BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2650_g1_i1 len=4691 path=[4669:0-4690]

Length=4691
                                                                      Score     E

ref|XP_010658320.1|  PREDICTED: myosin-9-like                           826   0.0      
ref|XP_009624217.1|  PREDICTED: sporulation-specific protein 15-like    801   0.0      
ref|XP_009787654.1|  PREDICTED: cingulin-like isoform X1                790   0.0      
ref|XP_007010076.1|  F-box and Leucine Rich Repeat domains contai...    743   0.0      
ref|XP_007010078.1|  F-box and Leucine Rich Repeat domains contai...    720   0.0      
ref|XP_007010077.1|  F-box and Leucine Rich Repeat domains contai...    623   0.0      
gb|KDP45065.1|  hypothetical protein JCGZ_01565                         552   6e-166   
ref|XP_006436553.1|  hypothetical protein CICLE_v10033678mg             536   2e-159   
ref|XP_006485296.1|  PREDICTED: early endosome antigen 1-like           538   7e-159   
gb|KDO45169.1|  hypothetical protein CISIN_1g041227mg                   511   1e-150   
ref|XP_010267314.1|  PREDICTED: centrosome-associated protein CEP...    506   2e-147   
ref|XP_004250022.1|  PREDICTED: girdin-like                             481   4e-140   
ref|XP_006360525.1|  PREDICTED: myosin-13-like                          464   3e-135   
ref|XP_009787659.1|  PREDICTED: girdin-like isoform X2                  454   3e-131   
ref|XP_011031590.1|  PREDICTED: centrosome-associated protein CEP...    426   3e-120   
ref|XP_011031591.1|  PREDICTED: myosin-7B-like isoform X2               426   3e-120   
ref|XP_006379507.1|  hypothetical protein POPTR_0008s02980g             424   1e-119   
emb|CBI31378.3|  unnamed protein product                                415   6e-118   
ref|XP_010241653.1|  PREDICTED: myosin heavy chain, skeletal musc...    416   1e-116   
gb|KHG28960.1|  Desmoplakin                                             409   1e-114   
emb|CAN83583.1|  hypothetical protein VITISV_009664                     403   3e-111   Vitis vinifera
ref|XP_010654335.1|  PREDICTED: uncharacterized protein LOC100248757    402   5e-111   
ref|XP_002534081.1|  DNA repair protein RAD50, putative                 378   4e-105   Ricinus communis
ref|XP_007204769.1|  hypothetical protein PRUPE_ppa015244mg             373   2e-103   
ref|XP_010918589.1|  PREDICTED: myosin-11-like                          356   1e-97    
ref|XP_008803435.1|  PREDICTED: myosin heavy chain, cardiac muscl...    348   3e-95    
ref|XP_008241355.1|  PREDICTED: cingulin-like                           337   1e-91    
ref|XP_011101522.1|  PREDICTED: restin homolog                          334   2e-90    
ref|XP_009375784.1|  PREDICTED: CAP-Gly domain-containing linker ...    331   6e-90    
ref|XP_009375783.1|  PREDICTED: CAP-Gly domain-containing linker ...    331   1e-89    
emb|CBI30188.3|  unnamed protein product                                328   9e-89    
ref|XP_008387517.1|  PREDICTED: sporulation-specific protein 15-like    327   2e-88    
ref|XP_008392615.1|  PREDICTED: myosin-11-like                          323   5e-87    
ref|XP_009341080.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-11-like     322   2e-86    
ref|XP_009384551.1|  PREDICTED: GRIP and coiled-coil domain-conta...    314   8e-84    
ref|XP_011018825.1|  PREDICTED: putative leucine-rich repeat-cont...    312   1e-83    
ref|XP_006381364.1|  hypothetical protein POPTR_0006s12200g             310   2e-83    
ref|XP_004306171.1|  PREDICTED: uncharacterized protein LOC101308313    304   1e-80    
ref|XP_009411507.1|  PREDICTED: cingulin-like                           304   1e-80    
gb|KCW65269.1|  hypothetical protein EUGRSUZ_G02735                     296   1e-78    
ref|XP_007027521.1|  F-box and Leucine Rich Repeat domains contai...    295   1e-77    
ref|XP_002519423.1|  ATSMC2, putative                                   288   3e-76    Ricinus communis
ref|XP_007027522.1|  F-box and Leucine Rich Repeat domains contai...    285   4e-75    
ref|XP_010067188.1|  PREDICTED: sporulation-specific protein 15-l...    283   2e-74    
gb|KCW65270.1|  hypothetical protein EUGRSUZ_G02735                     281   3e-74    
gb|KCW65268.1|  hypothetical protein EUGRSUZ_G02735                     281   3e-74    
ref|XP_010067187.1|  PREDICTED: sporulation-specific protein 15-l...    283   6e-74    
ref|XP_010908043.1|  PREDICTED: myosin heavy chain, skeletal musc...    278   2e-72    
ref|XP_008649896.1|  PREDICTED: myosin-11-like                          270   3e-70    
tpg|DAA42840.1|  TPA: hypothetical protein ZEAMMB73_571212              268   2e-69    
ref|XP_004986053.1|  PREDICTED: myosin-11-like isoform X1               266   9e-69    
ref|XP_004986054.1|  PREDICTED: myosin-11-like isoform X2               265   1e-68    
gb|EAY88210.1|  hypothetical protein OsI_09659                          265   2e-68    Oryza sativa Indica Group [Indian rice]
gb|AAN62776.1|  Putative kinesin-related protein                        265   2e-68    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ25290.1|  hypothetical protein OsJ_09100                          265   2e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006843081.1|  hypothetical protein AMTR_s00140p00022750          262   2e-67    
ref|XP_008660573.1|  PREDICTED: myosin-11-like isoform X3               258   7e-67    
ref|XP_006649238.1|  PREDICTED: myosin-11-like                          259   7e-67    
ref|XP_008660572.1|  PREDICTED: myosin-11-like isoform X2               259   1e-66    
ref|XP_008660571.1|  PREDICTED: myosin-11-like isoform X1               258   2e-66    
gb|AFW89859.1|  hypothetical protein ZEAMMB73_951067                    255   3e-66    
ref|XP_010050351.1|  PREDICTED: sporulation-specific protein 15-like    253   1e-65    
gb|KDP29215.1|  hypothetical protein JCGZ_16604                         243   1e-61    
ref|XP_003559014.1|  PREDICTED: paramyosin-like                         242   3e-61    
ref|XP_004516962.1|  PREDICTED: myosin-9-like                           235   4e-61    
gb|ABI51615.1|  RPG                                                     240   6e-61    Medicago truncatula
ref|XP_002468681.1|  hypothetical protein SORBIDRAFT_01g050140          239   1e-60    Sorghum bicolor [broomcorn]
ref|XP_004496302.1|  PREDICTED: centromere protein F-like               239   2e-60    
ref|XP_007144313.1|  hypothetical protein PHAVU_007G145600g             239   2e-60    
ref|XP_010098844.1|  hypothetical protein L484_022609                   238   3e-60    
ref|XP_006662573.1|  PREDICTED: putative leucine-rich repeat-cont...    235   3e-59    
gb|KHN37874.1|  hypothetical protein glysoja_016998                     235   4e-59    
gb|EMS60734.1|  hypothetical protein TRIUR3_01845                       234   5e-59    
ref|XP_011094566.1|  PREDICTED: golgin subfamily A member 4-like        232   3e-58    
gb|EMT06721.1|  hypothetical protein F775_07881                         228   7e-57    
ref|XP_004516963.1|  PREDICTED: myosin-9-like                           223   2e-55    
ref|XP_008351680.1|  PREDICTED: putative leucine-rich repeat-cont...    220   3e-55    
gb|KHN36452.1|  hypothetical protein glysoja_041039                     217   1e-53    
ref|XP_006590187.1|  PREDICTED: myosin-11-like                          215   4e-53    
ref|XP_009586795.1|  PREDICTED: sporulation-specific protein 15-like    214   1e-52    
gb|EMS49272.1|  hypothetical protein TRIUR3_32478                       209   7e-51    
emb|CDP15309.1|  unnamed protein product                                207   1e-50    
ref|XP_010325954.1|  PREDICTED: ELKS/Rab6-interacting/CAST family...    204   9e-50    
gb|EAY79416.1|  hypothetical protein OsI_34549                          202   5e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_006354414.1|  PREDICTED: myosin-11-like                          202   6e-49    
ref|XP_007145290.1|  hypothetical protein PHAVU_007G226600g             201   9e-49    
ref|XP_006594170.1|  PREDICTED: early endosome antigen 1-like           199   4e-48    
gb|KHN48228.1|  hypothetical protein glysoja_007897                     199   6e-48    
ref|XP_006589841.1|  PREDICTED: myosin-9-like                           197   2e-47    
ref|XP_009780326.1|  PREDICTED: sporulation-specific protein 15-like    194   1e-46    
gb|KHG04544.1|  Trafficking kinesin-binding 1                           191   1e-45    
gb|EAZ16877.1|  hypothetical protein OsJ_32355                          191   2e-45    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065218.2|  Os10g0547000                                       191   2e-45    Oryza sativa Japonica Group [Japonica rice]
gb|ABI51616.1|  RRP1                                                    180   3e-42    Medicago truncatula
gb|KEH42115.1|  myosin heavy chain-like protein, putative               180   3e-42    
ref|XP_003590443.1|  RRP1                                               179   4e-42    
gb|EMT09074.1|  hypothetical protein F775_03143                         178   2e-41    
ref|XP_004983763.1|  PREDICTED: myosin heavy chain, striated musc...    176   4e-41    
ref|XP_004137997.1|  PREDICTED: uncharacterized protein LOC101220815    174   2e-40    
gb|KGN59033.1|  hypothetical protein Csa_3G747640                       174   3e-40    
ref|XP_006360524.1|  PREDICTED: uncharacterized protein LOC102594502    158   4e-40    
ref|XP_006381365.1|  hypothetical protein POPTR_0006s12210g             155   4e-39    
gb|EYU41580.1|  hypothetical protein MIMGU_mgv1a001004mg                169   4e-39    
gb|AES60694.2|  myosin heavy chain-like protein, putative               168   1e-38    
ref|XP_010234977.1|  PREDICTED: myosin-11-like                          168   2e-38    
ref|XP_010050359.1|  PREDICTED: uncharacterized protein LOC104438903    158   8e-38    
ref|XP_009397616.1|  PREDICTED: myosin-11-like                          162   5e-37    
ref|XP_008442757.1|  PREDICTED: myosin-2 heavy chain-like isoform X4    159   8e-36    
ref|XP_008442756.1|  PREDICTED: myosin-2 heavy chain-like isoform X3    159   8e-36    
gb|AFW87945.1|  hypothetical protein ZEAMMB73_520730                    159   1e-35    
ref|XP_008442754.1|  PREDICTED: myosin-2 heavy chain-like isoform X1    158   1e-35    
ref|XP_008442755.1|  PREDICTED: myosin-2 heavy chain-like isoform X2    158   1e-35    
ref|XP_008659974.1|  PREDICTED: girdin-like isoform X1                  157   3e-35    
ref|XP_002464993.1|  hypothetical protein SORBIDRAFT_01g030020          156   5e-35    Sorghum bicolor [broomcorn]
ref|XP_008659978.1|  PREDICTED: girdin-like isoform X2                  154   2e-34    
ref|XP_010267312.1|  PREDICTED: uncharacterized protein LOC104604589    132   1e-30    
ref|NP_001048692.1|  Os03g0107400                                       140   3e-30    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002316409.1|  hypothetical protein POPTR_0010s23780g             131   1e-29    Populus trichocarpa [western balsam poplar]
ref|XP_004161275.1|  PREDICTED: uncharacterized protein LOC101231969    135   2e-28    
ref|XP_010090429.1|  Putative AC transposase                            131   9e-28    
ref|XP_011101561.1|  PREDICTED: uncharacterized protein LOC105179614    120   6e-27    
gb|KHN00942.1|  hypothetical protein glysoja_000610                     122   9e-25    
ref|XP_010090428.1|  hypothetical protein L484_007990                   119   1e-24    
ref|XP_009789092.1|  PREDICTED: putative leucine-rich repeat-cont...    122   3e-24    
ref|XP_009789123.1|  PREDICTED: putative leucine-rich repeat-cont...    121   4e-24    
ref|XP_009789129.1|  PREDICTED: putative leucine-rich repeat-cont...    121   4e-24    
ref|XP_009617621.1|  PREDICTED: putative leucine-rich repeat-cont...    121   6e-24    
ref|XP_004238511.1|  PREDICTED: putative leucine-rich repeat-cont...    118   5e-23    
ref|XP_010273099.1|  PREDICTED: trichohyalin                            116   1e-22    
ref|XP_006354031.1|  PREDICTED: centromere-associated protein E-l...    112   3e-21    
ref|XP_006354033.1|  PREDICTED: centromere-associated protein E-l...    112   3e-21    
ref|XP_002513863.1|  ATP binding protein, putative                      112   4e-21    Ricinus communis
gb|ABR17005.1|  unknown                                                 109   4e-21    Picea sitchensis
ref|XP_010664285.1|  PREDICTED: centromere-associated protein E         109   2e-20    
emb|CBI19108.3|  unnamed protein product                                108   2e-20    
ref|XP_006434057.1|  hypothetical protein CICLE_v100033011mg            107   3e-20    
ref|XP_011098011.1|  PREDICTED: sporulation-specific protein 15         108   4e-20    
emb|CDP01183.1|  unnamed protein product                                108   4e-20    
ref|XP_007018883.1|  F-box and Leucine Rich Repeat domains contai...    107   9e-20    
ref|XP_007018882.1|  F-box and Leucine Rich Repeat domains contai...    107   1e-19    
ref|XP_007018879.1|  F-box and Leucine Rich Repeat domains contai...    107   1e-19    
gb|KDO80865.1|  hypothetical protein CISIN_1g000199mg                   107   1e-19    
ref|XP_007018881.1|  F-box and Leucine Rich Repeat domains contai...    107   1e-19    
gb|KDO80868.1|  hypothetical protein CISIN_1g000199mg                   107   1e-19    
ref|XP_006472661.1|  PREDICTED: golgin subfamily B member 1-like ...    107   1e-19    
ref|XP_007225486.1|  hypothetical protein PRUPE_ppa000087mg             106   2e-19    
ref|XP_008233976.1|  PREDICTED: sporulation-specific protein 15         106   2e-19    
ref|XP_009409150.1|  PREDICTED: sporulation-specific protein 15-like    105   4e-19    
gb|KHG00623.1|  Keratin, type I cytoskeletal 18                         105   4e-19    
ref|XP_010261173.1|  PREDICTED: golgin subfamily A member 4-like        104   6e-19    
ref|XP_010069783.1|  PREDICTED: forkhead-associated domain-contai...    104   6e-19    
ref|XP_008378529.1|  PREDICTED: golgin subfamily B member 1             104   6e-19    
ref|XP_010069781.1|  PREDICTED: forkhead-associated domain-contai...    104   6e-19    
ref|XP_010269153.1|  PREDICTED: golgin subfamily A member 4-like ...    103   1e-18    
ref|XP_010269150.1|  PREDICTED: golgin subfamily A member 4-like ...    103   1e-18    
ref|XP_004301940.1|  PREDICTED: uncharacterized protein LOC101305084    103   1e-18    
ref|XP_009345521.1|  PREDICTED: early endosome antigen 1                103   1e-18    
ref|XP_009380998.1|  PREDICTED: nucleoprotein TPR-like                  103   2e-18    
dbj|BAJ90692.1|  predicted protein                                    98.6    2e-18    
ref|XP_002301031.2|  hypothetical protein POPTR_0002s09230g             102   2e-18    Populus trichocarpa [western balsam poplar]
ref|XP_002301032.2|  hypothetical protein POPTR_0002s09230g             102   2e-18    Populus trichocarpa [western balsam poplar]
ref|XP_010105863.1|  hypothetical protein L484_021518                   102   2e-18    
ref|XP_006386392.1|  hypothetical protein POPTR_0002s09230g             102   2e-18    
ref|XP_006386393.1|  hypothetical protein POPTR_0002s09230g             102   2e-18    
ref|XP_011027665.1|  PREDICTED: LOW QUALITY PROTEIN: sporulation-...    102   3e-18    
ref|XP_002985017.1|  hypothetical protein SELMODRAFT_446143             102   3e-18    
emb|CDY04701.1|  BnaC05g17390D                                        97.4    4e-18    
ref|XP_002986207.1|  hypothetical protein SELMODRAFT_425230           97.1    5e-18    
ref|XP_002307400.2|  hypothetical protein POPTR_0005s164502g            100   6e-18    Populus trichocarpa [western balsam poplar]
ref|XP_008338795.1|  PREDICTED: early endosome antigen 1-like           100   2e-17    
ref|XP_004511587.1|  PREDICTED: myosin-11-like                        94.7    4e-16    
gb|EYU29739.1|  hypothetical protein MIMGU_mgv1a000817mg              92.8    2e-15    
ref|XP_002990755.1|  hypothetical protein SELMODRAFT_429130           92.4    3e-15    
ref|XP_009340017.1|  PREDICTED: early endosome antigen 1-like         91.7    4e-15    
ref|XP_002986658.1|  hypothetical protein SELMODRAFT_425588           91.7    6e-15    
ref|XP_008452021.1|  PREDICTED: intracellular protein transport p...  89.0    3e-14    
ref|XP_004298729.1|  PREDICTED: uncharacterized protein LOC101310796  84.0    9e-13    
ref|XP_007210414.1|  hypothetical protein PRUPE_ppa000546mg           83.2    2e-12    
ref|XP_008238875.1|  PREDICTED: myosin-11                             79.7    2e-11    
ref|XP_011015471.1|  PREDICTED: LOW QUALITY PROTEIN: myosin heavy...  79.7    2e-11    
gb|KDO60006.1|  hypothetical protein CISIN_1g002248mg                 76.6    2e-10    
ref|XP_006490380.1|  PREDICTED: myosin-2 heavy chain-like isoform X1  76.6    2e-10    
ref|XP_006421913.1|  hypothetical protein CICLE_v10004257mg           76.3    2e-10    
gb|KHG28965.1|  Sarcolemmal membrane-associated                       75.1    4e-10    
ref|XP_010660906.1|  PREDICTED: myosin-9 isoform X1                   75.5    4e-10    
ref|XP_004143922.1|  PREDICTED: uncharacterized protein LOC101222480  73.9    1e-09    
ref|XP_010061052.1|  PREDICTED: unconventional myosin-XVIIIa          73.6    1e-09    
ref|XP_010473572.1|  PREDICTED: golgin subfamily A member 6-like ...  73.6    2e-09    
ref|XP_006476583.1|  PREDICTED: intracellular protein transport p...  72.4    3e-09    
gb|KDO76201.1|  hypothetical protein CISIN_1g001085mg                 72.4    4e-09    
ref|XP_010089136.1|  hypothetical protein L484_024311                 72.0    5e-09    
ref|XP_009619461.1|  PREDICTED: myosin heavy chain, striated musc...  71.2    8e-09    
ref|XP_009619462.1|  PREDICTED: myosin heavy chain, striated musc...  71.2    8e-09    
ref|XP_009785547.1|  PREDICTED: myosin heavy chain, striated musc...  70.9    1e-08    
ref|XP_009785546.1|  PREDICTED: myosin heavy chain, striated musc...  70.9    1e-08    
ref|XP_006439561.1|  hypothetical protein CICLE_v10018577mg           70.5    1e-08    
gb|EPS69111.1|  hypothetical protein M569_05650                       70.5    1e-08    
ref|XP_004245619.1|  PREDICTED: cingulin isoform X1                   69.7    2e-08    
ref|XP_010533683.1|  PREDICTED: myosin-13 isoform X1                  69.3    3e-08    
ref|XP_010533684.1|  PREDICTED: myosin-13 isoform X2                  68.9    4e-08    
ref|XP_010325416.1|  PREDICTED: cingulin isoform X2                   68.9    4e-08    
ref|XP_007040183.1|  Myosin heavy chain-related protein, putative     68.6    5e-08    
gb|KDP25462.1|  hypothetical protein JCGZ_20618                       68.2    7e-08    
ref|XP_004244607.1|  PREDICTED: E3 ubiquitin-protein ligase BRE1-...  67.8    9e-08    
ref|XP_004503761.1|  PREDICTED: myosin-11-like isoform X1             67.8    9e-08    
ref|XP_006352281.1|  PREDICTED: myosin-11-like                        67.4    1e-07    
gb|KFK33030.1|  hypothetical protein AALP_AA6G321500                  67.4    1e-07    
gb|KGN53347.1|  hypothetical protein Csa_4G049060                     67.0    1e-07    
ref|XP_009616000.1|  PREDICTED: centromere-associated protein E i...  67.0    1e-07    
ref|XP_004146567.1|  PREDICTED: uncharacterized protein LOC101221081  67.0    2e-07    
ref|XP_004160979.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  66.6    2e-07    
ref|XP_009616001.1|  PREDICTED: centromere-associated protein E i...  66.2    3e-07    
ref|XP_006405390.1|  hypothetical protein EUTSA_v10027632mg           65.1    6e-07    
ref|XP_010660910.1|  PREDICTED: myosin-9 isoform X2                   64.3    1e-06    
ref|XP_008452020.1|  PREDICTED: intracellular protein transport p...  63.9    1e-06    
gb|KHN25716.1|  hypothetical protein glysoja_018290                   61.2    8e-06    
ref|XP_006573769.1|  PREDICTED: myosin-3-like                         61.2    9e-06    
ref|XP_010430415.1|  PREDICTED: golgin subfamily A member 6-like ...  59.7    2e-05    
ref|XP_011072419.1|  PREDICTED: LOW QUALITY PROTEIN: intracellula...  58.9    4e-05    
ref|XP_007160043.1|  hypothetical protein PHAVU_002G287700g           58.9    5e-05    
ref|XP_002509773.1|  ATP binding protein, putative                    58.2    8e-05    Ricinus communis
ref|XP_006391751.1|  hypothetical protein EUTSA_v10023231mg           57.4    1e-04    
ref|XP_010545827.1|  PREDICTED: myosin-11                             56.2    3e-04    
gb|KHN23660.1|  hypothetical protein glysoja_039111                   55.5    5e-04    
ref|XP_006580596.1|  PREDICTED: myosin-6-like                         55.1    6e-04    
gb|KEH21046.1|  myosin heavy chain-like protein                       55.1    7e-04    
ref|XP_010418352.1|  PREDICTED: golgin subfamily A member 6-like ...  54.7    8e-04    
gb|KHN16837.1|  hypothetical protein glysoja_002934                   54.7    0.001    



>ref|XP_010658320.1| PREDICTED: myosin-9-like [Vitis vinifera]
Length=1678

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/1681 (40%), Positives = 957/1681 (57%), Gaps = 186/1681 (11%)
 Frame = +1

Query  49    REREMFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGK  228
             + R+MF+L RHK    D SG +F F FS  QALQVPKGWDKL VS+ISVE G+T +K GK
Sbjct  12    KRRKMFRLHRHKP---DKSGHRFHFNFSGFQALQVPKGWDKLCVSIISVETGRTTTKTGK  68

Query  229   ASVNNGTCQWTE----SLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRN  390
             +SV  G C+WTE    S+W P++ AS  ++   FK +V+MGSSR+GILGEATVN+  Y +
Sbjct  69    SSVRTGNCRWTETLSDSIWIPQDDASKEVEECLFKLVVAMGSSRSGILGEATVNLAGYVS  128

Query  391   SEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEV--------NSTAAYNEEEN---  537
             S+AS  +SLPL+KC+ GT L  +I+CLTPRT+ R ++         +S+A Y++ EN   
Sbjct  129   SKASFLLSLPLEKCHHGTTLQVKIQCLTPRTTLRDEQWQNTNSHVEDSSAEYDDLENISD  188

Query  538   ------------SVCNGIDN---------KSEER-----NNSLPSMEDSLGRDSLssasn  639
                         S  N  D+         K   R     + S  SME SLGR++LS  + 
Sbjct  189   VSDSTFTRSIGSSSSNQFDSTYHPGETGGKDTSRSASGSHRSFDSMEGSLGRENLSPQNP  248

Query  640   ssavvnnaIRRLESTESG-----GSAPWssysygspksnnspnklsisCQEKHPEYTEEE  804
              + V+N+ I + +ST S      GS P +  S  +  S NS    S S    H +   ++
Sbjct  249   FTGVMNDLIGKQDSTSSNSSSLFGSYPANDISRSNRSSFNSKVSSSGS----HLQNQRDD  304

Query  805   IGQCSLHITRTSIPDAN-----------IEELKAEARMWELNARRLMVKMETLRKEFANQ  951
              G+ S  I  + + +A             EEL+AEARMWE NAR+LM  +E LRKEF+NQ
Sbjct  305   FGRVSHAIATSPLRNAGSCKDLEAAEGAFEELRAEARMWEQNARKLMHDLEILRKEFSNQ  364

Query  952   SQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEME  1131
             S+  AD++MEL+ +HTE NRL  +I++L  LLEE   +Q   ENL LQA+N  NI +E+E
Sbjct  365   SKNQADLDMELAASHTECNRLRQEIEQLNFLLEELTVRQKDTENLKLQAQNMNNIQQELE  424

Query  1132  DELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDV---  1302
             DE+KFQ ESN+NL++QL+K+QESN ELVSVLQEMEE ++K+K+EI +L  L S+ DV   
Sbjct  425   DEIKFQKESNANLTIQLKKTQESNIELVSVLQEMEEMIEKQKMEITDLSMLKSKFDVDEC  484

Query  1303  ------MGVINSCGD-------------------------EDNVQPKSTEQVSVEKQCQE  1389
                    G ++S GD                             +P+ T  + ++ +   
Sbjct  485   SLGHEDWGKVSSRGDILVKRKASCDSDLAGSAVEHPISDLHAEFEPEDTSTLELQLEQLL  544

