BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2651_g1_i1 len=1547 path=[1:0-257 3069:258-277 259:278-1546]

Length=1547
                                                                      Score     E

gb|AEQ29017.1|  WRKY4                                                   200   3e-56   
ref|XP_007201365.1|  hypothetical protein PRUPE_ppa010217mg             195   2e-54   
ref|XP_002270750.3|  PREDICTED: probable WRKY transcription facto...    192   2e-53   Vitis vinifera
ref|XP_011079549.1|  PREDICTED: probable WRKY transcription facto...    191   6e-53   
ref|XP_009628910.1|  PREDICTED: probable WRKY transcription facto...    191   6e-53   
ref|XP_009628909.1|  PREDICTED: probable WRKY transcription facto...    184   2e-50   
ref|XP_009628911.1|  PREDICTED: probable WRKY transcription facto...    182   7e-50   
ref|XP_006444508.1|  hypothetical protein CICLE_v10021624mg             182   3e-49   
ref|XP_006492342.1|  PREDICTED: probable WRKY transcription facto...    182   3e-49   
gb|ACV92005.1|  WRKY transcription factor 3                             179   2e-48   (Populus tomentosa x Populus bolleana) x Populus tomentosa
gb|EYU46812.1|  hypothetical protein MIMGU_mgv1a012761mg                178   2e-48   
ref|XP_002301514.2|  hypothetical protein POPTR_0002s19630g             178   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_002515275.1|  conserved hypothetical protein                     179   2e-48   Ricinus communis
gb|AGV75971.1|  WRKY transcription factor 93                            179   2e-48   
gb|KHG13090.1|  putative WRKY transcription factor 35 -like protein     179   3e-48   
gb|AIE43843.1|  WRKY transcription factor 53                            177   7e-48   
ref|XP_006840437.1|  hypothetical protein AMTR_s00045p00165950          178   2e-47   
ref|XP_002320972.1|  hypothetical protein POPTR_0014s11490g             176   2e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011042262.1|  PREDICTED: probable WRKY transcription facto...    175   3e-47   
ref|XP_003625977.1|  WRKY transcription factor                          175   6e-47   
gb|AFK40226.1|  unknown                                                 175   6e-47   
gb|ABS18416.1|  WRKY8                                                   174   1e-46   Glycine max [soybeans]
ref|XP_010267989.1|  PREDICTED: probable WRKY transcription facto...    175   1e-46   
ref|XP_009772110.1|  PREDICTED: probable WRKY transcription facto...    173   1e-46   
ref|XP_011041119.1|  PREDICTED: probable WRKY transcription facto...    173   1e-46   
ref|XP_006604744.1|  PREDICTED: probable WRKY transcription facto...    174   2e-46   
ref|XP_003521596.1|  PREDICTED: probable WRKY transcription facto...    172   5e-46   
ref|XP_004300445.1|  PREDICTED: uncharacterized protein LOC101296670    173   6e-46   
ref|XP_011041128.1|  PREDICTED: probable WRKY transcription facto...    171   6e-46   
ref|XP_009378733.1|  PREDICTED: probable WRKY transcription facto...    172   1e-45   
ref|XP_004229384.1|  PREDICTED: probable WRKY transcription facto...    171   1e-45   
ref|XP_010322372.1|  PREDICTED: probable WRKY transcription facto...    171   1e-45   
ref|XP_009346616.1|  PREDICTED: probable WRKY transcription facto...    170   3e-45   
ref|NP_001280896.1|  probable WRKY transcription factor 35              170   4e-45   
ref|XP_006349180.1|  PREDICTED: probable WRKY transcription facto...    169   9e-45   
ref|XP_007051114.1|  WRKY DNA-binding protein 35, putative              169   1e-44   
ref|XP_008369035.1|  PREDICTED: probable WRKY transcription facto...    168   2e-44   
ref|XP_010259291.1|  PREDICTED: probable WRKY transcription facto...    167   8e-44   
gb|AIY62482.1|  WRKY105                                                 166   8e-44   
gb|AIE43846.1|  WRKY transcription factor 65                            161   2e-42   
ref|XP_010931747.1|  PREDICTED: probable WRKY transcription facto...    162   8e-42   
ref|XP_008812523.1|  PREDICTED: probable WRKY transcription facto...    160   2e-41   
ref|XP_007163184.1|  hypothetical protein PHAVU_001G213600g             160   2e-41   
gb|AGQ04237.1|  WRKY transcription factor 46                            160   3e-41   
ref|XP_010087230.1|  putative WRKY transcription factor 35              153   7e-39   
ref|XP_004494428.1|  PREDICTED: probable WRKY transcription facto...    149   9e-38   
gb|ABS18437.1|  WRKY41                                                  146   2e-37   Glycine max [soybeans]
ref|XP_010545170.1|  PREDICTED: probable WRKY transcription facto...    143   5e-36   
gb|AFK39080.1|  unknown                                                 143   5e-35   
ref|XP_010914568.1|  PREDICTED: probable WRKY transcription facto...    140   1e-34   
ref|XP_010069834.1|  PREDICTED: probable WRKY transcription facto...    141   1e-34   
ref|XP_008797453.1|  PREDICTED: probable WRKY transcription facto...    139   6e-34   
ref|XP_008235213.1|  PREDICTED: probable WRKY transcription facto...    136   1e-33   
gb|AEO31482.1|  WRKY transcription factor 3-1                           130   4e-33   
ref|XP_008228947.1|  PREDICTED: probable WRKY transcription facto...    133   9e-32   
ref|XP_007216729.1|  hypothetical protein PRUPE_ppa025586mg             133   1e-31   
ref|XP_010248362.1|  PREDICTED: probable WRKY transcription facto...    132   4e-31   
ref|XP_011083309.1|  PREDICTED: probable WRKY transcription facto...    129   8e-31   
ref|XP_008381191.1|  PREDICTED: probable WRKY transcription facto...    129   8e-31   
ref|XP_009365282.1|  PREDICTED: probable WRKY transcription facto...    129   9e-31   
ref|XP_002277383.1|  PREDICTED: probable WRKY transcription facto...    129   1e-30   Vitis vinifera
ref|XP_010689722.1|  PREDICTED: probable WRKY transcription facto...    130   1e-30   
ref|XP_010689723.1|  PREDICTED: probable WRKY transcription facto...    130   2e-30   
emb|CDP15957.1|  unnamed protein product                                129   2e-30   
ref|XP_010102121.1|  putative WRKY transcription factor 69              128   3e-30   
ref|XP_010242110.1|  PREDICTED: probable WRKY transcription facto...    128   6e-30   
ref|XP_006348892.1|  PREDICTED: probable WRKY transcription facto...    127   8e-30   
ref|XP_010323672.1|  PREDICTED: probable WRKY transcription facto...    127   9e-30   
gb|KDO77908.1|  hypothetical protein CISIN_1g022353mg                   126   9e-30   
ref|XP_010242109.1|  PREDICTED: probable WRKY transcription facto...    127   1e-29   
ref|XP_004243269.1|  PREDICTED: probable WRKY transcription facto...    127   1e-29   
ref|XP_006348893.1|  PREDICTED: probable WRKY transcription facto...    127   1e-29   
ref|XP_011039390.1|  PREDICTED: probable WRKY transcription facto...    126   2e-29   
ref|XP_004504282.1|  PREDICTED: probable WRKY transcription facto...    125   2e-29   
ref|XP_009595576.1|  PREDICTED: probable WRKY transcription facto...    127   2e-29   
ref|XP_009758490.1|  PREDICTED: probable WRKY transcription facto...    127   2e-29   
ref|XP_007149724.1|  hypothetical protein PHAVU_005G093800g             125   2e-29   
ref|XP_006654004.1|  PREDICTED: probable WRKY transcription facto...    123   2e-29   
ref|XP_006467614.1|  PREDICTED: probable WRKY transcription facto...    126   2e-29   
gb|AGQ04241.1|  WRKY transcription factor 50.1                          126   2e-29   
gb|EPS58967.1|  hypothetical protein M569_15845                         125   2e-29   
gb|ACD56642.1|  putative WRKY transcription factor                      126   3e-29   Gossypioides kirkii
ref|XP_006449542.1|  hypothetical protein CICLE_v10016229mg             126   3e-29   
ref|XP_009758491.1|  PREDICTED: probable WRKY transcription facto...    126   3e-29   
gb|AGV75966.1|  WRKY transcription factor 81                            125   3e-29   
ref|XP_009595577.1|  PREDICTED: probable WRKY transcription facto...    126   3e-29   
ref|XP_010057124.1|  PREDICTED: probable WRKY transcription facto...    126   3e-29   
ref|NP_001237726.1|  WRKY52 protein                                     125   4e-29   
gb|AAZ99027.1|  WRKY-A1244                                              126   4e-29   Capsicum annuum
gb|KDO77906.1|  hypothetical protein CISIN_1g022353mg                   125   5e-29   
ref|XP_002962865.1|  hypothetical protein SELMODRAFT_77979              120   5e-29   
ref|XP_004305451.1|  PREDICTED: probable WRKY transcription facto...    125   6e-29   
ref|XP_010549419.1|  PREDICTED: probable WRKY transcription facto...    124   6e-29   
ref|XP_010679393.1|  PREDICTED: probable WRKY transcription facto...    124   6e-29   
ref|NP_001274847.1|  WRKY transcription factor 5                        125   6e-29   
ref|NP_001237587.1|  transcription factor                               124   7e-29   
emb|CDX90180.1|  BnaA08g18040D                                          124   7e-29   
ref|XP_010549420.1|  PREDICTED: probable WRKY transcription facto...    124   8e-29   
gb|KCW74147.1|  hypothetical protein EUGRSUZ_E02783                     126   8e-29   
gb|AAT64024.1|  putative WRKY transcription factor                      124   8e-29   Gossypium hirsutum [American cotton]
gb|ACI14404.1|  WRKY65-1 transcription factor                           124   8e-29   Brassica napus [oilseed rape]
ref|XP_004487582.1|  PREDICTED: probable WRKY transcription facto...    126   9e-29   
gb|ACD56629.1|  putative WRKY transcription factor                      124   1e-28   Gossypium raimondii
ref|XP_009109676.1|  PREDICTED: probable WRKY transcription facto...    124   1e-28   
ref|XP_009593761.1|  PREDICTED: probable WRKY transcription facto...    124   1e-28   
ref|XP_006358112.1|  PREDICTED: probable WRKY transcription facto...    125   1e-28   
gb|EEE62209.1|  hypothetical protein OsJ_16996                          121   1e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010499444.1|  PREDICTED: probable WRKY transcription facto...    124   1e-28   
ref|XP_009115259.1|  PREDICTED: probable WRKY transcription facto...    124   1e-28   
gb|AAT64011.1|  putative WRKY transcription factor                      124   1e-28   Gossypium hirsutum [American cotton]
ref|XP_002522247.1|  WRKY transcription factor, putative                124   1e-28   Ricinus communis
ref|XP_002317397.1|  WRKY transcription factor 65 family protein        124   1e-28   Populus trichocarpa [western balsam poplar]
gb|KFK44771.1|  hypothetical protein AALP_AA1G300900                    124   1e-28   
gb|AAS79556.1|  WRKY family transcription factor                        123   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004233062.1|  PREDICTED: probable WRKY transcription facto...    125   1e-28   
gb|KHG22407.1|  putative WRKY transcription factor 65 -like protein     124   1e-28   
ref|XP_009802036.1|  PREDICTED: probable WRKY transcription facto...    124   1e-28   
ref|XP_004174142.1|  PREDICTED: probable WRKY transcription facto...    120   1e-28   
ref|NP_174222.2|  putative WRKY transcription factor 65                 123   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890801.1|  WRKY DNA-binding protein 65                        123   1e-28   
ref|XP_008779946.1|  PREDICTED: probable WRKY transcription facto...    122   1e-28   
gb|KFK44770.1|  hypothetical protein AALP_AA1G300900                    124   2e-28   
ref|XP_008454282.1|  PREDICTED: probable WRKY transcription facto...    124   2e-28   
ref|XP_007159480.1|  hypothetical protein PHAVU_002G240900g             123   2e-28   
ref|XP_002269267.1|  PREDICTED: probable WRKY transcription facto...    124   2e-28   Vitis vinifera
ref|XP_010316839.1|  PREDICTED: probable WRKY transcription facto...    124   2e-28   
ref|XP_004152355.1|  PREDICTED: uncharacterized protein LOC101212435    124   2e-28   
gb|KHG15095.1|  putative WRKY transcription factor 65 -like protein     123   2e-28   
ref|XP_009593762.1|  PREDICTED: probable WRKY transcription facto...    123   2e-28   
ref|XP_006585175.1|  PREDICTED: probable WRKY transcription facto...    123   2e-28   
gb|AHB33864.1|  WRKY transcription factor 69                            123   2e-28   
ref|XP_003524970.1|  PREDICTED: probable WRKY transcription facto...    123   2e-28   
emb|CDO96851.1|  unnamed protein product                                124   2e-28   
ref|NP_001237221.1|  WRKY48 protein                                     123   2e-28   
ref|XP_009802037.1|  PREDICTED: probable WRKY transcription facto...    123   2e-28   
ref|XP_004969956.1|  PREDICTED: probable WRKY transcription facto...    124   3e-28   
gb|AAU10752.1|  putative WRKY transcription factor                      122   3e-28   Oryza sativa Japonica Group [Japonica rice]
gb|KHN06418.1|  Putative WRKY transcription factor 65                   122   3e-28   
gb|KHN48014.1|  Putative WRKY transcription factor 65                   122   3e-28   
ref|XP_006304099.1|  hypothetical protein CARUB_v10010013mg             123   3e-28   
gb|KHG04202.1|  putative WRKY transcription factor 65 -like protein     123   3e-28   
emb|CDY50779.1|  BnaA09g54080D                                          122   3e-28   
ref|XP_002458491.1|  hypothetical protein SORBIDRAFT_03g034670          124   3e-28   Sorghum bicolor [broomcorn]
ref|XP_007211770.1|  hypothetical protein PRUPE_ppa009647mg             123   3e-28   
gb|AGV75938.1|  WRKY transcription factor 30                            123   3e-28   
gb|AGV75947.1|  WRKY transcription factor 43                            123   3e-28   
gb|ACV92010.1|  WRKY transcription factor 8                             122   3e-28   (Populus tomentosa x Populus bolleana) x Populus tomentosa
ref|XP_010686241.1|  PREDICTED: probable WRKY transcription facto...    123   3e-28   
gb|AIY62469.1|  WRKY43                                                  123   3e-28   
ref|XP_010460704.1|  PREDICTED: probable WRKY transcription facto...    122   3e-28   
ref|XP_008225223.1|  PREDICTED: probable WRKY transcription facto...    123   3e-28   
emb|CDX99806.1|  BnaC05g22280D                                          122   4e-28   
ref|XP_010524074.1|  PREDICTED: probable WRKY transcription facto...    122   4e-28   
gb|EAY75827.1|  hypothetical protein OsI_03741                          124   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_006830221.1|  hypothetical protein AMTR_s00130p00044000          122   4e-28   
dbj|BAB56055.1|  WRKY transcription factor-like                         123   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006304098.1|  hypothetical protein CARUB_v10010013mg             122   4e-28   
gb|EAZ13545.1|  hypothetical protein OsJ_03461                          123   5e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010460705.1|  PREDICTED: probable WRKY transcription facto...    122   5e-28   
ref|XP_002876476.1|  WRKY DNA-binding protein 69                        122   5e-28   
ref|NP_851020.1|  WRKY DNA-binding protein 69                           122   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686240.1|  PREDICTED: probable WRKY transcription facto...    123   5e-28   
gb|AHC54615.1|  WRKY10                                                  122   5e-28   
ref|XP_010315625.1|  PREDICTED: probable WRKY transcription facto...    124   6e-28   
ref|XP_006415592.1|  hypothetical protein EUTSA_v10008510mg             122   6e-28   
ref|XP_006291660.1|  hypothetical protein CARUB_v10017819mg             122   6e-28   
ref|XP_010504830.1|  PREDICTED: probable WRKY transcription facto...    122   7e-28   
ref|XP_003569817.1|  PREDICTED: probable WRKY transcription facto...    122   7e-28   
ref|XP_009416100.1|  PREDICTED: probable WRKY transcription facto...    124   7e-28   
ref|XP_010427779.1|  PREDICTED: probable WRKY transcription facto...    122   8e-28   
ref|XP_010478290.1|  PREDICTED: probable WRKY transcription facto...    121   8e-28   
ref|XP_010516529.1|  PREDICTED: probable WRKY transcription facto...    122   8e-28   
emb|CDX71933.1|  BnaC08g29410D                                          120   8e-28   
ref|XP_006359101.1|  PREDICTED: probable WRKY transcription facto...    124   9e-28   
ref|XP_010999781.1|  PREDICTED: probable WRKY transcription facto...    121   9e-28   
ref|XP_006402757.1|  hypothetical protein EUTSA_v10006157mg             122   9e-28   
ref|XP_009116551.1|  PREDICTED: probable WRKY transcription facto...    121   9e-28   
ref|NP_567073.2|  WRKY DNA-binding protein 69                           121   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416099.1|  PREDICTED: probable WRKY transcription facto...    124   9e-28   
ref|XP_002305730.1|  hypothetical protein POPTR_0004s05920g             121   9e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006415591.1|  hypothetical protein EUTSA_v10008510mg             121   1e-27   
ref|XP_010504831.1|  PREDICTED: probable WRKY transcription facto...    121   1e-27   
ref|XP_006410636.1|  hypothetical protein EUTSA_v10016714mg             124   1e-27   
gb|AGA37248.1|  WRKY transcription factor 69.1                          121   1e-27   
ref|NP_001267628.1|  probable WRKY transcription factor 69-like         122   1e-27   
ref|XP_009138938.1|  PREDICTED: probable WRKY transcription facto...    121   1e-27   
gb|AGA37249.1|  WRKY transcription factor 69.2                          121   1e-27   
gb|AET04288.2|  WRKY family transcription factor                        120   1e-27   
gb|EAY96413.1|  hypothetical protein OsI_18309                          121   1e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_008455292.1|  PREDICTED: probable WRKY transcription facto...    122   1e-27   
ref|XP_010516530.1|  PREDICTED: probable WRKY transcription facto...    121   1e-27   
gb|AEQ29018.1|  WRKY5                                                   120   1e-27   
gb|ACI14405.1|  WRKY69-1 transcription factor                           121   1e-27   Brassica napus [oilseed rape]
ref|XP_004173464.1|  PREDICTED: probable WRKY transcription facto...    120   1e-27   
gb|KFK35097.1|  hypothetical protein AALP_AA5G235000                    121   1e-27   
ref|XP_009116552.1|  PREDICTED: probable WRKY transcription facto...    121   1e-27   
gb|ADL62871.1|  WRKY transcription factor                               121   1e-27   
ref|NP_001280782.1|  probable WRKY transcription factor 65              120   1e-27   
ref|XP_003629812.1|  WRKY transcription factor                          120   2e-27   
ref|XP_009138939.1|  PREDICTED: probable WRKY transcription facto...    121   2e-27   
ref|XP_008455294.1|  PREDICTED: probable WRKY transcription facto...    121   2e-27   
gb|EEC78451.1|  hypothetical protein OsI_18313                          118   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_004135749.1|  PREDICTED: probable WRKY transcription facto...    122   2e-27   
ref|XP_009415176.1|  PREDICTED: probable WRKY transcription facto...    120   2e-27   
gb|KFK35096.1|  hypothetical protein AALP_AA5G235000                    120   2e-27   
gb|AFS64071.1|  WRKY transcription factor 6                             122   2e-27   
gb|KCW47365.1|  hypothetical protein EUGRSUZ_K01151                     120   2e-27   
ref|XP_010665626.1|  PREDICTED: probable WRKY transcription facto...    123   2e-27   
gb|AGQ04240.1|  WRKY transcription factor 49                            122   2e-27   
ref|XP_004486508.1|  PREDICTED: probable WRKY transcription facto...    124   3e-27   
ref|XP_008465657.1|  PREDICTED: probable WRKY transcription facto...    123   3e-27   
tpg|DAA57660.1|  TPA: putative WRKY DNA-binding domain superfamil...    120   3e-27   
ref|XP_007025322.1|  WRKY DNA-binding protein 65, putative              120   3e-27   
ref|NP_181029.1|  putative WRKY transcription factor 35                 123   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295586.1|  PREDICTED: probable WRKY transcription facto...    120   3e-27   
ref|XP_004158081.1|  PREDICTED: probable WRKY transcription facto...    122   3e-27   
dbj|BAJ98846.1|  predicted protein                                      120   3e-27   
ref|XP_010519038.1|  PREDICTED: probable WRKY transcription facto...    123   3e-27   
gb|KGN65962.1|  hypothetical protein Csa_1G547510                       122   3e-27   
gb|KEH37125.1|  WRKY family transcription factor                        122   3e-27   
ref|XP_007022995.1|  WRKY DNA-binding protein 14, putative              122   3e-27   
tpg|DAA05131.1|  TPA: WRKY transcription factor 66                      124   3e-27   
ref|XP_011085607.1|  PREDICTED: probable WRKY transcription facto...    122   4e-27   
ref|NP_001047827.1|  Os02g0698800                                       124   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011101421.1|  PREDICTED: probable WRKY transcription facto...    120   4e-27   
ref|XP_009622546.1|  PREDICTED: probable WRKY transcription facto...    123   4e-27   
ref|NP_001053735.1|  Os04g0597300                                       122   4e-27   Oryza sativa Japonica Group [Japonica rice]
gb|KEH37124.1|  WRKY family transcription factor                        123   4e-27   
ref|XP_010323673.1|  PREDICTED: probable WRKY transcription facto...    119   4e-27   
ref|XP_006294231.1|  hypothetical protein CARUB_v10023228mg             122   4e-27   
ref|XP_010504968.1|  PREDICTED: probable WRKY transcription facto...    122   4e-27   
ref|XP_009789029.1|  PREDICTED: probable WRKY transcription facto...    122   5e-27   
ref|XP_010509700.1|  PREDICTED: probable WRKY transcription facto...    122   5e-27   
ref|XP_009352729.1|  PREDICTED: probable WRKY transcription facto...    119   5e-27   
emb|CDP12602.1|  unnamed protein product                                122   5e-27   
ref|XP_010036633.1|  PREDICTED: probable WRKY transcription facto...    122   5e-27   
ref|XP_009351552.1|  PREDICTED: probable WRKY transcription facto...    119   5e-27   
ref|XP_008788702.1|  PREDICTED: probable WRKY transcription facto...    122   5e-27   
gb|AEO31477.1|  WRKY transcription factor 14-1                          122   5e-27   
ref|XP_010227247.1|  PREDICTED: probable WRKY transcription facto...    122   6e-27   
gb|ABO15543.1|  WRKY13 transcription factor                             119   6e-27   Triticum aestivum [Canadian hard winter wheat]
gb|KDO77574.1|  hypothetical protein CISIN_1g012605mg                   122   6e-27   
ref|XP_010036632.1|  PREDICTED: probable WRKY transcription facto...    122   6e-27   
ref|XP_010525210.1|  PREDICTED: probable WRKY transcription facto...    119   6e-27   
gb|KFK36384.1|  hypothetical protein AALP_AA4G116800                    122   6e-27   
ref|XP_007147420.1|  hypothetical protein PHAVU_006G123000g             123   6e-27   
ref|XP_008675050.1|  PREDICTED: probable WRKY transcription facto...    120   6e-27   
ref|XP_010247841.1|  PREDICTED: probable WRKY transcription facto...    122   6e-27   
ref|XP_008792328.1|  PREDICTED: probable WRKY transcription facto...    119   6e-27   
ref|XP_008792327.1|  PREDICTED: probable WRKY transcription facto...    119   6e-27   
emb|CBI31090.3|  unnamed protein product                                122   6e-27   
ref|XP_010933393.1|  PREDICTED: probable WRKY transcription facto...    122   7e-27   
ref|XP_004162853.1|  PREDICTED: probable WRKY transcription facto...    119   7e-27   
gb|EEC77906.1|  hypothetical protein OsI_17230                          122   7e-27   Oryza sativa Indica Group [Indian rice]
gb|AFK44330.1|  unknown                                                 119   7e-27   
ref|XP_010540523.1|  PREDICTED: probable WRKY transcription facto...    118   7e-27   
ref|XP_010098516.1|  putative WRKY transcription factor 35              122   8e-27   
gb|EEE61600.1|  hypothetical protein OsJ_16009                          122   8e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EMT21586.1|  Putative WRKY transcription factor 35                   122   8e-27   
emb|CDY52525.1|  BnaCnng22580D                                          121   8e-27   
gb|AIE43848.1|  WRKY transcription factor 72                            122   8e-27   
ref|XP_002881360.1|  hypothetical protein ARALYDRAFT_482446             121   8e-27   
emb|CDY09551.1|  BnaC05g23680D                                          121   8e-27   
emb|CBH32504.1|  WRKY transcription factor, putative, expressed         119   8e-27   
ref|NP_001183715.1|  uncharacterized protein LOC100502308               119   8e-27   
tpg|DAA05102.1|  TPA: WRKY transcription factor 37                      122   8e-27   
gb|EYU43209.1|  hypothetical protein MIMGU_mgv1a017713mg                121   8e-27   
ref|XP_006468371.1|  PREDICTED: probable WRKY transcription facto...    122   8e-27   
ref|NP_001183574.1|  putative WRKY DNA-binding domain superfamily...    119   8e-27   
ref|XP_002299016.1|  WRKY transcription factor 35 family protein        121   9e-27   Populus trichocarpa [western balsam poplar]
emb|CDX77581.1|  BnaA07g07190D                                          120   9e-27   
ref|XP_006448817.1|  hypothetical protein CICLE_v10014984mg             122   9e-27   
ref|XP_002269170.1|  PREDICTED: probable WRKY transcription facto...    121   9e-27   Vitis vinifera
ref|XP_011005315.1|  PREDICTED: probable WRKY transcription facto...    121   1e-26   
ref|XP_011085627.1|  PREDICTED: probable WRKY transcription facto...    115   1e-26   
ref|XP_003596707.1|  Transcription factor                               118   1e-26   
ref|XP_006662643.1|  PREDICTED: probable WRKY transcription facto...    119   1e-26   
ref|XP_009144762.1|  PREDICTED: probable WRKY transcription facto...    120   1e-26   
ref|XP_011096716.1|  PREDICTED: probable WRKY transcription facto...    122   1e-26   
ref|XP_010916734.1|  PREDICTED: probable WRKY transcription facto...    119   1e-26   
ref|XP_011040526.1|  PREDICTED: probable WRKY transcription facto...    121   1e-26   
emb|CDX98217.1|  BnaC07g08810D                                          120   1e-26   
ref|XP_002533765.1|  WRKY transcription factor, putative                122   1e-26   
gb|EMT29513.1|  Putative WRKY transcription factor 65                   118   1e-26   
ref|XP_006853288.1|  hypothetical protein AMTR_s00032p00016380          121   1e-26   
ref|XP_006652742.1|  PREDICTED: probable WRKY transcription facto...    122   1e-26   
emb|CDY69417.1|  BnaAnng30430D                                          117   1e-26   
gb|EEE57627.1|  hypothetical protein OsJ_08035                          120   1e-26   
gb|EPS65077.1|  hypothetical protein M569_09702                         114   1e-26   
ref|XP_010540640.1|  PREDICTED: probable WRKY transcription facto...    121   1e-26   
ref|XP_009143736.1|  PREDICTED: probable WRKY transcription facto...    120   1e-26   
ref|XP_010920047.1|  PREDICTED: probable WRKY transcription facto...    120   1e-26   
emb|CAE03935.3|  OSJNba0093F12.9                                        122   1e-26   
ref|XP_003572136.1|  PREDICTED: probable WRKY transcription facto...    119   2e-26   
gb|KFK44871.1|  hypothetical protein AALP_AA1G313500                    120   2e-26   
ref|XP_010235060.1|  PREDICTED: probable WRKY transcription facto...    119   2e-26   
ref|XP_010516644.1|  PREDICTED: probable WRKY transcription facto...    117   2e-26   
ref|XP_002317080.1|  WRKY transcription factor 35 family protein        121   2e-26   
ref|XP_006647734.1|  PREDICTED: glycine, alanine and asparagine-r...    122   2e-26   
ref|XP_009389339.1|  PREDICTED: probable WRKY transcription facto...    120   2e-26   
ref|XP_008439520.1|  PREDICTED: probable WRKY transcription facto...    122   2e-26   
ref|XP_004293685.1|  PREDICTED: probable WRKY transcription facto...    121   2e-26   
ref|XP_006415439.1|  hypothetical protein EUTSA_v10007691mg             120   2e-26   
ref|XP_009399434.1|  PREDICTED: probable WRKY transcription facto...    120   2e-26   
ref|XP_006586862.1|  PREDICTED: probable WRKY transcription facto...    121   2e-26   
ref|XP_010538215.1|  PREDICTED: probable WRKY transcription facto...    117   2e-26   
ref|XP_007211832.1|  hypothetical protein PRUPE_ppa004535mg             121   2e-26   
ref|XP_008367402.1|  PREDICTED: probable WRKY transcription facto...    121   2e-26   
gb|EYU19085.1|  hypothetical protein MIMGU_mgv1a006007mg                120   2e-26   
ref|XP_009399433.1|  PREDICTED: probable WRKY transcription facto...    120   2e-26   
ref|XP_009362177.1|  PREDICTED: probable WRKY transcription facto...    121   2e-26   
ref|XP_002890885.1|  WRKY DNA-binding protein 14                        120   2e-26   
ref|XP_004976670.1|  PREDICTED: probable WRKY transcription facto...    120   2e-26   
ref|XP_004134891.1|  PREDICTED: uncharacterized protein LOC101209169    121   2e-26   
gb|KHN44673.1|  Putative WRKY transcription factor 14                   121   2e-26   
gb|ACH99804.1|  WRKY35 transcription factor                             120   2e-26   
gb|KGN49489.1|  hypothetical protein Csa_6G526230                       121   2e-26   
gb|AIY62464.1|  WRKY27                                                  120   2e-26   
ref|XP_008371500.1|  PREDICTED: probable WRKY transcription facto...    117   2e-26   
ref|XP_009124607.1|  PREDICTED: probable WRKY transcription facto...    120   2e-26   
ref|XP_009385188.1|  PREDICTED: probable WRKY transcription facto...    119   2e-26   
ref|XP_009124606.1|  PREDICTED: probable WRKY transcription facto...    120   2e-26   
ref|XP_009397814.1|  PREDICTED: probable WRKY transcription facto...    120   3e-26   
ref|XP_002447031.1|  hypothetical protein SORBIDRAFT_06g027290          121   3e-26   
gb|AAD25752.1|AC007060_10  Identical to gb|D88748 AR411 gene from...    120   3e-26   
ref|XP_003534796.2|  PREDICTED: probable WRKY transcription facto...    121   3e-26   
ref|XP_006586861.1|  PREDICTED: probable WRKY transcription facto...    121   3e-26   
gb|AJA32884.1|  WRKY transcription factor                               120   3e-26   
ref|NP_564359.1|  putative WRKY transcription factor 14                 120   3e-26   
ref|NP_001167966.1|  putative WRKY DNA-binding domain superfamily...    120   3e-26   
ref|XP_006597676.1|  PREDICTED: probable WRKY transcription facto...    120   3e-26   
ref|XP_009410878.1|  PREDICTED: probable WRKY transcription facto...    117   3e-26   
gb|AIB05290.1|  WRKY transcription factor                               120   3e-26   
ref|XP_010538216.1|  PREDICTED: probable WRKY transcription facto...    116   3e-26   
ref|XP_009395741.1|  PREDICTED: probable WRKY transcription facto...    117   3e-26   
ref|XP_010499609.1|  PREDICTED: probable WRKY transcription facto...    120   3e-26   
ref|XP_008677498.1|  PREDICTED: putative WRKY DNA-binding domain ...    120   3e-26   
gb|AAM62708.1|  putative DNA-binding protein                            120   3e-26   
ref|XP_010460874.1|  PREDICTED: probable WRKY transcription facto...    120   3e-26   
ref|XP_010478495.1|  PREDICTED: probable WRKY transcription facto...    120   4e-26   
ref|XP_011011972.1|  PREDICTED: WRKY transcription factor 6-like ...    119   4e-26   
ref|XP_006307568.1|  hypothetical protein CARUB_v10009191mg             119   4e-26   
gb|EMT18262.1|  Putative WRKY transcription factor 35                   120   4e-26   
dbj|BAA13689.1|  AR411                                                  116   5e-26   
ref|XP_008777869.1|  PREDICTED: probable WRKY transcription facto...    117   5e-26   
ref|XP_006597675.1|  PREDICTED: probable WRKY transcription facto...    120   5e-26   
emb|CDY43651.1|  BnaA04g20400D                                          119   5e-26   
ref|XP_009382611.1|  PREDICTED: probable WRKY transcription facto...    118   5e-26   
ref|XP_008663553.1|  PREDICTED: probable WRKY transcription facto...    120   5e-26   
ref|XP_008668957.1|  PREDICTED: probable WRKY transcription facto...    120   5e-26   
ref|XP_006843337.1|  hypothetical protein AMTR_s00053p00025460          117   5e-26   
ref|XP_002466074.1|  hypothetical protein SORBIDRAFT_01g000696          118   5e-26   
dbj|BAK03476.1|  predicted protein                                      120   6e-26   
dbj|BAK00197.1|  predicted protein                                      120   6e-26   
ref|XP_009141404.1|  PREDICTED: probable WRKY transcription facto...    119   6e-26   
ref|XP_002454437.1|  hypothetical protein SORBIDRAFT_04g030930          120   6e-26   
ref|XP_004983519.1|  PREDICTED: probable WRKY transcription facto...    119   7e-26   
ref|XP_004953547.1|  PREDICTED: probable WRKY transcription facto...    119   7e-26   
ref|XP_006584998.1|  PREDICTED: probable WRKY transcription facto...    119   7e-26   
gb|KHN39167.1|  Putative WRKY transcription factor 14                   119   7e-26   
ref|XP_006650925.1|  PREDICTED: probable WRKY transcription facto...    118   7e-26   
ref|XP_010924759.1|  PREDICTED: WRKY transcription factor 22-like       117   1e-25   
ref|XP_009353871.1|  PREDICTED: probable WRKY transcription facto...    119   1e-25   
ref|XP_009396549.1|  PREDICTED: probable WRKY transcription facto...    116   1e-25   
ref|XP_008383367.1|  PREDICTED: probable WRKY transcription facto...    119   1e-25   
ref|XP_002467424.1|  hypothetical protein SORBIDRAFT_01g027770          118   1e-25   
ref|NP_001044251.1|  Os01g0750100                                       112   1e-25   
ref|XP_008225685.1|  PREDICTED: probable WRKY transcription facto...    119   2e-25   
ref|XP_008790020.1|  PREDICTED: probable WRKY transcription facto...    114   2e-25   
ref|XP_004980994.1|  PREDICTED: probable WRKY transcription facto...    117   2e-25   
ref|XP_006364097.1|  PREDICTED: probable WRKY transcription facto...    113   3e-25   
gb|AAG46150.1|AC018727_2  putative DNA-binding protein                  115   3e-25   
ref|XP_008443496.1|  PREDICTED: probable WRKY transcription facto...    114   3e-25   
ref|XP_007159024.1|  hypothetical protein PHAVU_002G202000g             117   3e-25   
ref|NP_001065507.1|  Os10g0579400                                       113   3e-25   
ref|XP_008658838.1|  PREDICTED: probable WRKY transcription facto...    117   4e-25   
ref|XP_011011971.1|  PREDICTED: uncharacterized protein LOC105116...    117   4e-25   
ref|XP_011011970.1|  PREDICTED: uncharacterized protein LOC105116...    117   4e-25   
ref|XP_008790018.1|  PREDICTED: probable WRKY transcription facto...    114   5e-25   
gb|ABI13404.1|  WRKY transcription factor 39                            114   5e-25   
ref|XP_008646113.1|  PREDICTED: probable WRKY transcription facto...    117   6e-25   
gb|KHN22935.1|  Putative WRKY transcription factor 35                   116   8e-25   
ref|XP_010925600.1|  PREDICTED: probable WRKY transcription facto...    114   8e-25   
ref|XP_006444507.1|  hypothetical protein CICLE_v10021624mg             112   8e-25   
ref|XP_006580027.1|  PREDICTED: probable WRKY transcription facto...    115   8e-25   
gb|KDO86982.1|  hypothetical protein CISIN_1g023982mg                   112   8e-25   
gb|AEO31492.1|  WRKY transcription factor 23-2                          108   1e-24   
gb|EMS55134.1|  putative WRKY transcription factor 35                   116   1e-24   
gb|AAN71731.1|  WRKY transcription factor IIe-1                         110   1e-24   
gb|EAY75714.1|  hypothetical protein OsI_03623                          113   1e-24   
ref|XP_008443489.1|  PREDICTED: probable WRKY transcription facto...    112   2e-24   
ref|NP_001044144.1|  Os01g0730700                                       113   2e-24   
ref|XP_010538217.1|  PREDICTED: probable WRKY transcription facto...    110   2e-24   
gb|AGV75969.1|  WRKY transcription factor 88                            113   2e-24   
ref|NP_001267700.1|  probable WRKY transcription factor 65-like         112   2e-24   
emb|CAN79055.1|  hypothetical protein VITISV_038175                     110   3e-24   
ref|XP_009768958.1|  PREDICTED: WRKY transcription factor 22-like       113   3e-24   
ref|XP_010279056.1|  PREDICTED: WRKY transcription factor 22            113   3e-24   
ref|XP_010261384.1|  PREDICTED: WRKY transcription factor 22-like       113   3e-24   
gb|ACQ76802.1|  WRKY transcription factor 22                            112   3e-24   
emb|CDY01962.1|  BnaC02g27650D                                          112   3e-24   
gb|EMS54218.1|  putative WRKY transcription factor 14                   113   3e-24   
gb|KHG04290.1|  WRKY transcription factor 22 -like protein              112   3e-24   
gb|KEH36644.1|  WRKY family transcription factor                        110   4e-24   
ref|XP_003559113.2|  PREDICTED: probable WRKY transcription facto...    114   4e-24   
ref|XP_003572849.1|  PREDICTED: probable WRKY transcription facto...    114   4e-24   
gb|KEH36643.1|  WRKY family transcription factor                        110   5e-24   
ref|XP_004248483.1|  PREDICTED: probable WRKY transcription facto...    110   5e-24   
ref|NP_001051941.1|  Os03g0855100                                       113   5e-24   
gb|ACN35650.1|  unknown                                                 112   5e-24   
ref|NP_001149833.1|  WRKY transcription factor 14                       112   5e-24   
ref|XP_008677423.1|  PREDICTED: WRKY transcription factor 14 isof...    112   5e-24   
ref|XP_010925829.1|  PREDICTED: probable WRKY transcription facto...    112   6e-24   
ref|XP_004485928.1|  PREDICTED: probable WRKY transcription facto...    109   6e-24   
ref|XP_010924728.1|  PREDICTED: probable WRKY transcription facto...    110   7e-24   
gb|AIA66973.1|  WRKY66                                                  110   7e-24   
ref|XP_009419794.1|  PREDICTED: WRKY transcription factor 22-like       111   8e-24   
ref|XP_010915790.1|  PREDICTED: WRKY transcription factor 22-like       112   9e-24   
ref|XP_007051705.1|  WRKY transcription factor 23, putative             111   1e-23   
ref|XP_009381766.1|  PREDICTED: probable WRKY transcription facto...    110   1e-23   
ref|XP_009409443.1|  PREDICTED: WRKY transcription factor 22-like       111   1e-23   
ref|XP_008347128.1|  PREDICTED: WRKY transcription factor 22-like       109   2e-23   
ref|XP_010924726.1|  PREDICTED: probable WRKY transcription facto...    110   2e-23   
gb|AIE16093.1|  WRKY transcription factor 22-like protein               108   2e-23   
ref|XP_009626813.1|  PREDICTED: WRKY transcription factor 22-like       111   2e-23   
ref|XP_004248063.1|  PREDICTED: WRKY transcription factor 22-like       110   2e-23   
ref|XP_008792407.1|  PREDICTED: WRKY transcription factor 22-like       110   2e-23   
ref|XP_006339631.1|  PREDICTED: WRKY transcription factor 22-like       110   2e-23   
ref|XP_004229932.1|  PREDICTED: WRKY transcription factor 22            110   2e-23   
gb|KHG10389.1|  WRKY transcription factor 22 -like protein              109   3e-23   
ref|XP_009406781.1|  PREDICTED: WRKY transcription factor 22-like       110   3e-23   
gb|KDO86314.1|  hypothetical protein CISIN_1g019126mg                   110   3e-23   
ref|XP_006444950.1|  hypothetical protein CICLE_v10020943mg             110   3e-23   
ref|XP_010104966.1|  putative WRKY transcription factor 65              109   3e-23   
ref|XP_008797253.1|  PREDICTED: WRKY transcription factor 22-like       110   3e-23   
gb|AIY62475.1|  WRKY67                                                  109   4e-23   
ref|XP_008363282.1|  PREDICTED: probable WRKY transcription facto...    108   5e-23   
ref|XP_009366563.1|  PREDICTED: WRKY transcription factor 22-like       109   5e-23   
ref|NP_001267532.1|  WRKY transcription factor 22-like                  108   5e-23   
ref|XP_008802713.1|  PREDICTED: probable WRKY transcription facto...    108   5e-23   
ref|XP_010916830.1|  PREDICTED: WRKY transcription factor 22-like       109   6e-23   
ref|XP_008347124.1|  PREDICTED: WRKY transcription factor 22-like       109   6e-23   
ref|XP_009350327.1|  PREDICTED: WRKY transcription factor 22-like       109   6e-23   
ref|XP_008776340.1|  PREDICTED: WRKY transcription factor 22-like       109   6e-23   
ref|XP_009341117.1|  PREDICTED: WRKY transcription factor 22-like       109   6e-23   
ref|XP_010669828.1|  PREDICTED: WRKY transcription factor 22            109   6e-23   
gb|ABC61127.1|  WRKY28                                                  106   7e-23   
ref|XP_008452006.1|  PREDICTED: probable WRKY transcription facto...    108   7e-23   
ref|XP_004492798.1|  PREDICTED: WRKY transcription factor 22-like       108   7e-23   
ref|XP_009413286.1|  PREDICTED: probable WRKY transcription facto...    109   8e-23   
ref|XP_006396285.1|  hypothetical protein EUTSA_v10028843mg             108   8e-23   
ref|NP_001237508.1|  transcription factor                               107   8e-23   
gb|KFK30708.1|  hypothetical protein AALP_AA6G017400                    108   8e-23   
ref|XP_002301374.2|  hypothetical protein POPTR_0002s16590g             109   9e-23   
ref|XP_003624081.1|  WRKY transcription factor                          108   9e-23   
ref|XP_010522946.1|  PREDICTED: WRKY transcription factor 22-like       108   9e-23   
gb|ACD69418.1|  WRKY28                                                  106   9e-23   
ref|XP_002276925.1|  PREDICTED: WRKY transcription factor 22            108   1e-22   
emb|CAB88288.1|  DNA-binding WRKY-like protein                          107   1e-22   
ref|XP_002320158.1|  transcription factor family protein                108   1e-22   
ref|XP_011037096.1|  PREDICTED: WRKY transcription factor 22            108   1e-22   
gb|ACI14389.1|  WRKY22-1 transcription factor                           107   1e-22   
ref|XP_011092990.1|  PREDICTED: WRKY transcription factor 22            108   1e-22   
ref|XP_010092573.1|  WRKY transcription factor 22                       108   1e-22   
ref|XP_011023273.1|  PREDICTED: WRKY transcription factor 22-like       108   1e-22   
ref|XP_009590526.1|  PREDICTED: WRKY transcription factor 22-like       107   1e-22   
gb|KHN40435.1|  WRKY transcription factor 22                            108   1e-22   
ref|XP_011015965.1|  PREDICTED: WRKY transcription factor 22-like       108   1e-22   
ref|XP_006386616.1|  hypothetical protein POPTR_0002s16590g             109   2e-22   
ref|XP_006375351.1|  hypothetical protein POPTR_0014s08600g             108   2e-22   
ref|XP_008363283.1|  PREDICTED: probable WRKY transcription facto...    106   2e-22   
emb|CDM84085.1|  unnamed protein product                                107   2e-22   
ref|XP_009758175.1|  PREDICTED: WRKY transcription factor 22-like       107   2e-22   
gb|ACU17673.1|  unknown                                                 108   2e-22   
gb|KGN56482.1|  hypothetical protein Csa_3G121580                       107   2e-22   
ref|XP_006601715.1|  PREDICTED: transcription factor isoform X1         108   2e-22   
gb|KHN18817.1|  WRKY transcription factor 22                            107   2e-22   
ref|NP_001267594.1|  WRKY transcription factor 22-like                  107   2e-22   
ref|XP_008437986.1|  PREDICTED: WRKY transcription factor 22            107   2e-22   
ref|XP_008795077.1|  PREDICTED: WRKY transcription factor 22-like       108   2e-22   
ref|XP_008234823.1|  PREDICTED: probable WRKY transcription facto...    105   2e-22   
emb|CDY48511.1|  BnaA09g00120D                                          107   2e-22   
ref|NP_192034.1|  WRKY transcription factor 22                          107   2e-22   
emb|CDY07185.1|  BnaCnng02000D                                          107   2e-22   
ref|XP_003534539.1|  PREDICTED: WRKY transcription factor 22-like       108   2e-22   
ref|XP_010456229.1|  PREDICTED: WRKY transcription factor 22-like       107   2e-22   
ref|XP_003548638.1|  PREDICTED: WRKY transcription factor 22            107   2e-22   
ref|XP_002511920.1|  WRKY transcription factor, putative                107   2e-22   
ref|XP_010422786.1|  PREDICTED: WRKY transcription factor 22-like       107   2e-22   
ref|XP_007139781.1|  hypothetical protein PHAVU_008G058300g             107   2e-22   
ref|XP_010427624.1|  PREDICTED: WRKY transcription factor 22            107   2e-22   
ref|NP_001288962.1|  WRKY transcription factor 22                       107   2e-22   
ref|XP_009421224.1|  PREDICTED: WRKY transcription factor 22-like       108   2e-22   
gb|AAO23324.1|  WRKY transcription factor 22                            107   2e-22   
ref|XP_010232262.1|  PREDICTED: probable WRKY transcription facto...    107   2e-22   
ref|XP_002872898.1|  WRKY transcription factor 22                       107   2e-22   
gb|ACV92025.1|  WRKY transcription factor 23                            107   2e-22   
gb|EMT00743.1|  Putative WRKY transcription factor 65                   107   3e-22   
ref|NP_001132768.1|  putative WRKY DNA-binding domain superfamily...    106   3e-22   
ref|XP_009413820.1|  PREDICTED: WRKY transcription factor 22-like       107   3e-22   



