BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26516_g1_i1 len=172 path=[1:0-171]

Length=172
                                                                      Score     E

ref|XP_007209371.1|  hypothetical protein PRUPE_ppa008806mg           65.9    4e-11   
ref|XP_008238665.1|  PREDICTED: putative DNA-binding protein ESCA...  65.5    4e-11   
ref|XP_009373349.1|  PREDICTED: putative DNA-binding protein ESCA...  64.7    9e-11   
ref|XP_008373878.1|  PREDICTED: putative DNA-binding protein ESCA...  64.3    1e-10   
ref|XP_006440435.1|  hypothetical protein CICLE_v10021222mg           62.4    6e-10   
ref|XP_004298707.1|  PREDICTED: uncharacterized protein LOC101304185  62.4    6e-10   
ref|XP_006477307.1|  PREDICTED: uncharacterized protein LOC102613375  62.4    6e-10   
emb|CDP09867.1|  unnamed protein product                              62.4    7e-10   
emb|CBI34816.3|  unnamed protein product                              60.1    2e-09   
ref|XP_002274756.1|  PREDICTED: uncharacterized protein LOC100244375  60.5    4e-09   Vitis vinifera
gb|KHG16255.1|  Putative DNA-binding ESCAROLA -like protein           60.5    4e-09   
gb|KHG15595.1|  Putative DNA-binding ESCAROLA -like protein           60.1    4e-09   
gb|KDP25582.1|  hypothetical protein JCGZ_20738                       60.1    4e-09   
emb|CAN62363.1|  hypothetical protein VITISV_031923                   60.5    5e-09   Vitis vinifera
ref|XP_008437162.1|  PREDICTED: uncharacterized protein LOC103482669  59.7    6e-09   
ref|XP_004515758.1|  PREDICTED: uncharacterized protein LOC101496521  59.7    6e-09   
ref|XP_007040013.1|  AT-hook motif nuclear-localized protein 1 is...  59.3    8e-09   
ref|XP_007040014.1|  AT-hook motif nuclear-localized protein 1 is...  59.3    9e-09   
gb|KHN04313.1|  Putative DNA-binding protein ESCAROLA                 58.2    1e-08   
ref|XP_004147567.1|  PREDICTED: uncharacterized protein LOC101210208  58.5    2e-08   
ref|XP_003525779.1|  PREDICTED: uncharacterized protein LOC100801730  58.5    2e-08   
ref|XP_007040012.1|  AT-hook motif nuclear-localized protein 1 is...  58.5    2e-08   
ref|XP_011069940.1|  PREDICTED: putative DNA-binding protein ESCA...  57.0    3e-08   
ref|XP_003608790.1|  hypothetical protein MTR_4g101990                57.4    4e-08   
gb|KHN09769.1|  Putative DNA-binding protein ESCAROLA                 56.2    6e-08   
ref|XP_003549892.1|  PREDICTED: uncharacterized protein LOC100794202  56.6    9e-08   
ref|XP_011081098.1|  PREDICTED: uncharacterized protein LOC105164...  55.8    2e-07   
ref|XP_011081097.1|  PREDICTED: uncharacterized protein LOC105164...  55.8    2e-07   
ref|XP_007155604.1|  hypothetical protein PHAVU_003G216000g           55.5    2e-07   
ref|XP_002509630.1|  DNA binding protein, putative                    53.5    1e-06   Ricinus communis
ref|XP_010055555.1|  PREDICTED: one cut domain family member 3-like   52.0    3e-06   
ref|XP_010108110.1|  hypothetical protein L484_023197                 51.6    4e-06   
ref|XP_011029366.1|  PREDICTED: formin-like protein 2                 49.7    9e-06   
ref|XP_009589307.1|  PREDICTED: uncharacterized protein LOC104086690  50.4    1e-05   
ref|XP_011029104.1|  PREDICTED: proline-rich receptor-like protei...  50.1    2e-05   
ref|XP_009776390.1|  PREDICTED: uncharacterized protein LOC104226174  49.7    2e-05   
gb|KHG30613.1|  Putative DNA-binding ESCAROLA -like protein           48.9    4e-05   
ref|XP_010276424.1|  PREDICTED: uncharacterized protein LOC104611170  48.9    4e-05   
ref|XP_008460610.1|  PREDICTED: putative DNA-binding protein ESCA...  48.9    4e-05   
ref|XP_008460609.1|  PREDICTED: putative DNA-binding protein ESCA...  48.9    4e-05   
ref|XP_006358365.1|  PREDICTED: uncharacterized protein LOC102578251  48.9    4e-05   
ref|XP_004244582.1|  PREDICTED: uncharacterized protein LOC101268706  48.5    6e-05   
gb|EPS57747.1|  hypothetical protein M569_17070                       46.2    6e-05   
ref|XP_009800836.1|  PREDICTED: uncharacterized protein LOC104246669  47.8    1e-04   
ref|XP_010676643.1|  PREDICTED: uncharacterized protein LOC104892414  47.8    1e-04   
ref|XP_010538767.1|  PREDICTED: uncharacterized protein LOC104813...  47.0    2e-04   
ref|XP_010538769.1|  PREDICTED: uncharacterized protein LOC104813...  47.0    2e-04   
ref|NP_001241091.1|  uncharacterized protein LOC100796830             45.4    7e-04   
ref|XP_006576228.1|  PREDICTED: uncharacterized protein LOC100793...  45.4    7e-04   
gb|KHM98884.1|  Putative DNA-binding protein ESCAROLA                 45.4    7e-04   
ref|NP_001240898.1|  uncharacterized protein LOC100793726             45.1    7e-04   
ref|XP_010277390.1|  PREDICTED: putative DNA-binding protein ESCA...  45.1    9e-04   



