPAYVYLASS-DASYVSGQVIHVNGGTVVNG  285



>gb|AIQ34852.1| short-chain dehydrogenase [Paenibacillus sp. FSL R5-0345]
Length=289

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 208/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              PPQ+Q  QPG E  M P P+Y   +YK + KL+GK AL+TGGDSGIGRAV   FA EGA
Sbjct  11    LPPQEQHHQPGIESEMKPLPKYEPANYKAAGKLEGKAALITGGDSGIGRAVAVLFAKEGA  70

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              V  +Y+   E  DA +T    K+   +  ++ + IP D+G +  C+ +++  V   G++
Sbjct  71    DVVISYLN--EHSDAEET----KRQVEQEGRKCILIPGDIGVESFCKDLIKQTVEGLGKL  124

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNAAEQH    IE+I   +LER FRTNIF+ F+L K A+ H+K GS+IINTTS+TA
Sbjct  125   DILINNAAEQHPQAKIEDITSEQLERTFRTNIFAMFYLTKAAMPHLKAGSAIINTTSITA  184

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             Y+GSP+LLDYS+TKGAI++FTR L+  L E+GIRVNGVAPGPIWTPLIP++F  ++ +EF
Sbjct  185   YRGSPQLLDYSSTKGAILSFTRSLSTNLAEQGIRVNGVAPGPIWTPLIPSTFDAKQVSEF  244

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   PMKR GQ  E+AP+YV+LAS  +SSY+TGQ++H NGG +VNG
Sbjct  245   GGTQPMKRPGQPEELAPAYVYLAS-DDSSYVTGQVIHVNGGEVVNG  289



>ref|WP_015188665.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Gloeocapsa sp. PCC 
7428]
 ref|YP_007127953.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30793.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Gloeocapsa sp. PCC 
7428]
Length=286

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/276 (59%), Positives = 207/276 (75%), Gaps = 7/276 (3%)
 Frame = -1

Query  1059  GKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGATVAFTYVKSQ  880
             G E  M P P+     ++ S KL GKVA++TGGDSGIGRAV   FA EGA VA  Y+   
Sbjct  18    GLESEMTPKPKADDPQHQGSGKLLGKVAVITGGDSGIGRAVAIAFAKEGADVAIMYLN--  75

Query  879   EDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRIDILVNNAAEQ  700
             E  DA++T ++++    E  ++   I  D+G +  C++ +E VV  +G++DILVNNAAEQ
Sbjct  76    EHDDAKETKRLVE----EKGRKATTIAGDIGDESFCKQAIEQVVQEFGKLDILVNNAAEQ  131

Query  699   HKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAYKGSPKLLDY  520
             H   S+E+I   +LER FRTNIFS F+L K ALKH++EGS+IINTTSVTAY+G+ +L+DY
Sbjct  132   HPQESLEDISAEQLERTFRTNIFSMFYLTKAALKHLQEGSTIINTTSVTAYQGNQQLIDY  191

Query  519   SATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFGKQVPMKRAG  340
             S+TKGAIVAFTR L+  LV++GIRVN VAPGPIWTPLIPA+F EE+ A+FGKQVPM RAG
Sbjct  192   SSTKGAIVAFTRSLSQSLVKKGIRVNAVAPGPIWTPLIPATFPEEKVADFGKQVPMGRAG  251

Query  339   QTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             Q  EVA  YVFLA+  +SSYI GQ+LHPNGGTIVNG
Sbjct  252   QPEEVASCYVFLAAN-DSSYIAGQVLHPNGGTIVNG  286



>ref|WP_003246982.1| short-chain dehydrogenase [Pseudomonas mendocina]
 gb|EJO91453.1| short-chain dehydrogenase/reductase SDR [Pseudomonas mendocina 
DLHK]
Length=284

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/286 (56%), Positives = 208/286 (73%), Gaps = 7/286 (2%)
 Frame = -1

Query  1089  FPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGA  910
              P Q QD QPG EH M P P Y S  Y+ ++KL GKVA++TGGDSGIGRAV   +ALEGA
Sbjct  6     LPAQHQDRQPGLEHAMHPEPVYLSDSYRAADKLAGKVAIITGGDSGIGRAVAVHYALEGA  65

Query  909   TVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRI  730
              VA  Y+   E++DA+ T+  + +       E +A+  D+G    C+ VV++V+  +GR+
Sbjct  66    KVALVYL--DENEDAQKTVDEVTRH----GSEAIALAGDVGDAGFCQCVVDAVIAKWGRL  119

Query  729   DILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTA  550
             DIL+NNA EQH    + E++E   ER FRTNI + F L K ALKH++ G+SIINT+SVTA
Sbjct  120   DILINNAGEQHPKEDLLELEEADWERTFRTNILAMFQLTKVALKHLQSGASIINTSSVTA  179

Query  549   YKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEF  370
             YKG+P LLDYS+TKGAI +FTR LA+ L  RGIRVNGVAPGPIWTPLIP++FS ++ AEF
Sbjct  180   YKGNPMLLDYSSTKGAITSFTRSLAINLAPRGIRVNGVAPGPIWTPLIPSTFSADKVAEF  239