>gb|AEQ29017.1| WRKY4 [Panax quinquefolius]
Length=271

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 153/243 (63%), Gaps = 26/243 (11%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPP-SDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R +AQK VV VK+ E +  K+KSEGPP SD WSWRKYGQKPIKGSP+PRGYYRCS+SKGC
Sbjct  27   RKLAQKTVVAVKIEENENGKQKSEGPPPSDCWSWRKYGQKPIKGSPYPRGYYRCSTSKGC  86

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP----EVReepaaaeeeDNPTSTPVPeggeeeae  623
            SAKKQVER RTDAS+LIITYTSTHNHP    + +EEP     ++N  + P  E  +EE  
Sbjct  87   SAKKQVERCRTDASLLIITYTSTHNHPGPKDQKQEEPKIQITQENNLTVPEKEDQQEEDP  146

Query  624  emeHRSGVKDNG------YEED--------SFHYSQSPFNTTSSEDMIIN--RADDNYLF  755
            + E     +         ++ED        +FHY QSPFN++  +D+IIN    +D    
Sbjct  147  KEEEEEEEEKEKEQQSLFFDEDGANEKITSNFHYCQSPFNSSDHQDIIINIKHEEDIPFT  206

Query  756  tetlgtttttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPP----TSSFISHTFFKDT  923
                        +PL YPHLM FST KS EENDFYDEL ELP     TSSF+   FF+D 
Sbjct  207  EHLENVLFDEKENPLCYPHLMTFSTQKS-EENDFYDELGELPISSSFTSSFMRSNFFEDR  265

Query  924  ISV  932
            I +
Sbjct  266  ILI  268



>ref|XP_007201365.1| hypothetical protein PRUPE_ppa010217mg [Prunus persica]
 gb|EMJ02564.1| hypothetical protein PRUPE_ppa010217mg [Prunus persica]
Length=258

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 155/232 (67%), Gaps = 17/232 (7%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            + + +K VVTVK+G   G K K+EGPPSDSWSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  28   KVVHEKTVVTVKIGTNVG-KLKNEGPPSDSWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  86

Query  459  AKKQVERSRTDASVLIITYTSTHNHP-----EVReepaaaeeeDNPTSTPVPeggeeeae  623
            AKKQVERS+TDASVLIITYTS+HNHP                ED+     +P+  E+E E
Sbjct  87   AKKQVERSKTDASVLIITYTSSHNHPGPDVSTTNLTQLQPSTEDHNLPALLPKQEEQEKE  146

Query  624  emeHRSGVKDNGY----EEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNY  791
            + E +  ++D+       ED FHY QSP    SS++++I++ +D +L    + +T     
Sbjct  147  QEEKQGKLEDHPAMKTDHEDHFHYIQSPIR--SSQNIMIDQEEDPFLEKTHVSSTLGFLL  204

Query  792  D--PLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHTFFKDTISVNSI  941
            D  PLSY  LM FSTPKS EENDF+DELEELP  SSF S  F +  +S+  I
Sbjct  205  DEEPLSYSQLMSFSTPKS-EENDFFDELEELPTFSSFPS--FMRSNLSLERI  253