>ref|XP_007209371.1| hypothetical protein PRUPE_ppa008806mg [Prunus persica]
 gb|EMJ10570.1| hypothetical protein PRUPE_ppa008806mg [Prunus persica]
Length=318

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVRPARSPS  146
            RGRPRKYG DG VTMAL PK I S APPPVIDF A+KR KV+P  S S
Sbjct  64   RGRPRKYGPDGSVTMALSPKPISSSAPPPVIDFSAEKRGKVKPTSSVS  111



>ref|XP_008238665.1| PREDICTED: putative DNA-binding protein ESCAROLA [Prunus mume]
Length=318

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVRPARSPS  146
            RGRPRKYG DG VTMAL PK I S APPPVIDF A+KR KV+P  S S
Sbjct  64   RGRPRKYGPDGSVTMALSPKPISSSAPPPVIDFSAEKRGKVKPTSSVS  111



>ref|XP_009373349.1| PREDICTED: putative DNA-binding protein ESCAROLA [Pyrus x bretschneideri]
Length=319

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVRPARSPS  146
            RGRPRKYG DG VTMAL PK I S APPPVIDF A+KR KV+P  S S
Sbjct  65   RGRPRKYGPDGSVTMALSPKPISSSAPPPVIDFSAEKRGKVKPPSSGS  112



>ref|XP_008373878.1| PREDICTED: putative DNA-binding protein ESCAROLA [Malus domestica]
Length=319

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVRPARSPS  146
            RGRPRKYG DG VTMAL PK I S APPPVIDF A+KR KV+P  S S
Sbjct  65   RGRPRKYGPDGSVTMALSPKPISSSAPPPVIDFSAEKRGKVKPPSSVS  112



>ref|XP_006440435.1| hypothetical protein CICLE_v10021222mg [Citrus clementina]
 gb|ESR53675.1| hypothetical protein CICLE_v10021222mg [Citrus clementina]
 gb|KDO63726.1| hypothetical protein CISIN_1g020999mg [Citrus sinensis]
Length=318

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARS  140
            RGRPRKYG DG VTMAL PK I S AP PPVIDF A+K RKV+PA S
Sbjct  65   RGRPRKYGPDGTVTMALSPKPISSAAPSPPVIDFSAEKPRKVKPASS  111



>ref|XP_004298707.1| PREDICTED: uncharacterized protein LOC101304185 [Fragaria vesca 
subsp. vesca]
Length=322