Query  1390  FKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQGl------------------  1515
                ++L+ S   L+N++       EEK HEIE+E+DL+AQ L                  
Sbjct  545   ESQKNLESSIHYLQNTL-------EEKNHEIEIERDLKAQALLDCQEEWKCKLAAKEVDI  597

Query  1516  -------lelesksssaeeseaNKPNMHLIEEIESLKKTIQelerecnelteenlellfk  1674
                     E     +  E    N  + +LI+EIE+LK  +QELER+C ELT+ENL L FK
Sbjct  598   ISLETKLSEAIHALNVKETGPQNGGDHNLIKEIEALKVKVQELERDCVELTDENLSLHFK  657

Query  1675  lkeSRKDPSENHDMLSSKSLEGPQSESLIGSEFETSKHGFQFLLL-----QKEVIEEEV-  1836
             +KES KD         S S E   + S   SE E +K   Q   L     QKE++ EEV 
Sbjct  658   IKESSKDLMTCAASFKSLSSEFVGNGSPHTSESEVTKLKSQIDRLEEELKQKEILVEEVT  717

Query  1837  PNSLQIHSSGQRENHTCLEPPNFQAFKCKGCDLNVKLHACCVKATDKQATEITVNPSEGQ  2016
              N+ Q+  +      T LE    Q FK K C L+ +L+ C  KA ++   EI +   + Q
Sbjct  718   ANNFQLQCTDLNNKCTDLEL-QLQIFKDKACHLDSELYNCHTKAEEQ---EIEIAALQLQ  773

Query  2017  ----RDEIDSRNFTLKDVSDRNRYSEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFS  2184
                 ++E +++   L DVS     SE     +   ++  LCEQ+ +   N+   ++ L+S
Sbjct  774   LKFYQEETETKTH-LADVSVSLENSESHAAIERSRILSELCEQIQLSLANIKKQQYTLYS  832

Query  2185  PVNIELRNATFYKDISRGTDPMAQKEHAKAVFDKLVQL---LRARLVSCTNDKYSEDGAR  2355
             P NIE +   +     + T+ + QK   +++ + L+QL     A+     ++ +S +G R
Sbjct  833   PENIECKYGVYSPKFLKNTELITQKAQVESILNNLIQLNKLFEAKTTESEDELHSREGIR  892

Query  2356  TEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNFK-ELEVKGESIGNNVLTKNSKMLEVKT  2532
                 N   ++D+       E DP  S QG  +   ELE +   +   +L K  ++ ++K 
Sbjct  893   ARNTNDNVVQDELVCNDLKENDPPFSCQGSSSLNIELESEFTDLSKELLVKICEIDKLKA  952

Query  2533  GCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMM  2703
               L ++  + A+ HC+RDL  +I + Q     +E++ME +Q E   +TS   D +R +M+
Sbjct  953   NHLLKEEEIVAVRHCQRDLETQISNLQAEKRQLEENMEIMQRE-SSVTSKCLDDLRNDMV  1011

Query  2704  VVTGRIFGNISE-KIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTD  2880
             ++   +   +S  KI E K LELE+ K ELE  + ELE+EN+QLSER+SGLEAQLR+FTD
Sbjct  1012  LLNTSMESLVSSNKILERKSLELESSKDELELHLSELEEENVQLSERISGLEAQLRYFTD  1071

Query  2881  AMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKK  3060
               E  R+ LQ+  +   NLQDEIR LE + ++Q++++KQ+L +MQKRWL+SQEE EYLK+
Sbjct  1072  ERESGRLVLQNSESHAKNLQDEIRRLETEMQAQKVDMKQKLQDMQKRWLESQEECEYLKQ  1131

Query  3061  ANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIES  3240
             ANPKLQATAESLIEEC SLQ  NGELR+Q+LE+  +C +LEA+LR+ Q     C  +IE 
Sbjct  1132  ANPKLQATAESLIEECSSLQKSNGELRKQKLEMYERCTVLEAKLRESQEYFLYCSRKIED  1191

Query  3241  LEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQ  3420
             LE  LSS LEE S KEK +N+ELE ++ + +  KE+L ++E+L +Q+   K  E+E  ++
Sbjct  1192  LEETLSSTLEEISVKEKTLNTELETLVQENRNHKEKLAVEENLLNQMYLEKTVEVEDLKR  1251

Query  3421  KSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQM  3600
             +  HL  Q+    D  +  ASE   E+  L A+   L+  LQE+++    +E KL T ++
Sbjct  1252  EIAHLSEQISATQDEREQTASEAVLEVSCLRADKAKLEAALQEVKEKFTNSENKLNTVRV  1311

Query  3601  EYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllses  3780
             E E K+  L+ EL A + NQ VL A   KL   L  V S+E  LK  I+ +  KL  SE 
Sbjct  1312  ESETKLMGLVSELAATRQNQEVLAADHAKLLGLLAEVKSNEEKLKGTINRVGLKLKTSEY  1371

Query  3781  erlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKAD  3960
             E  Q  +  SSLK++L K A L+DEVLALK SLN+ KF+NERLEASLQL   + E+LKA+
Sbjct  1372  EMQQQTEEISSLKMQLQKTALLQDEVLALKRSLNEAKFENERLEASLQLQSADYEDLKAE  1431

Query  3961  KTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSK  4140
             K S IQ+++ MQ +V+ELE+C+  KV LEEK+LRLEGDLTARE +CA+DAE+KN+L + K
Sbjct  1432  KISFIQKISSMQAAVSELEDCKSSKVALEEKILRLEGDLTAREALCARDAEMKNELGRIK  1491

Query  4141  RVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSK  4320
             R NSQ RWKIK LE E+       Q+++EEL +K+      S S A++   S +   +  
Sbjct  1492  RTNSQFRWKIKYLEEEKEECLNRTQALEEELKKKKEVNQDQSESSARNFPVSPESNSMGT  1551

Query  4321  ARSSQCNNCETIQIVT-----IDDCSSRCQVGDD------------KTQFKSLQPEGQST  4449
               + + N  E     +     I+D   + Q+ ++            + Q KSL    QS 
Sbjct  1552  PTNDKLNPLEVDNYCSGSSHVIEDPMPKIQLLENRLSEALETNEMYRVQLKSLSSGEQSN  1611

Query  4450  RS----------GNENE---QKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
              S          G + E    K+S LEAEL+EI ERY HMSLKYAEVE ++ +LVM LK 
Sbjct  1612  HSYADKKVRDEGGVKKEGYKDKVSSLEAELREIQERYSHMSLKYAEVEAEREELVMKLKT  1671

Query  4591  L  4593
             +
Sbjct  1672  V  1672



>ref|XP_009624217.1| PREDICTED: sporulation-specific protein 15-like [Nicotiana tomentosiformis]
Length=1510

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 657/1638 (40%), Positives = 942/1638 (58%), Gaps = 260/1638 (16%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNS---GDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKA  231
             +FKL RH+SS+S  S   G +  F FSN+ A QVPKGWDKLS+SL+SVE GKT+SK GKA
Sbjct  7     IFKLHRHRSSSSSFSEKSGQRLDFSFSNLHARQVPKGWDKLSISLVSVETGKTVSKSGKA  66

Query  232   SVNNGTCQWTE----SLW-SPENYASNGLDH-FKFLVSMGSSRAGILGEATVNVGHYRNS  393
             SV NG CQWTE    S+W +P++ +S      FKF+V+MGS+R+ ILGEA VN  HY+++
Sbjct  67    SVRNGNCQWTETWSQSIWITPDDISSQQEQFPFKFIVTMGSARSSILGEAAVNPSHYKDA  126

Query  394   EASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEE  573
             +A+ PVSLPL+KCN  TVL  EIKCLT   + RG+E      Y EEEN   N ++ KSEE
Sbjct  127   KANTPVSLPLKKCNYATVLQLEIKCLT---ALRGNEFKDMPIYIEEENVEYNNMEIKSEE  183

Query  574   -------RNNSLPSMEDSLGRDSLssasnssavvnnaIRRLESTES--------------  690
                     ++S  S EDSLGR+S SS S+S+  VN+ I R ES +S              
Sbjct  184   TGFRALSSSHSFGSTEDSLGRESFSSLSDSNRPVNHIIGRQESIDSRSSASCSSYSFCES  243

Query  691   --GGSAPWssysygspksnnspnklsisCQEKHPEYTEEEIGQCSLHIT-RTSIPDANI-  858
                 ++P++  + GS K+  +        ++   +++ +      L  + R S+   +I 
Sbjct  244   PKSYNSPYNLMNSGSGKNAQNQ-------KDDFKQFSHDNTASVQLAASSRNSLQAKDIT  296

Query  859   -EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
              +EL AEA MWE NA+ L   +E  RKEF +Q+Q+IA+++MEL +  TE   L+ +IK L
Sbjct  297   SKELIAEALMWEQNAQSLKTDLEMSRKEFFDQTQQIANLKMELCSLGTEHGGLVQEIKHL  356

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             EVLL+ES  K+ A E+L LQ K+ E+  K +++EL+ Q ESN +++LQL K+QESN +LV
Sbjct  357   EVLLQESMEKEKATESLMLQVKDMESFQKIVKEELRIQKESNDSMALQLSKTQESNIQLV  416

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVE-------  1374
             ++LQEMEETV+ +K+EIENL           ++N    ED +Q     Q+++E       
Sbjct  417   AILQEMEETVENQKLEIENL----------RIVNQKNPEDKLQQLQESQINLENTTLHLE  466

Query  1375  ----KQCQEFKLQHLQESHMSLENSIICQEK------AQEEKIHEI--ELEQDLRAQGll  1518
                 ++  E +L+  Q +   L+    C+EK       QEE+I  +  EL + L A+G  
Sbjct  467   KIIREKSHEIELEQGQRTQAFLD----CEEKWSSRSREQEEEIAYLKAELSRLLSAEGSE  522

Query  1519  elesksssaeeseaNKP--NMHLIEEIESLKKTIQelerecnelteenlellfklkeSRK  1692
               ++           KP  +  L++E E+LK+ +QELER+C ELTEENLELL+KLK  + 
Sbjct  523   TNKA-----------KPATDCDLMKENETLKEKLQELERDCKELTEENLELLYKLK-PKG  570

Query  1693  DPSENHDMLSSKSLEGPQSE-SLIGSEFETS-----KHGFQFLLLQKEVIEEEVPNSLQI  1854
               S +  +LSS S+EG  SE S  GSEFE S        FQ  + +K++I E   +  + 
Sbjct  571   ASSISGPILSSSSVEGQLSERSPGGSEFEVSNGELLSSPFQDDMGKKKIIAETAASESKQ  630

Query  1855  HSSGQRENHTCLEPPNFQAFKCKGCDLNVKLHACCVKATDK-QATEITVNPSEGQRDEID  2031
              +  Q EN   +E    +  K     LN ++++CC +  ++ Q TEI   PSE  ++E  
Sbjct  631   KTCDQEENLAQMEL--HKQVKDNTLRLNAEINSCCFEVQEQDQRTEIAPIPSECHQEESC  688

Query  2032  SRNFTLKDVSDRNRYSEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRNA  2211
                FT ++VS   + SE     D+ +L+  LC                            
Sbjct  689   HGGFTHENVSAMFQSSESGRIEDVYALLNTLCH---------------------------  721

Query  2212  TFYKDISRGTDPMAQKEHAKAVFDKLVQLLRARLVSCTN-DKYSEDGARTEVNNTYEIKD  2388
                           + E A  V  KL+QLL  R   C +  K+ ED  +  V +  E++D
Sbjct  722   ------------TTKDEQADMVLKKLLQLLGCRSAICLDGSKHIEDEPKITVKDACEVQD  769

Query  2389  KSDYGCSTEKDPCSSHQGYKNF-KELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKA  2565
                     EK PCS  Q  ++  K L+ K +++ ++ L KNS++LE+KT CL++D  ++A
Sbjct  770   GEKDDLPEEKTPCSCCQRLEDSNKVLDGKVQNLSSDNLAKNSEILELKTDCLKKDAEIEA  829

Query  2566  LNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITSDSMREE---MMVVTGRIFGNIS  2736
             L H   DL  +I D QM    +E+ ME VQ E    TS S++     +M +   I G++S
Sbjct  830   LRHQEIDLRTEISDLQMNKCQMEEGMESVQQEFS-ATSKSLQTSTNGLMFLDQCICGDVS  888

Query  2737  EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHK  2916
             +   +MK LELE++K ELE  + ELEKEN+ LSERVSGLEAQLRH TDAMEL+R+ELQH 
Sbjct  889   KMTFKMKSLELESDKYELELSLDELEKENVDLSERVSGLEAQLRHLTDAMELNRLELQHS  948

Query  2917  GTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESL  3096
             G ++ NLQD++RELE +K+SQ+L++K++L+EMQ RWLD+QEE EYLKK NPKLQAT ESL
Sbjct  949   GNRVVNLQDKVRELEHEKDSQKLDMKEKLLEMQHRWLDAQEECEYLKKVNPKLQATTESL  1008

Query  3097  IEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEET  3276
             +EEC  LQ LN ELR+Q+L+L    N+LEAELRK Q+S S+CL RIESLEA  SS+LEE 
Sbjct  1009  MEECRLLQNLNAELRQQKLKLHTSHNVLEAELRKSQYSFSTCLKRIESLEANFSSVLEEI  1068

Query  3277  SSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFD-  3453
              SKEKI+  +L+ + LQTKE +E+L+++E    ++ ++ + E+E  Q++   L  QM D 
Sbjct  1069  ESKEKILKFKLDDLHLQTKEHREKLLVEECTVHEISENTV-EVEKLQEQVQSLTAQMSDL  1127

Query  3454  PSDREDGKASEGSHEMHSLFAEN--KMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYEL  3627
              SD    KA EG+       A N  K+L+ T     ++L   E KL  T  E E K    
Sbjct  1128  MSDLGTSKAKEGT------LAANCEKLLRST-----EHLASNEAKLKCTINELESK----  1172

Query  3628  MGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADAN  3807
                                        ++SSE  +                  LQ+ + N
Sbjct  1173  ---------------------------LLSSECQM------------------LQMTEEN  1187

Query  3808  SSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELT  3987
              SLKI+L  +  L++EVL LKG+L+ MKF++ERL+ +LQL   + EELKA+K SL+QE++
Sbjct  1188  FSLKIQLQTLPLLQEEVLNLKGALSRMKFESERLQVTLQLKYEDCEELKAEKASLLQEIS  1247

Query  3988  GMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWK  4167
              MQ +V E EEC+ +K+ LEEKVLRL+GDLTA+EVMCAK +ELKN+L Q +RVNSQ   K
Sbjct  1248  YMQKAVAEAEECKYKKISLEEKVLRLDGDLTAKEVMCAKVSELKNELCQLRRVNSQFLRK  1307

Query  4168  IKQLELERYYLSKELQSVQEEL------NRKENSVPSPSHSVAKDKTTSCKEQKLSK---  4320
             IK L+ E+    K+++SV+E+L      N++E+ VP    ++ K K +   E+  SK   
Sbjct  1308  IKSLQFEKEDCLKQVKSVEEKLMRKRLDNQREDDVP----TLEKLKLSKAAEEDFSKQCK  1363

Query  4321  --ARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFK------------SLQPEGQ-----  4443
                +S Q      +Q +      +  Q G+ ++ +K            ++Q  G      
Sbjct  1364  IITQSPQSEKYLRVQKIQ----GNSQQDGNKQSNYKRDLQETVAKSVSAIQFPGDTVVQI  1419

Query  4444  --------------STRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMT  4581
                           S++  + + QKISQLEAEL+EI +RYLHMSLKYAEVE+Q+ +LVMT
Sbjct  1420  LESNCIHESHLICLSSKGIDGDMQKISQLEAELQEIRDRYLHMSLKYAEVEDQREQLVMT  1479

Query  4582  LKALQDQRTGTVR*ISQF  4635
             LK++ DQ+TG    +S F
Sbjct  1480  LKSIHDQKTGRGSYLSSF  1497



>ref|XP_009787654.1| PREDICTED: cingulin-like isoform X1 [Nicotiana sylvestris]
Length=1503

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/1636 (40%), Positives = 915/1636 (56%), Gaps = 257/1636 (16%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNS--GDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKAS  234
             +FKL RH+SS+S +   G +  F FSN+ A QVPKGWDKLS+SLI VE GKT+SK GKA 
Sbjct  7     IFKLHRHRSSSSFSEKSGQRLDFSFSNLHARQVPKGWDKLSISLICVETGKTVSKSGKAL  66

Query  235   VNNGTCQWTE----SLWSPENYASNGLDHF--KFLVSMGSSRAGILGEATVNVGHYRNSE  396
             V NG C+WTE    S+W   +  SN  + F  KF+V+MGS+R+ ILGEA +N   YR+++
Sbjct  67    VRNGNCKWTETWSQSIWITPDDISNQQEQFPFKFIVTMGSARSSILGEAALNPARYRDAK  126

Query  397   ASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEE-  573
             A  PVSLPL+KCN  TVL  EIKCLT   + RG+E      Y EEEN     ++ KSEE 
Sbjct  127   AYTPVSLPLKKCNYATVLQLEIKCLT---ALRGNEFKDMPIYIEEENVEYKNMEIKSEET  183

Query  574   ------RNNSLPSMEDSLGRDSLssasnssavvnnaIRRLESTES---------------  690
                    ++S  S EDSLGR+S SS S+S+  VN+ I R ES +S               
Sbjct  184   GCRALSSSHSFASTEDSLGRESFSSLSDSNRPVNHIIGRQESIDSRSSASCSSYSFCESP  243

Query  691   -GGSAPWssysygspksnnspnklsisCQEKHPEYTEEEIGQCSLHIT-RTSIPDANI--  858
                ++P++  + GS K+  +        ++ + + + +      L  + R S+   +I  
Sbjct  244   KSYNSPYNLMNSGSGKNAQNQ-------KDDYKQLSHDNTASVQLAASSRNSLQGKDITS  296

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             +EL AEA MWE NA+ L + +E  RKEF +Q+Q+I +++ME  +  TE + LM +IK LE
Sbjct  297   KELIAEAMMWEQNAQSLKINLEMSRKEFFDQTQQIENLKMEHRSLGTERDGLMQEIKHLE  356

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             VLL+ES  K+ A ++L LQ ++ +++ K ++ EL+ Q ESN ++SLQL K+QESN ELVS
Sbjct  357   VLLQESMEKEKATDSLMLQVRDMDSVQKILKGELRIQKESNDSMSLQLSKTQESNIELVS  416

Query  1219  VLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFKL  1398
             +LQEMEETV+ +K+EIENL  LN                             +Q  E KL
Sbjct  417   ILQEMEETVENQKLEIENLHILN-----------------------------QQNLEDKL  447

Query  1399  QHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQG----------------------  1512
             Q LQES ++LEN+ +  EK   EK HEIELEQ  R Q                       
Sbjct  448   QQLQESQINLENTTLRLEKIIREKTHEIELEQGHRTQALLDCEEKWKIKSREQEEEIAYL  507

Query  1513  -llelesksssaeeseaNKP--NMHLIEEIESLKKTIQelerecnelteenlellfklke  1683
                     S+ + E+   KP  +  LI E E+LK+ +QELER+C ELTEENLELL++LK 
Sbjct  508   KAELSRILSAESSETNKAKPAADCDLIRENETLKEKLQELERDCKELTEENLELLYELK-  566

Query  1684  SRKDPSENHDMLSSKSLEGPQSE-SLIGSEFETS-----KHGFQFLLLQKEVIEEEVPNS  1845
             S+   S +  +LSS S+EG  SE S  GSEFE S        FQ    +K++I E   + 
Sbjct  567   SKGTSSISGPILSSSSVEGQLSEQSPGGSEFEVSNGELLSSPFQDDKGKKKIIAETAASE  626

Query  1846  LQIHSSGQRENHTCLEPPNFQA-FKCKGCDLNVKLHACCVKATDK-QATEITVNPSEGQR  2019
              +     Q EN   L    F +  K     LN ++ + C +  +K Q TE+   P E  +
Sbjct  627   SKQKICDQEEN---LAQVEFHSRVKDNASRLNAEIISRCFEVQEKDQRTEVAAIPLECHQ  683

Query  2020  DEIDSRNFTLKDVSDRNRYSEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIE  2199
             +E     FT ++V    + SE     D+ +L+  LC                        
Sbjct  684   EESCHGGFTHENVPAMFQSSESGRIEDVYALLTTLCH-----------------------  720

Query  2200  LRNATFYKDISRGTDPMAQKEHAKAVFDKLVQLLRARLVSCTN-DKYSEDGARTEVNNTY  2376
                               + E A AV  KL+QLL  R   C +   + E+  +    +  
Sbjct  721   ----------------TTKDEQADAVLKKLLQLLGYRSALCLDGSNHIEEEPKITAKDAC  764

Query  2377  EIKDKSDYGCSTEKDPCSSHQGYKNF-KELEVKGESIGNNVLTKNSKMLEVKTGCLEEDV  2553
             E++D        EK PCS  Q  ++  K L++K +++ ++ L KNS++LE+KT CL++D 
Sbjct  765   EVQDGEKDDLPEEKTPCSCCQRLEDSNKVLDIKVQNLSSDNLAKNSEILELKTDCLKKDA  824

Query  2554  GLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMREEMMVVTGRIFG  2727
              ++AL H + DL  +I D QM    +E+ ME +Q E  D +   D+    +M +   I G
Sbjct  825   EIEALRHQQTDLRTQISDLQMSKCQMEERMENLQQELSDTSKSLDTSTNGLMFLDQCICG  884

Query  2728  NISEKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMEL  2907
             ++S+   +MK LELE++K ELE  ++ELEK+N+ LSERVSGLEAQLRH +DAME +R+EL
Sbjct  885   DVSKMTLKMKSLELESDKYELELNLYELEKDNVDLSERVSGLEAQLRHLSDAMEFNRLEL  944

Query  2908  QHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATA  3087
             QH G  + NLQ+++RELE +KESQ+L++K++L+EMQKRWLD+QEE EYLKK NPKLQAT 
Sbjct  945   QHSGNHVVNLQEKVRELEHEKESQKLDMKEKLLEMQKRWLDAQEECEYLKKVNPKLQATT  1004

Query  3088  ESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSIL  3267
             ESL+EEC  LQ LN ELR+Q+L+L    N+LEAELRK Q+S S+CL RIESLEA  SS+L
Sbjct  1005  ESLMEECRLLQNLNAELRQQKLKLHTSHNVLEAELRKSQYSFSTCLKRIESLEANFSSVL  1064

Query  3268  EETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQM  3447
             EE  SKEKI+  +L+ + LQTKE +E+L+++E    ++      E+E  Q++   L+ +M
Sbjct  1065  EEIESKEKILKFKLDDLHLQTKEHREKLIVEECTLHEISLENTIEVEKLQEQVQSLMMRM  1124

Query  3448  FD-PSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYE  3624
              +  SD    KA EG     +L A  + L  T++ +  N    E KL  T  E E K   
Sbjct  1125  SNLMSDLGTSKAKEG-----TLAANCEKLLRTMEHLASN----EAKLKCTINELESK---  1172

Query  3625  LMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADA  3804
                                         ++SSE  +                  LQ+ + 
Sbjct  1173  ----------------------------LLSSECQM------------------LQMTEE  1186

Query  3805  NSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQEL  3984
              SSLKI+L  +  L++EVL LKG+L+ MKF++ERL+ +LQL   + EELKA+K SL+QE+
Sbjct  1187  KSSLKIQLHSLPLLQEEVLDLKGALSRMKFESERLQVTLQLKYEDCEELKAEKASLLQEI  1246

Query  3985  TGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRW  4164
             + M  +V E EEC+ +K+ LEEKVLRLEGDLTA+EVMCAK +ELKN+  Q +RVNSQ   
Sbjct  1247  SCMHMAVAEAEECKYKKISLEEKVLRLEGDLTAKEVMCAKVSELKNEACQLRRVNSQFLR  1306

Query  4165  KIKQLELERYYLSKELQSVQEELNRK------ENSVPSPSHSVAKDKTTSCKEQKLSK--  4320
             KIK L+ E+    K+++SV++E  RK      E+ VP    ++ + K +  +E+  SK  
Sbjct  1307  KIKSLQFEKEDCLKQVKSVEKEFKRKQLENQREDDVP----ALEELKLSKAEEEDFSKQF  1362

Query  4321  ------------------ARSSQCNNCET-----IQIVTIDDCSSRCQVGDDKTQFKSLQ  4431
                                 S Q  N E+     +Q       S+    GD  T  ++L+
Sbjct  1363  GITTQSPQPEKYLKQKIQGNSQQDGNKESNYNRDLQETVAKSVSAIQFPGD--TVVQTLE  1420

Query  4432  PE--------GQSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLK  4587
                         S++  +EN  KI QLEAEL+EI +RYLHMS+KYAEVE+Q+ +LVMTLK
Sbjct  1421  SNCIHESHLISLSSKGRDENVHKICQLEAELQEIRDRYLHMSVKYAEVEDQREQLVMTLK  1480

Query  4588  ALQDQRTGTVR*ISQF  4635
             A+ DQ+T     +S F
Sbjct  1481  AMHDQKTARGSYLSSF  1496



>ref|XP_007010076.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY18886.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 1 [Theobroma cacao]
Length=1658

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/1685 (37%), Positives = 942/1685 (56%), Gaps = 211/1685 (13%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQV-------------PKGWDKLSVSLISVEA  201
             MF+L + KS   D SG++F F FS+ QALQV             PKGWDKL VS+ISV+ 
Sbjct  1     MFRLHKQKS---DKSGERFDFKFSSFQALQVILIQFWIIEFLKVPKGWDKLFVSIISVDT  57

Query  202   GKTISKLGKASVNNGTCQW----TESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEA  363
             GKTI+K  KASV NG C+W    +ES+W     +S  +D   FK +V+MGSSR+G LGEA
Sbjct  58    GKTITKSSKASVRNGNCRWAEAFSESIWIVRGDSSEVIDECLFKLVVAMGSSRSGFLGEA  117