>ref|XP_002270750.3| PREDICTED: probable WRKY transcription factor 65 [Vitis vinifera]
 emb|CBI36956.3| unnamed protein product [Vitis vinifera]
Length=242

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 146/231 (63%), Gaps = 25/231 (11%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + QK VVTV++ E +  K+K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  21   RRVVQKTVVTVRI-EANVGKQKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  79

Query  459  AKKQVERSRTDASVLIITYTSTHNH--PEVReepaaaeeeDNPTSTPV---Peggeeeae  623
            AKKQVER RTDAS+LIITYTS+HNH  P++   P +  +  +P + P+   P   +E+ +
Sbjct  80   AKKQVERCRTDASMLIITYTSSHNHPGPDLSTTPNSLNQPKDPQTQPIEETPTTPKEDHQ  139

Query  624  emeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNY---LFtetlgtttttNYD  794
              +  +   D    ED FHY QS           I+  +D +   L           +  
Sbjct  140  PQQPITMASDEDASEDHFHYFQS----------TISHEEDPFKVNLEKTHDSLGVVFDEQ  189

Query  795  PLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT-----FFKDTISV  932
            PL+YPHLM FSTPKS EENDF+DELEELP +SSF S       FF D I V
Sbjct  190  PLAYPHLMTFSTPKS-EENDFFDELEELPTSSSFTSFMRSGFNFFDDRILV  239



>ref|XP_011079549.1| PREDICTED: probable WRKY transcription factor 35 [Sesamum indicum]
Length=254

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 152/233 (65%), Gaps = 19/233 (8%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M ++VVV VK+ E D +++++EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  25   RKMGERVVVAVKIAENDKKQQRNEGPPSDCWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  84

Query  459  AKKQVERSRTDASVLIITYTSTHNHP---------EVReepaaaeeeDNPTSTPVPegge  611
            AKKQVER +TDAS+LIITYTSTHNHP         + +EE       ++  + P     E
Sbjct  85   AKKQVERCKTDASMLIITYTSTHNHPGPDFSLPTNQKQEEKETDSAPESTDTQPTTPKQE  144

Query  612  eeaeemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNY  791
            +EAE M   + V ++   E  F YSQSPFN+T+++ +I+N+  +N             + 
Sbjct  145  QEAELMPQETPVSNS---EHQFQYSQSPFNSTTTDHIIVNQ--ENPFQENLETHGGVYSE  199

Query  792  DPLSYPH--LMDFSTPKSQEENDFYDELEELPPTS---SFISHTFFKDTISVN  935
            DP S      ++ S+    EENDFYDELEELP +S   +F+  +F ++TI+VN
Sbjct  200  DPKSVVSHDAVELSSLLKPEENDFYDELEELPSSSFFTAFMRSSFCEETITVN  252



>ref|XP_009628910.1| PREDICTED: probable WRKY transcription factor 35 isoform X2 [Nicotiana 
tomentosiformis]
Length=245

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 146/221 (66%), Gaps = 6/221 (3%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M QKVV+TV++ E +  K+K+EG PSD WSWRKYGQKPIKGSP+PRGYY+CSSSKGCS
Sbjct  27   RKMTQKVVITVQM-EANAIKQKNEGAPSDCWSWRKYGQKPIKGSPYPRGYYKCSSSKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVERS TD+S+ IITYTSTHNHP         ++ D  T        +++    +  
Sbjct  86   AKKQVERSSTDSSLFIITYTSTHNHP---GPNFPNKDTDPVTQDTAMTLQQDQEPITDRH  142

Query  639  SGVKDNGYEEDSFHYSQSPFNTTSSEDMIIN-RADDNYLFtetlgtttttNYDPLSYPHL  815
              ++DN  +  SFHYS+SPFN+T+S    I+ + ++N    + LGT +  ++ PLSYP L
Sbjct  143  MSLEDNDDDSQSFHYSKSPFNSTTSISQGIHVQQEENQFTDKFLGTISYDDFLPLSYPQL  202

Query  816  MDFSTPKSQEENDFYDELEELPPTSSFISHT-FFKDTISVN  935
            M F   +  EENDFYDEL EL    SF S    F++TI V+
Sbjct  203  MKFPKSELSEENDFYDELGELQLPPSFTSFAGIFEETILVD  243



>ref|XP_009628909.1| PREDICTED: probable WRKY transcription factor 35 isoform X1 [Nicotiana 
tomentosiformis]
Length=251

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/227 (49%), Positives = 146/227 (64%), Gaps = 12/227 (5%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHP------RGYYRCS  440
            R M QKVV+TV++ E +  K+K+EG PSD WSWRKYGQKPIKGSP+P      RGYY+CS
Sbjct  27   RKMTQKVVITVQM-EANAIKQKNEGAPSDCWSWRKYGQKPIKGSPYPSDHFGYRGYYKCS  85

Query  441  SSKGCSAKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeea  620
            SSKGCSAKKQVERS TD+S+ IITYTSTHNHP         ++ D  T        +++ 
Sbjct  86   SSKGCSAKKQVERSSTDSSLFIITYTSTHNHP---GPNFPNKDTDPVTQDTAMTLQQDQE  142

Query  621  eemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIIN-RADDNYLFtetlgtttttNYDP  797
               +    ++DN  +  SFHYS+SPFN+T+S    I+ + ++N    + LGT +  ++ P
Sbjct  143  PITDRHMSLEDNDDDSQSFHYSKSPFNSTTSISQGIHVQQEENQFTDKFLGTISYDDFLP  202

Query  798  LSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT-FFKDTISVN  935
            LSYP LM F   +  EENDFYDEL EL    SF S    F++TI V+
Sbjct  203  LSYPQLMKFPKSELSEENDFYDELGELQLPPSFTSFAGIFEETILVD  249



>ref|XP_009628911.1| PREDICTED: probable WRKY transcription factor 35 isoform X3 [Nicotiana 
tomentosiformis]
Length=223

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 145/225 (64%), Gaps = 12/225 (5%)
 Frame = +3

Query  285  MAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHP------RGYYRCSSS  446
            M QKVV+TV++ E +  K+K+EG PSD WSWRKYGQKPIKGSP+P      RGYY+CSSS
Sbjct  1    MTQKVVITVQM-EANAIKQKNEGAPSDCWSWRKYGQKPIKGSPYPSDHFGYRGYYKCSSS  59

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaee  626
            KGCSAKKQVERS TD+S+ IITYTSTHNHP         ++ D  T        +++   
Sbjct  60   KGCSAKKQVERSSTDSSLFIITYTSTHNHP---GPNFPNKDTDPVTQDTAMTLQQDQEPI  116

Query  627  meHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIIN-RADDNYLFtetlgtttttNYDPLS  803
             +    ++DN  +  SFHYS+SPFN+T+S    I+ + ++N    + LGT +  ++ PLS
Sbjct  117  TDRHMSLEDNDDDSQSFHYSKSPFNSTTSISQGIHVQQEENQFTDKFLGTISYDDFLPLS  176

Query  804  YPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT-FFKDTISVN  935
            YP LM F   +  EENDFYDEL EL    SF S    F++TI V+
Sbjct  177  YPQLMKFPKSELSEENDFYDELGELQLPPSFTSFAGIFEETILVD  221



>ref|XP_006444508.1| hypothetical protein CICLE_v10021624mg [Citrus clementina]
 gb|ESR57748.1| hypothetical protein CICLE_v10021624mg [Citrus clementina]
Length=274

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 145/246 (59%), Gaps = 32/246 (13%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + +K VV VK+GE  G K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  30   RKVTEKTVVKVKIGENPG-KLKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  88

Query  459  AKKQVERSRTDASVLIITYTSTHNHP-----EVReepaaaeeeDN------------PTS  587
            AKKQVER RTDAS+LIITYTS+HNHP      +     + E   N            PTS
Sbjct  89   AKKQVERCRTDASMLIITYTSSHNHPCPDLHTINLTKQSKETPQNHQPTGTEFQDHHPTS  148

Query  588  TPVPeggeeeaeemeHRSGVKDNGYEEDS----FHYSQSPFNTTSSEDMIINRAD--DNY  749
             P  E    + EE ++   +      EDS    FHY QSP      +D+II++ D     
Sbjct  149  APTQEQQLPQEEEKQNEPPIITTPTAEDSNEDHFHYLQSPIR--CPQDIIISQEDPFTGN  206

Query  750  LFtetlgtttttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFI-----SHTFF  914
            L           + +P+SY +LM FSTPKS EENDF+DEL ELP TSS       S+  F
Sbjct  207  LEKPNETLNLLLDEEPVSYQNLMAFSTPKS-EENDFFDELGELPSTSSVFTSFMRSNDLF  265

Query  915  KDTISV  932
             + I V
Sbjct  266  DERIPV  271



>ref|XP_006492342.1| PREDICTED: probable WRKY transcription factor 69-like [Citrus 
sinensis]
 gb|KDO86981.1| hypothetical protein CISIN_1g023982mg [Citrus sinensis]
Length=274

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 145/246 (59%), Gaps = 32/246 (13%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + +K VV VK+GE  G K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  30   RKVTEKTVVKVKIGENPG-KLKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  88

Query  459  AKKQVERSRTDASVLIITYTSTHNHP-----EVReepaaaeeeDN------------PTS  587
            AKKQVER RTDAS+LIITYTS+HNHP      +     + E   N            PTS
Sbjct  89   AKKQVERCRTDASMLIITYTSSHNHPCPDLHTINLTKQSKETPQNHQPTGTEFEDHHPTS  148

Query  588  TPVPeggeeeaeemeHRSGVKDNGYEEDS----FHYSQSPFNTTSSEDMIINRAD--DNY  749
             P  E    + EE ++   +      EDS    FHY QSP      +D+II++ D     
Sbjct  149  APTQEQQLPQEEEKQNEPPIITTPTAEDSNEDHFHYLQSPIR--CPQDIIISQEDPFTGN  206

Query  750  LFtetlgtttttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFI-----SHTFF  914
            L           + +P+SY +LM FSTPKS EENDF+DEL ELP TSS       S+  F
Sbjct  207  LEKPNETLNLLLDEEPVSYQNLMAFSTPKS-EENDFFDELGELPSTSSVFTSFMRSNDLF  265

Query  915  KDTISV  932
             + I V
Sbjct  266  DERIPV  271



>gb|ACV92005.1| WRKY transcription factor 3 [(Populus tomentosa x Populus bolleana) 
x Populus tomentosa]
Length=245

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 140/225 (62%), Gaps = 19/225 (8%)
 Frame = +3

Query  255  EKVNFIEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYR  434
            +++   + R + +K VV V++G+  G K K+EGPPSD WSWRKYGQKPIKGSPHPRGYYR
Sbjct  18   QEIQASKRRKVVEKTVVRVRIGKNAG-KLKNEGPPSDFWSWRKYGQKPIKGSPHPRGYYR  76

Query  435  CSSSKGCSAKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeee------------DN  578
            CS+SKGCSAKKQVER RTDASVLIITYTS HNHP      ++  ++            D+
Sbjct  77   CSTSKGCSAKKQVERCRTDASVLIITYTSNHNHPGPDLHESSLNQQSKDPETPPTDHVDH  136

Query  579  PTSTPVPeggeeeaeemeH--RSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYL  752
            PT+    +  EE  EE  H       +N  E +SFHY QSP     S+D++I++ D    
Sbjct  137  PTTPRQEKPEEETEEEHGHPIVPSAGENASEGNSFHYLQSPIRI--SQDIMISQEDTFAE  194

Query  753  FtetlgtttttNYD--PLSYPHLMDFSTPKSQEENDFYDELEELP  881
              E    T     D  P+S   LM FS PKS+E NDF+DELEELP
Sbjct  195  NAEKSHDTLGIVLDEEPVSCSRLMTFSAPKSEENNDFFDELEELP  239



>gb|EYU46812.1| hypothetical protein MIMGU_mgv1a012761mg [Erythranthe guttata]
Length=241

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 146/237 (62%), Gaps = 25/237 (11%)
 Frame = +3

Query  255  EKVNFIEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYR  434
            E+++  + R +A++ VV VK+   D R+ ++EGPPSD WSWRKYGQKPIKGSP+PRGYY+
Sbjct  18   EEMHASKKRKVAERTVVAVKIQGNDKRQHRNEGPPSDCWSWRKYGQKPIKGSPYPRGYYK  77

Query  435  CSSSKGCSAKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeD-----NPTSTPVP  599
            CS+SKGCSAKKQVER +TDAS+LIITYTSTHNHP      A   ++D        +   P
Sbjct  78   CSTSKGCSAKKQVERCKTDASMLIITYTSTHNHPGPDSTLATNHKQDPDEINEEITDDQP  137

Query  600  eggeeeaeemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgttt  779
               ++E E        + NG  ED F YSQSPFN+        N+ D N+       ++ 
Sbjct  138  TTPKQEQEAELTIPDQETNG--EDRFQYSQSPFNS--------NQEDSNFQ-ENLETSSV  186

Query  780  ttNYDPLSYPHL--MDFSTPKSQEENDFYDELEELPPTS---SFISHTFFKDTISVN  935
              + DP  + H   M+FS+    EENDF+DELEELP +S   SF+  +F KD   VN
Sbjct  187  LYDQDPKPFTHGGPMEFSS----EENDFFDELEELPSSSFFKSFMRSSFCKDRSIVN  239



>ref|XP_002301514.2| hypothetical protein POPTR_0002s19630g [Populus trichocarpa]
 gb|EEE80787.2| hypothetical protein POPTR_0002s19630g [Populus trichocarpa]
Length=245

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 141/226 (62%), Gaps = 21/226 (9%)
 Frame = +3

Query  255  EKVNFIEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYR  434
            +++   + R + +K VV V++G+  G K K+EGPPSD WSWRKYGQKPIKGSPHPRGYYR
Sbjct  18   QEIQTSKRRKVVEKTVVRVRIGKNAG-KLKNEGPPSDFWSWRKYGQKPIKGSPHPRGYYR  76

Query  435  CSSSKGCSAKKQVERSRTDASVLIITYTSTHNHP--EVReepaaaeeeDNPTSTPV----  596
            CS+SKGCSAKKQVER RTDASVLIITYTS HNHP  ++ E     + +D P + P     
Sbjct  77   CSTSKGCSAKKQVERCRTDASVLIITYTSNHNHPGPDLHESSLNQQSKD-PETPPTDHVD  135

Query  597  -PeggeeeaeemeHRSG--------VKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNY  749
             P   ++E  E E   G          +N  E +SFHY QSP     S+D++I++ D   
Sbjct  136  HPTTPKQEKPEEETEEGHGHPIVPSADENASEGNSFHYLQSPIRI--SQDIMISQEDPFA  193

Query  750  LFtetlgtttttNYD--PLSYPHLMDFSTPKSQEENDFYDELEELP  881
               E    T     D  P+S   LM FS PKS+E NDF+DELEELP
Sbjct  194  ENPEKSHDTLGIVLDEEPISCSRLMTFSAPKSEENNDFFDELEELP  239



>ref|XP_002515275.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47259.1| conserved hypothetical protein [Ricinus communis]
Length=265

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 142/232 (61%), Gaps = 36/232 (16%)
 Frame = +3

Query  321  EGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDASV  500
            E + RK K++GPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQVER RTDASV
Sbjct  39   EANARKLKNDGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQVERCRTDASV  98

Query  501  LIITYTSTHNHP-------------EVReepaaaeeeDNPTSTP-------VPeggeeea  620
            LIITYTS HNHP                +   + +++D+P +TP       + +  ++  
Sbjct  99   LIITYTSNHNHPGPDLHSTGLNKQLNASQTQPSTDDQDHPITTPKQEEEDEIEKHDQQPV  158

Query  621  eemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgttttt-----  785
            E + H+    D+      FHY QSP N   S+D++I + D  ++   +   T  T     
Sbjct  159  ESISHKDESADHN-----FHYLQSPVNC--SQDIMITQEDHPFIVENSSEETHNTLGIVL  211

Query  786  NYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISH---TFFKDTISV  932
            + +P+S P LM FSTP S EENDF+DELEELP  SSF S     FF + I V
Sbjct  212  DEEPISRPRLMTFSTPAS-EENDFFDELEELPTYSSFTSFMRSNFFDERIPV  262



>gb|AGV75971.1| WRKY transcription factor 93 [Gossypium hirsutum]
Length=267

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 143/228 (63%), Gaps = 24/228 (11%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + +K+VVTVK+GE +G K KSEGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  27   RKVVEKIVVTVKVGE-NGGKLKSEGPPSDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHP-----------EVReepaaaeeeDNPTSTPVPeg  605
            AKKQVER +TDAS+LIITYTS+HNHP             +E      ++D P +T + + 
Sbjct  86   AKKQVERCKTDASMLIITYTSSHNHPGPDLHCADLKQSPKEPQTTHSDDDKPPTTTLKQL  145

Query  606  -------geeeaeemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRAD--DNYLFt  758
                    EE  +E    S   ++  EE  FHY QSP   +  ++ II++ D  +  L  
Sbjct  146  PEVSEKEPEEVKKEQNKTSSTDEDASEEQHFHYLQSPL--SFPQNNIISQEDPFNGNLEK  203

Query  759  etlgtttttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFIS  902
                     + +PLS  H+   S PKS EENDF+DELEELP +S+F S
Sbjct  204  THDTLEFLLDEEPLSCLHITTSSIPKS-EENDFFDELEELPISSAFTS  250



>gb|KHG13090.1| putative WRKY transcription factor 35 -like protein [Gossypium 
arboreum]
Length=267

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 143/228 (63%), Gaps = 24/228 (11%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + +K+VVTVK+GE +G K KSEGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  27   RKVVEKIVVTVKVGE-NGGKLKSEGPPSDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHP-----------EVReepaaaeeeDNPTSTPVPeg  605
            AKKQVER +TDAS+LIITYTS+HNHP             +E      ++D P +T + + 
Sbjct  86   AKKQVERCKTDASMLIITYTSSHNHPGPDLHCADLKQSPKEPQTTHSDDDKPPTTTLKQL  145

Query  606  -------geeeaeemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRAD--DNYLFt  758
                    EE  +E    S   ++  EE  FHY QSP   +  ++ II++ D  +  L  
Sbjct  146  PEVSEKEPEEVKKEQNKTSSTDEDASEEQHFHYLQSPL--SFPQNNIISQEDPFNGNLEK  203

Query  759  etlgtttttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFIS  902
                     + +PLS  H+   S PKS EENDF+DELEELP +S+F S
Sbjct  204  THDTLGFLLDEEPLSCLHITTSSIPKS-EENDFFDELEELPISSAFTS  250



>gb|AIE43843.1| WRKY transcription factor 53 [Gossypium hirsutum]
Length=267

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 111/228 (49%), Positives = 143/228 (63%), Gaps = 24/228 (11%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + +K+VVT+K+GE +G K KSEGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  27   RKVVEKIVVTLKVGE-NGGKLKSEGPPSDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHP-----------EVReepaaaeeeDNPTSTPVPeg  605
            AKKQVER +TDAS+LIITYTS+HNHP             +E      ++D P +T + + 
Sbjct  86   AKKQVERCKTDASMLIITYTSSHNHPGPDLHCADLKQSPKEPQTTHSDDDKPPTTTLKQL  145

Query  606  -------geeeaeemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRAD--DNYLFt  758
                    EE  +E    S   ++  EE  FHY QSP   +  ++ II++ D  +  L  
Sbjct  146  PEVSEKEPEEVKKEQNKTSSTDEDASEEQHFHYLQSPL--SFPQNNIISQEDPFNGNLEK  203

Query  759  etlgtttttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFIS  902
                     + +PLS  H+   S PKS EENDF+DELEELP +S+F S
Sbjct  204  THDTLGFLLDEEPLSCLHITTSSIPKS-EENDFFDELEELPISSAFTS  250



>ref|XP_006840437.1| hypothetical protein AMTR_s00045p00165950 [Amborella trichopoda]
 gb|ERN02112.1| hypothetical protein AMTR_s00045p00165950 [Amborella trichopoda]
Length=306

 Score =   178 bits (451),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 136/224 (61%), Gaps = 20/224 (9%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R +A K VVTV++       +K + PPSD WSWRKYGQKPIKGSP+PRGYYRCS++KGC 
Sbjct  94   RKVAPKTVVTVRIAAAAAGSQKGDCPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTAKGCL  153

Query  459  AKKQVERSRTDASVLIITYTSTHNHP---EVReepaaaeeeDNPTSTPVPeggeeeaeem  629
            AKKQVER RTDAS+LIITY+STHNHP   +    P   + ++N    PVP          
Sbjct  154  AKKQVERCRTDASMLIITYSSTHNHPLPSQQATNPPLKKPQENLARNPVPVSPNLAKTLE  213

Query  630  eHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNYDPLSYP  809
                G        D F   QSP    S ED+  N+ + + L  E +        +PLSYP
Sbjct  214  SQTVGEAPI----DDFFSFQSPMR--SPEDL--NQENPSPLTEEPVFE------EPLSYP  259

Query  810  HLMDFSTPKSQEENDFYDELEELPPTSSF---ISHTFFKDTISV  932
            H+M FS PK++E N+F+DELEELP +SSF   + ++FF + I +
Sbjct  260  HIMAFSEPKTEEGNEFFDELEELPISSSFAGPMRNSFFDERILI  303



>ref|XP_002320972.1| hypothetical protein POPTR_0014s11490g [Populus trichocarpa]
 gb|EEE99287.1| hypothetical protein POPTR_0014s11490g [Populus trichocarpa]
Length=262

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 143/241 (59%), Gaps = 30/241 (12%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K+VV V++GE +  K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  26   RKMVEKIVVRVRIGE-NAVKLKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  84

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVER RTDASVLI+TYTS HNHP      +   ++     TP P    +     +  
Sbjct  85   AKKQVERCRTDASVLIVTYTSNHNHPGPDLHDSNVNQQPRDPETP-PTDLVDHPITPKQE  143

Query  639  SGVKDNGYEED---------------SFHYSQSPFNTTSSEDMIINRADDNYLFtetlgt  773
               ++ G   D               +FHY +SP      +D++I++   +Y FTE    
Sbjct  144  KPEEETGERHDHPIMPSTDEDVSEGHNFHYLESPIRI--PQDIMISQ---DYPFTENSEK  198

Query  774  tttt-----NYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT---FFKDTIS  929
            +  T     + +P+    LM FS PKS+E NDF+DELEELP +SSF S     FF + I 
Sbjct  199  SHDTLGIVFDEEPICCSRLMTFSAPKSEENNDFFDELEELPTSSSFTSFVRGNFFDERIP  258

Query  930  V  932
            V
Sbjct  259  V  259



>ref|XP_011042262.1| PREDICTED: probable WRKY transcription factor 69 [Populus euphratica]
 ref|XP_011042263.1| PREDICTED: probable WRKY transcription factor 69 [Populus euphratica]
 ref|XP_011042264.1| PREDICTED: probable WRKY transcription factor 69 [Populus euphratica]
Length=245

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 134/217 (62%), Gaps = 19/217 (9%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + +K  V V++G+  G K K+EGPPSD WSWRKYGQKPIKGSPHPRGYYRCS+SKGCS
Sbjct  26   RKVVEKTFVRVRIGKNAG-KLKNEGPPSDFWSWRKYGQKPIKGSPHPRGYYRCSTSKGCS  84

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaee------------eDNPTSTPVPe  602
            AKKQVER RTDASVLIITYTS HNHP      ++  +             D+PT+    +
Sbjct  85   AKKQVERCRTDASVLIITYTSNHNHPGPDLHESSLNQLSKDPETPPTDHVDHPTTPKQEK  144

Query  603  ggeeeaeemeH--RSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtt  776
              EE  EE  H       +N  E +SFHY QSP     S+D++I++ D      E    T
Sbjct  145  PEEETEEEHGHPIVPSADENAGEGNSFHYLQSPIRI--SQDIMISQEDPFAENPEKSHDT  202

Query  777  tttNYD--PLSYPHLMDFSTPKSQEENDFYDELEELP  881
                 D  P+S   LM FS PKS+E NDF+DELEELP
Sbjct  203  LGIVLDEEPISCSKLMTFSAPKSEENNDFFDELEELP  239



>ref|XP_003625977.1| WRKY transcription factor [Medicago truncatula]
 gb|AES82195.1| WRKY family transcription factor [Medicago truncatula]
Length=265

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 140/235 (60%), Gaps = 25/235 (11%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K VVTV++GE +  K K+EG PSD WSWRKYGQKPIKGSP+PRGYYRCS+ KGCS
Sbjct  27   RKMVEKTVVTVRIGE-NVSKVKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYRCSTCKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNP------TSTPVPeggeeea  620
            AKKQVERS TDAS+LIITYTSTHNHP+     +       P      T+  +P   +EE 
Sbjct  86   AKKQVERSSTDASLLIITYTSTHNHPDPTALSSTTNLAQQPKESKTETTKDLPVTSKEEN  145