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKK--RRKVRPARSPS  146
            RGRPRKYG DG VTMAL PK I S APPPVIDF A+K  R KV+PA S S
Sbjct  66   RGRPRKYGPDGSVTMALSPKPISSAAPPPVIDFSAEKQPRGKVKPASSVS  115



>ref|XP_006477307.1| PREDICTED: uncharacterized protein LOC102613375 [Citrus sinensis]
Length=318

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARS  140
            RGRPRKYG DG VTMAL PK I S AP PPVIDF A+K RKV+PA S
Sbjct  65   RGRPRKYGPDGTVTMALSPKPISSAAPSPPVIDFSAEKPRKVKPASS  111



>emb|CDP09867.1| unnamed protein product [Coffea canephora]
Length=327

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVT-MAL*PKLILSLAPPPVIDFFAKKRRKVRPARSPSLPAQPK  164
            RGRPRKYG DG VT MAL PK I S  PPPVIDF ++KR KVRPA S     QP+
Sbjct  71   RGRPRKYGPDGSVTSMALSPKPISSSVPPPVIDFSSEKRGKVRPAGSSGKHHQPR  125



>emb|CBI34816.3| unnamed protein product [Vitis vinifera]
Length=261

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKYG DG VTMAL PK I S AP PPVIDF  +KR K+RP  S S
Sbjct  8    RGRPRKYGPDGTVTMALSPKPISSSAPGPPVIDFSVEKRGKIRPVGSAS  56



>ref|XP_002274756.1| PREDICTED: uncharacterized protein LOC100244375 [Vitis vinifera]
Length=346

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKYG DG VTMAL PK I S AP PPVIDF  +KR K+RP  S S
Sbjct  77   RGRPRKYGPDGTVTMALSPKPISSSAPGPPVIDFSVEKRGKIRPVGSAS  125



>gb|KHG16255.1| Putative DNA-binding ESCAROLA -like protein [Gossypium arboreum]
Length=329

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL PK I + APPPVIDF A KR KV+
Sbjct  74   RGRPRKYGPDGSVTMALSPKPISTAAPPPVIDFSAAKRGKVK  115



>gb|KHG15595.1| Putative DNA-binding ESCAROLA -like protein [Gossypium arboreum]
Length=304

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL PK I + APPPVIDF A KR KV+
Sbjct  53   RGRPRKYGPDGSVTMALSPKPISTAAPPPVIDFSAGKRAKVK  94



>gb|KDP25582.1| hypothetical protein JCGZ_20738 [Jatropha curcas]
Length=320

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRP  131
            RGRPRKYG DG VTMAL PK I S AP PPVIDF A+K+RK +P
Sbjct  70   RGRPRKYGPDGSVTMALSPKPISSAAPAPPVIDFSAEKQRKTKP  113



>emb|CAN62363.1| hypothetical protein VITISV_031923 [Vitis vinifera]
Length=457

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKYG DG VTMAL PK I S AP PPVIDF  +KR K+RP  S S
Sbjct  77   RGRPRKYGPDGTVTMALSPKPISSSAPGPPVIDFSVEKRGKIRPVGSAS  125



>ref|XP_008437162.1| PREDICTED: uncharacterized protein LOC103482669 [Cucumis melo]
Length=330

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVRP  131
            RGRPRKYG DG V+MAL PK I S  PPPVIDF  +K+ KVRP
Sbjct  77   RGRPRKYGPDGSVSMALSPKPISSSVPPPVIDFSTEKKGKVRP  119



>ref|XP_004515758.1| PREDICTED: uncharacterized protein LOC101496521 [Cicer arietinum]
Length=331

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKY  DG VTMAL PK I S AP PPVIDF A+KR KVRP  S S
Sbjct  75   RGRPRKYAPDGSVTMALSPKPISSSAPLPPVIDFTAEKRGKVRPVSSVS  123



>ref|XP_007040013.1| AT-hook motif nuclear-localized protein 1 isoform 2 [Theobroma 
cacao]
 gb|EOY24514.1| AT-hook motif nuclear-localized protein 1 isoform 2 [Theobroma 
cacao]
Length=331