Query  369   GKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             G   P+ R GQ  EVAP+YV+LAS  ++SY+TGQ+LH NGG++VNG
Sbjct  240   GADTPLGRPGQPSEVAPAYVYLASN-DASYMTGQMLHVNGGSVVNG  284



>ref|WP_026235740.1| short-chain dehydrogenase [Echinicola pacifica]
Length=285

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 211/284 (74%), Gaps = 7/284 (2%)
 Frame = -1

Query  1086  PPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEGAT  907
             P Q Q+ QPGKEH M P P+Y   DY+ S KL+G+VA+++GGDSGIGRAV   FA EGA 
Sbjct  8     PGQHQEEQPGKEHEMYPKPEYIRSDYQGSGKLKGQVAIISGGDSGIGRAVAVHFAAEGAN  67

Query  906   VAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGRID  727
             +A  Y+   EDKDA++T+++++K      +E +AI ADL   + C   VE  ++++G++D
Sbjct  68    IAIIYLN--EDKDAQETVRLVEKH----GQEAIAIKADLSRKQECFDAVEKTISAFGQLD  121

Query  726   ILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVTAY  547
             +LVNNAA+Q+    +E+I E +L   F TNI+S FFL + AL H+ +G++I+NT S+TAY
Sbjct  122   VLVNNAAQQYVQERLEDISEEQLRHTFETNIYSYFFLTQAALPHLNKGAAIVNTASITAY  181

Query  546   KGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAEFG  367
             +G P L+DYS+TKGAIVAFTR LA  L +RGIRVNGVAPGPIWTPLIPASFSEE+ AEFG
Sbjct  182   RGKPTLIDYSSTKGAIVAFTRSLAGNLADRGIRVNGVAPGPIWTPLIPASFSEEKVAEFG  241

Query  366   KQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVN  235
                P+ R G+  EVA +YV+LAS  ++SY++GQ LHPNGG +VN
Sbjct  242   VDTPLGRPGEPSEVATAYVYLAS-KDASYMSGQFLHPNGGEVVN  284



>ref|WP_009619814.1| putative short-chain dehydrogenase [Pseudomonas sp. M1]
 gb|ETM67090.1| short-chain dehydrogenase [Pseudomonas sp. M1]
Length=283

 Score =   327 bits (838),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 207/287 (72%), Gaps = 7/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             + PPQ QD QPG+E +M P P+++S+ Y+ + KL+GKVA+VTGGDSGIGRAV   FA EG
Sbjct  4     KLPPQHQDRQPGREEIMQPPPEFASESYRAAGKLEGKVAVVTGGDSGIGRAVALTFAREG  63

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A V   Y+  +E +DA  T Q+++        E     AD GF   C +V   +   +GR
Sbjct  64    ADVMLLYL--EETEDATKTCQLIEVCGRH-CLELAGDVADAGF---CAEVARRLKARWGR  117

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +D+LVNNA EQH   S+E+I E + ER FRTNIF  F L K  L  M EG++I+NTTS+T
Sbjct  118   LDVLVNNAGEQHPADSLEDISEEQWERTFRTNIFGMFQLTKALLPLMGEGAAIVNTTSIT  177

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AYKG+P+L+DYS+TKGAI +FTR LAL LV+RGIRVN VAPGPIWTPLIP++FS EE AE
Sbjct  178   AYKGNPRLIDYSSTKGAITSFTRSLALNLVQRGIRVNAVAPGPIWTPLIPSTFSAEEVAE  237

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FG   PM R GQ  E+AP+YV+LA C +SSY++GQ+LH NGGT+VNG
Sbjct  238   FGSNTPMGRPGQPDELAPAYVYLA-CSDSSYMSGQVLHVNGGTVVNG  283



>ref|WP_008567791.1| short-chain dehydrogenase [Pseudomonas sp. Chol1]
 gb|EKM95878.1| short-chain dehydrogenase [Pseudomonas sp. Chol1]
 gb|EKM96936.1| short-chain dehydrogenase [Pseudomonas sp. Chol1]
Length=284

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 158/291 (54%), Positives = 211/291 (73%), Gaps = 8/291 (3%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             +D    PPQ+Q  +PGKE +M P PQY  +DY+ + KL G+VA++TGGDSGIGR+V   F
Sbjct  2     ADNQTLPPQQQ-PEPGKEGLMHPRPQYRGEDYQAAGKLAGRVAIITGGDSGIGRSVAVLF  60

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             A EGA VA  Y+   + +DA +T +++++      +  +    D+   + CR+VV+  + 
Sbjct  61    AREGADVAILYLD--QHQDAEETRKVVEQH----GRRCLTFAGDVAEKDVCRRVVDETLA  114

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
               GR+DILVNNAAEQH     E++ + + E+ FRTN+F  F + + AL H+ EG+SIINT
Sbjct  115   QLGRLDILVNNAAEQHPQERFEDVSQQQWEKTFRTNVFGMFQMTQAALPHLPEGASIINT  174