Query  364   TVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSV  543
             T+N+  Y +S+++IP+SLPL+KCN GTVL  +I+CLTPR   R ++ N T +Y E+ +  
Sbjct  118   TINLASYISSKSTIPLSLPLKKCNHGTVLQVKIQCLTPREKLRDEQWNHTDSYMEDGSLE  177

Query  544   CNGIDNKSE-------------------------------------ERNNSLPSMEDSLG  612
              + ++NKS+                                     +  NS  S++ S  
Sbjct  178   YDELENKSDVSDSTFTRSVGSSSSNHLEGTIHPGEISSREPSFSASDSRNSFDSLDGSFN  237

Query  613   RDSLssasnssavvnnaIRRLESTESGGSAP-WssysygspksnnspnklsisCQEKHPE  789
             R++ S  +     +   I R +ST S  S+P  S     S +SN+S     +S    HP 
Sbjct  238   RENYSPQNGIMNSL---IGRQDSTGSQTSSPRGSYSLNDSSRSNHSSYTPKVSTSGSHPH  294

Query  790   YTEEEIGQCSLHITRTSI------------PDANIEELKAEARMWELNARRLMVKMETLR  933
                E++ + S  +  + +             +  I EL+AEARMWE NAR+LM  +E LR
Sbjct  295   NHREDLNRVSRLVPSSPLRNTGSSKDFLEAAEITIGELRAEARMWEQNARKLMTDLENLR  354

Query  934   KEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTEN  1113
             +E ++QS+    +E+ LST+  E + L  +++++++LLEES  KQ AA+NL  Q+K TEN
Sbjct  355   RELSDQSKHQKLLEVALSTSQAECDSLKQEVEQVKILLEESQMKQGAADNLKFQSKTTEN  414

Query  1114  ILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSR  1293
             + KE+EDE+KFQ+E N+NL+LQL+K+QESN ELVS+LQE+EET++K+K+E+ NL    S 
Sbjct  415   VQKELEDEIKFQSEENANLALQLKKTQESNIELVSILQELEETIEKQKVEMNNLSRTKSE  474

Query  1294  SDVMGVINSCGDEDNVQPKSTEQV-------------------------SVEKQCQEFKL  1398
              + +G  +  G E++ Q  + +QV                           E +  E + 
Sbjct  475   FEELGK-DDFGFEESSQINAGKQVLTNQTRKSSDSDRESGIVEHQRRDLHAENRNLELQF  533

Query  1399  QHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQGl---------------------  1515
             Q LQESH +LE++I+  +K+ EEK HE+E+EQ LR+Q L                     
Sbjct  534   QQLQESHKNLESTILFLKKSLEEKNHEMEIEQGLRSQSLMDCEAEWRGKLAEKEEKITNL  593

Query  1516  ----lelesksssaeeseaNKPNMHLIEEIESLKKTIQelerecnelteenlellfklke  1683
                  E        E    N+ N +LI EIE+L+  +QELER+CNELT+ENLELLFKLKE
Sbjct  594   EVKLSEALDGQGLKEMGSGNEGNSNLIREIEALRLKVQELERDCNELTDENLELLFKLKE  653

Query  1684  SRKDPSENHDMLSSKSLEGPQSESLIGSEFETSKHGFQFLLLQKEVIEEEVPNSLQIHSS  1863
             S KD S   + L     + P   S    + E +   ++  L +K   E    + L   S 
Sbjct  654   SSKDHSATSNSLLP---DHPGKNSPSRHKLEVTSCNYEDELNKKTPTEVHSADHLHFQSV  710

Query  1864  --GQRENHTCLEPPNFQAFKCKGCDLNVKLHACCVKATDKQATEITV---NPSEGQRDEI  2028
               G R  H     P  +AFK K   L+ +L  C  +A ++Q  EI          Q+ EI
Sbjct  711   VLGNRCAHL---EPQLEAFKDKASYLDGELSECRARA-EEQEIEIVALQQQLKHYQQVEI  766

Query  2029  DSRNFTLKDVSDRNRYSEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRN  2208
             +S++      ++ +R SE     ++  L+  L EQ+ +   ++  + + L S  N     
Sbjct  767   ESKDQPAHAFTE-SRISESTAAVEMSKLLAELDEQIQLSLGDIKRL-YTLKSHANPHGIC  824

Query  2209  ATFYKDISRGTDPMAQKEHAKAV---FDKLVQLLRARLVSCTNDKYSEDGARTEVNNTYE  2379
              +    I + TD ++QK+  + +   F +L Q  R + ++ ++D+Y              
Sbjct  825   GSNDSQILKSTDLVSQKQQVEIILNNFAQLKQFFREK-IAVSDDEY--------------  869

Query  2380  IKDKSDYGCSTEKDPCSSHQGYKNFKELEV---KGESIGNNVLTKNSKMLEVKTGCLEED  2550
              K+  D   ST+ D     +G+K  KEL     +   +G  +  K S++ ++K+  L ++
Sbjct  870   YKEAKDSAVSTD-DILDKLEGFK-LKELNSPCKEDSDLGKELSAKISEIEKLKSENLLKE  927

Query  2551  VGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRI  2721
               L+AL H +++L  ++   Q     +E+++E +   +  +T+   D +R E++++   +
Sbjct  928   DELEALRHQQKELEAQVSSVQTEKSQLEENIE-IMLREGAVTAKCLDDLRTEIVLLNSNM  986

Query  2722  FGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSR  2898
                IS  KI   K  ELE+ KQELE  + ELE+EN+QLSER+ GLEAQLR+ TD  E  R
Sbjct  987   DSQISANKILVKKSSELESGKQELEVHLSELEEENVQLSERICGLEAQLRYLTDERESHR  1046

Query  2899  MELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQ  3078
             +ELQ+  +Q  N ++EI+ LE + E+Q+++++Q++ EMQKRWL+ QEE +YLK ANPKLQ
Sbjct  1047  LELQNSESQAMNFKEEIKRLENEMEAQKVDMRQKMDEMQKRWLEVQEECKYLKIANPKLQ  1106

Query  3079  ATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLS  3258
             AT E+LIEEC  LQ  NGELR+Q++EL   C +LEAEL++ +   S+ ++ +E+LE K S
Sbjct  1107  ATTENLIEECSMLQKANGELRKQKMELHEHCAVLEAELKESEKVFSNMVNEVEALEEKYS  1166

Query  3259  SILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLV  3438
              +LEE +SKEK +N ELE++L + K+ KE+LV++ESL +Q    K  E++  Q++  HL 
Sbjct  1167  MMLEEIASKEKALNLELEVLLQENKKQKEKLVLEESLLNQRYLEKTVEVDNLQREVAHLT  1226

Query  3439  NQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKV  3618
              Q+    D ++  ASE   E+  L A+  ML+  LQ+ Q  L+++E KL   Q+E E ++
Sbjct  1227  EQISATQDVKEKTASEAVLEVSHLRADKAMLEAALQDAQGKLKLSESKLNAMQVECETEL  1286

Query  3619  YELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlA  3798
               L  EL A K  Q +L A  +KL   LE+V S+E  LK  +  LE KL  SE +  QL 
Sbjct  1287  QGLKEELAAAKQKQEILMADHEKLLDLLEDVKSNEDKLKGTVRGLELKLKASEYQNQQLV  1346

Query  3799  DANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQ  3978
             +  SSLK++L K A L+DE+LALK ++++ KF+NERLEAS Q++  + EELK ++T  +Q
Sbjct  1347  EEISSLKVQLQKTALLQDEILALKKTISETKFENERLEASFQMLSRDYEELKVERTLFVQ  1406

Query  3979  ELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQL  4158
             +++  Q +V++LE+CR RKV LEEKVLRL+GDLTA+E M  ++A LKN+L Q +R NSQ 
Sbjct  1407  KISNSQEAVSDLEDCRRRKVALEEKVLRLQGDLTAKEAMGTQEAALKNELAQIRRENSQF  1466

Query  4159  RWKIKQLELERYYLSKELQSVQEELNR-------KENSVPSPSHSVAKDKTTS-------  4296
             + KIK LE E+    K+ Q++++EL +        +NS+   ++ ++ +K  +       
Sbjct  1467  QRKIKYLEEEKEECLKKTQALEDELKQIKQDQCESKNSIEENNNLLSSEKLFTGINQVQH  1526

Query  4297  -CKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDD------------KTQFKSLQPE  4437
               +E      +S  CNN ET Q   + D  S+ Q  D+            K Q KSL  +
Sbjct  1527  HLEENHTQIDKSQNCNN-ETSQDKGV-DLLSKIQNLDNELAEALEANDMYKNQLKSLLSK  1584

Query  4438  GQSTRSGNENE--------------QKISQLEAELKEISERYLHMSLKYAEVENQKGKLV  4575
               S RS    +              +  S LE ELKE+ ERY  MSLKYAEVE+Q+ +LV
Sbjct  1585  EVSYRSAGPEKSTGEGAARKDGCECKASSALETELKELRERYFQMSLKYAEVEDQREQLV  1644

Query  4576  MTLKA  4590
             M LKA
Sbjct  1645  MQLKA  1649



>ref|XP_007010078.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 3, partial [Theobroma cacao]
 gb|EOY18888.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 3, partial [Theobroma cacao]
Length=1520

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/1488 (38%), Positives = 856/1488 (58%), Gaps = 155/1488 (10%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L + KS   D SG++F F FS+ QALQVPKGWDKL VS+ISV+ GKTI+K  KASV 
Sbjct  1     MFRLHKQKS---DKSGERFDFKFSSFQALQVPKGWDKLFVSIISVDTGKTITKSSKASVR  57

Query  241   NGTCQW----TESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NG C+W    +ES+W     +S  +D   FK +V+MGSSR+G LGEAT+N+  Y +S+++
Sbjct  58    NGNCRWAEAFSESIWIVRGDSSEVIDECLFKLVVAMGSSRSGFLGEATINLASYISSKST  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSE----  570
             IP+SLPL+KCN GTVL  +I+CLTPR   R ++ N T +Y E+ +   + ++NKS+    
Sbjct  118   IPLSLPLKKCNHGTVLQVKIQCLTPREKLRDEQWNHTDSYMEDGSLEYDELENKSDVSDS  177

Query  571   ---------------------------------ERNNSLPSMEDSLGRDSLssasnssav  651
                                              +  NS  S++ S  R++ S  +     
Sbjct  178   TFTRSVGSSSSNHLEGTIHPGEISSREPSFSASDSRNSFDSLDGSFNRENYSPQNGIMNS  237

Query  652   vnnaIRRLESTESGGSAP-WssysygspksnnspnklsisCQEKHPEYTEEEIGQCSLHI  828
             +   I R +ST S  S+P  S     S +SN+S     +S    HP    E++ + S  +
Sbjct  238   L---IGRQDSTGSQTSSPRGSYSLNDSSRSNHSSYTPKVSTSGSHPHNHREDLNRVSRLV  294

Query  829   TRTSI------------PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADM  972
               + +             +  I EL+AEARMWE NAR+LM  +E LR+E ++QS+    +
Sbjct  295   PSSPLRNTGSSKDFLEAAEITIGELRAEARMWEQNARKLMTDLENLRRELSDQSKHQKLL  354

Query  973   EMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQT  1152
             E+ LST+  E + L  +++++++LLEES  KQ AA+NL  Q+K TEN+ KE+EDE+KFQ+
Sbjct  355   EVALSTSQAECDSLKQEVEQVKILLEESQMKQGAADNLKFQSKTTENVQKELEDEIKFQS  414

Query  1153  ESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDE  1332
             E N+NL+LQL+K+QESN ELVS+LQE+EET++K+K+E+ NL    S  + +G  +  G E
Sbjct  415   EENANLALQLKKTQESNIELVSILQELEETIEKQKVEMNNLSRTKSEFEELGK-DDFGFE  473

Query  1333  DNVQPKSTEQV-------------------------SVEKQCQEFKLQHLQESHMSLENS  1437
             ++ Q  + +QV                           E +  E + Q LQESH +LE++
Sbjct  474   ESSQINAGKQVLTNQTRKSSDSDRESGIVEHQRRDLHAENRNLELQFQQLQESHKNLEST  533

Query  1438  IICQEKAQEEKIHEIELEQDLRAQGl-------------------------lelesksss  1542
             I+  +K+ EEK HE+E+EQ LR+Q L                          E       
Sbjct  534   ILFLKKSLEEKNHEMEIEQGLRSQSLMDCEAEWRGKLAEKEEKITNLEVKLSEALDGQGL  593

Query  1543  aeeseaNKPNMHLIEEIESLKKTIQelerecnelteenlellfklkeSRKDPSENHDMLS  1722
              E    N+ N +LI EIE+L+  +QELER+CNELT+ENLELLFKLKES KD S   + L 
Sbjct  594   KEMGSGNEGNSNLIREIEALRLKVQELERDCNELTDENLELLFKLKESSKDHSATSNSLL  653

Query  1723  SKSLEGPQSESLIGSEFETSKHGFQFLLLQKEVIEEEVPNSLQIHSS--GQRENHTCLEP  1896
                 + P   S    + E +   ++  L +K   E    + L   S   G R  H     
Sbjct  654   P---DHPGKNSPSRHKLEVTSCNYEDELNKKTPTEVHSADHLHFQSVVLGNRCAHL---E  707

Query  1897  PNFQAFKCKGCDLNVKLHACCVKATDKQATEITV---NPSEGQRDEIDSRNFTLKDVSDR  2067
             P  +AFK K   L+ +L  C  +A ++Q  EI          Q+ EI+S++      ++ 
Sbjct  708   PQLEAFKDKASYLDGELSECRARA-EEQEIEIVALQQQLKHYQQVEIESKDQPAHAFTE-  765

Query  2068  NRYSEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKDISRGTDP  2247
             +R SE     ++  L+  L EQ+ +   ++  + + L S  N      +    I + TD 
Sbjct  766   SRISESTAAVEMSKLLAELDEQIQLSLGDIKRL-YTLKSHANPHGICGSNDSQILKSTDL  824

Query  2248  MAQKEHAKAV---FDKLVQLLRARLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEK  2418
             ++QK+  + +   F +L Q  R + ++ ++D+Y               K+  D   ST+ 
Sbjct  825   VSQKQQVEIILNNFAQLKQFFREK-IAVSDDEY--------------YKEAKDSAVSTD-  868

Query  2419  DPCSSHQGYKNFKELEV---KGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDL  2589
             D     +G+K  KEL     +   +G  +  K S++ ++K+  L ++  L+AL H +++L
Sbjct  869   DILDKLEGFK-LKELNSPCKEDSDLGKELSAKISEIEKLKSENLLKEDELEALRHQQKEL  927

Query  2590  ANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMK  2757
               ++   Q     +E+++E +   +  +T+   D +R E++++   +   IS  KI   K
Sbjct  928   EAQVSSVQTEKSQLEENIE-IMLREGAVTAKCLDDLRTEIVLLNSNMDSQISANKILVKK  986

Query  2758  ILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNL  2937
               ELE+ KQELE  + ELE+EN+QLSER+ GLEAQLR+ TD  E  R+ELQ+  +Q  N 
Sbjct  987   SSELESGKQELEVHLSELEEENVQLSERICGLEAQLRYLTDERESHRLELQNSESQAMNF  1046

Query  2938  QDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSL  3117
             ++EI+ LE + E+Q+++++Q++ EMQKRWL+ QEE +YLK ANPKLQAT E+LIEEC  L
Sbjct  1047  KEEIKRLENEMEAQKVDMRQKMDEMQKRWLEVQEECKYLKIANPKLQATTENLIEECSML  1106

Query  3118  QILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIM  3297
             Q  NGELR+Q++EL   C +LEAEL++ +   S+ ++ +E+LE K S +LEE +SKEK +
Sbjct  1107  QKANGELRKQKMELHEHCAVLEAELKESEKVFSNMVNEVEALEEKYSMMLEEIASKEKAL  1166

Query  3298  NSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGK  3477
             N ELE++L + K+ KE+LV++ESL +Q    K  E++  Q++  HL  Q+    D ++  
Sbjct  1167  NLELEVLLQENKKQKEKLVLEESLLNQRYLEKTVEVDNLQREVAHLTEQISATQDVKEKT  1226

Query  3478  ASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTN  3657
             ASE   E+  L A+  ML+  LQ+ Q  L+++E KL   Q+E E ++  L  EL A K  
Sbjct  1227  ASEAVLEVSHLRADKAMLEAALQDAQGKLKLSESKLNAMQVECETELQGLKEELAAAKQK  1286

Query  3658  QVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKI  3837
             Q +L A  +KL   LE+V S+E  LK  +  LE KL  SE +  QL +  SSLK++L K 
Sbjct  1287  QEILMADHEKLLDLLEDVKSNEDKLKGTVRGLELKLKASEYQNQQLVEEISSLKVQLQKT  1346

Query  3838  AFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELE  4017
             A L+DE+LALK ++++ KF+NERLEAS Q++  + EELK ++T  +Q+++  Q +V++LE
Sbjct  1347  ALLQDEILALKKTISETKFENERLEASFQMLSRDYEELKVERTLFVQKISNSQEAVSDLE  1406

Query  4018  ECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLR  4161
             +CR RKV LEEKVLRL+GDLTA+E M  ++A LKN+L Q +R NSQ +
Sbjct  1407  DCRRRKVALEEKVLRLQGDLTAKEAMGTQEAALKNELAQIRRENSQFQ  1454



>ref|XP_007010077.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOY18887.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 2, partial [Theobroma cacao]
Length=1438

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/1393 (37%), Positives = 791/1393 (57%), Gaps = 146/1393 (10%)
 Frame = +1

Query  328   MGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVN  507
             MGSSR+G LGEAT+N+  Y +S+++IP+SLPL+KCN GTVL  +I+CLTPR   R ++ N
Sbjct  1     MGSSRSGFLGEATINLASYISSKSTIPLSLPLKKCNHGTVLQVKIQCLTPREKLRDEQWN  60

Query  508   STAAYNEEENSVCNGIDNKSE-------------------------------------ER  576
              T +Y E+ +   + ++NKS+                                     + 
Sbjct  61    HTDSYMEDGSLEYDELENKSDVSDSTFTRSVGSSSSNHLEGTIHPGEISSREPSFSASDS  120

Query  577   NNSLPSMEDSLGRDSLssasnssavvnnaIRRLESTESGGSAP-Wssysygspksnnspn  753
              NS  S++ S  R++ S  +     +   I R +ST S  S+P  S     S +SN+S  
Sbjct  121   RNSFDSLDGSFNRENYSPQNGIMNSL---IGRQDSTGSQTSSPRGSYSLNDSSRSNHSSY  177

Query  754   klsisCQEKHPEYTEEEIGQCSLHITRTSI------------PDANIEELKAEARMWELN  897
                +S    HP    E++ + S  +  + +             +  I EL+AEARMWE N
Sbjct  178   TPKVSTSGSHPHNHREDLNRVSRLVPSSPLRNTGSSKDFLEAAEITIGELRAEARMWEQN  237

Query  898   ARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAA  1077
             AR+LM  +E LR+E ++QS+    +E+ LST+  E + L  +++++++LLEES  KQ AA
Sbjct  238   ARKLMTDLENLRRELSDQSKHQKLLEVALSTSQAECDSLKQEVEQVKILLEESQMKQGAA  297

Query  1078  ENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKK  1257
             +NL  Q+K TEN+ KE+EDE+KFQ+E N+NL+LQL+K+QESN ELVS+LQE+EET++K+K
Sbjct  298   DNLKFQSKTTENVQKELEDEIKFQSEENANLALQLKKTQESNIELVSILQELEETIEKQK  357

Query  1258  IEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQV------------------------  1365
             +E+ NL    S  + +G  +  G E++ Q  + +QV                        
Sbjct  358   VEMNNLSRTKSEFEELGK-DDFGFEESSQINAGKQVLTNQTRKSSDSDRESGIVEHQRRD  416

Query  1366  -SVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQGl---------  1515
                E +  E + Q LQESH +LE++I+  +K+ EEK HE+E+EQ LR+Q L         
Sbjct  417   LHAENRNLELQFQQLQESHKNLESTILFLKKSLEEKNHEMEIEQGLRSQSLMDCEAEWRG  476

Query  1516  ----------------lelesksssaeeseaNKPNMHLIEEIESLKKTIQelerecnelt  1647
                              E        E    N+ N +LI EIE+L+  +QELER+CNELT
Sbjct  477   KLAEKEEKITNLEVKLSEALDGQGLKEMGSGNEGNSNLIREIEALRLKVQELERDCNELT  536

Query  1648  eenlellfklkeSRKDPSENHDMLSSKSLEGPQSESLIGSEFETSKHGFQFLLLQKEVIE  1827
             +ENLELLFKLKES KD S   + L     + P   S    + E +   ++  L +K   E
Sbjct  537   DENLELLFKLKESSKDHSATSNSLLP---DHPGKNSPSRHKLEVTSCNYEDELNKKTPTE  593

Query  1828  EEVPNSLQIHSS--GQRENHTCLEPPNFQAFKCKGCDLNVKLHACCVKATDKQATEITV-  1998
                 + L   S   G R  H     P  +AFK K   L+ +L  C  +A ++Q  EI   
Sbjct  594   VHSADHLHFQSVVLGNRCAHL---EPQLEAFKDKASYLDGELSECRARA-EEQEIEIVAL  649

Query  1999  --NPSEGQRDEIDSRNFTLKDVSDRNRYSEPETTFDIDSLVPALCEQLGIFFHNVNGVEH  2172
                    Q+ EI+S++      ++ +R SE     ++  L+  L EQ+ +   ++  + +
Sbjct  650   QQQLKHYQQVEIESKDQPAHAFTE-SRISESTAAVEMSKLLAELDEQIQLSLGDIKRL-Y  707

Query  2173  MLFSPVNIELRNATFYKDISRGTDPMAQKEHAKAV---FDKLVQLLRARLVSCTNDKYSE  2343
              L S  N      +    I + TD ++QK+  + +   F +L Q  R + ++ ++D+Y  
Sbjct  708   TLKSHANPHGICGSNDSQILKSTDLVSQKQQVEIILNNFAQLKQFFREK-IAVSDDEY--  764

Query  2344  DGARTEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNFKELEV---KGESIGNNVLTKNSK  2514
                          K+  D   ST+ D     +G+K  KEL     +   +G  +  K S+
Sbjct  765   ------------YKEAKDSAVSTD-DILDKLEGFK-LKELNSPCKEDSDLGKELSAKISE  810

Query  2515  MLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DS  2685
             + ++K+  L ++  L+AL H +++L  ++   Q     +E+++E +   +  +T+   D 
Sbjct  811   IEKLKSENLLKEDELEALRHQQKELEAQVSSVQTEKSQLEENIE-IMLREGAVTAKCLDD  869

Query  2686  MREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQ  2862
             +R E++++   +   IS  KI   K  ELE+ KQELE  + ELE+EN+QLSER+ GLEAQ
Sbjct  870   LRTEIVLLNSNMDSQISANKILVKKSSELESGKQELEVHLSELEEENVQLSERICGLEAQ  929

Query  2863  LRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEE  3042
             LR+ TD  E  R+ELQ+  +Q  N ++EI+ LE + E+Q+++++Q++ EMQKRWL+ QEE
Sbjct  930   LRYLTDERESHRLELQNSESQAMNFKEEIKRLENEMEAQKVDMRQKMDEMQKRWLEVQEE  989

Query  3043  SEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSC  3222
              +YLK ANPKLQAT E+LIEEC  LQ  NGELR+Q++EL   C +LEAEL++ +   S+ 
Sbjct  990   CKYLKIANPKLQATTENLIEECSMLQKANGELRKQKMELHEHCAVLEAELKESEKVFSNM  1049

Query  3223  LSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSE  3402
             ++ +E+LE K S +LEE +SKEK +N ELE++L + K+ KE+LV++ESL +Q    K  E
Sbjct  1050  VNEVEALEEKYSMMLEEIASKEKALNLELEVLLQENKKQKEKLVLEESLLNQRYLEKTVE  1109

Query  3403  LEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVK  3582
             ++  Q++  HL  Q+    D ++  ASE   E+  L A+  ML+  LQ+ Q  L+++E K
Sbjct  1110  VDNLQREVAHLTEQISATQDVKEKTASEAVLEVSHLRADKAMLEAALQDAQGKLKLSESK  1169

Query  3583  LVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesk  3762
             L   Q+E E ++  L  EL A K  Q +L A  +KL   LE+V S+E  LK  +  LE K
Sbjct  1170  LNAMQVECETELQGLKEELAAAKQKQEILMADHEKLLDLLEDVKSNEDKLKGTVRGLELK  1229

Query  3763  lllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGEN  3942
             L  SE +  QL +  SSLK++L K A L+DE+LALK ++++ KF+NERLEAS Q++  + 
Sbjct  1230  LKASEYQNQQLVEEISSLKVQLQKTALLQDEILALKKTISETKFENERLEASFQMLSRDY  1289

Query  3943  EELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKN  4122
             EELK ++T  +Q+++  Q +V++LE+CR RKV LEEKVLRL+GDLTA+E M  ++A LKN
Sbjct  1290  EELKVERTLFVQKISNSQEAVSDLEDCRRRKVALEEKVLRLQGDLTAKEAMGTQEAALKN  1349

Query  4123  DLTQSKRVNSQLR  4161
             +L Q +R NSQ +
Sbjct  1350  ELAQIRRENSQFQ  1362



>gb|KDP45065.1| hypothetical protein JCGZ_01565 [Jatropha curcas]
Length=1432

 Score =   552 bits (1422),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 495/1359 (36%), Positives = 764/1359 (56%), Gaps = 125/1359 (9%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +  IEEL+AEARMWE NAR+LM+ ME LR++ ++Q  R   +E+E++ + TE + L   
Sbjct  95    AEVTIEELRAEARMWEQNARKLMIDMEKLRRDLSDQLNRQESLEIEVTESRTECDGLKQQ  154