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL PK I + APPP+IDF A KR KV+
Sbjct  79   RGRPRKYGPDGSVTMALSPKPISTAAPPPLIDFSAGKRGKVK  120



>ref|XP_007040014.1| AT-hook motif nuclear-localized protein 1 isoform 3 [Theobroma 
cacao]
 gb|EOY24515.1| AT-hook motif nuclear-localized protein 1 isoform 3 [Theobroma 
cacao]
Length=332

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL PK I + APPP+IDF A KR KV+
Sbjct  79   RGRPRKYGPDGSVTMALSPKPISTAAPPPLIDFSAGKRGKVK  120



>gb|KHN04313.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=261

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKY  DG VTMAL PK I S AP PPVIDF ++KR K++PA S S
Sbjct  7    RGRPRKYAPDGSVTMALSPKPISSSAPLPPVIDFSSEKRGKIKPASSVS  55



>ref|XP_004147567.1| PREDICTED: uncharacterized protein LOC101210208 [Cucumis sativus]
 ref|XP_004168801.1| PREDICTED: uncharacterized LOC101210208 [Cucumis sativus]
 gb|KGN50187.1| hypothetical protein Csa_5G157940 [Cucumis sativus]
Length=330

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVRPA  134
            RGRPRKYG DG V+MAL PK I    PPPVIDF  +K+ KVRPA
Sbjct  77   RGRPRKYGPDGSVSMALSPKPISLSVPPPVIDFSTEKKGKVRPA  120



>ref|XP_003525779.1| PREDICTED: uncharacterized protein LOC100801730 [Glycine max]
Length=327

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKY  DG VTMAL PK I S AP PPVIDF ++KR K++PA S S
Sbjct  73   RGRPRKYAPDGSVTMALSPKPISSSAPLPPVIDFSSEKRGKIKPASSVS  121



>ref|XP_007040012.1| AT-hook motif nuclear-localized protein 1 isoform 1 [Theobroma 
cacao]
 gb|EOY24513.1| AT-hook motif nuclear-localized protein 1 isoform 1 [Theobroma 
cacao]
Length=398

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL PK I + APPP+IDF A KR KV+
Sbjct  79   RGRPRKYGPDGSVTMALSPKPISTAAPPPLIDFSAGKRGKVK  120



>ref|XP_011069940.1| PREDICTED: putative DNA-binding protein ESCAROLA [Sesamum indicum]
Length=247

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFA-KKRRKVRP  131
            RGRPRKYG DG V MAL PK + S APPPVIDF A +KR KVRP
Sbjct  74   RGRPRKYGPDGSVAMALSPKPLSSSAPPPVIDFSAVEKRGKVRP  117



>ref|XP_003608790.1| hypothetical protein MTR_4g101990 [Medicago truncatula]
 gb|AES90987.1| AT hook motif DNA-binding family protein [Medicago truncatula]
Length=332

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKY  DG VT AL PK I S AP PPVIDF A+KR KV+P  S S
Sbjct  75   RGRPRKYAADGSVTAALSPKPISSSAPLPPVIDFTAEKRAKVKPVSSVS  123



>gb|KHN09769.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=261

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKY  DG VTMAL PK I S AP PPVIDF ++KR K++P  S S
Sbjct  7    RGRPRKYAPDGSVTMALSPKPISSSAPLPPVIDFSSEKRGKIKPTSSVS  55



>ref|XP_003549892.1| PREDICTED: uncharacterized protein LOC100794202 [Glycine max]
Length=331

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKY  DG VTMAL PK I S AP PPVIDF ++KR K++P  S S
Sbjct  73   RGRPRKYAPDGSVTMALSPKPISSSAPLPPVIDFSSEKRGKIKPTSSVS  121



>ref|XP_011081098.1| PREDICTED: uncharacterized protein LOC105164191 isoform X2 [Sesamum 
indicum]
Length=330