Query  621  eem--------eHRSGV--KDNGYEEDSFHYSQSPFNTTSSEDMIINRADD---NYLFte  761
            +E          ++S V   D    E++FHY QS   T  SED+II++ D    N   + 
Sbjct  146  QEQKQVEEEINSNKSTVSSSDQVTNEENFHYLQS--TTHCSEDIIIDQEDPFKLNIEKSH  203

Query  762  tlgtttttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT--FFKD  920
                      +PL Y  L + S  KS EE DF+DELEELP +SS +  T   F D
Sbjct  204  IDKIDLLLEEEPLCYAQLKNMSASKS-EEFDFFDELEELPMSSSILHFTRSIFSD  257



>gb|AFK40226.1| unknown [Medicago truncatula]
Length=265

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 140/235 (60%), Gaps = 25/235 (11%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K VVTV++GE +  K K+EG PSD WSWRKYGQKPIKGSP+PRGYYRCS+ KGCS
Sbjct  27   RKMVEKTVVTVRIGE-NVSKVKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYRCSTCKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNP------TSTPVPeggeeea  620
            AKKQVERS TDAS+LIITYTSTHNHP+     +       P      T+  +P   +EE 
Sbjct  86   AKKQVERSSTDASLLIITYTSTHNHPDPTALSSTTNLAQQPKESKTETTKDLPVTSKEEN  145

Query  621  eem--------eHRSGV--KDNGYEEDSFHYSQSPFNTTSSEDMIINRADD---NYLFte  761
            +E          ++S V   D    E++FHY QS   T  SED+II++ D    N   + 
Sbjct  146  QEQKQVEEEINSNKSTVSSSDQVTNEENFHYLQS--TTHCSEDIIIDQEDPFKLNIEKSH  203

Query  762  tlgtttttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT--FFKD  920
                      +PL Y  L + S  KS EE DF+DELEELP +SS +  T   F D
Sbjct  204  IDKIDLLLEEEPLCYAQLRNMSASKS-EEFDFFDELEELPMSSSILHFTRSIFSD  257



>gb|ABS18416.1| WRKY8 [Glycine max]
Length=254

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 138/224 (62%), Gaps = 17/224 (8%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K VV V+ GE  G K K+EG PSD WSWRKYGQKPIKGSP+PRGYY+CS+SKGCS
Sbjct  30   RKMVEKTVVAVRTGENVG-KLKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYKCSTSKGCS  88

Query  459  AKKQVERSRTDASVLIITYTSTHNHP----------EVReepaaaeeeDNPTSTPVPegg  608
            AKKQVER RTDAS+LIITYTSTHNHP          +  +E + +E   + ++T   E  
Sbjct  89   AKKQVERCRTDASMLIITYTSTHNHPCPTAITTNSPQQPKELSESETTQDLSATTKEEDQ  148

Query  609  eeeaeemeHRSGVK--DNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetl--gtt  776
            E    E E R   K  D    E++FHY QSP    S +D+II + D   L TE       
Sbjct  149  EHIELEEEQRDNNKPSDEVTNEENFHYLQSPIRC-SGQDIIIEQEDPFKLNTEKSHDRMD  207

Query  777  tttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT  908
                 +PL +  L + S  K+ EE DF+DELEELP +SSF+  T
Sbjct  208  LLLEEEPLCFAQLKNLSASKN-EELDFFDELEELPMSSSFLHFT  250



>ref|XP_010267989.1| PREDICTED: probable WRKY transcription factor 69 [Nelumbo nucifera]
Length=281

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 134/218 (61%), Gaps = 15/218 (7%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + QK VVTV++ E  G  +K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+ KGCS
Sbjct  53   RKVIQKTVVTVRIEENAG-GQKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTCKGCS  111

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            A+KQVER RTDAS+LIITYTSTHNHP    +      +  P  +  P   E+       +
Sbjct  112  ARKQVERCRTDASMLIITYTSTHNHP--GPDVHTNPNQGQPILSTQPTVEEKLLPSTPQQ  169

Query  639  SGVK------DNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNY---  791
              ++      D    +D   + QS  N  S  D+I N+ ++     E   T    ++   
Sbjct  170  QQLEEPIIASDEDTSKDHLQHLQSSHNC-SQLDIITNQEENPSTVDEQEKTHNPLSFLFH  228

Query  792  -DPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFIS  902
              PLS+  LM FSTPKS EENDF+DELEELP +SSF S
Sbjct  229  EKPLSFSPLMTFSTPKS-EENDFFDELEELPISSSFTS  265



>ref|XP_009772110.1| PREDICTED: probable WRKY transcription factor 65 [Nicotiana sylvestris]
Length=228

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 135/220 (61%), Gaps = 23/220 (10%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M QKVV+TV++ E +  K+K+EGPPSD WSWRKYGQKPIKGSP+PRGYY+CSSSKGCS
Sbjct  27   RKMTQKVVITVQM-EANAIKQKNEGPPSDCWSWRKYGQKPIKGSPYPRGYYKCSSSKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVERS TD+S+ IITYTSTHNHP        +        +P+    ++E     H 
Sbjct  86   AKKQVERSSTDSSLFIITYTSTHNHPGPNLPYKDSPLNPVTQDSPMTLQQDQEPITDRHV  145

Query  639  SGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNYDPLSYPHLM  818
            S ++DN                    D I+ + ++N    + LGT +  ++ PLSYP LM
Sbjct  146  S-LEDN--------------------DGILVQQEENQFTDKLLGTISYDDFLPLSYPQLM  184

Query  819  DFSTPKSQEENDFYDELEELPPTSSFISHT-FFKDTISVN  935
            +F   +  EENDFYDEL EL    SF S    F++TI V+
Sbjct  185  NFPKSELSEENDFYDELGELQLPPSFTSFAGIFEETILVD  224



>ref|XP_011041119.1| PREDICTED: probable WRKY transcription factor 69 isoform X1 [Populus 
euphratica]
Length=242

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 133/218 (61%), Gaps = 24/218 (11%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K+VV V++GE + RK K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  26   RKMVEKIVVRVRIGE-NARKLKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  84

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVER RTDASVLI+TYTS HNHP      +   ++     TP P    +     +  
Sbjct  85   AKKQVERCRTDASVLIVTYTSNHNHPGPDLHDSNVNQQPRDPETP-PTDLVDHPITPKQE  143

Query  639  SGVKDNGYEED---------------SFHYSQSPFNTTSSEDMIINRADDNYLFtetlgt  773
               ++ G   D               +FHY +SP      +D++I++   +Y FTE    
Sbjct  144  KPEEETGERHDHPIMPSTDEDVSEGHNFHYLESPIRI--PQDIMISQ---DYPFTENSEK  198

Query  774  ttttNYD--PLSYPHLMDFSTPKSQEENDFYDELEELP  881
            +    +D  P+    LM FS PK++E NDF+DELEELP
Sbjct  199  SHDIVFDEEPICCSRLMTFSAPKTEENNDFFDELEELP  236



>ref|XP_006604744.1| PREDICTED: probable WRKY transcription factor 35 [Glycine max]
 gb|KHN43452.1| Putative WRKY transcription factor 35 [Glycine soja]
Length=264

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 138/224 (62%), Gaps = 17/224 (8%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K VV V+ GE  G K K+EG PSD WSWRKYGQKPIKGSP+PRGYY+CS+SKGCS
Sbjct  30   RKMVEKTVVAVRTGENVG-KLKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYKCSTSKGCS  88

Query  459  AKKQVERSRTDASVLIITYTSTHNHP----------EVReepaaaeeeDNPTSTPVPegg  608
            AKKQVER RTDAS+LIITYTSTHNHP          +  +E + +E   + ++T   E  
Sbjct  89   AKKQVERCRTDASMLIITYTSTHNHPCPTAITTNSPQQPKELSESETTQDLSATTKEEDQ  148

Query  609  eeeaeemeHRSGVK--DNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetl--gtt  776
            E    E E R   K  D    E++FHY QSP    S +D+II + D   L TE       
Sbjct  149  EHIELEEEQRDNNKPSDEVTNEENFHYLQSPIRC-SGQDIIIEQEDPFKLNTEKSHDRMD  207

Query  777  tttNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT  908
                 +PL +  L + S  K+ EE DF+DELEELP +SSF+  T
Sbjct  208  LLLEEEPLCFAQLKNLSASKN-EELDFFDELEELPMSSSFLHFT  250



>ref|XP_003521596.1| PREDICTED: probable WRKY transcription factor 35 [Glycine max]
 gb|KHN19208.1| Putative WRKY transcription factor 35 [Glycine soja]
Length=253

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 130/212 (61%), Gaps = 6/212 (3%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K VV V++GE  G K K+EG PSD WSWRKYGQKPIKGSP+PRGYY+CS+SKGCS
Sbjct  32   RKMVEKTVVAVRVGEKVG-KLKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYKCSTSKGCS  90

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVER RTDAS+LIITYTSTHNHP                     E  EEE +   + 
Sbjct  91   AKKQVERCRTDASMLIITYTSTHNHP-CPTPITTKSTTTKEEDQEHIELEEEEEQRDNNN  149

Query  639  SGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetl--gtttttNYDPLSYPH  812
            +   D    E++FHY QSP    SS+D+II + D   L TE            +PL +  
Sbjct  150  NKPSDEVTNEENFHYLQSPIR-CSSQDIIIEQEDPFKLNTEKSHDRMDLLLEEEPLCFAQ  208

Query  813  LMDFSTPKSQEENDFYDELEELPPTSSFISHT  908
            L + S  K+ EE DF+DELEELP +SS +  T
Sbjct  209  LKNLSASKN-EELDFFDELEELPMSSSLLHFT  239



>ref|XP_004300445.1| PREDICTED: uncharacterized protein LOC101296670 [Fragaria vesca 
subsp. vesca]
Length=282

 Score =   173 bits (438),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 115/245 (47%), Positives = 140/245 (57%), Gaps = 40/245 (16%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQ  470
            QK VVTVK+G   G K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQ
Sbjct  36   QKTVVTVKIGPNVG-KLKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQ  94

Query  471  VERSRTDASVLIITYTSTHNH--PEVReepaaaeeeDNPTSTPVPeggeeeaeemeHRSG  644
            VERS+TDASVLIITYTS+HNH  P+V     +  +  NP         + E ++ + ++ 
Sbjct  95   VERSKTDASVLIITYTSSHNHPGPDV----TSTTKYQNPPPKEAQMQQDSEDDDHDLKAE  150

Query  645  VK---------------------------DNGYEEDSFHYSQSPFNTTSSEDMIINRADD  743
            V                            D   E D FHY QSP    SS+D++I + D 
Sbjct  151  VAKEEEQEPEPAPEPEQEQEQEQEQERKVDVQQEPDHFHYIQSPIR--SSQDIVIYQEDP  208

Query  744  NYLFtetlgtttttNYDPLSYPHLMDFS---TPKSQEENDFYDELEELPPTSSFISHTFF  914
                     T    +   L Y  LM  S   TPKS+EE DFYDELEEL PTSS+   +F 
Sbjct  209  FSSGNHLEKTLLDEHPQSLCYSQLMSMSFSTTPKSEEEEDFYDELEELLPTSSYFP-SFM  267

Query  915  KDTIS  929
            +  +S
Sbjct  268  RSNLS  272



>ref|XP_011041128.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Populus 
euphratica]
Length=215

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 133/221 (60%), Gaps = 24/221 (11%)
 Frame = +3

Query  285  MAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAK  464
            M +K+VV V++GE + RK K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAK
Sbjct  1    MVEKIVVRVRIGE-NARKLKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAK  59

Query  465  KQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHRSG  644
            KQVER RTDASVLI+TYTS HNHP      +   ++     TP P    +     +    
Sbjct  60   KQVERCRTDASVLIVTYTSNHNHPGPDLHDSNVNQQPRDPETP-PTDLVDHPITPKQEKP  118

Query  645  VKDNGYEED---------------SFHYSQSPFNTTSSEDMIINRADDNYLFtetlgttt  779
             ++ G   D               +FHY +SP      +D++I++   +Y FTE    + 
Sbjct  119  EEETGERHDHPIMPSTDEDVSEGHNFHYLESPIRI--PQDIMISQ---DYPFTENSEKSH  173

Query  780  ttNYD--PLSYPHLMDFSTPKSQEENDFYDELEELPPTSSF  896
               +D  P+    LM FS PK++E NDF+DELEELP    F
Sbjct  174  DIVFDEEPICCSRLMTFSAPKTEENNDFFDELEELPHIFVF  214



>ref|XP_009378733.1| PREDICTED: probable WRKY transcription factor 65 [Pyrus x bretschneideri]
Length=262

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 148/239 (62%), Gaps = 23/239 (10%)
 Frame = +3

Query  279  RSMA-QKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R +A +K VVTVK+G   G K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGC
Sbjct  27   RKLAHEKTVVTVKIGANVG-KLKNEGPPSDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGC  85

Query  456  SAKKQVERSRTDASVLIITYTSTHNH---PEVReepaaaeeeDNPTSTPVPeggeeeaee  626
            SAKKQVERS+TDASVLIITYT +HNH   P+V       +E D        +  E+E E+
Sbjct  86   SAKKQVERSKTDASVLIITYTCSHNHSGPPDVNVISTTQQEHDQKQEQEQEQEQEQEQEQ  145

Query  627  meHRSGVKDNGYE--------EDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttt  782
             + +   +D   E        E+ FHY +SP  ++  E+ I    D ++ F         
Sbjct  146  EQEQDQKQDQKQEQEQEHRKLEEHFHYIESPVRSSQEEEHIFIAHDTSFGFLLDEKQEPL  205

Query  783  tNYDPLSYPHLMDFSTPK-SQEENDFYDELEELPPTSSFISHTFFKDTISVNSI*FNLE  956
            +    LSY  LM FSTPK S+E NDF+DELEELP  SSF S  F + T   N++ F +E
Sbjct  206  S----LSYSQLMSFSTPKLSEENNDFFDELEELPTFSSFPS--FMRRT---NNLSFGIE  255



>ref|XP_004229384.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Solanum 
lycopersicum]
Length=248

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 137/223 (61%), Gaps = 14/223 (6%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
             R MAQKVV+TV++ E    K+K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  34   VRKMAQKVVMTVQM-EAKSLKQKNEGPPSDCWSWRKYGQKPIKGSPYPRGYYRCSSSKGC  92

Query  456  SAKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeH  635
            SAKKQVER   DAS+ IITYTS+HNHP           +D+    PV +      +  + 
Sbjct  93   SAKKQVERCSKDASLFIITYTSSHNHP------GPNLPKDSVKQEPVVDQHVSLEDNNDE  146

Query  636  RSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtet-lgtttttNYDPLSYPH  812
                 D+   +      ++P N+T++   I     +  LFT+  LGT +  ++ PLSYP 
Sbjct  147  DDDDDDDNDTQS----CKTPLNSTTTSTSIPQGILEENLFTDNFLGTISYDDFLPLSYPQ  202

Query  813  LMDFSTPKSQEENDFYDELE--ELPPTSSFISHTFFKDTISVN  935
            LM F   +  EENDFYDEL   ELPP+SS      F++ I V+
Sbjct  203  LMKFPKSELSEENDFYDELGELELPPSSSTSFAGIFEEAILVD  245



>ref|XP_010322372.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Solanum 
lycopersicum]
Length=240

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 135/222 (61%), Gaps = 14/222 (6%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R MAQKVV+TV++ E    K+K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  27   RKMAQKVVMTVQM-EAKSLKQKNEGPPSDCWSWRKYGQKPIKGSPYPRGYYRCSSSKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVER   DAS+ IITYTS+HNHP           +D+    PV +      +  +  
Sbjct  86   AKKQVERCSKDASLFIITYTSSHNHP------GPNLPKDSVKQEPVVDQHVSLEDNNDED  139

Query  639  SGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttt-tNYDPLSYPHL  815
                D+   +      ++P N+T++   I     +  LFT+    T +  ++ PLSYP L
Sbjct  140  DDDDDDNDTQS----CKTPLNSTTTSTSIPQGILEENLFTDNFLGTISYDDFLPLSYPQL  195

Query  816  MDFSTPKSQEENDFYDELE--ELPPTSSFISHTFFKDTISVN  935
            M F   +  EENDFYDEL   ELPP+SS      F++ I V+
Sbjct  196  MKFPKSELSEENDFYDELGELELPPSSSTSFAGIFEEAILVD  237



>ref|XP_009346616.1| PREDICTED: probable WRKY transcription factor 35 [Pyrus x bretschneideri]
Length=263

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 139/216 (64%), Gaps = 20/216 (9%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQ  470
            +K VVTVK+G   G K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQ
Sbjct  32   EKTVVTVKIGANVG-KLKNEGPPSDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQ  90

Query  471  VERSRTDASVLIITYTSTHNHP-------------EVReepaaaeeeDNPTSTPVPegge  611
            VERS+TDASVLIITYTS+HNHP             E  ++    +E++        +  +
Sbjct  91   VERSKTDASVLIITYTSSHNHPGPPDVNVISTTQQEQEDDQKQEQEQEQEDDQEQEQEQD  150

Query  612  eeaeemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNY  791
            ++ ++ + +   +++G  E+ FHY +SP   +S ++ I    D ++ F         +  
Sbjct  151  QKQDQDKKQDQEQEHGKLEEHFHYIESPIR-SSQDEHIFTAHDTSFGFLLDEEQEPLS--  207

Query  792  DPLSYPHLMDFSTPK-SQEENDFYDELEELPPTSSF  896
              LSY  LM FSTPK S+E NDF+DELEELP  SSF
Sbjct  208  --LSYSQLMSFSTPKLSEENNDFFDELEELPTFSSF  241



>ref|NP_001280896.1| probable WRKY transcription factor 35 [Malus domestica]
 gb|ADL36851.1| WRKY domain class transcription factor [Malus domestica]
Length=268

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 139/221 (63%), Gaps = 25/221 (11%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQ  470
            +K VVTVK+G   G K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQ
Sbjct  32   EKTVVTVKIGANVG-KLKNEGPPSDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQ  90

Query  471  VERSRTDASVLIITYTSTHNH---PEVReepaaaeeeDNPTSTPVPeggeeeaeemeHRS  641
            VERS+TDASVLIITYTS+HNH   P+V       +E+++  +    E  +++ +E E   
Sbjct  91   VERSKTDASVLIITYTSSHNHPGPPDVNVISTTQQEQEDEQTQQEQEDDQKQEQEQEDDQ  150

Query  642  GV---------------KDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtt  776
                             +++G  E+ FHY +SP  + S E+ I    D ++ F       
Sbjct  151  EQEQDQKQDQDKKQDHEQEHGKLEERFHYIESPIRS-SQEEHIFTAHDTSFGFLLDEEQE  209

Query  777  tttNYDPLSYPHLMDFSTPK-SQEENDFYDELEELPPTSSF  896
              +    LSY  LM FSTPK S+E NDF+DELEELP  SSF
Sbjct  210  PLS----LSYSQLMSFSTPKLSEENNDFFDELEELPTFSSF  246



>ref|XP_006349180.1| PREDICTED: probable WRKY transcription factor 65-like [Solanum 
tuberosum]
Length=244

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 142/226 (63%), Gaps = 24/226 (11%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
             R MAQKVV+TV++ E    K+K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  34   VRKMAQKVVITVQM-EAKSLKQKNEGPPSDCWSWRKYGQKPIKGSPYPRGYYRCSSSKGC  92

Query  456  SAKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeH  635
            SAKKQVER   DAS+ +ITYTS+HNHP              P    +P+    + + ++ 
Sbjct  93   SAKKQVERCSKDASLFVITYTSSHNHP-------------GPN---LPKDSVTQEQIVDQ  136

Query  636  RSGVKDNGYEEDSFHYSQ---SPFNTTSSEDMIINRADDNYLFtetlgtttt-tNYDPLS  803
               ++DN  ++D    +Q   SP N+T++   I     +  LF+++   T +  ++ PLS
Sbjct  137  HVSLEDNNDDDDDNDDTQSCKSPLNSTTTGTSIPQGILEENLFSDSFLGTISYDDFLPLS  196

Query  804  YPHLMDFSTPKSQEENDFYDELE--ELPPTSSFISHTFFKDTISVN  935
            YP LM F   +  EENDFYDEL   ELPP+S+  +   F++ I V+
Sbjct  197  YPQLMKFPKSELSEENDFYDELGELELPPSSTSFAG-IFEEAILVD  241



>ref|XP_007051114.1| WRKY DNA-binding protein 35, putative [Theobroma cacao]
 gb|EOX95271.1| WRKY DNA-binding protein 35, putative [Theobroma cacao]
Length=269

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 129/214 (60%), Gaps = 22/214 (10%)
 Frame = +3

Query  315  LGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDA  494
            +GE  G K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQVER RTDA
Sbjct  44   IGENSG-KLKNEGPPSDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQVERCRTDA  102

Query  495  SVLIITYTSTHNHP-------EVReepaaaeeeDNPTSTPVPeggeeeaeemeHRSGV--  647
            S+LIITYTS+HNHP        + + P   + +      P P+  +   +  +       
Sbjct  103  SMLIITYTSSHNHPGPDLHTTNLMQSPKEPQTDHGDDQPPTPKQQQLPEDPQQEEPEEVQ  162

Query  648  -------KDNGYEEDSFHYSQSPFNTTSSEDMIINRAD--DNYLFtetlgtttttNYDPL  800
                    D    E+ FHY QSP   +S  ++IIN+ D     L           + +PL
Sbjct  163  NEPIKTSSDEDAIEEHFHYLQSPL--SSPRNIIINQEDLFTGNLVKTHDNLGFLLDEEPL  220

Query  801  SYPHLMDFSTPKSQEENDFYDELEELPPTSSFIS  902
            S PH+   STPKS EENDF+DELEELP +S+F S
Sbjct  221  SCPHITTSSTPKS-EENDFFDELEELPISSAFTS  253



>ref|XP_008369035.1| PREDICTED: probable WRKY transcription factor 35 [Malus domestica]
Length=260

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 140/232 (60%), Gaps = 20/232 (9%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQ  470
            +K VVTVK+G   G K K+EGPP D WSWRKYGQKPIKGSP+PRGYYRCS+SKGC AKKQ
Sbjct  32   EKTVVTVKIGANXG-KLKNEGPPFDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGCLAKKQ  90

Query  471  VERSRTDASVLIITYTSTHNH---PEVReepaaaeeeDNPTSTPVPeggeeeaeemeHRS  641
            VERS+TDASVLIITYT +HNH   P++       +E D        +  E+E E+   + 
Sbjct  91   VERSKTDASVLIITYTCSHNHSGPPDLNVISTTQQEHDQKQEXEQEQEQEQEQEQEXDQK  150

Query  642  GVKDNGYE------EDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNYDPLS  803
              +    E      E+ FHY +SP   +  E+ I    D ++ F         +    LS
Sbjct  151  QDQKQEQEQEHRKLEEHFHYIESPIRFSQEEEHIFIAHDTSFEFLLDEKQEPLS----LS  206

Query  804  YPHLMDFSTPK-SQEENDFYDELEELPPTSSFISHTFFKDTISVNSI*FNLE  956
            Y  +M FSTPK S+E NDF+DELEELP  SSF S  F + T   N++ F LE
Sbjct  207  YSQMMSFSTPKLSEENNDFFDELEELPTFSSFPS--FMRRT---NNLSFGLE  253



>ref|XP_010259291.1| PREDICTED: probable WRKY transcription factor 69 [Nelumbo nucifera]
Length=282

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 128/224 (57%), Gaps = 32/224 (14%)
 Frame = +3

Query  321  EGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDASV  500
            E +  ++KSEGPPSD W WRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQVER RTDAS+
Sbjct  68   EANSDRQKSEGPPSDFWCWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQVERCRTDASM  127

Query  501  LIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHRSGVKDNGYEEDS--  674
            LIITYTS+HNHP          ++  PT    P          + +     +  EED+  
Sbjct  128  LIITYTSSHNHPGPDLHTIDPNQQSQPTPESQPTEELPATILQQQQQQTITSEEEEDAQE  187

Query  675  --FHYSQSPFNTTSSEDMIINRADD-------------NYLFtetlgtttttNYDPLSYP  809
                YSQSP +   S+D    + +D             N LF E          +PLS+P
Sbjct  188  NHLQYSQSPMDC--SQDNPAKQEEDPSTTEPEKTQNSLNLLFDEN---------NPLSFP  236

Query  810  HLMDFSTPKSQEENDFYDELEELPPTSSF---ISHTFFKDTISV  932
             LM F T K+ EENDF+DELEELP +SS    +   FF + I +
Sbjct  237  PLMTFPTSKA-EENDFFDELEELPISSSLSGIMRSNFFDERILI  279



>gb|AIY62482.1| WRKY105 [Gossypium aridum]
Length=238

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 140/234 (60%), Gaps = 32/234 (14%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + ++ VVTVK+GE +G K K++GPP DSWSWRKYGQKPIKGSP+PRGYY+CS+SKGCS
Sbjct  18   RKVVERTVVTVKMGE-NGGKLKNDGPPYDSWSWRKYGQKPIKGSPYPRGYYKCSTSKGCS  76