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I+ ++ LLEES  KQ +AE LN QAK  +++ K++EDE+KFQ ESN++L+LQL+K+QESN
Sbjct  155   IEEMKFLLEESIGKQKSAETLNYQAKEMDDLQKQLEDEVKFQKESNADLALQLKKTQESN  214

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEK--  1377
              ELVS+LQE+E+T++K+K EI NL  + S    +G     G E+N + K  E+V V+   
Sbjct  215   IELVSILQELEDTIEKQKKEIANLSKMQSEDKNLGKY-GLGFEENGEIKPNEEVPVKDIS  273

Query  1378  --QCQ------------------------EFKLQHLQESHMSLENSIICQEKAQEEKIHE  1479
                C                         E ++Q L+ES  +LE++I   EK+ EEK  E
Sbjct  274   KVSCDSYLEVEHELVNLPSGLEPDGERDLELEIQKLRESAKNLESTIQFLEKSLEEKTCE  333

Query  1480  IELEQDLRAQGll--------------------elesksssaeeseaNKPNMHLIEEIES  1599
             +E E+ L+ Q L+                    E     +   +   N  N +L++E+E 
Sbjct  334   LEDERSLKTQTLMDFEAQWRDKLSVKEEKIINLEARLSEALKADGLENADNNNLMKEVEV  393

Query  1600  LKKTIQelerecnelteenlellfklkeSRKD-PS--ENHDMLSSKSLEGPQSESLIGSE  1770
             LK+ I+ELE++CNELT+EN+ELL KLKES+ D P    + + LS+  LE   ++SL  SE
Sbjct  394   LKQRIEELEKDCNELTDENIELLLKLKESKGDLPGCGASSNSLSNGFLE---NDSLSTSE  450

Query  1771  FETSKHGFQFLLLQKE------VIEEEVPNSLQIHSSGQRENHTCLEPPNFQAFKCKGCD  1932
                SK   Q   L++E      +IE    + LQ    G  +  + LE    QA+K K C 
Sbjct  451   STVSKMKSQICKLEEELNEKEMLIERLSTDKLQNQFIGLEKKCSDLEV-QLQAYKDKTCY  509

Query  1933  LNVKLHACCVKATDKQATEITVNPSE--GQRDEIDSRNFTLKDVSDRNRYSEPETTFDID  2106
             LN +L  C  +A ++Q  EI     +    +++   +N    D+    + S+ +   +I 
Sbjct  510   LNDELCKCQARA-EEQEIEIAALQQQLVSYQEKETQKNGQFADMRAEFKSSQSDDAVEIS  568

Query  2107  SLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKDISRGTDPMAQKEHAKAVFDK  2286
               +  L EQ+ +   N    ++ +  P   E  N  +   I   TD  +QK+ A A+ + 
Sbjct  569   KTLSELHEQIQLCLSNAKKQQYDINFPSTAE--NYHYNTLIPNATDFFSQKDLAIAILNS  626

Query  2287  LVQL---LRARLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNFK  2457
              VQL     A++ +   +            N  E++ K +  C+ E++   +    ++  
Sbjct  627   FVQLKDLFEAKVGTLEVELKRNGKVSAREANGGEVQKKLE-TCNLEENALRTSNLGQDL-  684

Query  2458  ELEVKGESI--GNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMV  2631
             +++ K E    G  +L K S++ ++K+  L  +  +K+L +C+R+L  +I + +     +
Sbjct  685   QMKFKPEITDSGKEILEKISEIEKLKSDNLLTEEQVKSLRNCQRELETQISNLKNERTQL  744

Query  2632  EKDMEKVQTEK-------DDITSDSM--REEMMVVTG--------RIFGNI------SEK  2742
             E+D+E +  E        DD  +++M     +M  TG        R   +       +E 
Sbjct  745   EEDVEVMIREGAKTSACLDDSCNETMVINSSIMTSTGLDELQNETRFLNSTINSHLPTEN  804

Query  2743  IQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGT  2922
                 K+LELE+ K E+E+ + ELEKEN+ LSER+SGLEAQLR+ TD  E SR+EL +  +
Sbjct  805   TLPSKLLELESSKCEVEAHLSELEKENVWLSERISGLEAQLRYLTDERETSRLELHNSES  864

Query  2923  QLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIE  3102
                NLQ+EI  L+ + E+Q+ + KQ+L  MQK+WL++Q E EYLK AN KLQ TAESLI+
Sbjct  865   SAINLQEEINRLKSELEAQKSDGKQKLQGMQKQWLETQSECEYLKIANVKLQMTAESLID  924

Query  3103  ECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSS  3282
             EC  LQ    ELR+Q+LEL   C +LEAELR+ ++  S  L  IESLE K + +LEE ++
Sbjct  925   ECSLLQQSIIELRKQKLELHGHCAILEAELRESRNGFSDVLKEIESLEGKYALMLEEITT  984

Query  3283  KEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSD  3462
             KEK +  EL+ +L + K ++E+LV +ESL +Q+   K  E E   ++   L   +    +
Sbjct  985   KEKALGLELDALLQENKTYREKLVTEESLLNQMYLEKEVEAENLHREIARLTEYISATPE  1044

Query  3463  REDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELN  3642
              ++   S    E+  L A+  MLK +LQEIQQ L+++E  L T QME E K+  LM EL+
Sbjct  1045  EKERTGSAAMIEVSQLRADKAMLKASLQEIQQKLKLSESNLSTLQMESETKLLGLMDELS  1104

Query  3643  AHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKI  3822
             A K N  VL A  +KL   LE+V S+E   K I+  L+ KL  S   RLQL +  SSL++
Sbjct  1105  ASKQNLDVLMADHEKLLELLEDVKSNEEKHKNIVRGLDLKLKASAYVRLQLEEEISSLRV  1164

Query  3823  ELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNS  4002
             +L K A  +DE+L+LK SL++++F+N+RLE S Q++ G+ EELKA+K  L+Q ++ MQ +
Sbjct  1165  QLQKTAVFQDEILSLKRSLDEVQFENQRLEVSHQILSGDQEELKAEKMVLLQMISDMQRA  1224

Query  4003  VTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLE  4182
             V ELE C+  KV LEEKVLRL+GDLTARE + A+DAELKN+L++ KR NS+L+ KI++L+
Sbjct  1225  VYELESCKRSKVSLEEKVLRLQGDLTAREALGAEDAELKNELSRVKRANSELQRKIRELQ  1284

Query  4183  LERYYLSKELQSVQEELNRKENSVP--SPSHS------VAKDKTTSCK-------EQKLS  4317
              E+    +  Q+ + EL +K  +    SP+ S       ++D   S         E K  
Sbjct  1285  EEKQEYLRRTQAFEAELKKKRKAAKQDSPNSSDTSLDVYSEDNAISSNTSSQVDIETKFV  1344

Query  4318  KARSSQCNNCETIQIVTIDDCSSRCQVGDD--KTQFKSLQPEGQSTRSGNENEQKISQLE  4491
                S+      +++I  +++  +     +D  KTQ KSL  EG           K+S +E
Sbjct  1345  PGSSTVMGIDPSLKIEQLENELAETLEANDMYKTQLKSLLNEG-----------KLSSME  1393

Query  4492  AELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQRT  4608
              EL+E+ + Y HMSLK AEVE+++ +LV+ L+A+ + R+
Sbjct  1394  IELRELRDSYFHMSLKCAEVESEREQLVLKLRAVSNGRS  1432



>ref|XP_006436553.1| hypothetical protein CICLE_v10033678mg [Citrus clementina]
 gb|ESR49793.1| hypothetical protein CICLE_v10033678mg [Citrus clementina]
Length=1507

 Score =   536 bits (1381),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 498/1377 (36%), Positives = 763/1377 (55%), Gaps = 147/1377 (11%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +  IEEL AEARMWE NAR+LM  +E ++++  +Q  R A +EMELS +H + + L  +
Sbjct  151   AEVKIEELHAEARMWEQNARKLMTNLEKVQQQSLDQLARQASLEMELSKSHAQCDGLKQE  210

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I+ L+ L +ES  +  A ENL  QA++T+  + E+EDE+KFQ ESN+NL++QL K+QESN
Sbjct  211   IEWLKKLAKESEVQSTATENLKFQARDTDKKINELEDEIKFQKESNANLAIQLNKTQESN  270

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSR-SDVMG---VIN-------------SCGDE  1332
              EL+S+LQE+EET+ K+K+EIE+L  + S   +V+G    IN             SC  +
Sbjct  271   IELISILQELEETLAKQKMEIEDLSKMKSEFEEVVGDSKQINTAKQILVKKRQDTSCDSD  330

Query  1333  DNV----QPKSTEQVSVEKQCQ---EFKLQHLQESHMSLENSIICQEKAQEEKIHEIELE  1491
               V     P       +E+Q     E +LQ LQE+  +LE+++   EK+  EK HEIE+E
Sbjct  331   QEVSIVEHPIRDLNAKIEQQDDRNLELELQKLQEAKKNLESTVQFLEKSLVEKSHEIEME  390

Query  1492  QDLRAQGlleles-------------------------ksssaeeseaNKPNMHLIEEIE  1596
             + L+ Q L+  E+                           +  E+S  N+ +  L++E++
Sbjct  391   RHLKTQTLMHYEAEWRSRIAEKEENIVNLEAKLSEVLCAQALKEKSFGNEDDHDLVKEVD  450

Query  1597  SLKKTIQelerecnelteenlellfklkeSRKDPSENHDMLS--SKSLEGPQSESLIGSE  1770
              LK+ + ELE++CNELTEENL LLFKLKES KD      +L+  + S E P ++S+  SE
Sbjct  451   VLKQKVLELEKDCNELTEENLALLFKLKESGKD------LLTGGASSHECPDNKSVFESE  504

Query  1771  FETSKHGFQFLLLQKEVIEEEVPNSLQIHSSGQRENHTCLEPPNFQAFKCKGCDLNVKLH  1950
              E  +   Q   L++E+ E    N+L I      EN +       QAFK K C L+ +L 
Sbjct  505   SEVVQLKSQICKLEEELQER---NAL-IERLSTYENSSDDLENQLQAFKDKVCYLDGEL-  559

Query  1951  ACCVKATDKQATEITVNPSEGQRDEIDSRNFTLKD----VSDRNRYSEPETTFDIDSLVP  2118
               C      Q  E+ +   + Q +    +    KD    V    +  E +   ++  L+ 
Sbjct  560   --CKSRFRVQEQEVQIAALQQQLELFQGKEAESKDHPAAVCPLCKIYESDDFLEMSRLLS  617

Query  2119  ALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKD---ISRGTDPMAQKEHAKAVFDKL  2289
              L EQ+ +   N+   + +L  P       + F  D   +   TD   QKE  +A+ +  
Sbjct  618   ELYEQIQLSLANLKK-QQLLQQP-------SAFGSDKSIVPTSTDLTTQKERVEAILNNF  669

Query  2290  VQLLR--ARLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNFKEL  2463
             ++L R     ++ + D+       T V    ++      G  + +   S+H    + + +
Sbjct  670   MELKRLFEEKINLSEDEIQSKKEITAVEANSDVDQNGLQGPDSNEIVLSTHIHGVDSQRM  729

Query  2464  EVKGE--SIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             E K +       +L K +++ ++K+  L ++  ++AL HC+ +L N+I D Q     +E+
Sbjct  730   EFKSDVTETAKELLEKIAEIDKLKSDNLRKEEEVEALRHCQNELENQISDLQKEKSQLEE  789

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVF  2805
              +E +   +  + S   + ++ E+MV+   +   +S  +  E K LELE+ K E+E  + 
Sbjct  790   SIE-IMLREGTVASKCLNDLQSEIMVLHRDMDSQVSVNRNLESKSLELESSKHEMEVHLH  848

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
             ELE+EN+QLSER+ GLEAQLR+ T+  E SR+EL++  T   +LQDEIR LE + E+Q++
Sbjct  849   ELEEENLQLSERICGLEAQLRYLTNERESSRLELENSATHAMSLQDEIRRLEAEMEAQKV  908

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
             E KQ+L +MQKRWL  QEE EYLK ANPKLQATAE LIEEC  LQ  N ELR+Q++ L  
Sbjct  909   ETKQKLQDMQKRWLGVQEECEYLKVANPKLQATAEGLIEECSLLQKSNAELRKQKVNLHE  968

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
              C +LEA+L + +   SS   ++E+LE K  S+LEE SSKEK +N EL+ +L + ++ K+
Sbjct  969   HCAVLEAQLGESEKGFSSLSMKVEALEEKYLSMLEEISSKEKALNLELDALLHENRKHKD  1028

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             + V +ESL +Q+   K  E +  Q++  HL  Q+    D +DG  SE   E+  L A+  
Sbjct  1029  KSVTEESLLNQMYMEKTVEAQNLQREVAHLTEQISATYDEKDGTHSEAVLEVSHLRADKA  1088

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
             +L+  LQE+Q  L+++E  L T +ME + K+ +L  EL A + NQ VL A  +KL   LE
Sbjct  1089  VLEAALQEVQGKLKLSESNLGTLRMESQTKIQQLKSELAAARQNQEVLMADHEKLLNLLE  1148

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
             +V  +E   +  I  LE KL  SE ERLQL +  SSLK++L + A  +DEVL+LK SLN+
Sbjct  1149  DVKPNEEKFRGTIRGLELKLKASEYERLQLTEEISSLKVQLERTAQFQDEVLSLKKSLNE  1208

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
              KF+NERLEAS Q++ G+ EELKA++ S +Q+++  Q  V+EL++C+ +KV L+EKVLRL
Sbjct  1209  AKFENERLEASFQILSGDYEELKAERISFMQKISTSQQVVSELDDCKRKKVSLQEKVLRL  1268

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKE  4245
             EGDL A E + +++A LKN+L Q +R NSQ + +IK LE E+       Q+++EEL + +
Sbjct  1269  EGDLAAIEALGSQEAALKNELAQIRRENSQFQRRIKCLEKEKEDCLSRAQAIEEELKQNK  1328

Query  4246  N----------SVPSP------------SH-----------------SVAKDKTTSCKEQ  4308
                        ++P P            SH                 S+   + TSC  Q
Sbjct  1329  EVKWNGCESAATLPHPDSNVTTTSIHDKSHPPMMEQEQNNLHLNEKPSMGTSQETSCTHQ  1388

Query  4309  KLSKARSSQ-CNNCETIQIVTIDDCSSRCQVGDD------------KTQFKSLQPEGQST  4449
                +    + CN   +  + T  D  S+ Q  ++            K+Q KSL  +  ++
Sbjct  1389  NQRQVDDEKHCNLGRSQDVET--DLLSKVQSLENELADALEANDMYKSQLKSLLSKELTS  1446

Query  4450  --RSGNEN---EQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
                +  EN   ++K+S LEAELK++ E YL MSLK AEVE Q+ +LVM LK++   R
Sbjct  1447  PLDTPMENDGYDRKVSSLEAELKDLQECYLQMSLKCAEVEAQREQLVMKLKSVNSGR  1503



>ref|XP_006485296.1| PREDICTED: early endosome antigen 1-like [Citrus sinensis]
Length=1665

 Score =   538 bits (1385),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 498/1377 (36%), Positives = 763/1377 (55%), Gaps = 147/1377 (11%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +  IEEL AEARMWE NAR+LM  +E ++++  +Q  R A +EMELS +H + + L  +
Sbjct  309   AEVKIEELHAEARMWEQNARKLMTNLEKVQQQSLDQLARQASLEMELSKSHAQCDGLKQE  368

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I+ L+ L +ES  +  A ENL  QA++T+  + E+EDE+KFQ ESN+NL++QL K+QESN
Sbjct  369   IEWLKKLAKESEVQSTATENLKFQARDTDKKINELEDEIKFQKESNANLAIQLNKTQESN  428

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSR-SDVMG---VIN-------------SCGDE  1332
              EL+S+LQE+EET+ K+K+EIE+L  + S   +V+G    IN             SC  +
Sbjct  429   IELISILQELEETLAKQKMEIEDLSKMKSEFEEVVGDSKQINTAKQILVKKRQDTSCDSD  488

Query  1333  DNV----QPKSTEQVSVEKQCQ---EFKLQHLQESHMSLENSIICQEKAQEEKIHEIELE  1491
               V     P       +E+Q     E +LQ LQE+  +LE+++   EK+  EK HEIE+E
Sbjct  489   QEVSIVEHPIRDLNAKIEQQDDRNLELELQKLQEAKKNLESTVQFLEKSLVEKSHEIEME  548

Query  1492  QDLRAQGlleles-------------------------ksssaeeseaNKPNMHLIEEIE  1596
             + L+ Q L+  E+                           +  E+S  N+ +  L++E++
Sbjct  549   RHLKTQTLMHYEAEWRSRIAEKEENIVNLEAKLSEVLCAQALKEKSFGNEDDHDLVKEVD  608

Query  1597  SLKKTIQelerecnelteenlellfklkeSRKDPSENHDMLS--SKSLEGPQSESLIGSE  1770
              LK+ + ELE++CNELTEENL LLFKLKES KD      +L+  + S E P ++S+  SE
Sbjct  609   VLKQKVLELEKDCNELTEENLALLFKLKESGKD------LLTGGASSHECPDNKSVFESE  662

Query  1771  FETSKHGFQFLLLQKEVIEEEVPNSLQIHSSGQRENHTCLEPPNFQAFKCKGCDLNVKLH  1950
              E  +   Q   L++E+ E    N+L I      EN +       QAFK K C L+ +L 
Sbjct  663   SEVVQLKSQICKLEEELQER---NAL-IERLSTYENSSDDLENQLQAFKDKVCYLDGEL-  717

Query  1951  ACCVKATDKQATEITVNPSEGQRDEIDSRNFTLKD----VSDRNRYSEPETTFDIDSLVP  2118
               C      Q  E+ +   + Q +    +    KD    V    +  E +   ++  L+ 
Sbjct  718   --CKSRFRVQEQEVQIAALQQQLELFQGKEAESKDHPAAVCPLCKIYESDDFLEMSRLLS  775

Query  2119  ALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKD---ISRGTDPMAQKEHAKAVFDKL  2289
              L EQ+ +   N+   + +L  P       + F  D   +   TD   QKE  +A+ +  
Sbjct  776   ELYEQIQLSLANLKK-QQLLQQP-------SAFGSDKSIVPTSTDLTTQKERVEAILNNF  827

Query  2290  VQLLRA--RLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNFKEL  2463
             ++L R     ++ + D+       T V    ++      G  + +   S+H    + + +
Sbjct  828   MELKRLFEEKINLSEDEIQSKKEITAVEANSDVDQNGLQGPDSNEIVLSTHIHGVDSQRM  887

Query  2464  EVKGE--SIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             E K +       +L K +++ ++K+  L ++  ++AL HC+ +L N+I D Q     +E+
Sbjct  888   EFKSDVTETAKELLEKIAEIDKLKSDNLRKEEEVEALRHCQNELENQISDLQKEKSQLEE  947

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVF  2805
              +E +   +  + S   + ++ E+MV+   +   +S  +  E K LELE+ K E+E  + 
Sbjct  948   SIE-IMLREGTVASKCLNDLQSEIMVLHRDMDSQVSVNRNLESKSLELESSKHEMEVHLH  1006

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
             ELE+EN+QLSER+ GLEAQLR+ T+  E SR+EL++  T   +LQDEIR LE + E+Q++
Sbjct  1007  ELEEENLQLSERICGLEAQLRYLTNERESSRLELENSATHAMSLQDEIRRLEAEMEAQKV  1066

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
             E KQ+L +MQKRWL  QEE EYLK ANPKLQATAE LIEEC  LQ  N ELR+Q++ L  
Sbjct  1067  ETKQKLQDMQKRWLGVQEECEYLKVANPKLQATAEGLIEECSLLQKSNAELRKQKVNLHE  1126

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
              C +LEA+L + +   SS   ++E+LE K  S+LEE SSKEK +N EL+ +L + ++ K+
Sbjct  1127  HCAVLEAQLGESEKGFSSLSMKVEALEEKYLSMLEEISSKEKALNLELDALLHENRKHKD  1186

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             + V +ESL +Q+   K  E +  Q++  HL  Q+    D +DG  SE   E+  L A+  
Sbjct  1187  KSVTEESLLNQMYMEKTVEAQNLQREVAHLTEQISATYDEKDGTHSEAVLEVSHLRADKA  1246

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
             +L+  LQE+Q  L+++E  L T +ME + K+ +L  EL A + NQ VL A  +KL   LE
Sbjct  1247  VLEAALQEVQGKLKLSESNLGTLRMESQTKIQQLKSELAAARQNQEVLMADHEKLLNLLE  1306

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
             +V  +E   +  I  LE KL  SE ERLQL +  SSLK++L + A  +DEVL+LK SLN+
Sbjct  1307  DVKPNEEKFRGTIRGLELKLKASEYERLQLTEEISSLKVQLERTAQFQDEVLSLKKSLNE  1366

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
              KF+NERLEAS Q++ G+ EELKA++ S +Q+++  Q  V+EL++C+ +KV L+EKVLRL
Sbjct  1367  AKFENERLEASFQILSGDYEELKAERISFMQKISTSQQVVSELDDCKRKKVSLQEKVLRL  1426

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKE  4245
             EGDL A E + +++A LKN+L Q +R NSQ + +IK LE E+       Q+++EEL + +
Sbjct  1427  EGDLAAIEALGSQEAALKNELAQIRRENSQFQRRIKCLEKEKEDCLSRAQAIEEELKQNK  1486

Query  4246  N----------SVPSP------------SH-----------------SVAKDKTTSCKEQ  4308
                        ++P P            SH                 S+   + TSC  Q
Sbjct  1487  EVKWNGCESAATLPHPDSNVTTTSIHDKSHPPMMEQEQNNLHLNEKPSMGTSQETSCTHQ  1546

Query  4309  KLSKARSSQ-CNNCETIQIVTIDDCSSRCQVGDD------------KTQFKSLQPEGQST  4449
                +    + CN   +  + T  D  S+ Q  ++            K+Q KSL  +  ++
Sbjct  1547  NQRQVDDEKHCNLGRSQDVET--DLLSKVQSLENELADALEANDMYKSQLKSLLSKELTS  1604

Query  4450  --RSGNEN---EQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
                +  EN   ++K+S LEAELK++ E YL MSLK AEVE Q+ +LVM LK++   R
Sbjct  1605  PLDTPMENDGYDRKVSSLEAELKDLQECYLQMSLKCAEVEAQREQLVMKLKSVNSGR  1661


 Score =   174 bits (442),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 121/182 (66%), Gaps = 8/182 (4%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF  R HK+  SD  G+KF F FS+ QALQVPKGWDKL VS++ VE GKTI+K  KA V 
Sbjct  1    MFS-RLHKNK-SDKFGEKFDFKFSHFQALQVPKGWDKLVVSVVLVETGKTIAKSSKAPVR  58

Query  241  NGTCQW----TESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG C+W    +ES+W P++ A   ++    K +V+ GSSR+GI+GEA VN+  Y +S+ S
Sbjct  59   NGNCRWIETFSESIWIPQDNALKEIEECLIKLVVTTGSSRSGIVGEALVNLASYMSSKTS  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
            +P++LPL+KCN GT L  +I+CLTPR   R ++   T +  E+ N   + ++NKS+  + 
Sbjct  119  VPLTLPLKKCNSGTTLQLKIQCLTPRAKIRDEQWKGTNSDMEDVNVDYDEVENKSDASDG  178

Query  583  SL  588
            + 
Sbjct  179  TF  180



>gb|KDO45169.1| hypothetical protein CISIN_1g041227mg [Citrus sinensis]
Length=1468

 Score =   511 bits (1315),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 446/1204 (37%), Positives = 688/1204 (57%), Gaps = 104/1204 (9%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +  IEEL AEARMWE NAR+LM  +E ++++  +Q  R A +EMELS +H + + L  +
Sbjct  290   AEVKIEELHAEARMWEQNARKLMTDLEKVQQQSLDQLARQASLEMELSKSHAQCDGLKQE  349

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I+ L+ L +ES  +  A ENL  QA++T+  + E+EDE+KFQ ESN+NL++QL K+QESN
Sbjct  350   IEWLKKLAKESEVQSTATENLKFQARDTDKKINELEDEIKFQKESNANLAIQLNKTQESN  409

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSR-SDVMGVINSCGDEDNVQPKSTEQVSVEKQ  1380
              EL+S+LQE+EET+ K+K+EIE+L  + S   +V+G        D+ Q  + +Q+ V+K+
Sbjct  410   IELISILQELEETLAKQKMEIEDLSKMKSEFEEVVG--------DSKQINTAKQILVKKR  461

Query  1381  ----CQ---------------------------EFKLQHLQESHMSLENSIICQEKAQEE  1467
                 C                            E +LQ LQE+  +LE+++   EK+  E
Sbjct  462   RDTSCDSDQEGSIVEHPIRDLNAKIEQQDDRNLELELQKLQEAKKNLESTVQFLEKSLVE  521

Query  1468  KIHEIELEQDLRAQGlleles-------------------------ksssaeeseaNKPN  1572
             K HEIE+E+ L+ Q L+  E+                           +  E+S  N+ +
Sbjct  522   KSHEIEMERHLKTQTLMHYEAEWRSRIAEKEENIVNLEAKLSEVLCAQALKEKSFGNEDD  581

Query  1573  MHLIEEIESLKKTIQelerecnelteenlellfklkeSRKDPSENHDMLS--SKSLEGPQ  1746
               L++E++ LK+ + ELE++CNELTEENL LLFKLKES KD      +L+  + S E P 
Sbjct  582   HDLVKEVDVLKQKVLELEKDCNELTEENLALLFKLKESGKD------LLTGGASSHECPD  635

Query  1747  SESLIGSEFETSKHGFQFLLLQKEVIEEEVPNSLQIHSSGQRENHTCLEPPNFQAFKCKG  1926
             ++S+  SE E  +   Q   L++E+ E    N+L I      EN +       QAFK K 
Sbjct  636   NKSVFESESEVVQLKSQICKLEEELQER---NAL-IERLSTYENRSDDLENQLQAFKDKV  691