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFA-KKRRKVRPARS  140
            RGRPRKYG DG V MAL PK I S APPPVIDF A  KR KVR   S
Sbjct  74   RGRPRKYGPDGSVGMALSPKPISSSAPPPVIDFSAVGKRGKVRSVGS  120



>ref|XP_011081097.1| PREDICTED: uncharacterized protein LOC105164191 isoform X1 [Sesamum 
indicum]
Length=331

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFA-KKRRKVRPARS  140
            RGRPRKYG DG V MAL PK I S APPPVIDF A  KR KVR   S
Sbjct  74   RGRPRKYGPDGSVGMALSPKPISSSAPPPVIDFSAVGKRGKVRSVGS  120



>ref|XP_007155604.1| hypothetical protein PHAVU_003G216000g [Phaseolus vulgaris]
 gb|ESW27598.1| hypothetical protein PHAVU_003G216000g [Phaseolus vulgaris]
Length=326

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP-PPVIDFFAKKRRKVRPARSPS  146
            RGRPRKY  DG VTMAL PK I S AP PPVIDF ++ R K++P  S S
Sbjct  72   RGRPRKYAPDGSVTMALSPKPISSSAPLPPVIDFSSENRGKIKPTSSVS  120



>ref|XP_002509630.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF51017.1| DNA binding protein, putative [Ricinus communis]
Length=322

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSL--APPPVIDFFAKKRRKVRP  131
            R RPRKYG DG VT AL PK I +   APPPVIDF A+K+RK++P
Sbjct  72   RERPRKYGPDGTVTKALSPKPISTAAPAPPPVIDFSAEKQRKIKP  116



>ref|XP_010055555.1| PREDICTED: one cut domain family member 3-like [Eucalyptus grandis]
 ref|XP_010055556.1| PREDICTED: one cut domain family member 3-like [Eucalyptus grandis]
 gb|KCW72039.1| hypothetical protein EUGRSUZ_E00486 [Eucalyptus grandis]
Length=316

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAK--KRRKVRPARSPSLPA  155
            RGRPRKYG DG VTMAL PK I S AP PVIDF +   KR + R A S + P+
Sbjct  74   RGRPRKYGPDGSVTMALSPKPISSSAPSPVIDFSSAPPKRGRGRGAGSVAKPS  126



>ref|XP_010108110.1| hypothetical protein L484_023197 [Morus notabilis]
 gb|EXC17842.1| hypothetical protein L484_023197 [Morus notabilis]
Length=318

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKR  116
            RGRPRKY  DG V MAL PK I S APPP+IDF A+KR
Sbjct  60   RGRPRKYRPDGSVAMALSPKPISSSAPPPIIDFSAEKR  97



>ref|XP_011029366.1| PREDICTED: formin-like protein 2 [Populus euphratica]
Length=198

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 5/46 (11%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP---PPVIDFFAKKRRKVRP  131
            RGRPRKYG DG VT++  PK I S AP   PPVIDF A K++K++P
Sbjct  71   RGRPRKYGPDGSVTLS--PKPISSAAPATLPPVIDFSAGKQKKIKP  114



>ref|XP_009589307.1| PREDICTED: uncharacterized protein LOC104086690 [Nicotiana tomentosiformis]
Length=342

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVV-TMAL*PKLILSLAPPPVIDFFAKKRRKVRPARSPSLPAQPK  164
            RGRPRKYG DG V T  + PK I S AP PVIDF ++K  KVRP  S     QPK
Sbjct  82   RGRPRKYGPDGSVPTSVISPKPISSAAPSPVIDFSSEKPAKVRPVGSALKVYQPK  136



>ref|XP_011029104.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Populus 
euphratica]
Length=326

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 5/46 (11%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAP---PPVIDFFAKKRRKVRP  131
            RGRPRKYG DG VT++  PK I S AP   PPVIDF A K++K++P
Sbjct  75   RGRPRKYGPDGSVTLS--PKPISSAAPATLPPVIDFSAGKQKKIKP  118



>ref|XP_009776390.1| PREDICTED: uncharacterized protein LOC104226174 [Nicotiana sylvestris]
Length=342