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVER +TDAS+LIITYTS+HNHP             +PT  P     +++  + + R
Sbjct  77   AKKQVERCKTDASMLIITYTSSHNHPSPH-LHNTKTLSQSPTKEP---QSDDDDGDNDDR  132

Query  639  SGVKDNGY----EEDSFHYSQSP--FNTTSSEDMI---INRADDNYLFtetlgtttttNY  791
            +      +    +E+ FHY QSP  F     ED+    + R+    L           + 
Sbjct  133  APTTKQEHLPDKDEEQFHYLQSPLSFPQNQEEDLFSGNLERSTVGLLL----------DE  182

Query  792  DPLSYPHLMDFS----TPKSQEENDFYDELEELPPTSS---FISHTFFKDTISV  932
            +P+S    M  +    TPKS EENDF+DELEELP  S+   F+   FF + I V
Sbjct  183  EPVSCCSRMKAASSSPTPKS-EENDFFDELEELPICSAFTRFMRSKFFDEGIPV  235



>gb|AIE43846.1| WRKY transcription factor 65 [Gossypium hirsutum]
Length=229

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 132/216 (61%), Gaps = 24/216 (11%)
 Frame = +3

Query  315  LGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDA  494
            +GE +G K KSEGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQVER +TDA
Sbjct  1    MGE-NGGKLKSEGPPSDLWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQVERCKTDA  59

Query  495  SVLIITYTSTHNHP-----------EVReepaaaeeeDNPTSTPVPeggeee-------a  620
            S+LIITYTS+HNHP             +E      ++D P +T + +  E          
Sbjct  60   SMLIITYTSSHNHPGPDLHCADLKQSPKEPQTTHSDDDKPPTTTLKQLPEVSEKEPEEVK  119

Query  621  eemeHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRAD--DNYLFtetlgtttttNYD  794
            +E    S   ++  EE  FHY QSP   +  ++ II++ D  +  L           + +
Sbjct  120  KEQNKTSSTDEDASEEQHFHYLQSPL--SFPQNNIISQEDPFNGNLEKTHDTLGFLLDEE  177

Query  795  PLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFIS  902
            PLS  H+   S PKS EENDF+DELEELP +S+F S
Sbjct  178  PLSCLHITTSSIPKS-EENDFFDELEELPISSAFTS  212



>ref|XP_010931747.1| PREDICTED: probable WRKY transcription factor 65 [Elaeis guineensis]
Length=283

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 132/234 (56%), Gaps = 38/234 (16%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + QK VVT ++ E +  K+K E PPSD WSWRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  60   RKVFQKTVVTSRI-EAEVGKQKGESPPSDFWSWRKYGQKPIKGSPYPRGYYRCSSSKGCS  118

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTP---VPeggeeeaeem  629
            AKKQVERS+TD+S+LIITYTS HNHP              PT  P    P       +  
Sbjct  119  AKKQVERSKTDSSLLIITYTSDHNHPGPHL----------PTICPQEASPRNQSINQDLP  168

Query  630  eHRSGVKDNGYEEDSFHYSQSPF-------NTTSSEDMIINRADD---NYLFtetlgttt  779
              +S  + N   E S +  QSP           S ++  +    D   N LF E      
Sbjct  169  APKSPSQPNTTSEGSLNKEQSPLPCPPKCSQEISQQNQPLEEVHDHQQNVLFDEE-----  223

Query  780  ttNYDPLSYPHLMDFS--TPKSQEENDFYDELEELP-PTS--SFISHTFFKDTI  926
                +PL  P+ M FS  TPK+ EENDF+DEL ELP P+S  S +  +FF + I
Sbjct  224  ----NPLPSPNSMTFSSTTPKTNEENDFFDELGELPIPSSLTSLVRESFFDERI  273



>ref|XP_008812523.1| PREDICTED: probable WRKY transcription factor 14 [Phoenix dactylifera]
Length=250

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 122/205 (60%), Gaps = 12/205 (6%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M QK V+T ++ E D  K+K + PPSD WSWRKYGQKPIKGSPHPRGYYRCS+SKGCS
Sbjct  27   RKMVQKTVITFRI-ESDAGKQKGDCPPSDFWSWRKYGQKPIKGSPHPRGYYRCSTSKGCS  85

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVERSRTD+SVLIITYTS HNHP             +P  T + +      +    +
Sbjct  86   AKKQVERSRTDSSVLIITYTSDHNHPGPHLPSI------SPNETFL-QSLSINQDCPTTK  138

Query  639  SGVKDNGYEEDSFHYSQSPFNTTS--SEDMIINRADDNYLFtetlgtttttNYDPLSYPH  812
            S  + N   E+S +  +SP  +    S+++ +                     DPL YP+
Sbjct  139  SPNQPNPTSEESLNKEKSPLPSPPKYSQEITLQNPPTEIGAHCHQLNILFDEGDPLPYPN  198

Query  813  LMDFSTP--KSQEENDFYDELEELP  881
             M FS+   K+ EENDF++ELEELP
Sbjct  199  SMTFSSTASKTNEENDFFNELEELP  223



>ref|XP_007163184.1| hypothetical protein PHAVU_001G213600g [Phaseolus vulgaris]
 gb|ESW35178.1| hypothetical protein PHAVU_001G213600g [Phaseolus vulgaris]
Length=261

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 132/222 (59%), Gaps = 16/222 (7%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K VV V++GE  G K K+EG PSD WSWRKYGQKPIKGSP+PRGYY+CS+SKGCS
Sbjct  30   RKMVEKTVVAVRIGENVG-KLKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYKCSTSKGCS  88

Query  459  AKKQVERSRTDASVLIITYTSTHNHP-----EVReepaaaeeeDNPTSTPVPeggeeeae  623
            AKKQVER RTDAS LIITYTS HNHP          P   +E ++ T+  +    +EE  
Sbjct  89   AKKQVERCRTDASTLIITYTSAHNHPCPTTTTTTNSPQQPKESESETTQDLSATSKEEDP  148

Query  624  eme---HRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetl----gtttt  782
            E      R    +   +E+ F Y QSP     S+D+ + + D   L TE           
Sbjct  149  EHIEEEQRDNNNNKPSDEEKFLYLQSPIRC--SQDIEMEQEDPFKLNTEKSHERIDLLLE  206

Query  783  tNYDPLSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT  908
               +PL Y  + + S  K+ EE DF+DELEELP +SSF+  T
Sbjct  207  EEEEPLCYAQVKNLSASKN-EELDFFDELEELPMSSSFLPFT  247



>gb|AGQ04237.1| WRKY transcription factor 46 [Jatropha curcas]
 gb|KDP28266.1| hypothetical protein JCGZ_14037 [Jatropha curcas]
Length=282

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 138/231 (60%), Gaps = 34/231 (15%)
 Frame = +3

Query  315  LGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDA  494
            +G   G K K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQVER RTDA
Sbjct  40   IGANAG-KLKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQVERCRTDA  98

Query  495  SVLIITYTSTHNHP----------EVReepaaaeeeDNPTST----PVPeggeeeaeeme  632
            SVLIITYTSTHNHP            +E+P  ++ +  P++T    P     EEE EE E
Sbjct  99   SVLIITYTSTHNHPGPDLHATNLINQQEQPKESQNQKQPSTTKDHSPTTTEEEEEDEEEE  158

Query  633  HRSG---------VKDNGYEEDSFHYSQ-SPFNTT-----SSEDMIINRADDNYLFtetl  767
            +++            DN  + + FHY Q SP + T     S ED  I +  D     E  
Sbjct  159  NQNQPIVENEIIHKNDNIEDGNDFHYLQSSPLSCTQDMMISQEDPFIEKKPDAEQTHEND  218

Query  768  gtttttNYDPL--SYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHTFF  914
                  + +P+  S P LM FSTP   EENDF+DELEELP  S+F S  FF
Sbjct  219  TLGILLDEEPIVSSCPTLMTFSTPSKSEENDFFDELEELPTYSAFTS--FF  267



>ref|XP_010087230.1| putative WRKY transcription factor 35 [Morus notabilis]
 gb|EXB28580.1| putative WRKY transcription factor 35 [Morus notabilis]
Length=268

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 132/213 (62%), Gaps = 33/213 (15%)
 Frame = +3

Query  330  GRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDASVLII  509
            G+  K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQVER +TD S+LII
Sbjct  46   GKLLKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQVERCKTDDSLLII  105

Query  510  TYTSTHNHP-------------EVReepaaaeeeDNPTSTPVPeggeeeaeemeHRSGVK  650
            TYTS+HNHP             E +E+ +  +E+ +    P P   EE+ +    +    
Sbjct  106  TYTSSHNHPGPDISNATTTLTKEQQEKQSKDQEDHDHHDLPPPMVQEEKNQSELEKD---  162

Query  651  DNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttt------tNYDPL---S  803
                ++D FHY QSP     S+D++I   +++ L  +T    T        + +PL   S
Sbjct  163  ----DQDHFHYIQSPIRC--SQDIVIGLEEEDPLIEKTTICDTLLGGTFPLDEEPLINVS  216

Query  804  YPH-LMDFSTPK-SQEENDFYDELEELPPTSSF  896
              H L+ FS PK S+E NDF+DELEELP +SSF
Sbjct  217  RTHQLLCFSKPKISEENNDFFDELEELPTSSSF  249



>ref|XP_004494428.1| PREDICTED: probable WRKY transcription factor 35-like [Cicer 
arietinum]
Length=248

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 128/217 (59%), Gaps = 18/217 (8%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K VV V++GE +  K K+EG P+D  SWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  29   RKMVEKRVVRVRVGE-NVSKLKNEGLPTDFGSWRKYGQKPIKGSPYPRGYYRCSASKGCS  87

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVERS TD+S+LIITYTSTHNHP+        ++    T        EE      ++
Sbjct  88   AKKQVERSSTDSSMLIITYTSTHNHPDPTTLLQQPKQSKTKTIEEQEHIEEEMINSNNNK  147

Query  639  -----SGVKDNGYEEDSFHYSQSPFNTTSSEDM--IINRADDNYLFtetlgtttttNYDP  797
                 +   D    E+++HY QSP +      +   IN AD   +  E          +P
Sbjct  148  NKNKSTITNDQMTNEENYHYLQSPIDQEDPFKLHTEINHADKIDILLEE---------EP  198

Query  798  LSYPHLMDFSTPKSQEENDFYDELEELPPTSSFISHT  908
            L Y  L + S  KS EE DF+DELEELP +SSF+  T
Sbjct  199  LCYAKLKNLSASKS-EELDFFDELEELPMSSSFLHFT  234



>gb|ABS18437.1| WRKY41 [Glycine max]
Length=179

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 99/150 (66%), Gaps = 3/150 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R M +K VV V++GE  G K K+EG PSD WSWRKYGQKPIKGSP+PRGYY+CS+SKGCS
Sbjct  32   RKMVEKTVVAVRVGEKVG-KLKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYKCSTSKGCS  90

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHR  638
            AKKQVER RTDAS+LIITYTSTHNHP                     E  EEE +   + 
Sbjct  91   AKKQVERCRTDASMLIITYTSTHNHP-CPTPITTKSTTTKEEDQEHIELEEEEEQRDNNN  149

Query  639  SGVKDNGYEEDSFHYSQSPFNTTSSEDMII  728
            +   D    E++FHY QSP    SS+D+II
Sbjct  150  NKPSDEVTNEENFHYLQSPIR-CSSQDIII  178



>ref|XP_010545170.1| PREDICTED: probable WRKY transcription factor 65 [Tarenaya hassleriana]
Length=213

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 118/203 (58%), Gaps = 30/203 (15%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQ  470
            +K VVTVK+GE      K+EG PSD WSWRKYGQKPIKGSP+PRGYYRCS+ KGCSAKKQ
Sbjct  22   KKTVVTVKIGEKAESLFKNEGLPSDLWSWRKYGQKPIKGSPYPRGYYRCSTCKGCSAKKQ  81

Query  471  VERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHRSGVK  650
            +ER RTDAS+LIITY++THNHP+         +  NP +  +P           H    +
Sbjct  82   IERCRTDASLLIITYSNTHNHPD---------QGSNPIAQ-IP----------LHHPRKE  121

Query  651  DNGYEEDSFHYSQSPFNTTS-SEDMIINRADDNYLFtetlgtttttNYDPLSYPHLMDFS  827
             N Y+   F   +S  + ++ +E M+         F        +   DP S P +    
Sbjct  122  QNLYKPIIFPARESENDGSADTESMMFGDVLKTGRFPVAREPIGS---DPTSRPVV----  174

Query  828  TPKSQEENDFYDELEELPPTSSF  896
               +++ENDF+DEL+ELP +S F
Sbjct  175  --GAEKENDFFDELDELPMSSGF  195



>gb|AFK39080.1| unknown [Lotus japonicus]
Length=289

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            + M +K VVTVK+GE   + +K+EG PSD WSWRKYGQKPIKGSP+PRGYY+ S+SKGCS
Sbjct  27   QKMVEKTVVTVKIGENVSKVKKNEGLPSDFWSWRKYGQKPIKGSPYPRGYYKYSTSKGCS  86

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            AKKQVER RTD+S+LIITYTSTHNHP
Sbjct  87   AKKQVERCRTDSSMLIITYTSTHNHP  112



>ref|XP_010914568.1| PREDICTED: probable WRKY transcription factor 14 [Elaeis guineensis]
Length=254

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R   QK  +T ++ E D  K+KSE PPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  26   RKAVQKTAITFRI-EADAGKQKSECPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  84

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            AKKQVERS+TD+SVLIITYTS HNHP
Sbjct  85   AKKQVERSKTDSSVLIITYTSDHNHP  110



>ref|XP_010069834.1| PREDICTED: probable WRKY transcription factor 68 [Eucalyptus 
grandis]
 gb|KCW58320.1| hypothetical protein EUGRSUZ_H01007 [Eucalyptus grandis]
Length=289

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R +  K VV VK+ E +  K+K+EGPPSD WSWRKYGQKPIKGSP+PRGYYRCS+SKGCS
Sbjct  28   RKLVHKTVVRVKI-EANVVKQKNEGPPSDFWSWRKYGQKPIKGSPYPRGYYRCSTSKGCS  86

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            AKKQVER +TDASVL++TYTSTHNHP
Sbjct  87   AKKQVERCKTDASVLVVTYTSTHNHP  112



>ref|XP_008797453.1| PREDICTED: probable WRKY transcription factor 14 [Phoenix dactylifera]
Length=250

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + QK VVT ++ E D RK+K E PPSD WSWRKYGQKPIKGSP+PRGYY+CS+SKGCS
Sbjct  28   RKVVQKTVVTSRI-EADVRKQKGESPPSDFWSWRKYGQKPIKGSPYPRGYYKCSTSKGCS  86

Query  459  AKKQVERSRTDASVLIITYTSTHNH  533
            AKKQVERS+TD+S+LIITYTS HNH
Sbjct  87   AKKQVERSKTDSSLLIITYTSDHNH  111



>ref|XP_008235213.1| PREDICTED: probable WRKY transcription factor 69, partial [Prunus 
mume]
Length=208

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 126/212 (59%), Gaps = 33/212 (16%)
 Frame = +3

Query  378  RKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDASVLIITYTST-----------  524
            RKYGQKPIKGSP+PRGYYRCS+SKGCSAKKQVERS+TDASVLIITYT +           
Sbjct  1    RKYGQKPIKGSPYPRGYYRCSTSKGCSAKKQVERSKTDASVLIITYTCSHNHPGPDVSTT  60

Query  525  -----------HNHPEVReepaaaeeeDNPTSTPVPeggeeeaeemeHRSGVKDNGYEED  671
                       HN P +  +    E+E+        E  E++ +  +H +   D+   ED
Sbjct  61   NLTQLQPSTEDHNLPALLPKQEEQEKEEQEKEPEK-EKEEKQGKLEDHPAMKSDH---ED  116

Query  672  SFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNYD--PLSYPHLMDFSTPKSQE  845
             FHY QSP    SS++++I + +D +L    + +T     D  PLSY  LM FSTPKS E
Sbjct  117  HFHYIQSPIR--SSQNIMIEQEEDPFLEKTHVSSTLGFLLDEEPLSYSQLMSFSTPKS-E  173

Query  846  ENDFYDELEELPPTSSFISHTFFKDTISVNSI  941
            ENDF+DELEELP  SSF S  F +  +S+  I
Sbjct  174  ENDFFDELEELPTFSSFPS--FMRSNLSLERI  203



>gb|AEO31482.1| WRKY transcription factor 3-1 [Dimocarpus longan]
Length=75

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R + QK VVTVK+GE +G K K+EGPPSD WSWRKYGQKPIKGSPHPRGYYRCS+SKGCS
Sbjct  1    RKLVQKTVVTVKIGE-NGGKLKNEGPPSDLWSWRKYGQKPIKGSPHPRGYYRCSTSKGCS  59

Query  459  AKKQVERSRTDASVLI  506
            AKKQVERSRTDAS+LI
Sbjct  60   AKKQVERSRTDASMLI  75



>ref|XP_008228947.1| PREDICTED: probable WRKY transcription factor 69 [Prunus mume]
Length=268

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VVTV +G+ +G K K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  48   RRGVQKRVVTVPIGDVEGSKSKGEGHPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNHPE  539
             A+KQVERSR D ++L+ITY   HNHP+
Sbjct  108  PARKQVERSRVDPTMLLITYACEHNHPK  135



>ref|XP_007216729.1| hypothetical protein PRUPE_ppa025586mg [Prunus persica]
 gb|EMJ17928.1| hypothetical protein PRUPE_ppa025586mg [Prunus persica]
Length=277

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VVTV +G+ +G K K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  48   RRGVQKRVVTVPIGDVEGSKSKGEGHPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNHPE  539
             A+KQVERSR D ++L+ITY   HNHP+
Sbjct  108  PARKQVERSRVDPTMLLITYACEHNHPK  135



>ref|XP_010248362.1| PREDICTED: probable WRKY transcription factor 65 [Nelumbo nucifera]
Length=303

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   QK VV+V +G+ DG + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   KSRRAVQKRVVSVPIGDVDGSRLKGETAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D ++L+ITY   HNHP
Sbjct  105  GCPARKQVERSRVDPTMLVITYACEHNHP  133



>ref|XP_011083309.1| PREDICTED: probable WRKY transcription factor 69 [Sesamum indicum]
Length=248

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 75/110 (68%), Gaps = 1/110 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R  A K VV V +G+GDG + K+E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   KSRRGAHKKVVAVPIGDGDGGRSKTEVYPPPDSWSWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTSTPVP  599
            GC A+KQVERSR D + L+ITY+  HNHP             N    P P
Sbjct  105  GCPARKQVERSRLDPTTLLITYSCDHNHPLPTTTSKNHHGSSNSCKVPFP  154



>ref|XP_008381191.1| PREDICTED: probable WRKY transcription factor 69 [Malus domestica]
Length=250

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VV+V +G+ +G K K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  23   RRGVQKRVVSVPIGDVEGSKSKGEGHPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  82

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR + ++LI+TY   HNHP
Sbjct  83   PARKQVERSRLNPTMLIVTYVCDHNHP  109



>ref|XP_009365282.1| PREDICTED: probable WRKY transcription factor 69 [Pyrus x bretschneideri]
Length=250

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VV+V +G+ +G K K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  23   RRGVQKRVVSVPIGDVEGSKSKGEGHPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  82

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR + ++LI+TY   HNHP
Sbjct  83   PARKQVERSRLNPTMLIVTYVCDHNHP  109



>ref|XP_002277383.1| PREDICTED: probable WRKY transcription factor 65 [Vitis vinifera]
Length=244

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +3

Query  288  AQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAK  464
             QK VV+V +G  DG + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC A+
Sbjct  50   VQKRVVSVPIGGVDGSRSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPAR  109

Query  465  KQVERSRTDASVLIITYTSTHNHP  536
            KQVERSR D +VLI+TY   HNHP
Sbjct  110  KQVERSRVDPTVLIVTYACDHNHP  133



>ref|XP_010689722.1| PREDICTED: probable WRKY transcription factor 69 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=297

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   QK VV++ +G+ DG + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  48   KSRRSIQKRVVSIPIGDVDGSRSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  107

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D ++L+ITY   HNHP
Sbjct  108  GCPARKQVERSRVDPTMLVITYACEHNHP  136



>ref|XP_010689723.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=296

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VV++ +G+ DG + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  49   RRSIQKRVVSIPIGDVDGSRSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  108

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D ++L+ITY   HNHP
Sbjct  109  PARKQVERSRVDPTMLVITYACEHNHP  135



>emb|CDP15957.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R  AQK V+TV +GEGDG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  44   RKGAQKKVITVPIGEGDGSRSKGEVYPPPDSWSWRKYGQKPIKGSPYPRGYYRCSSSKGC  103

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERS  D + L++TY+  HNHP
Sbjct  104  PARKQVERSCLDPTKLLVTYSCEHNHP  130



>ref|XP_010102121.1| putative WRKY transcription factor 69 [Morus notabilis]
 gb|EXB92371.1| putative WRKY transcription factor 69 [Morus notabilis]
Length=258

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +3

Query  288  AQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAK  464
             QK VV+V +G+ +G K K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC A+
Sbjct  46   VQKRVVSVPIGDVEGSKSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPAR  105

Query  465  KQVERSRTDASVLIITYTSTHNHP  536
            KQVERSR D + LIITY   HNHP
Sbjct  106  KQVERSRVDPTTLIITYACNHNHP  129



>ref|XP_010242110.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Nelumbo 
nucifera]
Length=295

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VV+V + + DG + K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  46   RRSVQKRVVSVPIKDVDGSRLKGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  105

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D + L+ITY   HNHP
Sbjct  106  PARKQVERSRVDPTRLVITYACEHNHP  132



>ref|XP_006348892.1| PREDICTED: probable WRKY transcription factor 69-like isoform 
X1 [Solanum tuberosum]
Length=275

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R  A+K V++V + EGDG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   KSRRGAKKKVISVPIIEGDGSRSKGEVYPPQDSWSWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNH  533
            GC A+KQVERSR D ++L+ITY S HNH
Sbjct  105  GCPARKQVERSRLDPTMLLITYCSEHNH  132



>ref|XP_010323672.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Solanum 
lycopersicum]
Length=275

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R  A+K V++V + EGDG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   KSRRGAKKKVISVPIIEGDGSRSKGEVYPPQDSWSWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNH  533
            GC A+KQVERSR D ++L+ITY S HNH
Sbjct  105  GCPARKQVERSRLDPTMLLITYCSEHNH  132



>gb|KDO77908.1| hypothetical protein CISIN_1g022353mg [Citrus sinensis]
Length=222

 Score =   126 bits (316),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSS  446
            + +R   QK V++V + E +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSS
Sbjct  1    MMSRRAMQKRVISVPIKEVEGSRLKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSS  60

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            KGC A+KQVERS  D S+L+ITY+  HNHP
Sbjct  61   KGCPARKQVERSSVDPSMLLITYSCEHNHP  90



>ref|XP_010242109.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Nelumbo 
nucifera]
Length=296

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   QK VV+V + + DG + K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  46   SRRSVQKRVVSVPIKDVDGSRLKGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  105

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D + L+ITY   HNHP
Sbjct  106  CPARKQVERSRVDPTRLVITYACEHNHP  133



>ref|XP_004243269.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Solanum 
lycopersicum]
Length=274

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R  A+K V++V + EGDG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  46   RRGAKKKVISVPIIEGDGSRSKGEVYPPQDSWSWRKYGQKPIKGSPYPRGYYRCSSSKGC  105

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D ++L+ITY S HNH
Sbjct  106  PARKQVERSRLDPTMLLITYCSEHNH  131



>ref|XP_006348893.1| PREDICTED: probable WRKY transcription factor 69-like isoform 
X2 [Solanum tuberosum]
Length=274

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R  A+K V++V + EGDG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  46   RRGAKKKVISVPIIEGDGSRSKGEVYPPQDSWSWRKYGQKPIKGSPYPRGYYRCSSSKGC  105

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D ++L+ITY S HNH
Sbjct  106  PARKQVERSRLDPTMLLITYCSEHNH  131



>ref|XP_011039390.1| PREDICTED: probable WRKY transcription factor 65 [Populus euphratica]
Length=268

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++   QK VV+V + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   SKKAMQKRVVSVPIKELEGSRLKGENASPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERS+ D S+L+ITY+  HNHP
Sbjct  105  GCPARKQVERSKVDPSMLVITYSCEHNHP  133



>ref|XP_004504282.1| PREDICTED: probable WRKY transcription factor 65-like [Cicer 
arietinum]
Length=227

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAK  464
            QK VV + + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS KGC A+
Sbjct  45   QKRVVQIPIKENEGTRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSCKGCPAR  104

Query  465  KQVERSRTDASVLIITYTSTHNHP  536
            KQVERSR D ++L+ITY+S HNHP
Sbjct  105  KQVERSRVDPTMLVITYSSDHNHP  128



>ref|XP_009595576.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Nicotiana 
tomentosiformis]
Length=303