Query  1927  CDLNVKLHACCVKATDKQATEITVNPSEGQRDEIDSRNFTLKD----VSDRNRYSEPETT  2094
             C L+ +L   C      Q  E+ +   + Q +    +    KD    V    +  E +  
Sbjct  692   CYLDGEL---CKSRFRAQEQEVQIAALQQQLELFQGKEAESKDHPAAVCPLCKIYESDDF  748

Query  2095  FDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKD---ISRGTDPMAQKEH  2265
              ++  L+  L EQ+ +   N+   + +L  P       + F  D   +   TD   QKE 
Sbjct  749   LEMSRLLSELYEQIQLSLANLKK-QQLLQQP-------SAFGSDKSIVPTSTDLTTQKER  800

Query  2266  AKAVFDKLVQLLRA--RLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKDPCSSHQ  2439
              +A+ +  ++L R     ++ + D+       T V    ++      G  + +   S+H 
Sbjct  801   VEAILNNFMELKRLFEEKINLSEDEIQSKKEITAVEANSDVDQNGLQGPDSNEIVLSTHI  860

Query  2440  GYKNFKELEVKGE--SIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQ  2613
                + + +E K +       +L K +++ ++K+  L ++  ++AL HC+ +L N+I D Q
Sbjct  861   HGVDSQHMEFKSDVTETAKELLEKIAEIDKLKSDNLRKEEEVEALRHCQNELENQISDLQ  920

Query  2614  MVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEK  2781
                  +E+ +E +   +  + S   + ++ E+MV+   +   +S  +  E K LELE+ K
Sbjct  921   KEKSQLEESIE-IMLREGTVASKCLNDLQSEIMVLHRDMDSQVSVNRNLESKSLELESSK  979

Query  2782  QELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELE  2961
              E+E  + ELE+EN+QLSER+ GLEAQLR+ T+  E SR+EL++  T   +LQDEIR LE
Sbjct  980   HEMEVHLHELEEENLQLSERICGLEAQLRYLTNERESSRLELENSATHAMSLQDEIRRLE  1039

Query  2962  KDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELR  3141
              + E+Q++E KQ+L +MQKRWL  QEE EYLK ANPKLQATAE LIEEC  LQ  N ELR
Sbjct  1040  AEMEAQKVETKQKLQDMQKRWLGVQEECEYLKVANPKLQATAEGLIEECSLLQKSNAELR  1099

Query  3142  RQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMIL  3321
             +Q++ L   C +LEA+L + +   SS   ++E+LE K  S+LEE SSKEK +N EL+ +L
Sbjct  1100  KQKVNLHEHCAVLEAQLGESEKGFSSLSMKVEALEEKYLSMLEEISSKEKALNLELDALL  1159

Query  3322  LQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEM  3501
              + ++ K++ V +ESL +Q+   K  E +  Q++  HL  Q+    D +DG  SE   E+
Sbjct  1160  HENRKHKDKSVTEESLLNQMYMEKTVEAQNLQREVAHLTEQISATYDEKDGTHSEAVLEV  1219

Query  3502  HSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKS  3681
               L A+  +L+  LQE+Q  L+++E  L T +ME + K+ +L  EL A + NQ VL A  
Sbjct  1220  SHLRADKAVLEAALQEVQGKLKLSESNLGTLRMESQTKIQQLKSELAAARQNQEVLMADH  1279

Query  3682  DKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVL  3861
             +KL   LE+V  +E   +  I  LE KL  S+ ERLQL +  SSLK++L + A  +DEVL
Sbjct  1280  EKLLNLLEDVKPNEEKFRGTIRGLELKLKASDYERLQLTEEISSLKVQLERTAQFQDEVL  1339

Query  3862  ALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVV  4041
             +LK  LN+ KF+NERLEAS Q++ G+ EELKA++ S +Q+++  Q  V+EL++C+ +KV 
Sbjct  1340  SLKKLLNEAKFENERLEASFQILSGDYEELKAERISFMQKISTSQQVVSELDDCKRKKVA  1399

Query  4042  LEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSV  4221
             L+EKVLRLEGDL A E + +++A LKN+L Q +R NSQ + +IK LE E+       Q++
Sbjct  1400  LQEKVLRLEGDLAAIEALGSQEAALKNELAQIRRENSQFQRRIKCLEKEKEDCLSRAQAI  1459

Query  4222  QEEL  4233
             +EEL
Sbjct  1460  EEEL  1463


 Score =   156 bits (395),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 106/159 (67%), Gaps = 6/159 (4%)
 Frame = +1

Query  130  SNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQW----TESLWSPENYASN  297
            S I  LQVPKGWDKL VS++ VE GKTI+K  KA V NG C+W    +ES+W P++ A  
Sbjct  3    SVIWELQVPKGWDKLVVSVVLVETGKTIAKSSKAPVRNGNCRWIETFSESIWIPQDNALK  62

Query  298  GLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCL  471
             ++    K +V+MGSSR+GI+GEA VN+  Y NS+ S+P++LPL+KCN GT L  +I+CL
Sbjct  63   EIEECLIKLVVTMGSSRSGIVGEALVNLASYMNSKTSVPLTLPLKKCNSGTSLQLKIQCL  122

Query  472  TPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNNSL  588
            TPR   R ++   T +  E+ N   + ++NKS+  + + 
Sbjct  123  TPRAKIRDEQWKGTNSDMEDVNVDYDEVENKSDASDGTF  161



>ref|XP_010267314.1| PREDICTED: centrosome-associated protein CEP250-like [Nelumbo 
nucifera]
Length=1673

 Score =   506 bits (1302),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 441/1184 (37%), Positives = 688/1184 (58%), Gaps = 74/1184 (6%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             I+EL AEAR+WE N ++LM+ +++L+KEF++QS+  AD++MELS A TE + L  +I++L
Sbjct  329   IDELCAEARVWEKNDQKLMLDLQSLKKEFSDQSRHQADLDMELSAACTERDGLKQEIEQL  388

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             ++L++E   K  A E   L+A++  +I KE+EDE+KFQ ESN+NL+LQL+K+QESN ELV
Sbjct  389   KILVKEMTDKGTATEYSKLKAEDMSHIQKELEDEIKFQKESNANLALQLKKTQESNIELV  448

Query  1216  SVLQEMEETVQKKKIEIENLLALN----SRSDVMGVINSCGDEDNVQPKSTEQVSVEKQC  1383
             S+LQE+EET++K+++EI++L AL+    +R+      +  GD  N+     E V  +K  
Sbjct  449   SILQELEETIEKQRLEIDDLSALHRLEKTRNASSDSDSEDGDAGNISRNLNEMVDGKKSN  508

Query  1384  QEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQGll-----------eles  1530
                +L+ LQES  +L+N+I   EK  EE+   IE EQ LR Q +              E 
Sbjct  509   LVLQLKELQESQENLQNTIQLLEKTLEERNKVIEDEQSLRNQAVSDIEAEWRHMLSMKEE  568

Query  1531  ksssaeeseaNKPN-----------MHLIEEIESLKKTIQelerecnelteenlellfkl  1677
             + ++ E   +  PN             L +EIESLK  I ELER+ NELT+ENL L+  L
Sbjct  569   QITNLEAMVSGNPNDEKIGLDHRDDPDLTKEIESLKAKIDELERDFNELTDENLNLVLML  628

Query  1678  keSRKD-PSENHDMLSSKSLEGPQSESLIGSEFETSKHGFQFLLLQKEVIEEEVPNSLQI  1854
              ES+K  PS    +  S    G     +  SE +  +   +   LQ+E+  EEV  +LQ 
Sbjct  629   NESKKGLPSGGASLDDSNIFIGISEPEVRNSESQICQLENE---LQEEMFPEEVATNLQA  685

Query  1855  HSSGQRENHTCLEPPNFQAFKCKGCDLNVKLHACCVKATDKQATEIT-----VNPSEGQR  2019
                     +T LE    Q FK K   L+ +LH   V+  ++   EIT     +  SEG++
Sbjct  686   ELIDLENKYTELEL-QLQIFKDKASTLDAQLHKSQVEVQERD-LEITALQQRLERSEGRK  743

Query  2020  DEIDSRNFTLKDVSDRNRYSEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIE  2199
                D  +  + D + R+ Y +     +I ++   L  QL +   +V    +  +S V+ E
Sbjct  744   --TDKEDPYIVDCA-RSEYIDSNICIEISNIFSKLINQLQLALTHVKKPWYKTYSHVDTE  800

Query  2200  LRNATFYKDISRGTDPMA---QKEHAKAVFDKLV---QLLRARLVSCTNDKYSEDGARTE  2361
               +     D     + +A    KE  +A+  K V   +LL   +  C N  + ++     
Sbjct  801   CEDDL---DGIMALNSIAITNLKEQGEAIIRKFVMLNKLLEENITECKNALHHKE-----  852

Query  2362  VNNTYEIKDKSDYGCSTEKDPCSSHQGYKNFK-ELEVKGESIGNNVLTKNSKMLEVKTGC  2538
                  EI+++ D   S   + C S + Y+  +  LE     +   ++++  ++ E+    
Sbjct  853   ----VEIRER-DAKLS---ESCKSLEEYEKLEMGLEEDIADLSKELISRQYEVEELAASL  904

Query  2539  LEEDVGLKALNHCRR---DLANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMREEMM  2703
                 + ++ +N  RR   +L  K+   Q     +E+  E +  E D +    D++R +++
Sbjct  905   ---SLKVEEINDLRRSQTELELKVSALQKEKRELEEYAEILLRENDILLKCLDNVRHDLV  961

Query  2704  VVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTD  2880
             V+   +  ++S  K  E K  ELE+ KQELE  +  LE+EN+QL ER+SGLEAQLR+ TD
Sbjct  962   VLGSTVSSHVSANKTLEWKCSELESAKQELEVHINYLEEENVQLLERISGLEAQLRYLTD  1021

Query  2881  AMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKK  3060
               E SR+EL++  +    LQDEIR LE   E+Q+++LKQ+L +MQKRW ++QEE EYLKK
Sbjct  1022  DKESSRLELENSKSVSSGLQDEIRRLEIQMETQKVDLKQKLQDMQKRWSEAQEECEYLKK  1081

Query  3061  ANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIES  3240
             ANPKLQATAESLIEEC SLQ LNGELR Q+L+L  +C  LE++L + +   S C  ++E+
Sbjct  1082  ANPKLQATAESLIEECSSLQKLNGELRNQKLDLHKRCIQLESKLFESKMHFSDCSRKVEA  1141

Query  3241  LEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQ  3420
             L+ K SS+ E+ S KE  + S+L+ +L + KE KE+L+++++L +Q    K +E+E  Q+
Sbjct  1142  LQEKFSSMQEDVSLKEYFLTSKLDALLQENKEHKEKLILEKNLLNQKYLEKTAEVENLQR  1201

Query  3421  KSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQM  3600
             +  HL  Q+  P D  +  AS+   E+ SL A+   L+ +LQE+Q  ++++E +L   ++
Sbjct  1202  EVAHLAEQLLAPDDERERIASDAVLEVISLRADKSKLESSLQEVQAKVKLSENELDALKV  1261

Query  3601  EYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllses  3780
             +   KV  L+ EL A K N  +L + ++KL+R LE   SSE   K  +  LE  L  SE 
Sbjct  1262  KTNMKVQVLVDELAASKKNHELLISGNEKLKRLLEATKSSEERFKSTVTGLEQILADSEY  1321

Query  3781  erlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKAD  3960
             ER  L +  ++LKI+  + A L++ VL+LK SLN+ KF+ E+LE  +QL+ G+ EELKA+
Sbjct  1322  ERQHLFEEITTLKIKQKRTAELQNLVLSLKSSLNETKFEKEKLETLMQLLSGDCEELKAE  1381

Query  3961  KTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSK  4140
             +  L+++++ +Q +++E E+CR  KV LEEKVLRLEGDLTA+E + A+DA +K +L++ K
Sbjct  1382  RGPLLEKVSSLQKAMSEFEDCRRSKVALEEKVLRLEGDLTAKEALFAQDAGIKIELSRIK  1441

Query  4141  RVNSQLRWKIKQLELERYYLSKELQSVQEE--LNRKENSVPSPS  4266
             R NSQ + KI+ LE E+    K  Q +++E  L R+EN   S S
Sbjct  1442  RTNSQFQRKIQHLEEEKDEYLKRAQVLEQELKLKREENRFQSVS  1485


 Score =   168 bits (426),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 159/238 (67%), Gaps = 19/238 (8%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             I EL+AEARMWE NAR+LM+ +E+L+KEF++QS+  AD++MELS A TE + L  +I++L
Sbjct  67    INELRAEARMWERNARKLMLDLESLKKEFSDQSRYQADLDMELSEACTERDGLKQEIEQL  126

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             ++L++E   K    E+  L+A+   +I KE+EDE+KFQ ESN+NL+LQL+K+QESN ELV
Sbjct  127   KILVKEMTDKGTETEDSKLKAEGMSHIQKELEDEIKFQKESNANLALQLKKTQESNIELV  186

Query  1216  SVLQEMEETVQKKKIEIENLLALNS---------------RSDVMGVINSCGD----EDN  1338
             S+LQE+EET++K+++EI+NL  L+S               RS +    N+  D    + +
Sbjct  187   SILQELEETIEKQRLEIDNLSELHSYNCINNDIRELNSTTRSLLKKTRNASSDSNSEDGD  246

Query  1339  VQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQG  1512
              + +S +++  EK     +L+ LQES  SL+N+I   EK  EEK   IE+E+ LR Q 
Sbjct  247   ARSRSLQEMIDEKSNLVLQLKELQESQESLQNTIKLLEKTLEEKNKVIEVERSLRNQA  304



>ref|XP_004250022.1| PREDICTED: girdin-like [Solanum lycopersicum]
Length=1473

 Score =   481 bits (1238),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 360/945 (38%), Positives = 528/945 (56%), Gaps = 144/945 (15%)
 Frame = +1

Query  1936  NVKLHACCVKATDK-QATEITVNPSEGQRDEIDSRNFTLKDVSDRNRYSEPETTFDIDSL  2112
             N ++++CCV+  ++ Q TE+   PSE Q++      F  K V    + S+     DI +L
Sbjct  627   NAEINSCCVEVQEQDQRTEVAAMPSECQQEGDCQDGFIHKSVPIIFQSSKSGHIEDIYTL  686

Query  2113  VPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKDISRGTDPMAQKEHAKAVFDKLV  2292
             +  LC                                       P A+ E A AV +   
Sbjct  687   LNTLCH--------------------------------------P-AKDEQANAVLENFQ  707

Query  2293  QLLRARLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNF-KELEV  2469
              L     +     ++ ED  +T + +  E++D+       E  PCS  + +++  K LE 
Sbjct  708   LLRYRLALYLDGSQHIEDEPKTTLKDACEVQDEEKDDLPKEITPCSCCERFEDLNKVLEG  767

Query  2470  KGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEK  2649
             K +++ ++ L KNS++LE+KT CL++D  ++AL + + DL+++I D QM   ++E+ ME 
Sbjct  768   KIQNLSSDSLAKNSEILELKTKCLKKDAEIEALRNHQTDLSSQISDLQMSKCLMEERMEN  827

Query  2650  VQTEKDDITS--DSMREEMMVVTGRIFGNISEKIQEMKILELENEKQELESCVFELEKEN  2823
             +Q E    ++  D+    +M +   I G IS+   EMK  ELE++K ELE  + ELEKEN
Sbjct  828   LQQELSATSNSLDTSTNGLMFLDRCICGGISKMTYEMKSSELESDKYELEFNLRELEKEN  887

Query  2824  MQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRL  3003
             + LSERVSGLEAQLRH TDAME +R+ELQH G ++ +L+ +IR+LE  KESQ+L+LK++L
Sbjct  888   VDLSERVSGLEAQLRHLTDAMEFNRLELQHSGNRVVSLESKIRKLEHQKESQKLDLKEQL  947

Query  3004  MEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLE  3183
             +EMQKRWLD+QEE EYLKK NPKLQAT ESL+EEC  LQ LN ELR+Q+L+L    N+LE
Sbjct  948   LEMQKRWLDAQEECEYLKKVNPKLQATTESLMEECRLLQNLNAELRQQKLKLHASHNVLE  1007

Query  3184  AELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKE  3363
             AELRK QHSLS+CL RIESLEA  SS++EE  SKEKI+  +L+ + LQ++E  E+ +++ 
Sbjct  1008  AELRKSQHSLSTCLKRIESLEANFSSVMEEIESKEKILKFKLDDLHLQSREHGEKFLVEG  1067

Query  3364  SLQSQLCQHKLSELEYPQQKSPHLVNQMFD-PSDREDGKASEGSHEMHSLFAEN--KMLK  3534
                 ++      E+E  Q++   L+ +M +  S+    KA EG+       A N  K+L+
Sbjct  1068  CTLCEMSPENTVEVEKLQEQVQSLMVEMSNLMSELGTSKAKEGT------LAANCDKLLR  1121

Query  3535  LTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVI  3714
             +      ++L  +E KL  T  E E K                               ++
Sbjct  1122  MM-----EHLVSSEAKLKCTINELESK-------------------------------LL  1145

Query  3715  SSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKF  3894
             SSE  L  + D                   NSSLKI+L  +  L++EVL LK +L+ MKF
Sbjct  1146  SSECQLLQMTDE------------------NSSLKIQLHTLPLLQEEVLYLKEALSGMKF  1187

Query  3895  KNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGD  4074
             ++ER + +L L  G+ EELK +K SL+QE+T MQ  V + E+C+ + + LEEKVLRLEGD
Sbjct  1188  ESERTQVTLLLKYGDCEELKDEKASLLQEITCMQKEVAKAEKCKYKTIALEEKVLRLEGD  1247

Query  4075  LTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRK----  4242
             LTA+EVMCAK +ELKN+L Q +R NSQL WKIK L+ E+    K++ S++++L++K    
Sbjct  1248  LTAKEVMCAKVSELKNELCQLRRSNSQLLWKIKSLQFEKENCLKQVTSLEKKLSKKRPDN  1307

Query  4243  ----ENSVPS------PS----------HSVAKDKTTSCKEQKLSK--ARSSQCNNCET-  4353
                 +++VP+      P           H +      S K  K+ K    S Q  N E+ 
Sbjct  1308  QREDDDTVPTLDELKFPKAEEENFSKHQHEIITQSLQSEKYLKVQKIQGNSQQNGNKESN  1367

Query  4354  ----IQIVTIDDCSSRCQVGD------DKTQFKSLQPEGQSTRSGNENEQKISQLEAELK  4503
                 +Q       S++   GD      D            S++  ++N QKISQLEAEL+
Sbjct  1368  YYRDLQETLAKSVSAKQSPGDTVAQTLDSNHIHKSHLISLSSKGRDDNTQKISQLEAELQ  1427

Query  4504  EISERYLHMSLKYAEVENQKGKLVMTLKALQDQRTGT-VR*ISQF  4635
             EI +RYL +SLKYAEVE+Q+ +LVMTLKA+ D++T T  R +S F
Sbjct  1428  EIRDRYLKISLKYAEVEDQREQLVMTLKAIHDEKTSTGYRSLSSF  1472


 Score =   339 bits (870),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 220/501 (44%), Positives = 302/501 (60%), Gaps = 69/501 (14%)
 Frame = +1

Query  106   GDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTE----SLW  273
             G +F F FSN+QA QVPKGWDKLSVSLISVE GKT+SK GKASV N  C+WTE    S+W
Sbjct  25    GHRFDFSFSNLQARQVPKGWDKLSVSLISVETGKTVSKSGKASVRNSNCKWTETWSQSMW  84

Query  274   SPENYASNGLDHF--KFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
                +  SN  + F  KF+V+MGS+R+ ILGEA+VN+  +R+++A  PVSLPL+KCN GTV
Sbjct  85    ITADDISNNQEQFPLKFIVTMGSARSSILGEASVNLARFRDAKAFTPVSLPLKKCNHGTV  144

Query  448   LNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERN-------NSLPSMEDS  606
             L  EIKCL   TS R +E      Y EEEN   N ++ KSEE +       +S  S EDS
Sbjct  145   LQLEIKCL---TSIRDNESKDMPFYAEEENMEYNNMELKSEETSLPRLSSYHSFASTEDS  201

Query  607   LGRDSLssasnssavvnnaIRRLESTESGGSA----------------PWssysygspks  738
             LGR+S SS S+S+   N  I R ES +S  +A                P++    GS K+
Sbjct  202   LGRESFSSLSDSNRHGNLIIGRQESIDSRSTASCGSYSFCESPKSYNSPYNLMISGSGKN  261

Query  739   nnspnklsisCQEKHPEYTEEEIGQCSLHI-TRTSIP--DANIEELKAEARMWELNARRL  909
               +        ++   +++ +      L   +R S+P  D + +EL AEA MWE NA RL
Sbjct  262   AQNQ-------KDDFKQFSHDNTASVQLSASSRNSLPAKDTSTKELIAEAMMWEQNAHRL  314

Query  910   MVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLN  1089
              + +E  RKEFA+Q+Q+I +++MEL +  TE +  M +IK LE+LL+ES  K+ A E+L 
Sbjct  315   KIDLEMSRKEFADQTQQIENLKMELCSLGTERDESMQEIKHLEILLQESMEKEKATESLL  374

Query  1090  LQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIE  1269
              + ++ +++ K +++EL+ Q ESN N+S QL K+QESN +LVS+LQEMEETV+K+ +EI+
Sbjct  375   FRVRDMDSVEKILKEELRIQKESNDNMSFQLSKTQESNIQLVSILQEMEETVEKQNLEIK  434

Query  1270  NLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQ  1449
             NLL + S S+ +                           E KLQ LQES  +LEN+ +  
Sbjct  435   NLLEVKSHSENL---------------------------EDKLQQLQESQKNLENTTLHL  467

Query  1450  EKAQEEKIHEIELEQDLRAQG  1512
             EK   EK HEIELE+D R Q 
Sbjct  468   EKIIREKTHEIELERDHRTQA  488



>ref|XP_006360525.1| PREDICTED: myosin-13-like [Solanum tuberosum]
Length=1310

 Score =   464 bits (1194),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 358/951 (38%), Positives = 528/951 (56%), Gaps = 155/951 (16%)
 Frame = +1

Query  1936  NVKLHACCVKATDK-QATEITVNPSEGQRDEIDSRNFTLKDVSDRNRYSEPETTFDIDSL  2112
             N ++++CCV+  ++ Q TE+   PSE Q++      FT K+V    + SE     DI +L
Sbjct  463   NAEINSCCVEVQEQDQRTEVAAMPSECQQEGDCQDRFTHKNVPIIFQSSESGHIEDIYTL  522

Query  2113  VPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKDISRGTDPMAQKEHAKAVFDKLV  2292
             +  LC                                       P A+ E A AV     
Sbjct  523   LNTLCH--------------------------------------P-AKDEQANAVLKNFQ  543

Query  2293  QLLRARLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNF-KELEV  2469
              L     +     ++ ED  +T + +  E++D+       E  PCS  +  ++  K LE 
Sbjct  544   LLRYRLALYLDGSQHIEDEPKTTLKDACEVQDEEKDDLPKENTPCSCCERLEDLNKVLEG  603

Query  2470  KGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEK  2649
             K +++ ++ L KNS++LE+KT CL++DV ++AL H + DL+ +I D QM   ++E+ +E 
Sbjct  604   KIQNLSSDSLAKNSEILELKTKCLKKDVKIEALRHQQTDLSTQISDLQMSKCLMEERIEN  663

Query  2650  VQTEKDDITS--DSMREEMMVVTGRIFGNISEKIQEMKILELENEKQELESCVFELEKEN  2823
             +Q E    ++  D+    +M +   I G +S+   EMK LELE++K ELE  + ELEKEN
Sbjct  664   MQQELSATSNSLDTSANGLMFLDQCICGGVSKMTYEMKSLELESDKYELELNLHELEKEN  723

Query  2824  MQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRL  3003
             + LSERVSGLEAQLRH TDAME +R+ELQH G ++ +L+ +IR+LE  KESQ+L++K++L
Sbjct  724   VDLSERVSGLEAQLRHLTDAMEFNRLELQHSGNRVVSLESKIRKLEHQKESQKLDMKEQL  783

Query  3004  MEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLE  3183
             MEMQKRWLD+QEE EYLKK NPKLQAT ESL+EEC  LQ LN ELR+Q+L+L V  N+LE
Sbjct  784   MEMQKRWLDAQEECEYLKKVNPKLQATTESLMEECCLLQNLNAELRQQKLKLHVSHNVLE  843

Query  3184  AELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKE  3363
             AELRK QHS S+CL RIESLEA  SS++EE  SKEKI+  +L+ + LQTKE  E+ +++ 
Sbjct  844   AELRKSQHSFSTCLKRIESLEANFSSVMEEIESKEKILKFKLDDLHLQTKEHGEKFLVEG  903

Query  3364  SLQSQLCQHKLSELEYPQQKSPHLVNQMFD-PSDREDGKASEGSHEMHSLFAEN--KMLK  3534
                 ++      E+E  Q++   L+ +M D  S+    KA EG+       A N  K+L+
Sbjct  904   CTLREMSPENTVEVEKLQEQVQSLMVEMSDLMSELGTSKAKEGT------LAANCDKLLR  957

Query  3535  LTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVI  3714
             +      ++L  +E KL  T  E E K                +L ++   LQ   EN  
Sbjct  958   MM-----EHLVSSEAKLKCTINELESK----------------LLSSECQMLQMTEEN--  994

Query  3715  SSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKF  3894
                S+LK                            I+L  +  L++EVL LK +L+ MKF
Sbjct  995   ---SSLK----------------------------IQLHTLPLLQEEVLYLKEALSGMKF  1023