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVV-TMAL*PKLILSLAPPPVIDFFAKKRRKVRPARSPSLPAQPK  164
            RGRPRKYG DG +    + PK I S AP PVIDF ++KR K+RP  S     QPK
Sbjct  82   RGRPRKYGPDGSLPASVISPKPISSAAPSPVIDFSSEKRAKIRPVGSALKVYQPK  136



>gb|KHG30613.1| Putative DNA-binding ESCAROLA -like protein [Gossypium arboreum]
Length=327

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 2/44 (5%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSL--APPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VT AL PK I +   APP VIDF A KR KV+
Sbjct  74   RGRPRKYGPDGSVTKALSPKPISTSAPAPPSVIDFSAVKRGKVK  117



>ref|XP_010276424.1| PREDICTED: uncharacterized protein LOC104611170 [Nelumbo nucifera]
 ref|XP_010276433.1| PREDICTED: uncharacterized protein LOC104611170 [Nelumbo nucifera]
Length=330

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVRP  131
            RGRPRKYG DG V++AL P  I S APP V +F A KR + RP
Sbjct  58   RGRPRKYGPDGTVSLALSPIPISSSAPPAVSEFSAGKRGRGRP  100



>ref|XP_008460610.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Cucumis 
melo]
Length=303

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMA-L*PKLILSLAPPP--VIDFFAKKRRKVRPARS  140
            RGRPRKYG DG + +A L PK I + AP P  VIDF A+KR KVRPA S
Sbjct  47   RGRPRKYGPDGKLNVAALSPKPISASAPAPTAVIDFSAEKRGKVRPASS  95



>ref|XP_008460609.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X1 [Cucumis 
melo]
Length=310

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 3/49 (6%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMA-L*PKLILSLAPPP--VIDFFAKKRRKVRPARS  140
            RGRPRKYG DG + +A L PK I + AP P  VIDF A+KR KVRPA S
Sbjct  54   RGRPRKYGPDGKLNVAALSPKPISASAPAPTAVIDFSAEKRGKVRPASS  102



>ref|XP_006358365.1| PREDICTED: uncharacterized protein LOC102578251 [Solanum tuberosum]
Length=324

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 36/60 (60%), Gaps = 6/60 (10%)
 Frame = +3

Query  3    RGRPRKYGMDGV----VTMAL*PKLILSLAP--PPVIDFFAKKRRKVRPARSPSLPAQPK  164
            RGRPRKYG DGV       AL PK I S AP   PVIDF ++KR K+RP    S P  PK
Sbjct  60   RGRPRKYGPDGVAVPSTAAALSPKPISSAAPVSSPVIDFSSEKRGKIRPVGLVSKPHMPK  119



>ref|XP_004244582.1| PREDICTED: uncharacterized protein LOC101268706 [Solanum lycopersicum]
Length=328

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 36/59 (61%), Gaps = 5/59 (8%)
 Frame = +3

Query  3    RGRPRKYGMDGVVT---MAL*PKLILSLAP--PPVIDFFAKKRRKVRPARSPSLPAQPK  164
            RGRPRKYG DGV      AL PK I S AP   PVIDF ++KR K+RP    S P  PK
Sbjct  66   RGRPRKYGPDGVAVPSAAALSPKPISSAAPVSSPVIDFSSEKRGKIRPVGLFSKPHMPK  124



>gb|EPS57747.1| hypothetical protein M569_17070, partial [Genlisea aurea]
Length=109

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 3/43 (7%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFA-KKRRKVR  128
            RGRPRKY  DG  ++AL PK I S APPPVIDF A  KR K+R
Sbjct  67   RGRPRKYAPDG--SVALSPKPISSAAPPPVIDFTAGSKRGKIR  107



>ref|XP_009800836.1| PREDICTED: uncharacterized protein LOC104246669 [Nicotiana sylvestris]
Length=330

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 31/48 (65%), Gaps = 5/48 (10%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMA-----L*PKLILSLAPPPVIDFFAKKRRKVRP  131
            RGRPRKY  DG V +      L PK I S AP PVIDF ++KR KVRP
Sbjct  61   RGRPRKYAPDGSVNVTSSNNVLSPKPISSSAPSPVIDFSSEKRGKVRP  108