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   QK VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  48   SRRSIQKRVVSVPIKEVEGTKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  107

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D ++L++TY+  HNHP
Sbjct  108  GCPARKQVERSRADPNMLVVTYSCEHNHP  136



>ref|XP_009758490.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Nicotiana 
sylvestris]
Length=304

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   QK VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  48   SRRSIQKRVVSVPIKEVEGSKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  107

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D ++L++TY+  HNHP
Sbjct  108  GCPARKQVERSRADPNMLVVTYSCEHNHP  136



>ref|XP_007149724.1| hypothetical protein PHAVU_005G093800g [Phaseolus vulgaris]
 gb|ESW21718.1| hypothetical protein PHAVU_005G093800g [Phaseolus vulgaris]
Length=253

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VVTV +G+ DG K K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  47   RREMKKRVVTVPIGDVDGSKSKGETYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  106

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + LI+TY + HNH
Sbjct  107  PARKQVERSRVDPTKLIVTYANDHNH  132



>ref|XP_006654004.1| PREDICTED: probable WRKY transcription factor 65-like [Oryza 
brachyantha]
Length=180

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 76/104 (73%), Gaps = 6/104 (6%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R   QKVVV++K        +  +GPP+DSWSWRKYGQKPIKGSPHPRGYY+CSS +GC 
Sbjct  18   RQDVQKVVVSLK------DHKVVQGPPADSWSWRKYGQKPIKGSPHPRGYYKCSSYRGCP  71

Query  459  AKKQVERSRTDASVLIITYTSTHNHPEVReepaaaeeeDNPTST  590
            A+KQV++ R DAS+LIITYTS HNH +     +  E++ NP ST
Sbjct  72   ARKQVDKCRNDASLLIITYTSDHNHDKYTATSSVQEQKHNPDST  115



>ref|XP_006467614.1| PREDICTED: probable WRKY transcription factor 65-like [Citrus 
sinensis]
 gb|KDO77907.1| hypothetical protein CISIN_1g022353mg [Citrus sinensis]
Length=269

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK V++V + E +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  51   RRAMQKRVISVPIKEVEGSRLKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  110

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERS  D S+L+ITY+  HNHP
Sbjct  111  PARKQVERSSVDPSMLLITYSCEHNHP  137



>gb|AGQ04241.1| WRKY transcription factor 50.1 [Jatropha curcas]
 gb|KDP21129.1| hypothetical protein JCGZ_21600 [Jatropha curcas]
Length=269

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAK  464
            QK VV+V L + DG + K E   PP DSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC A+
Sbjct  53   QKRVVSVSLKDVDGSRLKGETAPPPPDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPAR  112

Query  465  KQVERSRTDASVLIITYTSTHNHP  536
            KQVERSR D S+L++TY+  HNHP
Sbjct  113  KQVERSRVDPSMLVVTYSCEHNHP  136



>gb|EPS58967.1| hypothetical protein M569_15845, partial [Genlisea aurea]
Length=237

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R  A K VVTV +  GDG + K E  PP D+WSWRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  33   KSRRGANKRVVTVAVEGGDGYRSKGEVYPPPDNWSWRKYGQKPIKGSPYPRGYYRCSSSK  92

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D + L++TY+S HNHP
Sbjct  93   GCPARKQVERSRHDPTTLVVTYSSDHNHP  121



>gb|ACD56642.1| putative WRKY transcription factor [Gossypioides kirkii]
Length=271

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 2/86 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM QK VV+V + + +G + K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  51   RSM-QKRVVSVPIKDVEGSRLKGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  109

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR + ++L+ITY+S HNH
Sbjct  110  PARKQVERSRVNPTMLVITYSSEHNH  135



>ref|XP_006449542.1| hypothetical protein CICLE_v10016229mg [Citrus clementina]
 gb|ESR62782.1| hypothetical protein CICLE_v10016229mg [Citrus clementina]
Length=274

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK V++V + E +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  51   RRAMQKRVISVPIKEVEGSRLKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  110

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERS  D S+L+ITY+  HNHP
Sbjct  111  PARKQVERSSVDPSMLLITYSCEHNHP  137



>ref|XP_009758491.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Nicotiana 
sylvestris]
Length=303

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  48   RRSIQKRVVSVPIKEVEGSKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  107

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++L++TY+  HNHP
Sbjct  108  CPARKQVERSRADPNMLVVTYSCEHNHP  135



>gb|AGV75966.1| WRKY transcription factor 81 [Gossypium hirsutum]
Length=273

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 120/218 (55%), Gaps = 13/218 (6%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM QK VV+V + + +G + K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  49   RSM-QKRVVSVPIKDVEGSRLKGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNH--PEVReepaaaeeeDNPTSTPVPeggeeeaeem  629
             A+KQVERSR + ++L+ITY+  HNH  P  R    +A++     +  V E   + +  +
Sbjct  108  PARKQVERSRVNPTMLVITYSCEHNHAWPASRHNNTSAKQAAAAAAGEVSESPTKSSTAV  167

Query  630  eHRSGVKDNGYEEDSFHYSQSPFNTTSSEDMIINRADDNYLFtetlgtttttNYDPL---  800
            +H         E DS    +  F    +ED I+   D+   F E   T++T    PL   
Sbjct  168  KHEPSTSQPDTEPDSGM--EDGFACL-TEDSILTTGDEFAWFGEMETTSSTVLESPLFSE  224

Query  801  ---SYPHLMDFSTPKSQEENDFYDELEELPPTSSFISH  905
               S         P  +E+   + +LEELP  S    H
Sbjct  225  RDNSEADDTAMIFPMREEDESLFADLEELPECSFVFRH  262



>ref|XP_009595577.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Nicotiana 
tomentosiformis]
Length=302

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  48   RRSIQKRVVSVPIKEVEGTKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  107

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++L++TY+  HNHP
Sbjct  108  CPARKQVERSRADPNMLVVTYSCEHNHP  135



>ref|XP_010057124.1| PREDICTED: probable WRKY transcription factor 65 [Eucalyptus 
grandis]
Length=294

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSS  446
            ++R   QK VV++ + + +G + K EG  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSS
Sbjct  56   KSRRGMQKRVVSIPIKDVEGSRLKGEGAPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSS  115

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            KGC A+KQVERSR D ++L+ITY+  HNHP
Sbjct  116  KGCPARKQVERSREDPTMLLITYSCEHNHP  145



>ref|NP_001237726.1| WRKY52 protein [Glycine max]
 gb|ABS18447.1| WRKY52 [Glycine max]
Length=265

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VVT+ +G+ DG K K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  49   RREMKKRVVTIPIGDVDGSKSKGENYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  108

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + LI+TY   HNH
Sbjct  109  PARKQVERSRVDPTXLIVTYAYEHNH  134



>gb|AAZ99027.1| WRKY-A1244 [Capsicum annuum]
Length=305

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  47   SRRSIEKRVVSVPIKEVEGSKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  106

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D ++LI+TY+  HNHP
Sbjct  107  GCPARKQVERSRADPNMLIVTYSCEHNHP  135



>gb|KDO77906.1| hypothetical protein CISIN_1g022353mg [Citrus sinensis]
Length=298

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK V++V + E +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  51   RRAMQKRVISVPIKEVEGSRLKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  110

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERS  D S+L+ITY+  HNHP
Sbjct  111  PARKQVERSSVDPSMLLITYSCEHNHP  137



>ref|XP_002962865.1| hypothetical protein SELMODRAFT_77979, partial [Selaginella moellendorffii]
 ref|XP_002989444.1| hypothetical protein SELMODRAFT_129832, partial [Selaginella 
moellendorffii]
 gb|EFJ09535.1| hypothetical protein SELMODRAFT_129832, partial [Selaginella 
moellendorffii]
 gb|EFJ36328.1| hypothetical protein SELMODRAFT_77979, partial [Selaginella moellendorffii]
Length=95

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 66/84 (79%), Gaps = 2/84 (2%)
 Frame = +3

Query  285  MAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAK  464
            M QK +V V +  G   K   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCSA+
Sbjct  1    MQQKRIVCVPVAGGG--KPTGEVLPSDMWAWRKYGQKPIKGSPYPRGYYRCSSSKGCSAR  58

Query  465  KQVERSRTDASVLIITYTSTHNHP  536
            KQVERSR D ++LIITYTS HNHP
Sbjct  59   KQVERSRNDPTMLIITYTSEHNHP  82



>ref|XP_004305451.1| PREDICTED: probable WRKY transcription factor 69-like [Fragaria 
vesca subsp. vesca]
Length=268

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R + QK VV+V + E +G K K +G PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK C
Sbjct  50   RGVVQKRVVSVPIREMEGSKGKGDGNPPSDSWTWRKYGQKPIKGSPYPRGYYRCSSSKAC  109

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR+D  +L+ITY   HNH
Sbjct  110  PARKQVERSRSDPRMLLITYACEHNH  135



>ref|XP_010549419.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Tarenaya 
hassleriana]
Length=250

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   QK +VTV + + +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  43   SRRSVQKRLVTVPIKDVEGSRMKGETAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  102

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVER+R D +++++TYT  HNHP
Sbjct  103  CPARKQVERNRDDPTMILVTYTCEHNHP  130



>ref|XP_010679393.1| PREDICTED: probable WRKY transcription factor 69 [Beta vulgaris 
subsp. vulgaris]
Length=255

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 118/215 (55%), Gaps = 29/215 (13%)
 Frame = +3

Query  291  QKVVVTVKLG--EGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAK  464
            +K VVT+K+   +GD + +K+ GPPSDS+SWRKYGQK +KGSP+P+GYYRCS+SKGC AK
Sbjct  32   EKKVVTIKIEAEKGDSQLKKN-GPPSDSYSWRKYGQKLVKGSPYPKGYYRCSTSKGCLAK  90

Query  465  KQVERSRTDASVLIITYTSTHNHPEV--------------ReepaaaeeeDNPTSTPVPe  602
            KQVER + DAS+LIITY S HNHP                +++     + +   S P  E
Sbjct  91   KQVERCKEDASILIITYFSAHNHPTQSPQSPTSTQTHKAPKKKAQFQAQVNEAHSRPKQE  150

Query  603  ggeeeaeemeHRSGVKDNGYEEDSFHYSQSP-FNTTSSEDMIINRADDNYL--Ftetlgt  773
                + +     +   D G ++  FHY QSP + +  +  M     +  Y+  F      
Sbjct  151  QPSNDNKGNNVENTPNDQG-QQGHFHYIQSPTYCSNDTTKMEKQHEEKPYVVSFDNITPF  209

Query  774  ttttNYDPLSYPHLMDFSTPKSQEENDFYDELEEL  878
             +  N+D +   +L        Q+ NDF+DEL EL
Sbjct  210  DSQNNFDVVDDQYL--------QQNNDFFDELNEL  236



>ref|NP_001274847.1| WRKY transcription factor 5 [Solanum tuberosum]
 gb|ABU49724.1| WRKY transcription factor 5 [Solanum tuberosum]
Length=300

 Score =   125 bits (315),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  47   SRRSIEKRVVSVPIKEVEGSKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  106

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D ++L++TY+  HNHP
Sbjct  107  GCPARKQVERSRADPNMLVVTYSCEHNHP  135



>ref|NP_001237587.1| transcription factor [Glycine max]
 gb|ABY84659.1| transcription factor [Glycine max]
Length=263

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VVT+ +G+ DG K K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  49   RREMKKRVVTIPIGDVDGSKSKGENYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  108

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + LI+TY   HNH
Sbjct  109  PARKQVERSRVDPTKLIVTYAYEHNH  134



>emb|CDX90180.1| BnaA08g18040D [Brassica napus]
Length=261

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 2/87 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KGC
Sbjct  44   RSM-EKRVVNVPMKEIEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKGC  102

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D +++IITYTS HNHP
Sbjct  103  PARKQVERSRDDPTMIIITYTSEHNHP  129



>ref|XP_010549420.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Tarenaya 
hassleriana]
Length=249

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK +VTV + + +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  43   RRSVQKRLVTVPIKDVEGSRMKGETAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  102

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVER+R D +++++TYT  HNHP
Sbjct  103  PARKQVERNRDDPTMILVTYTCEHNHP  129



>gb|KCW74147.1| hypothetical protein EUGRSUZ_E02783 [Eucalyptus grandis]
Length=370

 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 2/90 (2%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSS  446
            ++R   QK VV++ + + +G + K EG  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSS
Sbjct  132  KSRRGMQKRVVSIPIKDVEGSRLKGEGAPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSS  191

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            KGC A+KQVERSR D ++L+ITY+  HNHP
Sbjct  192  KGCPARKQVERSREDPTMLLITYSCEHNHP  221



>gb|AAT64024.1| putative WRKY transcription factor [Gossypium hirsutum]
 gb|AIE43850.1| WRKY transcription factor 91 [Gossypium hirsutum]
Length=273

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM QK VV+V + + +G + K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  49   RSM-QKRVVSVPIKDVEGSRLKGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR + ++L+ITY+  HNH
Sbjct  108  PARKQVERSRVNPTMLVITYSCEHNH  133



>gb|ACI14404.1| WRKY65-1 transcription factor [Brassica napus]
Length=261

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 2/87 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KGC
Sbjct  44   RSM-EKRVVNVPMKEIEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKGC  102

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D +++IITYTS HNHP
Sbjct  103  PARKQVERSRDDPTMIIITYTSEHNHP  129



>ref|XP_004487582.1| PREDICTED: probable WRKY transcription factor 69-like [Cicer 
arietinum]
Length=345

 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VVT+ +GE +G K K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  127  RKEMKKRVVTIPIGEVEGSKSKGETYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  186

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D + L++TY   HNHP
Sbjct  187  PARKQVERSRVDPTNLLVTYAYEHNHP  213



>gb|ACD56629.1| putative WRKY transcription factor [Gossypium raimondii]
Length=274

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM QK VV+V + + +G + K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  49   RSM-QKRVVSVPIKDVEGSRLKGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR + ++L+ITY+  HNH
Sbjct  108  PARKQVERSRVNPTMLVITYSCEHNH  133



>ref|XP_009109676.1| PREDICTED: probable WRKY transcription factor 65 [Brassica rapa]
 gb|AHB33860.1| WRKY transcription factor 65 [Brassica rapa]
Length=261

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 2/87 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KGC
Sbjct  44   RSM-EKRVVNVPMKEIEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKGC  102

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D +++IITYTS HNHP
Sbjct  103  PARKQVERSRDDPTMIIITYTSEHNHP  129



>ref|XP_009593761.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Nicotiana 
tomentosiformis]
Length=270

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R  A+K V+TV + + DG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  46   KSRRGAKKKVITVPIIDADGSRSKGEVYPPPDSWSWRKYGQKPIKGSPYPRGYYRCSSSK  105

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNH  533
            GC A+KQVERSR D + L+ITY S HNH
Sbjct  106  GCPARKQVERSRLDPTTLLITYCSEHNH  133



>ref|XP_006358112.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Solanum 
tuberosum]
Length=298

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   +K VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  47   RRSIEKRVVSVPIKEVEGSKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  106

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++L++TY+  HNHP
Sbjct  107  CPARKQVERSRADPNMLVVTYSCEHNHP  134



>gb|EEE62209.1| hypothetical protein OsJ_16996 [Oryza sativa Japonica Group]
Length=179

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 6/85 (7%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R   QKVVV++K        +  +GPP+DSWSWRKYGQKPIKGSPHPRGYY+CSS +GC 
Sbjct  18   RQDVQKVVVSLK------DHKVEQGPPADSWSWRKYGQKPIKGSPHPRGYYKCSSYRGCP  71

Query  459  AKKQVERSRTDASVLIITYTSTHNH  533
            A+KQV++ R DAS+LIITYTS HNH
Sbjct  72   ARKQVDKCRNDASLLIITYTSDHNH  96



>ref|XP_010499444.1| PREDICTED: probable WRKY transcription factor 65 [Camelina sativa]
Length=265

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  46   SRRSVEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  105

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  106  CPARKQVERSRDDPTMILITYTSEHNHP  133



>ref|XP_009115259.1| PREDICTED: probable WRKY transcription factor 65 [Brassica rapa]
Length=262

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV + + E +G + K +  PPSDSWSWRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  42   SRRSIEKRVVNIPMKEIEGSRHKGDTTPPSDSWSWRKYGQKPIKGSPYPRGYYRCSSTKG  101

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  102  CPARKQVERSRDDPTMILITYTSEHNHP  129



>gb|AAT64011.1| putative WRKY transcription factor [Gossypium hirsutum]
Length=272

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM QK VV+V + + +G + K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  49   RSM-QKRVVSVPIKDVEGSRLKGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR + ++L+ITY+  HNH
Sbjct  108  PARKQVERSRVNPTMLVITYSCEHNH  133



>ref|XP_002522247.1| WRKY transcription factor, putative [Ricinus communis]
 gb|EEF40105.1| WRKY transcription factor, putative [Ricinus communis]
Length=267

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++   QK V++V + + +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  48   SKRATQKRVISVPIKDIEGSRLKGENAPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  107

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S+L++TY+  HNHP
Sbjct  108  GCPARKQVERSRVDPSMLVVTYSCEHNHP  136



>ref|XP_002317397.1| WRKY transcription factor 65 family protein [Populus trichocarpa]
 gb|EEE98009.1| WRKY transcription factor 65 family protein [Populus trichocarpa]
Length=268

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++   QK VV+V + + +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   SKKAMQKRVVSVPIKDLEGSRLKGENASPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERS+ D ++L+ITY+  HNHP
Sbjct  105  GCPARKQVERSKVDPTMLVITYSCEHNHP  133



>gb|KFK44771.1| hypothetical protein AALP_AA1G300900 [Arabis alpina]
Length=269

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  45   SRRSVEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  104

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  105  CPARKQVERSRDDPTMILITYTSEHNHP  132



>gb|AAS79556.1| WRKY family transcription factor [Arabidopsis thaliana]
 emb|CAG25867.1| hypothetical protein [Arabidopsis thaliana]
Length=253

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  39   SRRSVEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  98

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  99   CPARKQVERSRDDPTMILITYTSEHNHP  126



>ref|XP_004233062.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Solanum 
lycopersicum]
Length=308

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  47   SRRSIEKRVVSVPIKEIEGSKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  106

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D ++L++TY+  HNHP
Sbjct  107  GCPARKQVERSRADPNMLVVTYSCEHNHP  135



>gb|KHG22407.1| putative WRKY transcription factor 65 -like protein [Gossypium 
arboreum]
Length=272

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            RSM QK VV+V + + +G + K EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  49   RSM-QKRVVSVPIKDVEGSRLKGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR + ++L+ITY+  HNH
Sbjct  108  PARKQVERSRVNPTMLVITYSCEHNH  133



>ref|XP_009802036.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Nicotiana 
sylvestris]
Length=273

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R  A+K V+TV + + DG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  47   KSRRGAKKKVITVPIIDADGSRSKGEVYPPPDSWSWRKYGQKPIKGSPYPRGYYRCSSSK  106

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNH  533
            GC A+KQVERSR D + L+ITY S HNH
Sbjct  107  GCPARKQVERSRLDPTTLLITYCSEHNH  134



>ref|XP_004174142.1| PREDICTED: probable WRKY transcription factor 27-like [Cucumis 
sativus]
Length=155

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  342  KSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDASVLIITYTS  521
            K+EGPP D WSWRKYGQKPIKGSP+PRGYYRCS++KGCSAKKQVER +TD S+ IITYTS
Sbjct  2    KNEGPPPDFWSWRKYGQKPIKGSPYPRGYYRCSTTKGCSAKKQVERCKTDGSMFIITYTS  61

Query  522  THNHP  536
            +HNHP
Sbjct  62   SHNHP  66



>ref|NP_174222.2| putative WRKY transcription factor 65 [Arabidopsis thaliana]
 sp|Q9LP56.1|WRK65_ARATH RecName: Full=Probable WRKY transcription factor 65; AltName: 
Full=WRKY DNA-binding protein 65 [Arabidopsis thaliana]
 gb|AAF88112.1|AC021043_5 Hypothetical protein [Arabidopsis thaliana]
 gb|AAL50783.1|AF452173_1 WRKY transcription factor 65 [Arabidopsis thaliana]
 gb|ABH04461.1| At1g29280 [Arabidopsis thaliana]
 dbj|BAH30323.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31068.1| putative WRKY transcription factor 65 [Arabidopsis thaliana]
Length=259

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  45   SRRSVEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  104

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  105  CPARKQVERSRDDPTMILITYTSEHNHP  132



>ref|XP_002890801.1| WRKY DNA-binding protein 65 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67060.1| WRKY DNA-binding protein 65 [Arabidopsis lyrata subsp. lyrata]
Length=259

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  45   SRRSIEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  104

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  105  CPARKQVERSRDDPTMILITYTSEHNHP  132



>ref|XP_008779946.1| PREDICTED: probable WRKY transcription factor 14, partial [Phoenix 
dactylifera]
Length=230

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  KVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQV  473
            K VV +      G +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCSA+KQV
Sbjct  4    KKVVCIPAPAAAGSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCSARKQV  63

Query  474  ERSRTDASVLIITYTSTHNHP  536
            ERSRTD ++L+ITYTS HNHP
Sbjct  64   ERSRTDPNMLVITYTSEHNHP  84



>gb|KFK44770.1| hypothetical protein AALP_AA1G300900 [Arabis alpina]
Length=268

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KGC
Sbjct  45   RRSVEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKGC  104

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D ++++ITYTS HNHP
Sbjct  105  PARKQVERSRDDPTMILITYTSEHNHP  131



>ref|XP_008454282.1| PREDICTED: probable WRKY transcription factor 69 [Cucumis melo]
Length=288

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTDASVLIITY  515
            K K+EGPP D WSWRKYGQKPIKGSP+PRGYYRCS++KGCSAKKQVER +TD S+ IITY
Sbjct  59   KMKNEGPPPDFWSWRKYGQKPIKGSPYPRGYYRCSTTKGCSAKKQVERCKTDGSMFIITY  118

Query  516  TSTHNHP  536
            TS+HNHP
Sbjct  119  TSSHNHP  125



>ref|XP_007159480.1| hypothetical protein PHAVU_002G240900g [Phaseolus vulgaris]
 gb|ESW31474.1| hypothetical protein PHAVU_002G240900g [Phaseolus vulgaris]
Length=257

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV + + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  46   RRAIQKRVVQIPIKETEGCRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  105

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERS  D ++L++TY+S HNHP
Sbjct  106  CPARKQVERSCVDPTMLVVTYSSDHNHP  133



>ref|XP_002269267.1| PREDICTED: probable WRKY transcription factor 65 [Vitis vinifera]
 emb|CBI30716.3| unnamed protein product [Vitis vinifera]
Length=278

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKK  467
            QK VV+V + + +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC A+K
Sbjct  53   QKRVVSVPIKDVEGSRVKGDCAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPARK  112

Query  468  QVERSRTDASVLIITYTSTHNHP  536
            QVERSR D ++L++TY+  HNHP
Sbjct  113  QVERSRVDPTMLVVTYSCEHNHP  135



>ref|XP_010316839.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Solanum 
lycopersicum]
Length=307

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   +K VV+V + E +G K K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  47   RRSIEKRVVSVPIKEIEGSKMKGEISMPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  106

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++L++TY+  HNHP
Sbjct  107  CPARKQVERSRADPNMLVVTYSCEHNHP  134



>ref|XP_004152355.1| PREDICTED: uncharacterized protein LOC101212435 [Cucumis sativus]
 gb|KGN52859.1| hypothetical protein Csa_4G003720 [Cucumis sativus]
Length=290

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +3

Query  312  KLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKKQVERSRTD  491
            K   G G K K+EGPP D WSWRKYGQKPIKGSP+PRGYYRCS++KGCSAKKQVER +TD
Sbjct  52   KAAIGIG-KMKNEGPPPDFWSWRKYGQKPIKGSPYPRGYYRCSTTKGCSAKKQVERCKTD  110

Query  492  ASVLIITYTSTHNHP  536
             S+ IITYTS+HNHP
Sbjct  111  GSMFIITYTSSHNHP  125



>gb|KHG15095.1| putative WRKY transcription factor 65 -like protein [Gossypium 
arboreum]
Length=276

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            + R   QK VV+V + + D  + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  52   KGRKPIQKRVVSVPIKDVDSSRLKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  111

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D  +L+ITY+  HNHP
Sbjct  112  GCLARKQVERSRLDPKMLVITYSYEHNHP  140



>ref|XP_009593762.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Nicotiana 
tomentosiformis]
Length=269

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R  A+K V+TV + + DG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  47   RRGAKKKVITVPIIDADGSRSKGEVYPPPDSWSWRKYGQKPIKGSPYPRGYYRCSSSKGC  106

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + L+ITY S HNH
Sbjct  107  PARKQVERSRLDPTTLLITYCSEHNH  132



>ref|XP_006585175.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Glycine 
max]
Length=262

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   QK VV + + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  56   SRRAIQKRVVQIPMKETEGCRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  115