Query  3895  KNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGD  4074
             ++ER + +L L  G+ EELK +K SL+QE+T MQ  V E E+C+ + + LEEKVLRLEGD
Sbjct  1024  ESERTQVTLLLKYGDCEELKEEKASLLQEITCMQKEVAEAEKCKYKTIALEEKVLRLEGD  1083

Query  4075  LTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRK----  4242
             LTA+EVMC K +ELKN+L Q +R NSQL W+IK L+ E+    K++ S++E+L++K    
Sbjct  1084  LTAKEVMCTKVSELKNELCQLRRANSQLLWQIKSLQFEKENCLKQVTSLEEKLSKKRPDN  1143

Query  4243  ----ENSVPS----------------PSHSVAKDKTTSCKEQKLSKARSS-------QCN  4341
                 ++++P+                  H +      S K  K+ K + +       + N
Sbjct  1144  QREDDDTIPTLDELKFSEVEEENFSKHQHEIITQSLQSEKYLKVQKIQGNFQLDGNKESN  1203

Query  4342  NCETIQIVTIDDCSSRCQVGD------------DKTQFKSLQPEGQSTRSGNENEQKISQ  4485
                  Q       S+    GD            D++   SL  +G+     ++N QK+SQ
Sbjct  1204  YYRDFQGTLAKSVSANQFPGDTVAQTLDSNYIHDESHLISLSSKGR-----DDNMQKVSQ  1258

Query  4486  LEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQRTGT-VR*ISQF  4635
             LE+EL+EI +RYL++SLKYAEVE+Q+ +L+MTLK++ DQ+T T  R +S F
Sbjct  1259  LESELQEIRDRYLNISLKYAEVEDQREQLIMTLKSIHDQKTATGYRSLSSF  1309


 Score =   179 bits (454),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 148/382 (39%), Positives = 212/382 (55%), Gaps = 60/382 (16%)
 Frame = +1

Query  445   VLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERN-------NSLPSMED  603
              L  EIKCLT   S R +E      Y EEEN   N ++ KSEER+       +S  S ED
Sbjct  2     FLQLEIKCLT---SIRDNESKDMPFYAEEENMEYNNMEMKSEERSLPRLSSYHSFASTED  58

Query  604   SLGRDSLssasnssavvnnaIRRLESTESGGSA----------------PWssysygspk  735
             SLGR+S SS S+S+   N  I R ES +S  SA                P++    GS K
Sbjct  59    SLGRESFSSQSDSNRHGNLIIGRQESIDSRSSASCGSYSFCESPKSYNSPYNLMISGSGK  118

Query  736   snnspnklsisCQEKHPEYTEEEIGQCSLHIT-RTSI--PDANIEELKAEARMWELNARR  906
             +  +        ++   +++ +      L  + R S+   D   +EL AEA MWE NA+ 
Sbjct  119   NAQNQ-------KDDFKQFSHDNTASVQLSASSRNSLQAKDTISKELIAEAMMWEQNAQS  171

Query  907   LMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENL  1086
             L   +E  RKEFA+QSQ+I +++MEL +  TE +  M +I+ LE+LL+ES  K+ + E+L
Sbjct  172   LKTDLEMSRKEFADQSQQIENLKMELCSLGTERDGSMQEIRHLEILLQESMEKEKSTESL  231

Query  1087  NLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEI  1266
              L+ ++ +++ K +++EL+ Q ESN ++S QL K+QESN +LVS+LQEMEETV+K+K+EI
Sbjct  232   MLRVRDKDSVEKILKEELRIQKESNDDMSFQLSKTQESNIQLVSILQEMEETVEKQKLEI  291

Query  1267  ENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIIC  1446
             +NLL + S S+                         +Q  E KLQ LQES  +LEN+ + 
Sbjct  292   KNLLEVKSNSE------------------------NQQNLEDKLQQLQESQKNLENTTLH  327

Query  1447  QEKAQEEKIHEIELEQDLRAQG  1512
              EK   EK HEIELE+D R Q 
Sbjct  328   LEKIIREKTHEIELERDHRTQA  349



>ref|XP_009787659.1| PREDICTED: girdin-like isoform X2 [Nicotiana sylvestris]
Length=1342

 Score =   454 bits (1167),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 416/1096 (38%), Positives = 605/1096 (55%), Gaps = 152/1096 (14%)
 Frame = +1

Query  520   YNEEENSVCNGIDNKSEE-------RNNSLPSMEDSLGRDSLssasnssavvnnaIRRLE  678
             Y EEEN     ++ KSEE        ++S  S EDSLGR+S SS S+S+  VN+ I R E
Sbjct  4     YIEEENVEYKNMEIKSEETGCRALSSSHSFASTEDSLGRESFSSLSDSNRPVNHIIGRQE  63

Query  679   STES----------------GGSAPWssysygspksnnspnklsisCQEKHPEYTEEEIG  810
             S +S                  ++P++  + GS K+  +        ++ + + + +   
Sbjct  64    SIDSRSSASCSSYSFCESPKSYNSPYNLMNSGSGKNAQNQ-------KDDYKQLSHDNTA  116

Query  811   QCSLHIT-RTSIPDANI--EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEME  981
                L  + R S+   +I  +EL AEA MWE NA+ L + +E  RKEF +Q+Q+I +++ME
Sbjct  117   SVQLAASSRNSLQGKDITSKELIAEAMMWEQNAQSLKINLEMSRKEFFDQTQQIENLKME  176

Query  982   LSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESN  1161
               +  TE + LM +IK LEVLL+ES  K+ A ++L LQ ++ +++ K ++ EL+ Q ESN
Sbjct  177   HRSLGTERDGLMQEIKHLEVLLQESMEKEKATDSLMLQVRDMDSVQKILKGELRIQKESN  236

Query  1162  SNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNV  1341
              ++SLQL K+QESN ELVS+LQEMEETV+ +K+EIENL  LN                  
Sbjct  237   DSMSLQLSKTQESNIELVSILQEMEETVENQKLEIENLHILN------------------  278

Query  1342  QPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQG---  1512
                        +Q  E KLQ LQES ++LEN+ +  EK   EK HEIELEQ  R Q    
Sbjct  279   -----------QQNLEDKLQQLQESQINLENTTLRLEKIIREKTHEIELEQGHRTQALLD  327

Query  1513  --------------------llelesksssaeeseaNKP--NMHLIEEIESLKKTIQele  1626
                                        S+ + E+   KP  +  LI E E+LK+ +QELE
Sbjct  328   CEEKWKIKSREQEEEIAYLKAELSRILSAESSETNKAKPAADCDLIRENETLKEKLQELE  387

Query  1627  recnelteenlellfklkeSRKDPSENHDMLSSKSLEGPQSE-SLIGSEFETS-----KH  1788
             R+C ELTEENLELL++LK S+   S +  +LSS S+EG  SE S  GSEFE S       
Sbjct  388   RDCKELTEENLELLYELK-SKGTSSISGPILSSSSVEGQLSEQSPGGSEFEVSNGELLSS  446

Query  1789  GFQFLLLQKEVIEEEVPNSLQIHSSGQRENHTCLEPPNFQA-FKCKGCDLNVKLHACCVK  1965
              FQ    +K++I E   +  +     Q EN   L    F +  K     LN ++ + C +
Sbjct  447   PFQDDKGKKKIIAETAASESKQKICDQEEN---LAQVEFHSRVKDNASRLNAEIISRCFE  503

Query  1966  ATDK-QATEITVNPSEGQRDEIDSRNFTLKDVSDRNRYSEPETTFDIDSLVPALCEQLGI  2142
               +K Q TE+   P E  ++E     FT ++V    + SE     D+ +L+  LC     
Sbjct  504   VQEKDQRTEVAAIPLECHQEESCHGGFTHENVPAMFQSSESGRIEDVYALLTTLCH----  559

Query  2143  FFHNVNGVEHMLFSPVNIELRNATFYKDISRGTDPMAQKEHAKAVFDKLVQLLRARLVSC  2322
                                                  + E A AV  KL+QLL  R   C
Sbjct  560   -----------------------------------TTKDEQADAVLKKLLQLLGYRSALC  584

Query  2323  TN-DKYSEDGARTEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNF-KELEVKGESIGNNV  2496
              +   + E+  +    +  E++D        EK PCS  Q  ++  K L++K +++ ++ 
Sbjct  585   LDGSNHIEEEPKITAKDACEVQDGEKDDLPEEKTPCSCCQRLEDSNKVLDIKVQNLSSDN  644

Query  2497  LTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDIT  2676
             L KNS++LE+KT CL++D  ++AL H + DL  +I D QM    +E+ ME +Q E  D +
Sbjct  645   LAKNSEILELKTDCLKKDAEIEALRHQQTDLRTQISDLQMSKCQMEERMENLQQELSDTS  704

Query  2677  S--DSMREEMMVVTGRIFGNISEKIQEMKILELENEKQELESCVFELEKENMQLSERVSG  2850
                D+    +M +   I G++S+   +MK LELE++K ELE  ++ELEK+N+ LSERVSG
Sbjct  705   KSLDTSTNGLMFLDQCICGDVSKMTLKMKSLELESDKYELELNLYELEKDNVDLSERVSG  764

Query  2851  LEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLD  3030
             LEAQLRH +DAME +R+ELQH G  + NLQ+++RELE +KESQ+L++K++L+EMQKRWLD
Sbjct  765   LEAQLRHLSDAMEFNRLELQHSGNHVVNLQEKVRELEHEKESQKLDMKEKLLEMQKRWLD  824

Query  3031  SQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHS  3210
             +QEE EYLKK NPKLQAT ESL+EEC  LQ LN ELR+Q+L+L    N+LEAELRK Q+S
Sbjct  825   AQEECEYLKKVNPKLQATTESLMEECRLLQNLNAELRQQKLKLHTSHNVLEAELRKSQYS  884

Query  3211  LSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQH  3390
              S+CL RIESLEA  SS+LEE  SKEKI+  +L+ + LQTKE +E+L+++E    ++   
Sbjct  885   FSTCLKRIESLEANFSSVLEEIESKEKILKFKLDDLHLQTKEHREKLIVEECTLHEISLE  944

Query  3391  KLSELEYPQQKSPHLVNQMFD-PSDREDGKASEGS---------HEMHSLFAENKMLKLT  3540
                E+E  Q++   L+ +M +  SD    KA EG+           M  L +    LK T
Sbjct  945   NTIEVEKLQEQVQSLMMRMSNLMSDLGTSKAKEGTLAANCEKLLRTMEHLASNEAKLKCT  1004

Query  3541  LQEIQQNLEITEVKLV  3588
             + E++  L  +E +++
Sbjct  1005  INELESKLLSSECQML  1020



>ref|XP_011031590.1| PREDICTED: centrosome-associated protein CEP250-like isoform 
X1 [Populus euphratica]
Length=1648

 Score =   426 bits (1096),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 332/899 (37%), Positives = 508/899 (57%), Gaps = 69/899 (8%)
 Frame = +1

Query  2071  RYSEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKDISRGTDPM  2250
             + SE + T ++   +  L E +     NV   +     P+N E  +A     IS  TD  
Sbjct  761   KLSESQATAEMAKTLSELQEHIQSCLANVKKQQCDPCFPINGECSSAFDKPVISNDTDLF  820

Query  2251  AQKEHAKAVFDKLVQL---LRARLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKD  2421
              QKE AK++ +  VQL     A+     N+ +     R EV N+ E+++  +        
Sbjct  821   NQKEKAKSILNSFVQLKDLFEAKSALFKNEVHQSKEVRAEVVNSDELRNNLE--------  872

Query  2422  PCSSHQGYKNFKELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALN----------  2571
               +   G   F     + ES+    +    +M +++   LE+  G+  LN          
Sbjct  873   --AYDSGKNTFSTCGPQPESLQ---MESTPEMTDLEKELLEKISGMDKLNSSNEQEIDAL  927

Query  2572  -HCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNISE  2739
              H + +L  +I + Q   W++E+++E V   +  +TS   D +R+EM  ++       S 
Sbjct  928   RHSQTELETQISNLQNERWLLEQNLE-VTLRESMVTSKCLDDLRKEMTKLSSNRDSQASA  986

Query  2740  K-IQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHK  2916
             K I E K+ ELE+ K E+E  + ELEKEN+Q SER+ GLEAQLR+ T+  E +  EL + 
Sbjct  987   KEILERKLSELESGKLEMEVHLSELEKENVQFSERICGLEAQLRYLTNDRESTSEELHNS  1046

Query  2917  GTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESL  3096
              +   +L++EIR LE + E+Q+++ +Q++ +M+KRWL++QEE  YLK ANPKLQ TAESL
Sbjct  1047  ESSNVSLREEIRRLESELEAQKVDARQKMQDMRKRWLEAQEECGYLKVANPKLQTTAESL  1106

Query  3097  IEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEET  3276
             IEEC  LQ  N ELR Q+++L   C +LEAELR  +   S+ L  +E+LE K   + +E 
Sbjct  1107  IEECSVLQKSNAELRTQKMQLHEHCTILEAELRDSEKYFSNMLKEVEALEGKYILLQQEI  1166

Query  3277  SSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDP  3456
             +SKE+ +  EL+ ++ + K++KE+L ++E+  +Q+   K  E+E  Q++  HL  Q+   
Sbjct  1167  ASKEQALGIELDSLIQENKKYKEKLAMEENFLNQMHMEKTVEVENLQREVAHLTEQISAT  1226

Query  3457  SDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGE  3636
                ++  ASE   E+  L +   ML+ +LQE+Q  LE++E  L T QME E KV  L+ E
Sbjct  1227  HGEKERTASEAVIEVSHLRSGRAMLEASLQELQGKLELSESNLCTLQMESEIKVLGLVQE  1286

Query  3637  LNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSL  3816
             L A K NQ VL A  +KL   LE+V S+E   K  +  LE KL  SE  R Q+A+  SSL
Sbjct  1287  LAASKQNQEVLMADHEKLLELLEDVKSNEEKHKSSVKGLEIKLKASEYARQQVAEETSSL  1346

Query  3817  KIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQ  3996
             KI+L K + L+DE+L LK SLN++KF+N++LEASLQ++ G+ EELK +K   +Q+++ MQ
Sbjct  1347  KIQLQKTSLLQDEILDLKRSLNEVKFENQKLEASLQMLSGDYEELKTEKILSMQKISDMQ  1406

Query  3997  NSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQ  4176
              +V+ELE+ +  KV LEEK+LRLEGDLTARE + A+DAELKN+L ++KR NS+ + KI+ 
Sbjct  1407  RAVSELEDYKRSKVALEEKLLRLEGDLTAREAIGAQDAELKNELARAKRANSEFQRKIRY  1466

Query  4177  LELERYYLSKELQSVQEELNRKENS---------VPSPSHSVAKDKTTSCKEQKLSKARS  4329
             L  E+    K+ QS++EEL +++ S            PS S + D  +S  ++ L+ ++ 
Sbjct  1467  LGEEKQECLKKAQSLEEELEQRKASKQDQHSFSDASLPSGSESSDMNSSTPDE-LNVSQV  1525

Query  4330  SQCNNCETIQIVTID-DCSSRCQVGDD------------KTQFKSLQPEGQS--------  4446
                +N  T     I  D  S+ Q+ ++            K Q KSL  E           
Sbjct  1526  GTKSNINTGNAPGIGLDSLSKIQLLENELAEALEANDMYKAQLKSLLTEEYKDPLNAPKK  1585

Query  4447  ------TRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
                      G+  + KIS L+ ELK++ ERY  MSLKYAEVE ++ KLV+ LK + ++R
Sbjct  1586  LMDEDVVVEGDGYDGKISSLQTELKDLQERYFDMSLKYAEVEAERAKLVLKLKPVNNRR  1644


 Score =   196 bits (499),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 125/180 (69%), Gaps = 6/180 (3%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L +HKS   D  GD   F FS+ QALQVPKGWD+L V +ISVE GKT+SK GK S  
Sbjct  1    MFRLHKHKS---DKLGDTLDFKFSSFQALQVPKGWDRLFVHIISVETGKTLSKSGKGSAR  57

Query  241  NGTCQWTESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVS  414
            NGTC+WTESL      +   +D   FKF+VSMGSSR+GILGEATVN+G Y+N+E ++PVS
Sbjct  58   NGTCRWTESLTESIPVSEKEIDDCLFKFVVSMGSSRSGILGEATVNLGSYKNAETAVPVS  117

Query  415  LPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSV-CNGIDNKSEERNNSLP  591
            LPL+KCN GT+L   I+CLTPR   R ++     +Y E+  +V    ++NKS+  ++S+ 
Sbjct  118  LPLKKCNYGTILLVRIQCLTPRAKPREEQFEEPGSYAEDVIAVDYTDMENKSDVSDSSVA  177


 Score =   179 bits (454),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 110/252 (44%), Positives = 156/252 (62%), Gaps = 30/252 (12%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +A IEEL+AEARMWE NARRLM+ +E  RK+ ++QS   A +EM+LS +H E +     
Sbjct  304   AEATIEELRAEARMWEQNARRLMIDLEKTRKDLSDQSMHCASLEMQLSESHRECDGSRQK  363

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I++L++LLEES AKQ   ENL  QAK  +N  KE+EDELKFQ E+N++L+LQL+K+QESN
Sbjct  364   IEQLKILLEESIAKQTTTENLKFQAKEMDNFQKEIEDELKFQKETNADLALQLKKTQESN  423

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN-SCGDEDNVQP--KSTEQVSVE  1374
              ELV++LQE+E+T++ +KIEI +L  + S+S   G  +    D +  +P  KS  +V+ E
Sbjct  424   IELVTILQELEDTIEIQKIEISDLSKIQSKSQKAGKYHLEVQDSEETKPMKKSFAKVTRE  483

Query  1375  KQCQ---------------------------EFKLQHLQESHMSLENSIICQEKAQEEKI  1473
               C                            E +LQ LQ+S  +LE +I   E++ E KI
Sbjct  484   ASCDSGMEGSTVEQELDDLPVGSESEDSRSLELELQQLQDSQKNLEITIHPPERSLENKI  543

Query  1474  HEIELEQDLRAQ  1509
             H IE+EQ L+ Q
Sbjct  544   HAIEVEQSLKTQ  555



>ref|XP_011031591.1| PREDICTED: myosin-7B-like isoform X2 [Populus euphratica]
Length=1566

 Score =   426 bits (1094),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 326/861 (38%), Positives = 494/861 (57%), Gaps = 69/861 (8%)
 Frame = +1

Query  2185  PVNIELRNATFYKDISRGTDPMAQKEHAKAVFDKLVQL---LRARLVSCTNDKYSEDGAR  2355
             P+N E  +A     IS  TD   QKE AK++ +  VQL     A+     N+ +     R
Sbjct  717   PINGECSSAFDKPVISNDTDLFNQKEKAKSILNSFVQLKDLFEAKSALFKNEVHQSKEVR  776

Query  2356  TEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNFKELEVKGESIGNNVLTKNSKMLEVKTG  2535
              EV N+ E+++  +   S          G   F     + ES+    +    +M +++  
Sbjct  777   AEVVNSDELRNNLEAYDS----------GKNTFSTCGPQPESLQ---MESTPEMTDLEKE  823

Query  2536  CLEEDVGLKALN-----------HCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS-  2679
              LE+  G+  LN           H + +L  +I + Q   W++E+++E V   +  +TS 
Sbjct  824   LLEKISGMDKLNSSNEQEIDALRHSQTELETQISNLQNERWLLEQNLE-VTLRESMVTSK  882

Query  2680  --DSMREEMMVVTGRIFGNISEK-IQEMKILELENEKQELESCVFELEKENMQLSERVSG  2850
               D +R+EM  ++       S K I E K+ ELE+ K E+E  + ELEKEN+Q SER+ G
Sbjct  883   CLDDLRKEMTKLSSNRDSQASAKEILERKLSELESGKLEMEVHLSELEKENVQFSERICG  942

Query  2851  LEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLD  3030
             LEAQLR+ T+  E +  EL +  +   +L++EIR LE + E+Q+++ +Q++ +M+KRWL+
Sbjct  943   LEAQLRYLTNDRESTSEELHNSESSNVSLREEIRRLESELEAQKVDARQKMQDMRKRWLE  1002

Query  3031  SQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHS  3210
             +QEE  YLK ANPKLQ TAESLIEEC  LQ  N ELR Q+++L   C +LEAELR  +  
Sbjct  1003  AQEECGYLKVANPKLQTTAESLIEECSVLQKSNAELRTQKMQLHEHCTILEAELRDSEKY  1062

Query  3211  LSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQH  3390
              S+ L  +E+LE K   + +E +SKE+ +  EL+ ++ + K++KE+L ++E+  +Q+   
Sbjct  1063  FSNMLKEVEALEGKYILLQQEIASKEQALGIELDSLIQENKKYKEKLAMEENFLNQMHME  1122

Query  3391  KLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEI  3570
             K  E+E  Q++  HL  Q+      ++  ASE   E+  L +   ML+ +LQE+Q  LE+
Sbjct  1123  KTVEVENLQREVAHLTEQISATHGEKERTASEAVIEVSHLRSGRAMLEASLQELQGKLEL  1182

Query  3571  TEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDN  3750
             +E  L T QME E KV  L+ EL A K NQ VL A  +KL   LE+V S+E   K  +  
Sbjct  1183  SESNLCTLQMESEIKVLGLVQELAASKQNQEVLMADHEKLLELLEDVKSNEEKHKSSVKG  1242

Query  3751  lesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLI  3930
             LE KL  SE  R Q+A+  SSLKI+L K + L+DE+L LK SLN++KF+N++LEASLQ++
Sbjct  1243  LEIKLKASEYARQQVAEETSSLKIQLQKTSLLQDEILDLKRSLNEVKFENQKLEASLQML  1302

Query  3931  CGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDA  4110
              G+ EELK +K   +Q+++ MQ +V+ELE+ +  KV LEEK+LRLEGDLTARE + A+DA
Sbjct  1303  SGDYEELKTEKILSMQKISDMQRAVSELEDYKRSKVALEEKLLRLEGDLTAREAIGAQDA  1362

Query  4111  ELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENS---------VPSP  4263
             ELKN+L ++KR NS+ + KI+ L  E+    K+ QS++EEL +++ S            P
Sbjct  1363  ELKNELARAKRANSEFQRKIRYLGEEKQECLKKAQSLEEELEQRKASKQDQHSFSDASLP  1422

Query  4264  SHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTID-DCSSRCQVGDD-----------  4407
             S S + D  +S  ++ L+ ++    +N  T     I  D  S+ Q+ ++           
Sbjct  1423  SGSESSDMNSSTPDE-LNVSQVGTKSNINTGNAPGIGLDSLSKIQLLENELAEALEANDM  1481

Query  4408  -KTQFKSLQPEGQS--------------TRSGNENEQKISQLEAELKEISERYLHMSLKY  4542
              K Q KSL  E                    G+  + KIS L+ ELK++ ERY  MSLKY
Sbjct  1482  YKAQLKSLLTEEYKDPLNAPKKLMDEDVVVEGDGYDGKISSLQTELKDLQERYFDMSLKY  1541

Query  4543  AEVENQKGKLVMTLKALQDQR  4605
             AEVE ++ KLV+ LK + ++R
Sbjct  1542  AEVEAERAKLVLKLKPVNNRR  1562


 Score =   196 bits (499),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 125/180 (69%), Gaps = 6/180 (3%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L +HKS   D  GD   F FS+ QALQVPKGWD+L V +ISVE GKT+SK GK S  
Sbjct  1    MFRLHKHKS---DKLGDTLDFKFSSFQALQVPKGWDRLFVHIISVETGKTLSKSGKGSAR  57

Query  241  NGTCQWTESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVS  414
            NGTC+WTESL      +   +D   FKF+VSMGSSR+GILGEATVN+G Y+N+E ++PVS
Sbjct  58   NGTCRWTESLTESIPVSEKEIDDCLFKFVVSMGSSRSGILGEATVNLGSYKNAETAVPVS  117

Query  415  LPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSV-CNGIDNKSEERNNSLP  591
            LPL+KCN GT+L   I+CLTPR   R ++     +Y E+  +V    ++NKS+  ++S+ 
Sbjct  118  LPLKKCNYGTILLVRIQCLTPRAKPREEQFEEPGSYAEDVIAVDYTDMENKSDVSDSSVA  177


 Score =   179 bits (453),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 110/252 (44%), Positives = 156/252 (62%), Gaps = 30/252 (12%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +A IEEL+AEARMWE NARRLM+ +E  RK+ ++QS   A +EM+LS +H E +     
Sbjct  304   AEATIEELRAEARMWEQNARRLMIDLEKTRKDLSDQSMHCASLEMQLSESHRECDGSRQK  363

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I++L++LLEES AKQ   ENL  QAK  +N  KE+EDELKFQ E+N++L+LQL+K+QESN
Sbjct  364   IEQLKILLEESIAKQTTTENLKFQAKEMDNFQKEIEDELKFQKETNADLALQLKKTQESN  423

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN-SCGDEDNVQP--KSTEQVSVE  1374
              ELV++LQE+E+T++ +KIEI +L  + S+S   G  +    D +  +P  KS  +V+ E
Sbjct  424   IELVTILQELEDTIEIQKIEISDLSKIQSKSQKAGKYHLEVQDSEETKPMKKSFAKVTRE  483

Query  1375  KQCQ---------------------------EFKLQHLQESHMSLENSIICQEKAQEEKI  1473
               C                            E +LQ LQ+S  +LE +I   E++ E KI
Sbjct  484   ASCDSGMEGSTVEQELDDLPVGSESEDSRSLELELQQLQDSQKNLEITIHPPERSLENKI  543

Query  1474  HEIELEQDLRAQ  1509
             H IE+EQ L+ Q
Sbjct  544   HAIEVEQSLKTQ  555



>ref|XP_006379507.1| hypothetical protein POPTR_0008s02980g [Populus trichocarpa]
 gb|ERP57304.1| hypothetical protein POPTR_0008s02980g [Populus trichocarpa]
Length=1566