>ref|XP_010676643.1| PREDICTED: uncharacterized protein LOC104892414 [Beta vulgaris 
subsp. vulgaris]
Length=325

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPP--VIDFFAKKRRKVRPARSPSLPAQPK  164
            RGRPRKYG DG VT+AL  K I + AP    VIDF ++KR K++PA       QPK
Sbjct  67   RGRPRKYGPDGAVTVALSAKPISASAPAQANVIDFSSEKRPKMKPAAPVIKQHQPK  122



>ref|XP_010538767.1| PREDICTED: uncharacterized protein LOC104813002 isoform X1 [Tarenaya 
hassleriana]
Length=333

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPP---VIDFFA-KKRRKVRPARS  140
            RGRPRKYG DG    AL PK I SLAPPP   VIDF A +KR +V+PA S
Sbjct  82   RGRPRKYGPDGAAA-ALSPKPISSLAPPPASHVIDFSASEKRGRVKPAGS  130



>ref|XP_010538769.1| PREDICTED: uncharacterized protein LOC104813002 isoform X2 [Tarenaya 
hassleriana]
Length=325

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPP---VIDFFA-KKRRKVRPARS  140
            RGRPRKYG DG    AL PK I SLAPPP   VIDF A +KR +V+PA S
Sbjct  82   RGRPRKYGPDGAAA-ALSPKPISSLAPPPASHVIDFSASEKRGRVKPAGS  130



>ref|NP_001241091.1| uncharacterized protein LOC100796830 [Glycine max]
 ref|XP_006572871.1| PREDICTED: uncharacterized protein LOC100796830 isoform X1 [Glycine 
max]
 ref|XP_006572872.1| PREDICTED: uncharacterized protein LOC100796830 isoform X2 [Glycine 
max]
 gb|ACU22881.1| unknown [Glycine max]
 gb|KHN40147.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=346

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL P  I S APP   DF + KR K+R
Sbjct  67   RGRPRKYGPDGSVTMALSPMPISSSAPPSN-DFSSGKRGKMR  107



>ref|XP_006576228.1| PREDICTED: uncharacterized protein LOC100793726 isoform X1 [Glycine 
max]
 ref|XP_006576229.1| PREDICTED: uncharacterized protein LOC100793726 isoform X2 [Glycine 
max]
 ref|XP_006576230.1| PREDICTED: uncharacterized protein LOC100793726 isoform X3 [Glycine 
max]
 ref|XP_006576231.1| PREDICTED: uncharacterized protein LOC100793726 isoform X4 [Glycine 
max]
Length=346

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL P  I S APP   DF + KR K+R
Sbjct  67   RGRPRKYGPDGSVTMALSPMPISSSAPPSN-DFSSGKRGKMR  107



>gb|KHM98884.1| Putative DNA-binding protein ESCAROLA [Glycine soja]
Length=346

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL P  I S APP   DF + KR K+R
Sbjct  67   RGRPRKYGPDGSVTMALSPMPISSSAPPSN-DFSSGKRGKMR  107



>ref|NP_001240898.1| uncharacterized protein LOC100793726 [Glycine max]
 gb|ACU22693.1| unknown [Glycine max]
Length=264

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVR  128
            RGRPRKYG DG VTMAL P  I S APP   DF + KR K+R
Sbjct  67   RGRPRKYGPDGSVTMALSPMPISSSAPPSN-DFSSGKRGKMR  107



>ref|XP_010277390.1| PREDICTED: putative DNA-binding protein ESCAROLA isoform X2 [Nelumbo 
nucifera]
Length=330

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  3    RGRPRKYGMDGVVTMAL*PKLILSLAPPPVIDFFAKKRRKVRP  131
            RGRPRKYG  G V++AL P  I S APP V +F A KR + RP
Sbjct  58   RGRPRKYGPGGTVSLALSPIPISSSAPPVVSNFSAGKRGRGRP  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513120851568