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERS  D ++L++TY+S HNHP
Sbjct  116  GCPARKQVERSCVDPTMLVVTYSSDHNHP  144



>gb|AHB33864.1| WRKY transcription factor 69 [Brassica rapa]
Length=282

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +3

Query  258  KVNFIEARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYR  434
            K  F   R+M +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYR
Sbjct  39   KKRFCSMRNM-EKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYR  97

Query  435  CSSSKGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            CSSSKGC A+KQVERSR D S L+ITY   HNHP
Sbjct  98   CSSSKGCPARKQVERSRVDPSKLMITYACEHNHP  131



>ref|XP_003524970.1| PREDICTED: probable WRKY transcription factor 65-like [Glycine 
max]
Length=255

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV + + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  56   RRAIQKRVVQIPMKETEGCRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  115

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERS  D ++L++TY+S HNHP
Sbjct  116  CPARKQVERSCVDPTMLVVTYSSDHNHP  143



>emb|CDO96851.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSS  446
            ++R   QK VV+V + + +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSS
Sbjct  46   KSRRSIQKRVVSVPIKDPEGSRLKGEMGVPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSS  105

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            KGC A+KQVERSR D ++L++TY+  HNHP
Sbjct  106  KGCPARKQVERSRVDPNMLVVTYSCEHNHP  135



>ref|NP_001237221.1| WRKY48 protein [Glycine max]
 gb|ABS18444.1| WRKY48 [Glycine max]
Length=255

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV + + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  56   RRAIQKRVVQIPMKETEGCRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  115

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERS  D ++L++TY+S HNHP
Sbjct  116  CPARKQVERSCVDPTMLVVTYSSDHNHP  143



>ref|XP_009802037.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Nicotiana 
sylvestris]
Length=272

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R  A+K V+TV + + DG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  48   RRGAKKKVITVPIIDADGSRSKGEVYPPPDSWSWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + L+ITY S HNH
Sbjct  108  PARKQVERSRLDPTTLLITYCSEHNH  133



>ref|XP_004969956.1| PREDICTED: probable WRKY transcription factor 65-like [Setaria 
italica]
Length=305

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 68/89 (76%), Gaps = 3/89 (3%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG---PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSS  446
            +R   +K VV+V L E   R R   G   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSS
Sbjct  62   SRRSVEKRVVSVPLAECGDRPRAGSGEGPPPSDSWTWRKYGQKPIKGSPYPRGYYRCSSS  121

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNH  533
            KGC A+KQVERSR D +VL++TYT  HNH
Sbjct  122  KGCPARKQVERSRADPTVLLVTYTFEHNH  150



>gb|AAU10752.1| putative WRKY transcription factor [Oryza sativa Japonica Group]
Length=225

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 6/85 (7%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R   QKVVV++K        +  +GPP+DSWSWRKYGQKPIKGSPHPRGYY+CSS +GC 
Sbjct  64   RQDVQKVVVSLK------DHKVEQGPPADSWSWRKYGQKPIKGSPHPRGYYKCSSYRGCP  117

Query  459  AKKQVERSRTDASVLIITYTSTHNH  533
            A+KQV++ R DAS+LIITYTS HNH
Sbjct  118  ARKQVDKCRNDASLLIITYTSDHNH  142



>gb|KHN06418.1| Putative WRKY transcription factor 65 [Glycine soja]
Length=250

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV + + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  56   RRAIQKRVVQIPMKETEGCRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  115

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERS  D ++L++TY+S HNHP
Sbjct  116  CPARKQVERSCVDPTMLVVTYSSDHNHP  143



>gb|KHN48014.1| Putative WRKY transcription factor 65 [Glycine soja]
Length=261

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 2/88 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV + + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  56   RRAIQKRVVQIPMKETEGCRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  115

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERS  D ++L++TY+S HNHP
Sbjct  116  CPARKQVERSCVDPTMLVVTYSSDHNHP  143



>ref|XP_006304099.1| hypothetical protein CARUB_v10010013mg [Capsella rubella]
 gb|EOA36997.1| hypothetical protein CARUB_v10010013mg [Capsella rubella]
Length=269

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R    K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  46   SRRSVDKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  105

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  106  CPARKQVERSRDDPTMILITYTSEHNHP  133



>gb|KHG04202.1| putative WRKY transcription factor 65 -like protein [Gossypium 
arboreum]
Length=275

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            + R   QK VV+V + + +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  50   KGRRSIQKRVVSVPIKDVEGSRFKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  109

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERS  D  +L+ITY+  HNHP
Sbjct  110  GCPARKQVERSHVDPKMLVITYSCEHNHP  138



>emb|CDY50779.1| BnaA09g54080D [Brassica napus]
Length=262

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 1/83 (1%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSAKK  467
            +K VV + + E +G + K +  PPSDSWSWRKYGQKPIKGSP+PRGYYRCSS+KGC A+K
Sbjct  47   EKRVVNIPMKEIEGSRHKGDTTPPSDSWSWRKYGQKPIKGSPYPRGYYRCSSTKGCPARK  106

Query  468  QVERSRTDASVLIITYTSTHNHP  536
            QVERSR D ++++ITYTS HNHP
Sbjct  107  QVERSRDDPTMILITYTSEHNHP  129



>ref|XP_002458491.1| hypothetical protein SORBIDRAFT_03g034670 [Sorghum bicolor]
 gb|EES03611.1| hypothetical protein SORBIDRAFT_03g034670 [Sorghum bicolor]
Length=310

 Score =   124 bits (310),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 3/89 (3%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG---PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSS  446
            +R   +K VV+V L E   R R + G   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSS
Sbjct  67   SRRSVEKRVVSVPLAECGDRPRGATGEGPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSS  126

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNH  533
            KGC A+KQVERSR D +VL++TYT  HNH
Sbjct  127  KGCPARKQVERSRADPTVLLVTYTFDHNH  155



>ref|XP_007211770.1| hypothetical protein PRUPE_ppa009647mg [Prunus persica]
 gb|EMJ12969.1| hypothetical protein PRUPE_ppa009647mg [Prunus persica]
Length=283

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            AR   QK VV++ + +GD        PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  63   ARRAIQKRVVSIPI-KGDNSNTP---PPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  118

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D S+L+ITY+S HNHP
Sbjct  119  PARKQVERSRVDPSMLVITYSSEHNHP  145



>gb|AGV75938.1| WRKY transcription factor 30 [Gossypium hirsutum]
Length=277

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            + R   QK VV+V + + +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  50   KGRRSIQKRVVSVPIKDVEGSRFKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  109

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERS  D  +L+ITY+  HNHP
Sbjct  110  GCPARKQVERSHVDPKMLVITYSCEHNHP  138



>gb|AGV75947.1| WRKY transcription factor 43 [Gossypium hirsutum]
 gb|AIE43849.1| WRKY transcription factor 85 [Gossypium hirsutum]
Length=276

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            + R   QK VV+V + + D  + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  52   KGRKPIQKRVVSVPIKDVDSSRLKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  111

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D  +L++TY+  HNHP
Sbjct  112  GCPARKQVERSRVDPKMLVVTYSYEHNHP  140



>gb|ACV92010.1| WRKY transcription factor 8 [(Populus tomentosa x Populus bolleana) 
x Populus tomentosa]
Length=268

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++   QK VVT  + + +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   SKKAMQKRVVTAPIKDLEGSRLKGENASPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERS+ D  +L+ITY+  HNHP
Sbjct  105  GCPARKQVERSKVDPRMLVITYSCEHNHP  133



>ref|XP_010686241.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=304

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VVT  + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  48   RRAIQKKVVTFPIKEIEGSRFKGDCTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  107

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR+D + L++TY+  HNHP
Sbjct  108  PARKQVERSRSDPNTLVVTYSYEHNHP  134



>gb|AIY62469.1| WRKY43 [Gossypium aridum]
Length=275

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 1/85 (1%)
 Frame = +3

Query  285  MAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSA  461
            + QK VV+V + + D  + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC A
Sbjct  55   LIQKRVVSVPIKDVDSSRLKGESAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCPA  114

Query  462  KKQVERSRTDASVLIITYTSTHNHP  536
            +KQVERSR D  +L++TY+  HNHP
Sbjct  115  RKQVERSRVDPKMLVVTYSYEHNHP  139



>ref|XP_010460704.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Camelina 
sativa]
Length=264

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  46   SRRSVEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  105

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERS+ D ++++ITYTS HNHP
Sbjct  106  CPARKQVERSKDDPTMILITYTSEHNHP  133



>ref|XP_008225223.1| PREDICTED: probable WRKY transcription factor 65 [Prunus mume]
Length=284

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 4/87 (5%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            AR   QK VV++ + +GD        PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  65   ARRAIQKRVVSIPI-KGDNSNTP---PPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  120

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D S+L+ITY+S HNHP
Sbjct  121  PARKQVERSRVDPSMLVITYSSEHNHP  147



>emb|CDX99806.1| BnaC05g22280D [Brassica napus]
Length=261

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV + + + +G + K +  PPSDSWSWRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  42   SRRSIEKRVVNIPMKDIEGSRHKGDTTPPSDSWSWRKYGQKPIKGSPYPRGYYRCSSTKG  101

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  102  CPARKQVERSRDDPTMILITYTSEHNHP  129



>ref|XP_010524074.1| PREDICTED: probable WRKY transcription factor 69 [Tarenaya hassleriana]
Length=265

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  64   RRNMKKRVVSVPVADVEGSKSRGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  123

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D + ++ITY S HNHP
Sbjct  124  PARKQVERSRVDPTKIVITYASDHNHP  150



>gb|EAY75827.1| hypothetical protein OsI_03741 [Oryza sativa Indica Group]
 gb|ABO34049.1| defense-responsive protein WRKY13 [Oryza sativa Indica Group]
Length=316

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGE-GDGRKRKSEGPP-SDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E GD  K   EGPP SDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  68   SRRSVEKRVVSVPIAECGDRPKGAGEGPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  127

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D +VL++TY+  HNHP
Sbjct  128  GCPARKQVERSRADPTVLLVTYSFEHNHP  156



>ref|XP_006830221.1| hypothetical protein AMTR_s00130p00044000 [Amborella trichopoda]
 gb|ERM97637.1| hypothetical protein AMTR_s00130p00044000 [Amborella trichopoda]
Length=281

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 4/89 (4%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGD--GRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            R + +K V++V +G GD  G + + EG PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  59   RRVVEKRVISVPIG-GDLEGSRPRGEGAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  117

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S+L++TY   HNHP
Sbjct  118  GCPARKQVERSRVDPSMLVVTYACEHNHP  146



>dbj|BAB56055.1| WRKY transcription factor-like [Oryza sativa Japonica Group]
 tpg|DAA05078.1| TPA_inf: WRKY transcription factor 13 [Oryza sativa (japonica 
cultivar-group)]
 gb|AAW63711.1| WRKY13 [Oryza sativa Japonica Group]
 dbj|BAG90371.1| unnamed protein product [Oryza sativa Japonica Group]
Length=316

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGE-GDGRKRKSEGPP-SDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E GD  K   EGPP SDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  68   SRRSVEKRVVSVPIAECGDRPKGAGEGPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  127

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D +VL++TY+  HNHP
Sbjct  128  GCPARKQVERSRADPTVLLVTYSFEHNHP  156



>ref|XP_006304098.1| hypothetical protein CARUB_v10010013mg [Capsella rubella]
 gb|EOA36996.1| hypothetical protein CARUB_v10010013mg [Capsella rubella]
Length=268

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R    K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KGC
Sbjct  46   RRSVDKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKGC  105

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D ++++ITYTS HNHP
Sbjct  106  PARKQVERSRDDPTMILITYTSEHNHP  132



>gb|EAZ13545.1| hypothetical protein OsJ_03461 [Oryza sativa Japonica Group]
Length=316

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGE-GDGRKRKSEGPP-SDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E GD  K   EGPP SDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  68   SRRSVEKRVVSVPIAECGDRPKGAGEGPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  127

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D +VL++TY+  HNHP
Sbjct  128  GCPARKQVERSRADPTVLLVTYSFEHNHP  156



>ref|XP_010460705.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Camelina 
sativa]
Length=263

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KGC
Sbjct  46   RRSVEKRVVNVPMKEMEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKGC  105

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERS+ D ++++ITYTS HNHP
Sbjct  106  PARKQVERSKDDPTMILITYTSEHNHP  132



>ref|XP_002876476.1| WRKY DNA-binding protein 69 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52735.1| WRKY DNA-binding protein 69 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  40   KSRRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  99

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  100  GCPARKQVERSRVDPSKLMITYACDHNHP  128



>ref|NP_851020.1| WRKY DNA-binding protein 69 [Arabidopsis thaliana]
 gb|AAM60832.1| DNA-binding WRKY-like protein [Arabidopsis thaliana]
 gb|ABK59699.1| At3g58710 [Arabidopsis thaliana]
 gb|AEE79820.1| WRKY DNA-binding protein 69 [Arabidopsis thaliana]
Length=272

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  41   KSRRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  100

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  101  GCPARKQVERSRVDPSKLMITYACDHNHP  129



>ref|XP_010686240.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=305

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   QK VVT  + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  48   SRRAIQKKVVTFPIKEIEGSRFKGDCTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  107

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR+D + L++TY+  HNHP
Sbjct  108  CPARKQVERSRSDPNTLVVTYSYEHNHP  135



>gb|AHC54615.1| WRKY10 [Chrysanthemum x morifolium]
Length=287

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSE--GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   QK VV+V + E +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   SRRSKQKRVVSVPITEIEGYRHKGETNAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNH  533
            GC A+KQVERSR D +++I+TY+  HNH
Sbjct  105  GCPARKQVERSRADPTMVIVTYSCDHNH  132



>ref|XP_010315625.1| PREDICTED: probable WRKY transcription factor 14 [Solanum lycopersicum]
Length=381

 Score =   124 bits (311),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S A+KVV        + R+   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  149  KSQAKKVVCIPAAAPANSRQ-GGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  207

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRTD ++L+ITYTS HNHP
Sbjct  208  ARKQVERSRTDPNMLVITYTSEHNHP  233



>ref|XP_006415592.1| hypothetical protein EUTSA_v10008510mg [Eutrema salsugineum]
 gb|ESQ33945.1| hypothetical protein EUTSA_v10008510mg [Eutrema salsugineum]
Length=262

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  42   SRRSIEKRVVNVPMKEMEGTRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  101

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYT  HNHP
Sbjct  102  CPARKQVERSRDDPTMILITYTCDHNHP  129



>ref|XP_006291660.1| hypothetical protein CARUB_v10017819mg [Capsella rubella]
 gb|EOA24558.1| hypothetical protein CARUB_v10017819mg [Capsella rubella]
Length=274

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  42   KSRRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  101

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  102  GCPARKQVERSRVDPSKLMITYACDHNHP  130



>ref|XP_010504830.1| PREDICTED: probable WRKY transcription factor 69 isoform X1 [Camelina 
sativa]
Length=278

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  41   KSRRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  100

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  101  GCPARKQVERSRVDPSKLMITYACDHNHP  129



>ref|XP_003569817.1| PREDICTED: probable WRKY transcription factor 65 [Brachypodium 
distachyon]
Length=300

 Score =   122 bits (307),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGE-GDGRKRKSEGPPS-DSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E GD  +   EGPP  DSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  55   SRRSVEKRVVSVPIAECGDRARANGEGPPPPDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  114

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSRTD +VL++TY+  HNHP
Sbjct  115  GCPARKQVERSRTDPTVLLVTYSFDHNHP  143



>ref|XP_009416100.1| PREDICTED: probable WRKY transcription factor 35 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   124 bits (311),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV V        +  SE  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  167  IKRRKSQAKKVVCVPAPVAASSRPSSEAVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  226

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  227  GCSARKQVERSRTDPNILVITYTSEHNHP  255



>ref|XP_010427779.1| PREDICTED: probable WRKY transcription factor 69 [Camelina sativa]
Length=277

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  41   KSRRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  100

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  101  GCPARKQVERSRVDPSKLMITYACDHNHP  129



>ref|XP_010478290.1| PREDICTED: probable WRKY transcription factor 65 [Camelina sativa]
Length=265

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            +R   +K VV V +   +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KG
Sbjct  46   SRRSVEKRVVNVPMKALEGSRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKG  105

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++++ITYTS HNHP
Sbjct  106  CPARKQVERSRDDPTMILITYTSEHNHP  133



>ref|XP_010516529.1| PREDICTED: probable WRKY transcription factor 69 isoform X1 [Camelina 
sativa]
Length=276

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  41   KSRRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  100

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  101  GCPARKQVERSRVDPSKLMITYACDHNHP  129



>emb|CDX71933.1| BnaC08g29410D [Brassica napus]
Length=199

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  39   KSRRNMEKRVVSVPIVDVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  98

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  99   GCPARKQVERSRVDPSKLMITYACDHNHP  127



>ref|XP_006359101.1| PREDICTED: probable WRKY transcription factor 14-like [Solanum 
tuberosum]
Length=413

 Score =   124 bits (311),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S A+KVV        + R+   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  173  KSQAKKVVCIPAAAPANSRQ-GGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  231

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRTD ++L+ITYTS HNHP
Sbjct  232  ARKQVERSRTDPNMLVITYTSEHNHP  257



>ref|XP_010999781.1| PREDICTED: probable WRKY transcription factor 65 [Populus euphratica]
Length=262

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++   QK +V+V + + +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   SKKAMQKRIVSVPIKDLEGPRLKGENASPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERS+ D ++L++TY+  HNHP
Sbjct  105  GCPARKQVERSKLDPTMLVVTYSCEHNHP  133



>ref|XP_006402757.1| hypothetical protein EUTSA_v10006157mg [Eutrema salsugineum]
 gb|ESQ44210.1| hypothetical protein EUTSA_v10006157mg [Eutrema salsugineum]
Length=274

 Score =   122 bits (305),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  40   KSRRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  99

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  100  GCPARKQVERSRVDPSKLMITYACDHNHP  128



>ref|XP_009116551.1| PREDICTED: probable WRKY transcription factor 69 isoform X1 [Brassica 
rapa]
 emb|CDY49246.1| BnaA09g55250D [Brassica napus]
Length=271

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  39   KSRRNMEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  98

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  99   GCPARKQVERSRVDPSKLMITYACDHNHP  127



>ref|NP_567073.2| WRKY DNA-binding protein 69 [Arabidopsis thaliana]
 sp|Q93WV5.1|WRK69_ARATH RecName: Full=Probable WRKY transcription factor 69; AltName: 
Full=WRKY DNA-binding protein 69 [Arabidopsis thaliana]
 gb|AAL13045.1|AF421156_1 WRKY transcription factor 69 [Arabidopsis thaliana]
 gb|AEE79821.1| WRKY DNA-binding protein 69 [Arabidopsis thaliana]
Length=271

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  42   RRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  101

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D S L+ITY   HNHP
Sbjct  102  PARKQVERSRVDPSKLMITYACDHNHP  128



>ref|XP_009416099.1| PREDICTED: probable WRKY transcription factor 35 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=389

 Score =   124 bits (310),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I  +S A+KVV          R   SE  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  173  IHKKSQAKKVVCVPAPVAASSRP-SSEAVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  231

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  232  GCSARKQVERSRTDPNILVITYTSEHNHP  260



>ref|XP_002305730.1| hypothetical protein POPTR_0004s05920g [Populus trichocarpa]
 gb|EEE86241.1| hypothetical protein POPTR_0004s05920g [Populus trichocarpa]
Length=262

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++   QK +V+V + + +G + K E   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   SKKAMQKRIVSVPIKDLEGPRLKGENASPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERS+ D ++L++TY+  HNHP
Sbjct  105  GCPARKQVERSKLDPTMLVVTYSCEHNHP  133



>ref|XP_006415591.1| hypothetical protein EUTSA_v10008510mg [Eutrema salsugineum]
 gb|ESQ33944.1| hypothetical protein EUTSA_v10008510mg [Eutrema salsugineum]
Length=261

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV V + E +G + K +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSS+KGC
Sbjct  42   RRSIEKRVVNVPMKEMEGTRHKGDTTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSTKGC  101

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D ++++ITYT  HNHP
Sbjct  102  PARKQVERSRDDPTMILITYTCDHNHP  128



>ref|XP_010504831.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Camelina 
sativa]
Length=277

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  42   RRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  101

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D S L+ITY   HNHP
Sbjct  102  PARKQVERSRVDPSKLMITYACDHNHP  128



>ref|XP_006410636.1| hypothetical protein EUTSA_v10016714mg [Eutrema salsugineum]
 gb|ESQ52089.1| hypothetical protein EUTSA_v10016714mg [Eutrema salsugineum]
Length=421

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  183  IKRRKSQTKKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  242

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++LIITYTS HNHP
Sbjct  243  GCSARKQVERSRTDPNMLIITYTSEHNHP  271



>gb|AGA37248.1| WRKY transcription factor 69.1 [Brassica napus]
Length=279

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  40   KSRRNMEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  99

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  100  GCPARKQVERSRVDPSKLMITYACEHNHP  128



>ref|NP_001267628.1| probable WRKY transcription factor 69-like [Cucumis sativus]
 gb|ADU52525.1| WRKY protein [Cucumis sativus]
 gb|KGN43635.1| hypothetical protein Csa_7G049170 [Cucumis sativus]
Length=298

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   QK VV+V + + +G K K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   KSRRGVQKRVVSVPITDVEGSKSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNH  533
            GC A+KQVERSR D + L+ITY   HNH
Sbjct  105  GCPARKQVERSRVDPTKLVITYAFDHNH  132



>ref|XP_009138938.1| PREDICTED: probable WRKY transcription factor 69 isoform X1 [Brassica 
rapa]
 emb|CDX89000.1| BnaA04g01860D [Brassica napus]
Length=279

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  40   KSRRNMEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  99

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  100  GCPARKQVERSRVDPSKLMITYACEHNHP  128



>gb|AGA37249.1| WRKY transcription factor 69.2 [Brassica napus]
 emb|CDY00583.1| BnaC04g23420D [Brassica napus]
Length=279

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  40   KSRRNMEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  99

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D S L+ITY   HNHP
Sbjct  100  GCPARKQVERSRVDPSKLMITYACEHNHP  128



>gb|AET04288.2| WRKY family transcription factor [Medicago truncatula]
Length=245

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV + + E  G + K E   PPSDSW+WRKYGQKPIKGSP+PR YYRCSS KG
Sbjct  48   RRAIQKRVVQIPIKEPHGSRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRAYYRCSSCKG  107

Query  453  CSAKKQVERSRTDASVLIITYTSTHNH  533
            C A+KQVERSR D ++LIITY+S HNH
Sbjct  108  CPARKQVERSRVDPTMLIITYSSDHNH  134



>gb|EAY96413.1| hypothetical protein OsI_18309 [Oryza sativa Indica Group]
Length=292

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 6/85 (7%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R   QKVVV++K        +  +GPP+DSWSWRKYGQKPIKGSPHPRGYY+CSS +GC 
Sbjct  131  RQDVQKVVVSLK------DHKVEQGPPADSWSWRKYGQKPIKGSPHPRGYYKCSSYRGCP  184

Query  459  AKKQVERSRTDASVLIITYTSTHNH  533
            A+KQV++ R DAS+LIITYTS HNH
Sbjct  185  ARKQVDKCRNDASLLIITYTSDHNH  209



>ref|XP_008455292.1| PREDICTED: probable WRKY transcription factor 69 isoform X1 [Cucumis 
melo]
 ref|XP_008455293.1| PREDICTED: probable WRKY transcription factor 69 isoform X1 [Cucumis 
melo]
Length=297

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   QK VV+V + + +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  45   KSRRGVQKRVVSVPIADVEGSRSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  104

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNH  533
            GC A+KQVERSR D + L+ITY   HNH
Sbjct  105  GCPARKQVERSRVDPTKLVITYAFDHNH  132



>ref|XP_010516530.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Camelina 
sativa]
Length=275

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  42   RRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  101

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D S L+ITY   HNHP
Sbjct  102  PARKQVERSRVDPSKLMITYACDHNHP  128



>gb|AEQ29018.1| WRKY5 [Panax quinquefolius]
Length=219

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 67/86 (78%), Gaps = 6/86 (7%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            +R ++ K VVTV + +GD        PP+DSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  40   SRRISGKRVVTVAIADGDVY------PPADSWAWRKYGQKPIKGSPNPRGYYRCSSSKGC  93

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D +V++ITY   HNH
Sbjct  94   PARKQVERSRKDPTVVVITYACEHNH  119



>gb|ACI14405.1| WRKY69-1 transcription factor [Brassica napus]
Length=269

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  40   RRNMEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  99

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D S L+ITY   HNHP
Sbjct  100  PARKQVERSRVDPSKLMITYACDHNHP  126



>ref|XP_004173464.1| PREDICTED: probable WRKY transcription factor 69-like, partial 
[Cucumis sativus]
Length=252

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VV+V + + +G K K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  1    RRGVQKRVVSVPITDVEGSKSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  60

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + L+ITY   HNH
Sbjct  61   PARKQVERSRVDPTKLVITYAFDHNH  86