 Score =   424 bits (1090),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 326/861 (38%), Positives = 489/861 (57%), Gaps = 69/861 (8%)
 Frame = +1

Query  2185  PVNIELRNATFYKDISRGTDPMAQKEHAKAVFDKLVQL---LRARLVSCTNDKYSEDGAR  2355
             P+N E   A     IS  TD   QKE AK++ +  VQL     A+     N+ +     R
Sbjct  717   PINGECSTAFDKPVISNDTDLFNQKERAKSILNSFVQLKDLFEAKSALFKNEVHQSKEVR  776

Query  2356  TEVNNTYEIKDKSDYGCSTEKDPCSSHQGYKNFKELEVKGESIGNNVLTKNSKMLEVKTG  2535
              +V N  E+++  +          +   G   F     + ES+    +    +M +++  
Sbjct  777   AKVVNPDELRNNLE----------AYDSGGNTFSTCGPQPESMQ---MESTPEMTDLEKE  823

Query  2536  CLEEDVGLKALN-----------HCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS-  2679
              LE+  G+  LN           H + +L  +I + Q   W +E+++E V   +  +TS 
Sbjct  824   LLEKISGMDKLNSLNEQEIDALRHSQTELETQISNLQNERWQLEQNLE-VTLRESMVTSK  882

Query  2680  --DSMREEMMVVTGRIFGNISEK-IQEMKILELENEKQELESCVFELEKENMQLSERVSG  2850
               D +R+EM  ++       S K I E K+ ELE+ K E+E  + ELEKEN+QLSER+ G
Sbjct  883   CLDDLRKEMTKLSSNRDSQASAKEILERKLSELESGKLEMEVHLSELEKENVQLSERICG  942

Query  2851  LEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLD  3030
             LEAQLR+ T+  E +  EL +  +   +L++EIR LE + E+Q+++ +Q++ +MQKRWL+
Sbjct  943   LEAQLRYLTNDRESTSEELHNSESSNMSLREEIRRLESELEAQKVDARQKMQDMQKRWLE  1002

Query  3031  SQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHS  3210
             +QEE  YLK ANPKLQ TAESLIEEC  LQ  N ELR Q+++L   C +LEAELR  +  
Sbjct  1003  AQEECGYLKVANPKLQTTAESLIEECSVLQKSNAELRTQKMQLHEHCTILEAELRDSEKC  1062

Query  3211  LSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQH  3390
              S+    +E+LE K   + +E +SKE+ +  EL+ +L + K++KE+L ++E+  +Q+   
Sbjct  1063  FSNMSKEVEALEGKYILLQQEIASKEQALGIELDSLLQENKKYKEKLAMEENFLNQMHLE  1122

Query  3391  KLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEI  3570
             K  E+E  Q++  HL  Q+      ++  ASE   E+  L +   ML+ +LQE+Q  LE+
Sbjct  1123  KTVEVENLQREVAHLTEQISATHGEKERTASEAVIEVSHLRSGRAMLEASLQELQGKLEL  1182

Query  3571  TEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDN  3750
             +E  L T QME E KV  LM EL A K NQ VL A  +KL   LE+V S+E   K  +  
Sbjct  1183  SESNLCTLQMESEIKVLGLMQELAASKQNQEVLMADHEKLLELLEDVKSNEEKHKSSVKG  1242

Query  3751  lesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLI  3930
             LE KL  SE  R Q+A+  SSL+I+L K + L+DE+L LK SLN++KF+N++LEASLQ++
Sbjct  1243  LEIKLKASEYARQQVAEETSSLQIQLQKTSLLQDEILDLKRSLNEVKFENQKLEASLQML  1302

Query  3931  CGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDA  4110
              G+ EELK +K   +Q+++ MQ +V+ELE+C+  KV LEEK+LRL+GDLTARE + A+DA
Sbjct  1303  SGDYEELKTEKILSMQKISDMQRAVSELEDCKRSKVALEEKLLRLDGDLTAREAIGAQDA  1362

Query  4111  ELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENS---------VPSP  4263
             ELKN+L ++KR NS+ + KI+ LE E+    K+ Q++ EEL +++ S            P
Sbjct  1363  ELKNELARAKRANSEFQRKIRYLEEEKQECLKKAQALGEELEQRKASKQDQHSFSDASLP  1422

Query  4264  SHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTID-DCSSRCQVGDD-----------  4407
             S   + D  +S  ++  S ++    +N  T     I  D  S+ Q+ ++           
Sbjct  1423  SGPESSDMNSSTPDE-FSVSQVGTKSNFNTGNAPGIGLDSLSKIQLLENELAEALEANDM  1481

Query  4408  -KTQFKSLQPEGQS--------------TRSGNENEQKISQLEAELKEISERYLHMSLKY  4542
              K Q KSL  E                    G+  E KIS L+ ELK++ ERY  MSLKY
Sbjct  1482  YKAQLKSLLTEEYKDPLNAPKKLLDEDVVVEGDGYEGKISSLQTELKDLQERYFDMSLKY  1541

Query  4543  AEVENQKGKLVMTLKALQDQR  4605
             AEVE ++ KLV+ LK + + R
Sbjct  1542  AEVEAERAKLVLKLKPVNNGR  1562


 Score =   196 bits (499),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L +HKS   D  G    F FS+ QALQVPKGWD+L V +ISVE GKT+SK GK SV 
Sbjct  1    MFRLHKHKS---DKFGGTLDFKFSSFQALQVPKGWDRLFVYIISVETGKTLSKSGKGSVR  57

Query  241  NGTCQWTESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVS  414
            NGTC+WTESL      +   +D   FKF+VSMGSSR+GILGEATVN+G YRN+E ++PVS
Sbjct  58   NGTCRWTESLTESIPVSEKEIDDCLFKFVVSMGSSRSGILGEATVNLGSYRNAETAVPVS  117

Query  415  LPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGID--NKSEERNNSL  588
            LPL+KCN GT+L   I+CLTPR   R ++     +Y E+  +V + ID  NKS+  ++S+
Sbjct  118  LPLKKCNHGTILLVRIQCLTPRAKPREEQFEEPGSYAEDVIAV-DYIDMENKSDVSDSSV  176


 Score =   172 bits (436),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 154/253 (61%), Gaps = 34/253 (13%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             +A IEEL+AEARMWE NARRLM  +E +RK+ ++QS   A +EM+LS +H E +     I
Sbjct  305   EATIEELRAEARMWEQNARRLMFDLEKMRKDLSDQSMHCASLEMQLSESHRECDGSKQKI  364

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             ++L++LLEES AKQ   E L  QAK  +N  KE+EDELKFQ E+N++L+LQL+K+QESN 
Sbjct  365   EQLKILLEESVAKQTTTEKLKFQAKEMDNFQKEIEDELKFQKETNADLALQLKKTQESNI  424

Query  1207  ELVSVLQEMEETVQKKKIEIENLLALNSRSDVMG-----VINSCGDEDNVQPKSTEQVSV  1371
             ELV++LQE+E+T++ +KIEI +L  + S+S   G     V NS  +E     KS  + + 
Sbjct  425   ELVTILQELEDTIEIQKIEISDLSKIQSKSQKAGKYHLEVQNS--EETKRMKKSFAKDTR  482

Query  1372  EKQCQ---------------------------EFKLQHLQESHMSLENSIICQEKAQEEK  1470
             E  C                            E + Q LQ+S  +LE++I   E++ E K
Sbjct  483   EASCDSGMEGSTVEQELDDLPVGSESEDSRSLELEFQQLQDSQKNLESTIKPPERSLENK  542

Query  1471  IHEIELEQDLRAQ  1509
             IH IE+EQ L+ Q
Sbjct  543   IHAIEVEQSLKTQ  555



>emb|CBI31378.3| unnamed protein product [Vitis vinifera]
Length=1338

 Score =   415 bits (1067),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 315/746 (42%), Positives = 440/746 (59%), Gaps = 70/746 (9%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE +   +   +L K  ++ ++K   L ++  + A+ HC+RDL  +I + Q     +E+
Sbjct  623   ELESEFTDLSKELLVKICEIDKLKANHLLKEEEIVAVRHCQRDLETQISNLQAEKRQLEE  682

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNISE-KIQEMKILELENEKQELESCVF  2805
             +ME +Q E   +TS   D +R +M+++   +   +S  KI E K LELE+ K ELE  + 
Sbjct  683   NMEIMQRE-SSVTSKCLDDLRNDMVLLNTSMESLVSSNKILERKSLELESSKDELELHLS  741

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
             ELE+EN+QLSER+SGLEAQLR+FTD  E  R++                           
Sbjct  742   ELEEENVQLSERISGLEAQLRYFTDERESGRLD---------------------------  774

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
                     MQKRWL+SQEE EYLK+ANPKLQATAESLIEEC SLQ  NGELR+Q+LE+  
Sbjct  775   --------MQKRWLESQEECEYLKQANPKLQATAESLIEECSSLQKSNGELRKQKLEMYE  826

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
             +C +LEA+LR+ Q     C  +IE LE  LSS LEE S KEK +N+ELE ++ + +  KE
Sbjct  827   RCTVLEAKLRESQEYFLYCSRKIEDLEETLSSTLEEISVKEKTLNTELETLVQENRNHKE  886

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             +L ++E+L +Q+   K  E+E  +++  HL  Q+    D  +  ASE   E+  L A+  
Sbjct  887   KLAVEENLLNQMYLEKTVEVEDLKREIAHLSEQISATQDEREQTASEAVLEVSCLRADKA  946

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
              L+  LQE+++    +E KL T ++E E K+  L+ EL A + NQ VL A   KL   L 
Sbjct  947   KLEAALQEVKEKFTNSENKLNTVRVESETKLMGLVSELAATRQNQEVLAADHAKLLGLLA  1006

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
              V S+E  LK  I+ +  KL  SE E  Q  +  SSLK++L K A L+DEVLALK SLN+
Sbjct  1007  EVKSNEEKLKGTINRVGLKLKTSEYEMQQQTEEISSLKMQLQKTALLQDEVLALKRSLNE  1066

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
              KF+NERLEASLQL   + E+LKA+K S IQ+++ MQ +V+ELE+C+  KV LEEK+LRL
Sbjct  1067  AKFENERLEASLQLQSADYEDLKAEKISFIQKISSMQAAVSELEDCKSSKVALEEKILRL  1126

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKE  4245
             EGDLTARE +CA+DAE+KN+L + KR NSQ RWKIK LE E+       Q+++EEL +K+
Sbjct  1127  EGDLTAREALCARDAEMKNELGRIKRTNSQFRWKIKYLEEEKEECLNRTQALEEELKKKK  1186

Query  4246  NSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVT-----IDDCSSRCQVGDD-  4407
                   S S A++   S +   +    + + N  E     +     I+D   + Q+ ++ 
Sbjct  1187  EVNQDQSESSARNFPVSPESNSMGTPTNDKLNPLEVDNYCSGSSHVIEDPMPKIQLLENR  1246

Query  4408  -----------KTQFKSLQPEGQSTRS----------GNENE---QKISQLEAELKEISE  4515
                        + Q KSL    QS  S          G + E    K+S LEAEL+EI E
Sbjct  1247  LSEALETNEMYRVQLKSLSSGEQSNHSYADKKVRDEGGVKKEGYKDKVSSLEAELREIQE  1306

Query  4516  RYLHMSLKYAEVENQKGKLVMTLKAL  4593
             RY HMSLKYAEVE ++ +LVM LK +
Sbjct  1307  RYSHMSLKYAEVEAEREELVMKLKTV  1332


 Score =   172 bits (437),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 130/185 (70%), Gaps = 11/185 (6%)
 Frame = +1

Query  781   HPEYTEEEIGQCSLHITRTSIPDAN-----------IEELKAEARMWELNARRLMVKMET  927
             H +   ++ G+ S  I  + + +A             EEL+AEARMWE NAR+LM  +E 
Sbjct  232   HLQNQRDDFGRVSHAIATSPLRNAGSCKDLEAAEGAFEELRAEARMWEQNARKLMHDLEI  291

Query  928   LRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNT  1107
             LRKEF+NQS+  AD++MEL+ +HTE NRL  +I++L  LLEE   +Q   ENL LQA+N 
Sbjct  292   LRKEFSNQSKNQADLDMELAASHTECNRLRQEIEQLNFLLEELTVRQKDTENLKLQAQNM  351

Query  1108  ENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALN  1287
              NI +E+EDE+KFQ ESN+NL++QL+K+QESN ELVSVLQEMEE ++K+K+EI +L  L 
Sbjct  352   NNIQQELEDEIKFQKESNANLTIQLKKTQESNIELVSVLQEMEEMIEKQKMEITDLSMLK  411

Query  1288  SRSDV  1302
             S+ DV
Sbjct  412   SKFDV  416


 Score =   170 bits (431),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 9/150 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L RHK    D SG +F F FS  QALQVPKGWDKL VS+ISVE G+T +K GK+SV 
Sbjct  1    MFRLHRHKP---DKSGHRFHFNFSGFQALQVPKGWDKLCVSIISVETGRTTTKTGKSSVR  57

Query  241  NGTCQWTE----SLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             G C+WTE    S+W P++ AS  ++   FK +V+MGSSR+GILGEATVN+  Y +S+AS
Sbjct  58   TGNCRWTETLSDSIWIPQDDASKEVEECLFKLVVAMGSSRSGILGEATVNLAGYVSSKAS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
              +SLPL+KC+ GT L  +I+CLTPRT+ R
Sbjct  118  FLLSLPLEKCHHGTTLQVKIQCLTPRTTLR  147



>ref|XP_010241653.1| PREDICTED: myosin heavy chain, skeletal muscle-like [Nelumbo 
nucifera]
Length=1668

 Score =   416 bits (1068),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 378/1052 (36%), Positives = 573/1052 (54%), Gaps = 127/1052 (12%)
 Frame = +1

Query  1765  SEFETSKHGFQFLLLQ-----KEVIEEEVPNSLQIHSSGQ----RENHTCLEPPNFQAFK  1917
             SE + S  G Q L L+     KE+  E V  S   H  GQ    +E  T LE    Q  K
Sbjct  636   SEPKVSNPGSQILQLEDELNRKEMFSEGVATS---HLQGQLIDLQEKCTELEF-QLQLSK  691

Query  1918  CKGCDLNVKLHACCVKATDKQATEITVNPSEGQRDEIDSRNFTLKD---VS-DRNRYSEP  2085
              K C+L+ +LH    +  + Q  E+ +   + Q      R    +D   VS  R+  S+P
Sbjct  692   DKACNLDSQLHK---RQAEMQERELEITALQRQLKGYQERKTDKEDQLFVSCVRSENSDP  748

Query  2086  ETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKDISRGTDPMAQKEH  2265
                 +I  +   L  QL +   +       + S  N    +      I   TD +  KE 
Sbjct  749   NFPIEISRIFTELDNQLRLALAHARKSCCSVCSHENTNCEDDLDSLAILSSTDTICLKEQ  808

Query  2266  AKAVFDKLV---QLLRARLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKDPCSSH  2436
             A+A+    +   +LL A+ + C      ED  + +V+   + +D  D     + D CS +
Sbjct  809   AEAILSNFILLNKLLEAK-IKC------EDALQNKVD--IKERDVDDSEAQKKFDQCSLN  859

Query  2437  QGYK----NFKELEVKGES----IGNNVLTKNSKMLEVKTGC---LEEDVGLKALNHCRR  2583
             +  +      + LE+K E     +   ++ + S++ E+       +EE   L+ L+H  R
Sbjct  860   ENARLSIEECESLEMKLEDGVADLRKELVARQSEVEELAASLSLKIEEVDDLR-LSH--R  916

Query  2584  DLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQE  2751
              + +++   Q     +E++ME V  EK  I S   D +R ++MV++  +    S  K  +
Sbjct  917   KIESQVSTLQKEKNHLEENMEIVLREKS-IASKCLDDVRHDLMVLSNSVASYASANKTLQ  975

Query  2752  MKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLC  2931
              K  +LE+EK ELE  + +LE+EN++LSERVS  EAQLR+ TD  E SR+EL +  +   
Sbjct  976   RKCSDLESEKHELEVHLCDLEEENIKLSERVSAFEAQLRYLTDEKESSRLELDNSKSLAS  1035

Query  2932  NLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECD  3111
             NLQDEI  L  + E+Q+++ KQ+L +MQKRW +SQEE EYLK+ANPKLQ TAESLIEEC 
Sbjct  1036  NLQDEIGRLVTEIEAQKVDFKQKLQDMQKRWSESQEECEYLKRANPKLQITAESLIEECS  1095

Query  3112  SLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEK  3291
             SLQ LNGELR Q+LEL  +C  LE+ L + +   S C S++E LE KLS + E+T+ KEK
Sbjct  1096  SLQKLNGELRNQKLELHERCMHLESRLLESRIKFSDCSSKVELLERKLSLVYEDTTLKEK  1155

Query  3292  IMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDRED  3471
             +++SEL+ +L + KE KE+LV++ +L +Q    K +E+E  Q++  HL++Q+    D  +
Sbjct  1156  LLSSELDALLHENKEHKEKLVLEMNLINQKYLDKTAEVEKLQREVAHLIDQISATHDERE  1215

Query  3472  GKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHK  3651
               AS+   E+  L A+   L+ +LQE+Q  +E +E +L T ++E   K+  L+ EL   +
Sbjct  1216  RLASDAILEVPCLRADKAKLEDSLQEVQAKVESSENELATLRVENAAKIQALVDELTVSR  1275

Query  3652  TNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELL  3831
              +  +L +   KL R LE+V SSE   +   + LE KL   E ER QL +  +SLK +L 
Sbjct  1276  QSHELLISDHGKLMRLLEDVKSSEEKFRSTSNGLERKLTSCEYERQQLLEEIASLKTQLQ  1335

Query  3832  KIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTE  4011
             KI+ L+DEVL+LK SLN+ KF+ E+LE+SLQL+ G+ EELKA++ SLI++++ MQ +V+E
Sbjct  1336  KISQLQDEVLSLKNSLNETKFEKEKLESSLQLLSGDFEELKAERVSLIEKVSSMQEAVSE  1395

Query  4012  LEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQL----  4179
             LE+CR  KV LEEKVLRL+GDLTA E +CA+DAELKN+L++ KR +SQ + KI+ L    
Sbjct  1396  LEDCRHSKVALEEKVLRLKGDLTAIEALCAQDAELKNELSRIKRTSSQFQRKIQHLVEEK  1455

Query  4180  ------------ELERYYLSKELQS-------------------VQEELNRKENS-----  4251
                         EL++    K+LQS                   + EELN +E +     
Sbjct  1456  DEYLKRVQVLEEELKQKREEKQLQSESSNKDLSEYSESNTNVFTIHEELNPEEKTENINR  1515

Query  4252  ------VPSP-SHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDD-  4407
                   +PS  +   ++D+     +Q L +  +   N+  + + + +D  S R QV ++ 
Sbjct  1516  HGENQKLPSKKADQFSEDRPNLIADQYLGEGNNFHHNDHRSPKGIEVDPLS-RIQVLENE  1574

Query  4408  -----------KTQFKSL----------QP---EGQSTRSGNENEQKISQLEAELKEISE  4515
                        K Q +SL           P   EG+       N++K S LEAEL+E+ E
Sbjct  1575  LSEALEANDMYKEQLRSLLSEEKNSHVDHPNTTEGEGVVRKEGNQRKASSLEAELREMRE  1634

Query  4516  RYLHMSLKYAEVENQKGKLVMTLKALQDQRTG  4611
             RY  MSLK+A+VE Q+ +LVM LKA   Q++G
Sbjct  1635  RYFQMSLKFADVEAQREELVMKLKA---QKSG  1663


 Score =   320 bits (821),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 219/547 (40%), Positives = 311/547 (57%), Gaps = 76/547 (14%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MFKL RHKS      G+K  F  S+ QALQVPKGWDK+ VSL+S+E G+T +K  KA V 
Sbjct  1     MFKLHRHKSL---KPGEKVDFRLSSFQALQVPKGWDKILVSLVSLETGRTTAKTSKAVVR  57

Query  241   NGTCQW----TESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NGTCQW    TES+W  ++ AS  L+   FK +VSMGSSR+ ILGE  +N+ +Y +S AS
Sbjct  58    NGTCQWTETLTESIWISQDDASKELEECLFKLIVSMGSSRSSILGEVVINLTNYLSSRAS  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSE----  570
             + VS PL+KCN GT+L  +I+CL PR   R ++   T    E+ N+  N +D++S+    
Sbjct  118   VLVSFPLKKCNHGTILQVKIQCLAPRRD-RAEQWKETNPQPEDLNTDYNDMDSRSDGSDI  176

Query  571   ---------------------------------ERNNSLPSMEDSLGRDSLssasnssav  651
                                              E  +S  S + S+ R S S  +N +  
Sbjct  177   IFTTSVGSTSSNHLGNTSHQGDLGSRDPSFSASESRHSSDSADGSIDRVSFSPGNNLNDG  236

Query  652   vnnaIRRLESTESGGSAPWssysygspksnnspnklsisC------QEKHPEYTEEEIGQ  813
             V N I R +ST S  S P+ +Y  G    +N  +  S +       Q +HP      +  
Sbjct  237   VYNLIGRQDSTGSPNSIPYGTYPSGDLSRSNHSSFNSRASGSSNHHQNQHPVTAMSSMKN  296

Query  814   CSLHITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTA  993
                      + +  IEEL+AEARMWE NAR+LM  +E ++KE ++QSQR AD+ MELS A
Sbjct  297   VGSSKELLDVAEETIEELRAEARMWERNARKLMFDLEIVKKECSDQSQRQADLNMELSGA  356

Query  994   HTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLS  1173
             ++E + L  +I++L+ LLEES  K+ A E+ + QA+   +I KE+EDE+KFQ ESN+NL+
Sbjct  357   YSERDGLKQEIEQLKTLLEESTEKKTATESSSFQAEGITHIQKELEDEIKFQQESNANLT  416

Query  1174  LQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLAL---NSRSDVMGVIN---------  1317
             LQ++K+QESN ELVS+LQE+EET++K+++EI+NL AL   N R+D  G +N         
Sbjct  417   LQMQKTQESNIELVSILQELEETIEKQRLEIDNLSALQSCNCRNDDSGELNLTKGSSLEK  476

Query  1318  ---SCGDEDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIEL  1488
                +  + D     ++  VS        +L  LQES  SL+ ++   EKA EEK   IE+
Sbjct  477   TRKASSNLDGAVDDTSNLVS--------QLMELQESQKSLQTTVQMLEKALEEKNQMIEV  528

Query  1489  EQDLRAQ  1509
             E+  R Q
Sbjct  529   ERSPRNQ  535



>gb|KHG28960.1| Desmoplakin [Gossypium arboreum]
Length=1545

 Score =   409 bits (1050),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 310/749 (41%), Positives = 460/749 (61%), Gaps = 45/749 (6%)
 Frame = +1

Query  2482  IGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTE  2661
             +G  +  K S++ ++K+  L ++  L AL H +++L  ++   Q     +E+++E +   
Sbjct  798   LGKQLSDKISEIGKLKSDNLLKEDELVALRHHQKELEAQVSSLQKEKIQLEENIE-IMLG  856

Query  2662  KDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQ  2829
             +  +T+   D +R +MMV+   +   IS  KI   K  ELE+ KQELE  + ELE+EN+Q
Sbjct  857   EGAVTAKCLDDLRSKMMVLNSNMDSQISTNKILVKKSEELESGKQELEVHLSELEEENLQ  916

Query  2830  LSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLME  3009
             LSER+SGLEAQLR+ TD  E  R+ELQ+  +Q   L+ EI  LE + E+Q+++++Q++ E
Sbjct  917   LSERISGLEAQLRYLTDERESHRLELQNSESQAMELKGEITRLENEIEAQKVDMRQKMEE  976

Query  3010  MQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAE  3189
             MQKRWL+ QEE EYLK ANPKLQAT ESLIEEC  LQ  N ELR+++ EL   C +LEAE
Sbjct  977   MQKRWLEVQEECEYLKVANPKLQATTESLIEECSVLQKANRELRKRKAELNEHCAVLEAE  1036

Query  3190  LRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESL  3369
             L++ +   S+  S +E+LE K SS+LEE +SKE+ +N ELE +L + K+ KE+LV++E+L
Sbjct  1037  LKESEKVFSNMTSEVEALEEKYSSMLEEIASKERALNLELEALLEENKKQKEKLVLEENL  1096

Query  3370  QSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQE  3549
              +Q    K +E+E  Q++  HL  Q+    D ++  A E   E+  L A+  ML+  LQ+
Sbjct  1097  LNQKYLEKTAEVENLQREVAHLTEQISATQDEKEKTAYEAVLEVSHLRADKAMLEAALQD  1156

Query  3550  IQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESN  3729
             +Q  L++++ KL T Q+E E +  EL  EL + K  Q +L A  +KL   LE+V S+E  
Sbjct  1157  LQGKLKLSDGKLNTFQVESETETQELKEELASAKQKQEILMADHEKLLDLLEDVKSNEDK  1216

Query  3730  LKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERL  3909
             LK  +  LE KL  SE E  QLA+  SSLK++L K   L+DE+L LK ++++ KF+NERL
Sbjct  1217  LKGTVRGLELKLKASEYENQQLAEEISSLKVQLQKTMVLQDEILDLKKTISESKFENERL  1276

Query  3910  EASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTARE  4089
             EAS Q++  + EELK ++T L ++++  Q +V+EL+ CR RKV LEEKVLRL+GDLTARE
Sbjct  1277  EASFQMLSRDYEELKVERTLLAEKVSNSQQAVSELDACRRRKVALEEKVLRLQGDLTARE  1336

Query  4090  VMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSP-S  4266
              +  ++A LKN+L Q +R NSQL+ KIK+LE E+    K+ Q ++EEL + +    SP +
Sbjct  1337  ALGTQEAALKNELAQIRRENSQLQRKIKKLEEEKDDCLKKAQGLEEELKQIKQDQNSPKT  1396