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
             TSVTAYKG+P L+DYS+TKGAIV FTR LA+ L ERGIRVNGVAPGPIWTPLIP++F  +
Sbjct  175   TSVTAYKGNPMLIDYSSTKGAIVGFTRALAMHLAERGIRVNGVAPGPIWTPLIPSTFDAD  234

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             + AEFG  VPMKR GQ  EVAP+YV+LAS  +SSY++GQ+LH NGGT+VNG
Sbjct  235   KVAEFGSNVPMKRPGQPEEVAPAYVYLASR-DSSYVSGQVLHVNGGTVVNG  284



>ref|WP_017444974.1| hypothetical protein [Gayadomonas joobiniege]
Length=285

 Score =   327 bits (838),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 202/291 (69%), Gaps = 7/291 (2%)
 Frame = -1

Query  1104  SDGNQFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCF  925
             S  N FPPQ Q  QPG E  M P PQ   ++Y+P+ KL GKVALV+GGDSGIGRAVC  F
Sbjct  2     SSNNSFPPQHQLHQPGDESQMHPRPQSFMKNYQPAGKLTGKVALVSGGDSGIGRAVCMGF  61

Query  924   ALEGATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVN  745
             A EGA VAF Y    ED DA +TL  +K+A   GAK  +AI  D+   + C   VE   N
Sbjct  62    AKEGADVAFIY--RDEDNDANETLAAVKEA---GAKA-IAIKGDIASKKFCLDAVEQTRN  115

Query  744   SYGRIDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINT  565
               G ++ILVNNAAEQH   S+ EI+E+++ R F TN+F   FL + +L H+ +G S++NT
Sbjct  116   ELGGLNILVNNAAEQHVKQSLTEIEESQIRRTFDTNVFGTMFLTQASLPHLTKGDSVVNT  175

Query  564   TSVTAYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEE  385
             TSV AY+G   L+DY ATKGAIV FTR LA  L E GIRVN VAPGPIWTPLIPASFS E
Sbjct  176   TSVVAYRGKSSLIDYGATKGAIVGFTRSLASNLSETGIRVNAVAPGPIWTPLIPASFSAE  235

Query  384   ECAEFGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             E   FG+  PM R GQ  EVAP+Y+FLAS  ++SYITGQ++HPNGGTI+ G
Sbjct  236   EVETFGQSSPMGRPGQPDEVAPAYIFLASN-DASYITGQVIHPNGGTIIGG  285



>ref|WP_006579394.1| short-chain dehydrogenase [Cupriavidus sp. HPC(L)]
 gb|ESH93166.1| short-chain dehydrogenase [Cupriavidus sp. HPC(L)]
Length=285

 Score =   327 bits (838),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/287 (57%), Positives = 206/287 (72%), Gaps = 7/287 (2%)
 Frame = -1

Query  1092  QFPPQKQDSQPGKEHVMDPAPQYSSQDYKPSNKLQGKVALVTGGDSGIGRAVCQCFALEG  913
             Q PPQ QD QPG E  M P P   + DY  S +L GKVAL++GGDSGIGRAV   FA EG
Sbjct  6     QLPPQHQDRQPGLESEMHPKPDSGADDYVGSGQLTGKVALISGGDSGIGRAVAVAFAREG  65

Query  912   ATVAFTYVKSQEDKDARDTLQILKKAKVEGAKEPMAIPADLGFDENCRKVVESVVNSYGR  733
             A VA  Y+   ED  AR+T +++++A     +  + +  DLG   +  +VVE  V   G+
Sbjct  66    ADVAVAYLNEHED--ARETARLVEEA----GRRCLLMDGDLGDSAHAAQVVERTVKELGK  119

Query  732   IDILVNNAAEQHKTWSIEEIDETRLERVFRTNIFSQFFLVKHALKHMKEGSSIINTTSVT  553
             +DILVNNAAEQH     E+IDE ++E  FRTN+F+ F L + AL H++ GS+I+NTTSVT
Sbjct  120   LDILVNNAAEQHPKQQPEQIDEGQVEATFRTNVFAMFHLTRAALPHLQPGSAIVNTTSVT  179

Query  552   AYKGSPKLLDYSATKGAIVAFTRGLALQLVERGIRVNGVAPGPIWTPLIPASFSEEECAE  373
             AY+GS  LLDYS+TKGAIV+FTR LALQ+V+RGIRVNGVAPGPIWTPLIP++FS E+  +
Sbjct  180   AYRGSAHLLDYSSTKGAIVSFTRSLALQVVKRGIRVNGVAPGPIWTPLIPSTFSPEQVEK  239

Query  372   FGKQVPMKRAGQTIEVAPSYVFLASCPESSYITGQILHPNGGTIVNG  232
             FGK+ PM R GQ  EVA  +VFLAS   +SYITGQ+LH NGG ++NG
Sbjct  240   FGKETPMGRPGQPFEVAAGFVFLASR-AASYITGQVLHINGGEVING  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3333114759636