>gb|KFK35097.1| hypothetical protein AALP_AA5G235000 [Arabis alpina]
Length=272

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  39   KSRRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  98

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D + L+ITY   HNHP
Sbjct  99   GCPARKQVERSRVDPTKLMITYACDHNHP  127



>ref|XP_009116552.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Brassica 
rapa]
Length=270

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  40   RRNMEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  99

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D S L+ITY   HNHP
Sbjct  100  PARKQVERSRVDPSKLMITYACDHNHP  126



>gb|ADL62871.1| WRKY transcription factor [Malus hupehensis]
Length=269

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 4/87 (5%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            AR   QK VV+V +      +  +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  58   ARRAIQKRVVSVPIK----NENSNTPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  113

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D ++L+ITY++ HNHP
Sbjct  114  PARKQVERSRVDPTMLVITYSAEHNHP  140



>ref|NP_001280782.1| probable WRKY transcription factor 65 [Malus domestica]
 gb|ADL36857.1| WRKY domain class transcription factor [Malus domestica]
Length=266

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 4/87 (5%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            AR   QK VV+V +      +  +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  58   ARRAIQKRVVSVPIK----NENSNTPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  113

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D ++L+ITY++ HNHP
Sbjct  114  PARKQVERSRVDPTMLVITYSAEHNHP  140



>ref|XP_003629812.1| WRKY transcription factor [Medicago truncatula]
 gb|KEH20681.1| WRKY family transcription factor [Medicago truncatula]
Length=244

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 66/87 (76%), Gaps = 2/87 (2%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
            R   QK VV + + E  G + K E   PPSDSW+WRKYGQKPIKGSP+PR YYRCSS KG
Sbjct  47   RRAIQKRVVQIPIKEPHGSRLKGESNTPPSDSWAWRKYGQKPIKGSPYPRAYYRCSSCKG  106

Query  453  CSAKKQVERSRTDASVLIITYTSTHNH  533
            C A+KQVERSR D ++LIITY+S HNH
Sbjct  107  CPARKQVERSRVDPTMLIITYSSDHNH  133



>ref|XP_009138939.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Brassica 
rapa]
Length=278

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  41   RRNMEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  100

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D S L+ITY   HNHP
Sbjct  101  PARKQVERSRVDPSKLMITYACEHNHP  127



>ref|XP_008455294.1| PREDICTED: probable WRKY transcription factor 69 isoform X2 [Cucumis 
melo]
Length=296

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   QK VV+V + + +G + K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  46   RRGVQKRVVSVPIADVEGSRSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  105

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + L+ITY   HNH
Sbjct  106  PARKQVERSRVDPTKLVITYAFDHNH  131



>gb|EEC78451.1| hypothetical protein OsI_18313 [Oryza sativa Indica Group]
Length=179

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 66/85 (78%), Gaps = 6/85 (7%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            R   QKVVV++K        +  +GPP+DSWSWRKYGQKPIKGSPH RGYY+CSS +GC 
Sbjct  18   RQDVQKVVVSLK------DHKVEQGPPADSWSWRKYGQKPIKGSPHLRGYYKCSSYRGCP  71

Query  459  AKKQVERSRTDASVLIITYTSTHNH  533
            A+KQV++ R DAS+LIITYTS HNH
Sbjct  72   ARKQVDKCRNDASLLIITYTSDHNH  96



>ref|XP_004135749.1| PREDICTED: probable WRKY transcription factor 14-like [Cucumis 
sativus]
Length=332

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S  +KVV        + R    E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  170  KSQVKKVVCIPAPAPANSRSSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  229

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRT+ ++L+ITYTS HNHP
Sbjct  230  ARKQVERSRTNPNMLVITYTSEHNHP  255



>ref|XP_009415176.1| PREDICTED: probable WRKY transcription factor 65 [Musa acuminata 
subsp. malaccensis]
Length=264

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 4/91 (4%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG----PPSDSWSWRKYGQKPIKGSPHPRGYYRCSS  443
            +R   QK VV++ +G+ +G   ++ G    PPSDSW+WRKYGQKPIKGSPHPRGYYRCSS
Sbjct  34   SRRSIQKRVVSIPIGDAEGVGSRNGGGEAFPPSDSWAWRKYGQKPIKGSPHPRGYYRCSS  93

Query  444  SKGCSAKKQVERSRTDASVLIITYTSTHNHP  536
             KGC A+KQVERSR D + L+++Y+  HNHP
Sbjct  94   WKGCPARKQVERSRLDPATLVVSYSFEHNHP  124



>gb|KFK35096.1| hypothetical protein AALP_AA5G235000 [Arabis alpina]
Length=271

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + + +G K + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  40   RRNVEKRVVSVPIADVEGSKSRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  99

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D + L+ITY   HNHP
Sbjct  100  PARKQVERSRVDPTKLMITYACDHNHP  126



>gb|AFS64071.1| WRKY transcription factor 6 [Tamarix hispida]
Length=354

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG--PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
             R   QK VVTV + + +G + K +   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  59   GRRAIQKRVVTVPIKDVEGSRLKGDSITPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  118

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR   S L+ITY+  HNHP
Sbjct  119  GCPARKQVERSRASPSTLVITYSYEHNHP  147



>gb|KCW47365.1| hypothetical protein EUGRSUZ_K01151 [Eucalyptus grandis]
Length=277

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            +S+ ++VV     G+ +G K K E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  46   KSVKKRVVSVPIAGDPEGSKSKGEAYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  105

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + L++TY+S HNH
Sbjct  106  PARKQVERSRLDPTTLLVTYSSDHNH  131



>ref|XP_010665626.1| PREDICTED: probable WRKY transcription factor 14 [Beta vulgaris 
subsp. vulgaris]
Length=452

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R +  K VV +        ++  E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  215  IKRRKIQAKKVVCIPAPAVANSRQTGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  274

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  275  GCSARKQVERSRTDPNMLVITYTSEHNHP  303



>gb|AGQ04240.1| WRKY transcription factor 49 [Jatropha curcas]
 gb|KDP34851.1| hypothetical protein JCGZ_09139 [Jatropha curcas]
Length=339

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S A+KVV        + R    E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  83   KSQAKKVVCIPAPAAANSRP-SGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  141

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRTD ++L+ITYTS HNHP
Sbjct  142  ARKQVERSRTDPNMLVITYTSEHNHP  167



>ref|XP_004486508.1| PREDICTED: probable WRKY transcription factor 14-like [Cicer 
arietinum]
Length=485

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +3

Query  261  VNFIEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCS  440
             N    ++ A+KVV        + R+   E  PSD W+WRKYGQKPIKGSP+PRGYYRCS
Sbjct  231  TNLKRRKNQAKKVVCIPAPAAANSRQ-TGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCS  289

Query  441  SSKGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            SSKGCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  290  SSKGCSARKQVERSRTDPNMLVITYTSEHNHP  321



>ref|XP_008465657.1| PREDICTED: probable WRKY transcription factor 14 isoform X1 [Cucumis 
melo]
Length=413

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S  +KVV        + R    E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  176  KSQVKKVVCIPAPAPANSRSSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  235

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRT+ ++L+ITYTS HNHP
Sbjct  236  ARKQVERSRTNPNMLVITYTSEHNHP  261



>tpg|DAA57660.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea 
mays]
Length=261

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 3/89 (3%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG---PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSS  446
            +R   +K VV+V L E   R R + G   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSS
Sbjct  13   SRRSVEKRVVSVPLAECGDRPRGASGEGPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSS  72

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNH  533
            KGC A+KQVERS  D + L++TYT  HNH
Sbjct  73   KGCPARKQVERSHADPTALLVTYTFEHNH  101



>ref|XP_007025322.1| WRKY DNA-binding protein 65, putative [Theobroma cacao]
 gb|EOY27944.1| WRKY DNA-binding protein 65, putative [Theobroma cacao]
Length=286

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 71/97 (73%), Gaps = 9/97 (9%)
 Frame = +3

Query  273  EARSMAQKVVVTVKLGEGDGRKRKSE-GPPSDSWSWRKYGQKPIKGSPHPR--------G  425
            + R   QK VV+V + + +G + K E  PPSDSW+WRKYGQKPIKGSP+PR        G
Sbjct  48   KGRRSIQKRVVSVPIKDVEGSRLKGESAPPSDSWAWRKYGQKPIKGSPYPRFLFSSYDRG  107

Query  426  YYRCSSSKGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            YYRCSSSKGC A+KQVERSR D S+L+ITY+  HNHP
Sbjct  108  YYRCSSSKGCPARKQVERSRMDPSMLVITYSCEHNHP  144



>ref|NP_181029.1| putative WRKY transcription factor 35 [Arabidopsis thaliana]
 sp|O64747.1|WRK35_ARATH RecName: Full=Probable WRKY transcription factor 35; AltName: 
Full=WRKY DNA-binding protein 35 [Arabidopsis thaliana]
 gb|AAK96201.1|AF404863_1 WRKY transcription factor 35 [Arabidopsis thaliana]
 gb|AAC12823.1| putative WRKY-type DNA binding protein [Arabidopsis thaliana]
 gb|ABJ98571.1| At2g34830 [Arabidopsis thaliana]
 gb|AEC09027.1| putative WRKY transcription factor 35 [Arabidopsis thaliana]
Length=427

 Score =   123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  185  IKRRKSQAKKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  244

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  245  GCSARKQVERSRTDPNMLVITYTSEHNHP  273



>ref|XP_004295586.1| PREDICTED: probable WRKY transcription factor 65-like [Fragaria 
vesca subsp. vesca]
Length=266

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 4/87 (5%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            +R   QK VV++ + E       +  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  46   SRRAIQKRVVSIPIKENS----NTNTPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  101

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D ++L++TY+S HNHP
Sbjct  102  PARKQVERSRADPTMLMVTYSSEHNHP  128



>ref|XP_004158081.1| PREDICTED: probable WRKY transcription factor 14-like [Cucumis 
sativus]
Length=406

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S  +KVV        + R    E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  170  KSQVKKVVCIPAPAPANSRSSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  229

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRT+ ++L+ITYTS HNHP
Sbjct  230  ARKQVERSRTNPNMLVITYTSEHNHP  255



>dbj|BAJ98846.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=308

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGE-GDGRKRKSEGPPS-DSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E G+  K   EGPP  DSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  76   SRRSVEKRVVSVPIAECGERAKTNGEGPPPPDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  135

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSRTD +VL++TY+  HNHP
Sbjct  136  GCPARKQVERSRTDPTVLLVTYSYDHNHP  164



>ref|XP_010519038.1| PREDICTED: probable WRKY transcription factor 14 [Tarenaya hassleriana]
Length=468

 Score =   123 bits (309),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S A+KVV        + R    E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  220  KSQAKKVVCIPAPAAANSRS-SGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  278

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRTD ++L+ITYTS HNHP
Sbjct  279  ARKQVERSRTDPNMLVITYTSEHNHP  304



>gb|KGN65962.1| hypothetical protein Csa_1G547510 [Cucumis sativus]
Length=413

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S  +KVV        + R    E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  177  KSQVKKVVCIPAPAPANSRSSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  236

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRT+ ++L+ITYTS HNHP
Sbjct  237  ARKQVERSRTNPNMLVITYTSEHNHP  262



>gb|KEH37125.1| WRKY family transcription factor [Medicago truncatula]
Length=426

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++ R    K VV +        ++  E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  237  LKRRKNQAKKVVCIPAPAAANSRQTGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  296

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  297  GCSARKQVERSRTDPNMLVITYTSEHNHP  325



>ref|XP_007022995.1| WRKY DNA-binding protein 14, putative [Theobroma cacao]
 gb|EOY25617.1| WRKY DNA-binding protein 14, putative [Theobroma cacao]
Length=426

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
             +S A+KVV        + R    E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  189  GKSQAKKVVCIPAPAAANSRS-SGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  247

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
            SA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  248  SARKQVERSRTDPNMLVITYTSEHNHP  274



>tpg|DAA05131.1| TPA_inf: WRKY transcription factor 66 [Oryza sativa (indica cultivar-group)]
 gb|EEC73836.1| hypothetical protein OsI_08576 [Oryza sativa Indica Group]
Length=503

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  261  VNFIEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCS  440
            V  I+ R    + VV +      G +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCS
Sbjct  199  VGGIKRRKNQARKVVCIPAPAAAGGRTSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCS  258

Query  441  SSKGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            SSKGCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  259  SSKGCSARKQVERSRTDPNMLVITYTSEHNHP  290



>ref|XP_011085607.1| PREDICTED: probable WRKY transcription factor 14 [Sesamum indicum]
Length=371

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  113  IKRRKSQAKKVVCIPAPTPANSRASGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  172

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  173  GCSARKQVERSRTDPNMLVITYTSEHNHP  201



>ref|NP_001047827.1| Os02g0698800 [Oryza sativa Japonica Group]
 dbj|BAD07870.1| putative WRKY DNA-binding protein [Oryza sativa Japonica Group]
 dbj|BAF09741.1| Os02g0698800 [Oryza sativa Japonica Group]
Length=506

 Score =   124 bits (310),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  261  VNFIEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCS  440
            V  I+ R    + VV +      G +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCS
Sbjct  206  VGGIKRRKNQARKVVCIPAPAAAGGRTSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCS  265

Query  441  SSKGCSAKKQVERSRTDASVLIITYTSTHNHP  536
            SSKGCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  266  SSKGCSARKQVERSRTDPNMLVITYTSEHNHP  297



>ref|XP_011101421.1| PREDICTED: probable WRKY transcription factor 65 [Sesamum indicum]
Length=302

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 4/86 (5%)
 Frame = +3

Query  291  QKVVVTVKLGEGDGRKRKSE----GPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            QK VV+V + +  G + K E     PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC 
Sbjct  58   QKRVVSVPIKDVQGFRLKGEYHITAPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGCP  117

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERS+ D ++L++TY+  HNHP
Sbjct  118  ARKQVERSKLDPNMLVVTYSCEHNHP  143



>ref|XP_009622546.1| PREDICTED: probable WRKY transcription factor 14 [Nicotiana tomentosiformis]
Length=457

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S A+KVV        + R+   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  220  KSQAKKVVCIPAPAPANSRQ-GGEIVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  278

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRTD ++L+ITYTS HNHP
Sbjct  279  ARKQVERSRTDPNMLVITYTSEHNHP  304



>ref|NP_001053735.1| Os04g0597300 [Oryza sativa Japonica Group]
 dbj|BAF15649.1| Os04g0597300 [Oryza sativa Japonica Group]
Length=414

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    + VV +      G +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  133  IKRRKNQARKVVCIPAPTAAGGRPSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  192

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  193  GCSARKQVERSRTDPNMLVITYTSEHNHP  221



>gb|KEH37124.1| WRKY family transcription factor [Medicago truncatula]
Length=483

 Score =   123 bits (308),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++ R    K VV +        ++  E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  237  LKRRKNQAKKVVCIPAPAAANSRQTGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  296

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  297  GCSARKQVERSRTDPNMLVITYTSEHNHP  325



>ref|XP_010323673.1| PREDICTED: probable WRKY transcription factor 69 isoform X3 [Solanum 
lycopersicum]
Length=236

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +3

Query  285  MAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCSA  461
            M ++ +    L +GDG + K E  PP DSWSWRKYGQKPIKGSP+PRGYYRCSSSKGC A
Sbjct  10   MKRRKLACHHLEKGDGSRSKGEVYPPQDSWSWRKYGQKPIKGSPYPRGYYRCSSSKGCPA  69

Query  462  KKQVERSRTDASVLIITYTSTHNH  533
            +KQVERSR D ++L+ITY S HNH
Sbjct  70   RKQVERSRLDPTMLLITYCSEHNH  93



>ref|XP_006294231.1| hypothetical protein CARUB_v10023228mg [Capsella rubella]
 gb|EOA27129.1| hypothetical protein CARUB_v10023228mg [Capsella rubella]
Length=440

 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  198  IKRRKGQTKKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  257

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  258  GCSARKQVERSRTDPNMLVITYTSEHNHP  286



>ref|XP_010504968.1| PREDICTED: probable WRKY transcription factor 35 [Camelina sativa]
Length=433

 Score =   122 bits (307),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  193  IKRRKSQTKKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  252

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  253  GCSARKQVERSRTDPNMLVITYTSEHNHP  281



>ref|XP_009789029.1| PREDICTED: probable WRKY transcription factor 14 [Nicotiana sylvestris]
Length=460

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S A+KVV        + R+   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  222  KSQAKKVVCIPAPAPANSRQ-GGEIVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  280

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRTD ++L+ITYTS HNHP
Sbjct  281  ARKQVERSRTDPNMLVITYTSEHNHP  306



>ref|XP_010509700.1| PREDICTED: probable WRKY transcription factor 35 [Camelina sativa]
Length=437

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  194  IKRRKSQTKKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  253

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  254  GCSARKQVERSRTDPNMLVITYTSEHNHP  282



>ref|XP_009352729.1| PREDICTED: probable WRKY transcription factor 65 [Pyrus x bretschneideri]
Length=269

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 4/87 (5%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            AR   QK VV+V +      +  +  PPSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  58   ARRAIQKRVVSVPIK----NENSNTPPPSDPWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  113

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D ++L+ITY++ HNHP
Sbjct  114  PARKQVERSRVDPTMLVITYSAEHNHP  140



>emb|CDP12602.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGCS  458
            +S A+KVV        + R    E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSKGCS
Sbjct  191  KSQAKKVVCIPAPAPANSRP-SGEIVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCS  249

Query  459  AKKQVERSRTDASVLIITYTSTHNHP  536
            A+KQVERSRTD ++L+ITYTS HNHP
Sbjct  250  ARKQVERSRTDPNMLVITYTSEHNHP  275



>ref|XP_010036633.1| PREDICTED: probable WRKY transcription factor 14 isoform X2 [Eucalyptus 
grandis]
Length=440

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  182  IKRRKSQAKKVVCIPAPAAANSRAGGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  241

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  242  GCSARKQVERSRTDPNMLVITYTSEHNHP  270



>ref|XP_009351552.1| PREDICTED: probable WRKY transcription factor 65 [Pyrus x bretschneideri]
Length=279

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 2/86 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
             R   QK VV+V + +GD     S  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  58   GRRAIQKRVVSVPI-KGDN-SNSSTPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  115

Query  456  SAKKQVERSRTDASVLIITYTSTHNH  533
             A+KQVERSR D + L+ITY+S HNH
Sbjct  116  PARKQVERSRVDPTTLVITYSSEHNH  141



>ref|XP_008788702.1| PREDICTED: probable WRKY transcription factor 14 [Phoenix dactylifera]
Length=421

 Score =   122 bits (305),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  186  IKRRKSQAKKVVCIPAPAAASNRPSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  245

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  246  GCSARKQVERSRTDPNMLVITYTSEHNHP  274



>gb|AEO31477.1| WRKY transcription factor 14-1 [Dimocarpus longan]
Length=471

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  216  IKRRKSQAKKVVCIPAPAAANSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  275

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  276  GCSARKQVERSRTDPNMLVITYTSEHNHP  304



>ref|XP_010227247.1| PREDICTED: probable WRKY transcription factor 35 [Brachypodium 
distachyon]
Length=476

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    + VV +      G +   E  PSD W+WRKYGQKPIKGSPHPRGYYRCSSSK
Sbjct  186  IKRRKNQARKVVCIPAPTTAGSRPTGEVVPSDLWAWRKYGQKPIKGSPHPRGYYRCSSSK  245

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  246  GCSARKQVERSRTDPNMLVITYTSEHNHP  274



>gb|ABO15543.1| WRKY13 transcription factor [Triticum aestivum]
Length=281

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 2/89 (2%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGE-GDGRKRKSEGPPS-DSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            +R   +K VV+V + E G+  K   EGPP  DSW+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  49   SRRSVEKRVVSVPIAECGERAKTNGEGPPPPDSWAWRKYGQKPIKGSPYPRGYYRCSSSK  108

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GC A+KQVERSR D +VL++TY+  HNHP
Sbjct  109  GCPARKQVERSRADPTVLLVTYSYDHNHP  137



>gb|KDO77574.1| hypothetical protein CISIN_1g012605mg [Citrus sinensis]
Length=460

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  220  IKRRKSQAKKVVCIPAPAAANSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  279

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  280  GCSARKQVERSRTDPNMLVITYTSEHNHP  308



>ref|XP_010036632.1| PREDICTED: probable WRKY transcription factor 14 isoform X1 [Eucalyptus 
grandis]
 gb|KCW48244.1| hypothetical protein EUGRSUZ_K01971 [Eucalyptus grandis]
Length=450

 Score =   122 bits (306),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  192  IKRRKSQAKKVVCIPAPAAANSRAGGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  251

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  252  GCSARKQVERSRTDPNMLVITYTSEHNHP  280



>ref|XP_010525210.1| PREDICTED: probable WRKY transcription factor 69 [Tarenaya hassleriana]
Length=261

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  RSMAQKVVVTVKLGEGDGRKRKSEG-PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKGC  455
            R   +K VV+V + +  G   + E  PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSSKGC
Sbjct  41   RRSIEKRVVSVPIADVAGSGGRGEVYPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSSKGC  100

Query  456  SAKKQVERSRTDASVLIITYTSTHNHP  536
             A+KQVERSR D + L+ITY S HNHP
Sbjct  101  PARKQVERSRVDPTRLVITYASDHNHP  127



>gb|KFK36384.1| hypothetical protein AALP_AA4G116800 [Arabis alpina]
Length=415

 Score =   122 bits (305),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  190  IKRRKSQAKKVVCIPAPAAMNSRSSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  249

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  250  GCSARKQVERSRTDPNMLVITYTSEHNHP  278



>ref|XP_007147420.1| hypothetical protein PHAVU_006G123000g [Phaseolus vulgaris]
 gb|ESW19414.1| hypothetical protein PHAVU_006G123000g [Phaseolus vulgaris]
Length=495

 Score =   123 bits (308),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            ++ R    K VV +        ++  E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  234  LKRRKNQAKKVVCIPAPAAANSRQTGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  293

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  294  GCSARKQVERSRTDPNMLVITYTSEHNHP  322



>ref|XP_008675050.1| PREDICTED: probable WRKY transcription factor 65 [Zea mays]
 tpg|DAA57661.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05802.1| WRKY transcription factor, partial [Zea mays]
Length=306

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 67/89 (75%), Gaps = 3/89 (3%)
 Frame = +3

Query  276  ARSMAQKVVVTVKLGEGDGRKRKSEG---PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSS  446
            +R   +K VV+V L E   R R + G   PPSDSW+WRKYGQKPIKGSP+PRGYYRCSSS
Sbjct  58   SRRSVEKRVVSVPLAECGDRPRGASGEGPPPSDSWAWRKYGQKPIKGSPYPRGYYRCSSS  117

Query  447  KGCSAKKQVERSRTDASVLIITYTSTHNH  533
            KGC A+KQVERS  D + L++TYT  HNH
Sbjct  118  KGCPARKQVERSHADPTALLVTYTFEHNH  146



>ref|XP_010247841.1| PREDICTED: probable WRKY transcription factor 14 [Nelumbo nucifera]
Length=434

 Score =   122 bits (305),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = +3

Query  270  IEARSMAQKVVVTVKLGEGDGRKRKSEGPPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSK  449
            I+ R    K VV +        +   E  PSD W+WRKYGQKPIKGSP+PRGYYRCSSSK
Sbjct  188  IKRRKSQVKKVVCIPAPAAANSRPSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSK  247

Query  450  GCSAKKQVERSRTDASVLIITYTSTHNHP  536
            GCSA+KQVERSRTD ++L+ITYTS HNHP
Sbjct  248  GCSARKQVERSRTDPNMLVITYTSEHNHP  276



>ref|XP_008792328.1| PREDICTED: probable WRKY transcription factor 65 isoform X2 [Phoenix 
dactylifera]
Length=276

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = +3

Query  288  AQKVVVTVKL-GEGDGRKRKSEG----PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
             QK VV+V + G+G  R +   G    PP+DSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  49   VQKRVVSVPISGDGGSRPKGGAGGEGVPPTDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  108

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++L++TY+  HNHP
Sbjct  109  CPARKQVERSRVDPAMLVVTYSFDHNHP  136



>ref|XP_008792327.1| PREDICTED: probable WRKY transcription factor 65 isoform X1 [Phoenix 
dactylifera]
Length=277

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = +3

Query  288  AQKVVVTVKL-GEGDGRKRKSEG----PPSDSWSWRKYGQKPIKGSPHPRGYYRCSSSKG  452
             QK VV+V + G+G  R +   G    PP+DSW+WRKYGQKPIKGSP+PRGYYRCSSSKG
Sbjct  50   VQKRVVSVPISGDGGSRPKGGAGGEGVPPTDSWAWRKYGQKPIKGSPYPRGYYRCSSSKG  109

Query  453  CSAKKQVERSRTDASVLIITYTSTHNHP  536
            C A+KQVERSR D ++L++TY+  HNHP
Sbjct  110  CPARKQVERSRVDPAMLVVTYSFDHNHP  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4270971428024