Query  4267  HSVAKDKTTSCKEQKLSKARSSQ---------------CNNCETIQIVTI----------  4371
              ++ +    S  E+  S+    Q               CNN ET Q+             
Sbjct  1397  QNIEEKDNLSSSEKLFSETDQVQQHIDENHTQVDNNQNCNN-ETSQVSGAELLSKIQNLE  1455

Query  4372  DDCSSRCQVGD-DKTQFKSL----------QPEGQSTRSGNENEQKISQLEAELKEISER  4518
             ++ +   +  D  K Q KSL           PEG + + G + +   S LE ELKE+ ER
Sbjct  1456  NELAEALEANDMYKAQLKSLLTKEVSFHSPGPEGDARKDGCDCQ--TSALEKELKELRER  1513

Query  4519  YLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             Y HMSLKYAEVE+Q+ +L+M L+A   +R
Sbjct  1514  YSHMSLKYAEVEDQREQLMMQLRAASGRR  1542


 Score =   325 bits (833),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 223/537 (42%), Positives = 310/537 (58%), Gaps = 61/537 (11%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L + KS   D SG++F F FS+ QA QVPKGWDKL VS+IS + GKT++K  KA V 
Sbjct  1     MFRLHKQKS---DKSGERFDFKFSSFQANQVPKGWDKLFVSIISADTGKTVNKSNKALVR  57

Query  241   NGTCQWTES----LWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NG C+WTES    +W      S  LD   FK +V+MGSSR+G LGEAT+N+ +Y +S+ S
Sbjct  58    NGNCRWTESFSESIWIARGDTSKVLDECLFKLVVAMGSSRSGFLGEATINLANYISSKNS  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNG-IDNKSEERN  579
             IP+SLPL+KCN GTVL  +I+CLTP+   R DE    A  N E+ S+ N  ++NKS+  +
Sbjct  118   IPLSLPLKKCNHGTVLQVKIQCLTPKEK-RRDEQWKDADLNLEDASLENDDLENKSDASD  176

Query  580   NSL-------------------------PSMEDSLGRDSLssasnssav--------vnn  660
              +                          PS+  S  R+S  S   S           ++N
Sbjct  177   GTYARSVGSSSSNHFEGTLHPGELSSREPSLSASDSRNSFDSLDGSYRENFSPHNGVMSN  236

Query  661   aIRRLESTESGGSAP-WssysygspksnnspnklsisCQEKHPEYTEEEIGQCSLHITRT  837
              I R +ST S  S P  S     S +SN+S     +S    HP    E++ + S  +  +
Sbjct  237   LIGRQDSTGSQTSTPSGSYSFNDSSRSNHSSVTPKVSSSGGHPHNHREDLNRASRLVPSS  296

Query  838   SI------------PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEME  981
              +             +  I EL+AEARMWE NAR+LM+ +E  +KEF + S+    +E  
Sbjct  297   PLRNTGSSKDLMEAAEITIGELRAEARMWEQNARKLMIDLENSQKEFLDLSKHQKSLEAA  356

Query  982   LSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESN  1161
             LS +  E + L  +IK +++LLEES  KQ AA NL  Q KN  N+ KE+E+E++FQ E N
Sbjct  357   LSASQAECDCLKQEIKEVKILLEESQMKQAAANNLKFQTKNNGNVQKELEEEIRFQREEN  416

Query  1162  SNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNV  1341
             +NL+LQL+K+QESN ELVS+LQE+EET++K+K+EI+NL A           +S G+ D V
Sbjct  417   ANLALQLKKTQESNIELVSILQELEETIEKQKVEIDNLSAAKQ---TRKSSDSDGESDIV  473

Query  1342  QPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQG  1512
             + +S + ++ E +  E + Q LQESH  LE++I   EK  EEK HE E EQ LR Q 
Sbjct  474   EQRSRDLLA-ENRNLEIQFQLLQESHGKLESTIQALEKTLEEKNHETETEQALRRQS  529



>emb|CAN83583.1| hypothetical protein VITISV_009664 [Vitis vinifera]
Length=2427

 Score =   403 bits (1035),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 278/668 (42%), Positives = 428/668 (64%), Gaps = 22/668 (3%)
 Frame = +1

Query  2233  RGTDPMAQKEHAKAVFDKLVQL---LRARLVSCTN-DKYSE----DGARTEVNNTYEIKD  2388
             +  D +AQ++H +++ + LV+L   L AR++ C    K+ E    DG+RT +    +++D
Sbjct  709   KSVDVIAQRDHVESILNCLVELNRLLEARIIECEEVRKHDEAEIRDGSRTIIEAQKKLED  768

Query  2389  KSDYGCSTEKDPCSSHQGYKNFKELEVKGESIGNNVLTKNSKMLEVKTGCL---EEDVGL  2559
                Y         S H+   +  ELEVK   +   +  + S++++++  CL   EE++GL
Sbjct  769   ---YIVKENNLFRSIHEIESSKMELEVKVTDLDKELTERKSEIIKLE-ACLLSKEEEIGL  824

Query  2560  KALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGN  2730
               L   +R+  +++ + Q     +E+++E V  E  +ITS   D +R ++MV++  +  +
Sbjct  825   --LRQSQRESESQVSELQKEKTQLEENIEIVVRE-SNITSKCLDDLRNDLMVLSSSVDSH  881

Query  2731  ISE-KIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMEL  2907
             +S  +I   K+ ELEN K+ELE  + ELE EN+QLSER SGLEAQLR+ TD     ++EL
Sbjct  882   VSANRILRRKMSELENGKRELELHISELELENVQLSERTSGLEAQLRYLTDERASCQLEL  941

Query  2908  QHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATA  3087
             ++  +   + QDEIR L  + E+Q++ ++Q+L +MQ +W ++QEE +YLK+ANPKL+ATA
Sbjct  942   ENSKSVASSFQDEIRRLAIEMETQKVVIEQKLQDMQTKWSEAQEECDYLKRANPKLKATA  1001

Query  3088  ESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSIL  3267
             E LIEEC SLQ  NGELR+Q+LEL     LLEA+LR+ Q   ++C  R+E LE  LSS+L
Sbjct  1002  ERLIEECSSLQKSNGELRKQKLELHEGSTLLEAKLRESQKRFANCSKRVEVLEENLSSML  1061

Query  3268  EETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQM  3447
             E+ +SKEKI  SEL+++L + ++ KE+L++ ESL +Q    K +E+E  Q++  HL NQ+
Sbjct  1062  EDMASKEKIFTSELDILLQENRKQKEKLILGESLFNQRYSEKTAEVEKLQKEVEHLNNQI  1121

Query  3448  FDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYEL  3627
                 D  +   S   +E  SL A+   L+  LQE+Q  +++ E +L   Q+E E KV  L
Sbjct  1122  SATHDERERITSNSVYEASSLHADKAKLESELQEVQSKVKLIENELYIVQLESEEKVQGL  1181

Query  3628  MGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADAN  3807
               +L+  K N  +L A   K  + LEN  SSE  LK  + +LE KL +SE ER QL +  
Sbjct  1182  TSDLSISKQNHSMLMADHKKNLKLLENYRSSEEKLKTTLSDLELKLTVSEYERQQLLEET  1241

Query  3808  SSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELT  3987
             +SLK++L K+A L+DEVLALK   +  KF+  ++EASL LI  +NEELKA+K S I++++
Sbjct  1242  ASLKVQLQKLAPLQDEVLALKAEFDAAKFERGKMEASLHLISADNEELKAEKISFIEKIS  1301

Query  3988  GMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWK  4167
              ++ S +ELE+C+L +VVLEEK+LR+EGDLTARE  CA+DAELKN+L++ +R   Q + K
Sbjct  1302  SLETSTSELEDCKLNRVVLEEKILRMEGDLTAREAFCAQDAELKNELSRIRREVRQFQRK  1361

Query  4168  IKQLELER  4191
             ++QLE E+
Sbjct  1362  VEQLEEEK  1369


 Score =   162 bits (411),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 147/219 (67%), Gaps = 14/219 (6%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEA+MWE N+++LM+ +E LRKEF++QS+  A ++MELS A++E + L  +I +L
Sbjct  319   IEELRAEAKMWERNSQKLMLDLEILRKEFSDQSKNQATLDMELSAAYSERDALKKEIDQL  378

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             ++LLEES  KQ   E+   Q +   +I KE+EDE+KFQ ESN+NL+LQLR+SQESN ELV
Sbjct  379   KILLEESKMKQAMGES-TFQDEGATHIQKELEDEIKFQKESNANLALQLRRSQESNIELV  437

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFK  1395
             SVLQE+E T++K+KIE+E+L AL  +           D D+    S  +   E +    +
Sbjct  438   SVLQELELTIEKQKIELEDLAALRLK---------LNDADS----SIHESLAENKDVALQ  484

Query  1396  LQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQG  1512
             LQ LQ+S  +L+  +   E+A E+K HE+E E+ L  Q 
Sbjct  485   LQQLQDSEKNLQVKVGFLEQALEDKNHELENERSLSNQA  523


 Score =   159 bits (403),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 113/163 (69%), Gaps = 9/163 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R+K++    SG++  F FSN QA QVPKGWDKL VS++SVE GK+I+K  KAS  
Sbjct  1    MFRLHRNKAA---KSGERVDFKFSNFQATQVPKGWDKLFVSIVSVETGKSIAKSSKASAR  57

Query  241  NGTCQWTE----SLWSPENYASNGLDHF--KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQWTE    S+W  +   S  L+ F  KF+V+MGS+R GILGEAT+N+  Y +S AS
Sbjct  58   NGNCQWTETLSESIWISQEDNSKDLEEFLFKFVVAMGSARTGILGEATINMASYMSSSAS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEE  531
            + VSLPL+KCN GT+L  +I CLTPR   R +E   T ++ E+
Sbjct  118  VSVSLPLKKCNHGTILQVKIHCLTPRIKQRDEESKDTNSHEED  160



>ref|XP_010654335.1| PREDICTED: uncharacterized protein LOC100248757 [Vitis vinifera]
Length=2487

 Score =   402 bits (1033),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 278/668 (42%), Positives = 428/668 (64%), Gaps = 22/668 (3%)
 Frame = +1

Query  2233  RGTDPMAQKEHAKAVFDKLVQL---LRARLVSCTN-DKYSE----DGARTEVNNTYEIKD  2388
             +  D +AQ++H +++ + LV+L   L AR++ C    K+ E    DG+RT +    +++D
Sbjct  709   KSVDVIAQRDHVESILNCLVELNRLLEARIIECEEVRKHDEAEIRDGSRTIIEAQKKLED  768

Query  2389  KSDYGCSTEKDPCSSHQGYKNFKELEVKGESIGNNVLTKNSKMLEVKTGCL---EEDVGL  2559
                Y         S H+   +  ELEVK   +   +  + S++++++  CL   EE++GL
Sbjct  769   ---YIVKENNLFRSIHEIESSKMELEVKVTDLDKELTERKSEIIKLE-ACLLSKEEEIGL  824

Query  2560  KALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGN  2730
               L   +R+  +++ + Q     +E+++E V  E  +ITS   D +R ++MV++  +  +
Sbjct  825   --LRQSQRESESQVSELQKEKTQLEENIEIVVRE-SNITSKCLDDLRNDLMVLSSSVDSH  881

Query  2731  ISE-KIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMEL  2907
             +S  +I   K+ ELEN K+ELE  + ELE EN+QLSER SGLEAQLR+ TD     ++EL
Sbjct  882   VSANRILRRKMSELENGKRELELHISELELENVQLSERTSGLEAQLRYLTDERASCQLEL  941

Query  2908  QHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATA  3087
             ++  +   + QDEIR L  + E+Q++ ++Q+L +MQ +W ++QEE +YLK+ANPKL+ATA
Sbjct  942   ENSKSVASSFQDEIRRLAIEMETQKVVIEQKLQDMQTKWSEAQEECDYLKRANPKLKATA  1001

Query  3088  ESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSIL  3267
             E LIEEC SLQ  NGELR+Q+LEL     LLEA+LR+ Q   ++C  R+E LE  LSS+L
Sbjct  1002  ERLIEECSSLQKSNGELRKQKLELHEGSTLLEAKLRESQKRFANCSKRVEVLEENLSSML  1061

Query  3268  EETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQM  3447
             E+ +SKEKI  SEL+++L + ++ KE+L++ ESL +Q    K +E+E  Q++  HL NQ+
Sbjct  1062  EDMASKEKIFTSELDILLQENRKQKEKLILGESLFNQRYSEKTAEVEKLQKEVEHLNNQI  1121

Query  3448  FDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYEL  3627
                 D  +   S   +E  SL A+   L+  LQE+Q  +++ E +L   Q+E E KV  L
Sbjct  1122  SATHDERERITSNSVYEASSLHADKAKLESELQEVQSKVKLIENELYIVQLESEEKVQGL  1181

Query  3628  MGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADAN  3807
               +L+  K N  +L A   K  + LEN  SSE  LK  + +LE KL +SE ER QL +  
Sbjct  1182  TSDLSISKQNHSMLMADHKKNLKLLENYRSSEEKLKTTLSDLELKLTVSEYERQQLLEET  1241

Query  3808  SSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELT  3987
             +SLK++L K+A L+DEVLALK   +  KF+  ++EASL LI  +NEELKA+K S I++++
Sbjct  1242  ASLKVQLQKLAPLQDEVLALKAEFDAAKFERGKMEASLHLISADNEELKAEKISFIEKIS  1301

Query  3988  GMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWK  4167
              ++ S +ELE+C+L +VVLEEK+LR+EGDLTARE  CA+DAELKN+L++ +R   Q + K
Sbjct  1302  SLETSTSELEDCKLNRVVLEEKILRMEGDLTAREAFCAQDAELKNELSRIRREVRQFQRK  1361

Query  4168  IKQLELER  4191
             ++QLE E+
Sbjct  1362  VEQLEEEK  1369


 Score =   162 bits (411),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 147/219 (67%), Gaps = 14/219 (6%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEA+MWE N+++LM+ +E LRKEF++QS+  A ++MELS A++E + L  +I +L
Sbjct  319   IEELRAEAKMWERNSQKLMLDLEILRKEFSDQSKNQATLDMELSAAYSERDALKKEIDQL  378

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             ++LLEES  KQ   E+   Q +   +I KE+EDE+KFQ ESN+NL+LQLR+SQESN ELV
Sbjct  379   KILLEESKMKQAMGES-TFQDEGATHIQKELEDEIKFQKESNANLALQLRRSQESNIELV  437

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFK  1395
             SVLQE+E T++K+KIE+E+L AL  +           D D+    S  +   E +    +
Sbjct  438   SVLQELELTIEKQKIELEDLAALRLK---------LNDADS----SIHESLAENKDVALQ  484

Query  1396  LQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQG  1512
             LQ LQ+S  +L+  +   E+A E+K HE+E E+ L  Q 
Sbjct  485   LQQLQDSEKNLQVKVGFLEQALEDKNHELENERSLSNQA  523


 Score =   159 bits (402),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 113/163 (69%), Gaps = 9/163 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R+K++    SG++  F FSN QA QVPKGWDKL VS++SVE GK+I+K  KAS  
Sbjct  1    MFRLHRNKAA---KSGERVDFKFSNFQATQVPKGWDKLFVSIVSVETGKSIAKSSKASAR  57

Query  241  NGTCQWTE----SLWSPENYASNGLDHF--KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQWTE    S+W  +   S  L+ F  KF+V+MGS+R GILGEAT+N+  Y +S AS
Sbjct  58   NGNCQWTETLSESIWISQEDNSKDLEEFLFKFVVAMGSARTGILGEATINMASYMSSSAS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEE  531
            + VSLPL+KCN GT+L  +I CLTPR   R +E   T ++ E+
Sbjct  118  VSVSLPLKKCNHGTILQVKIHCLTPRIKQRDEESKDTNSHEED  160



>ref|XP_002534081.1| DNA repair protein RAD50, putative [Ricinus communis]
 gb|EEF28304.1| DNA repair protein RAD50, putative [Ricinus communis]
Length=1362

 Score =   378 bits (970),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 281/709 (40%), Positives = 413/709 (58%), Gaps = 46/709 (6%)
 Frame = +1

Query  2557  LKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTE---KDDITSDSMREEMMVVTGRIFG  2727
             ++AL  C+R L  +I   Q     +E++ME VQ           DS  E MM  + R+  
Sbjct  675   VEALRCCQRQLETQISILQNEKRRLEENMEVVQKRGMMSSSCLDDSNNEIMMFNSSRMMS  734

Query  2728  -------------------NISEKIQEMKILELENEKQELESCVFELEKENMQLSERVSG  2850
                                ++S      ++ ELE+ K E+E  + ELEKEN++LSER+ G
Sbjct  735   TGLDASQNQILVLNSSKDSHVSTSEIPTRMSELESSKSEMEIHLAELEKENIELSERICG  794

Query  2851  LEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLD  3030
             LEAQLR+ TD  E SR+ELQ+  +   NLQ+E+R LE + E+ + + KQ+L EMQ  WL+
Sbjct  795   LEAQLRYLTDERESSRLELQNSESCALNLQNEMRRLESEWETDKGDRKQKLQEMQNMWLE  854

Query  3031  SQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHS  3210
             +Q E+EYLK AN KLQ TAESLI+EC  LQ    ELR+Q++EL   C +LEAELR+ Q  
Sbjct  855   AQSENEYLKIANLKLQTTAESLIDECSLLQKSLLELRKQKIELHEHCTILEAELRESQKG  914

Query  3211  LSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQH  3390
              S  L  +E+LE K   ILEE +SKEK +  E++++L   K++KE+L  + SL +Q+   
Sbjct  915   FSDMLKEVEALERKYILILEEIASKEKALALEVDVLLQDNKQYKEKLEEETSL-NQIYLE  973

Query  3391  KLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEI  3570
             K  E+E  Q++  H+   M    D ++  A+    E+  L A+   L+ +L  ++  L +
Sbjct  974   KAVEVENLQKEVAHITEHMSTTCDEKERTAAAAVVEVSRLRADRATLEASLHTVRGKLRL  1033

Query  3571  TEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDN  3750
             +E  L T QME E K+  L  EL A + NQ +L A ++KL   LE+V S+E   K I+  
Sbjct  1034  SESNLSTLQMESETKLLGLQNELAASRQNQEILMADNEKLLELLEDVKSNEDKYKSIVRG  1093

Query  3751  lesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLI  3930
             LE KL  +  E LQL +   SL+++L K A L DE+LALK SLN+++F+N+RLE SLQ++
Sbjct  1094  LELKLKATAYEGLQLKEEICSLRVQLQKTALLEDEILALKKSLNEVQFENQRLEVSLQML  1153

Query  3931  CGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDA  4110
              G+ EEL A K  L+Q ++ MQ +V ELE CR  KV LEEK+LRLEGDLTARE +  +DA
Sbjct  1154  SGDYEELMAAKMQLLQMISDMQKAVAELEHCRRSKVSLEEKILRLEGDLTAREALGGQDA  1213

Query  4111  ELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL-NRKENSVPSPSHSVAKDK  4287
             ELKN+L + KR N++L  KI+ L+ E     +  Q+ + EL  R E    S +  +    
Sbjct  1214  ELKNELARVKRANNELHRKIRHLQEENQEYIQRTQTCEGELEQRIEAKQISENSRIEYLS  1273

Query  4288  TTSCKEQKLSKARSSQCNNCETIQIVT--IDDCSSRCQVGDDKTQFKSLQPEGQSTRSGN  4461
                  E KL++A   + N+   +Q+ +  +++CS                    S ++G 
Sbjct  1274  KLQLLETKLAEAL--EANDMYKVQLKSFLLEECS------------------NHSNKAGK  1313

Query  4462  ENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQRT  4608
             E E   S LE EL+++ ERY HMSLK AEVE+++ +LV+ L+ + + R+
Sbjct  1314  EFEGSASTLEIELRDLQERYFHMSLKCAEVESEREQLVLKLRTVSNGRS  1362


 Score =   270 bits (689),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 174/432 (40%), Positives = 255/432 (59%), Gaps = 70/432 (16%)
 Frame = +1

Query  145   LQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTE----SLWSPENYASNGLD--  306
             +QVPKGWDKL VS++S E GKT++K GKASV N +CQWTE    S+W   + +S  +   
Sbjct  1     MQVPKGWDKLYVSIVSTETGKTLTKSGKASVRNASCQWTETLSESIWISRHDSSKQIGDC  60

Query  307   HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTS  486
              FK +VSMGS+R+ ILGEATVN+  Y+NS+ ++PVSL L+KCN GT+L            
Sbjct  61    FFKLVVSMGSARSSILGEATVNLASYKNSKTAVPVSLSLKKCNHGTILQVS---------  111

Query  487   FRGDEVNSTAAYNEEENSVCNGIDNKSEERNNSLP-------------------------  591
                   + + ++ E+ N  C+ +++KS+  +NSL                          
Sbjct  112   ------HQSNSHMEDVNVDCDDVESKSDVSDNSLTKSIGSSSSSHLDSSSHAGELLNRDF  165

Query  592   ------------SMEDSLGRDSLssasnssavvnnaIRRLESTESGGSAPWssysygspk  735
                         S + SLGR++ S  +N + ++NN I R +ST S  S+  S     S +
Sbjct  166   SFSASGSRYSFDSTDGSLGRETYSPLNNLTGIMNNQIGRQDSTGSQNSSHGSYSFNDSSR  225

Query  736   snnspnklsisCQEKHPEYTEEEIGQCSLHITRTSI------------PDANIEELKAEA  879
             SN S     +       +   +E  Q S  +  + +             +A IEEL+AEA
Sbjct  226   SNQSSFNSKVLASRSSLQIQRDEFNQVSRSVASSPLRNAGSSKDLLEAAEAKIEELRAEA  285

Query  880   RMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESN  1059
             RMWE NAR+LM  +E LRKE ++QS+  A +EMELS +  E + L  +I+++++LLEES 
Sbjct  286   RMWEQNARKLMNDLEKLRKELSDQSKCQASLEMELSESRRECDGLKQEIEQVKILLEESL  345

Query  1060  AKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEE  1239
              KQ +AEN+ LQAK+  N+ KE+EDE++F+ ESN+NL+LQL+K+QESN ELVS+LQE+E+
Sbjct  346   VKQKSAENMELQAKDMGNLQKELEDEVRFEKESNANLALQLKKTQESNIELVSILQELED  405

Query  1240  TVQKKKIEIENL  1275
             T++K K+EI NL
Sbjct  406   TIEKLKMEIANL  417



>ref|XP_007204769.1| hypothetical protein PRUPE_ppa015244mg [Prunus persica]
 gb|EMJ05968.1| hypothetical protein PRUPE_ppa015244mg [Prunus persica]
Length=1400

 Score =   373 bits (957),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 291/757 (38%), Positives = 448/757 (59%), Gaps = 54/757 (7%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCL--EEDVGLKALNHCRRDLANKIYDHQMVAWMV  2631
             ELE+K   +G  +    S++ +++   L  EE++G+  L   + +L  K+ D Q     +
Sbjct  643   ELEIKVTELGKELTENRSEIAKLEANLLTKEEEIGV--LRQVQNELEAKVSDLQTEKIEL  700

Query  2632  EKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNISE-KIQEMKILELENEKQELESC  2799
             E+ ME V  E  DI+S   + +R E+ V++  +  ++S  K+ E K  ELE +K EL+  
Sbjct  701   EEQMEIVLRE-SDISSKCLNDLRNELTVISSSVNSHVSSNKVLERKSSELEADKCELDLH  759

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             V ELE+EN+QLS  +S LEAQ R+ TD  E +++EL    +   +LQDEI  L+ + ES 
Sbjct  760   VSELEQENVQLSAHISALEAQQRYLTDEKEANQLELDKSKSYCLSLQDEISRLKIEMESD  819

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
             ++ELKQ+L  ++ +W +++EE EYLK+ANPKLQATAESLIEEC+SLQ  N EL++Q+LEL
Sbjct  820   KVELKQKLKHLESQWSEAREEGEYLKRANPKLQATAESLIEECNSLQKSNEELKKQKLEL  879

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
             + QC+LLEA+L +   S + C  R+E LE  LS +LE  +SKE+ +NSEL+ +L +   +
Sbjct  880   QEQCSLLEAKLNQSHKSFTDCSKRVEVLEKDLSLMLENIASKEESLNSELDALLDENMTY  939

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             +E+L ++ESL +++   K +E+E  QQ+   L  ++       +  AS+  HE   L AE
Sbjct  940   REKLTLEESLFNEMYLEKATEVESLQQEVEQLTKKISATKKEREQLASDAIHEASRLRAE  999

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
               ML+  LQE+Q     TE +L   + E E K+  L  EL A K NQ    A  ++L + 
Sbjct  1000  KAMLESALQEVQSKAIQTENELNVMRTETEPKLQGLSAELAASKQNQESTMADHERLLKL  1059

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
              E+  SSE+ LK  +++LE KL +S+ ER QL + +++LK++L K+   ++EVLA K  L
Sbjct  1060  FESYKSSEAKLKTTVNDLELKLTVSDYERQQLVEESTNLKVQLQKLTDCQNEVLAFKNEL  1119

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             +   F+ E+LEA L  I  E E+LKA+K+S  ++++ ++ ++ ELE+C+  KV+LEEK+L
Sbjct  1120  DATTFEKEKLEALLHSISEECEDLKAEKSSFHEKISTLEKALFELEDCKRNKVLLEEKIL  1179

Query  4060  RLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERY-YLSK------ELQS  4218
             ++EG+L A+E +CA+DAELKN+L Q KR N Q + +IK LE ER  YL +      EL+ 
Sbjct  1180  QMEGNLIAKEALCAQDAELKNELNQIKRANEQYQQRIKLLEEERSEYLRRSQALEQELKL  1239

Query  4219  VQEELNRKENSVPSPSHSVAKDKTTSC---KEQKLSK-----------------------  4320
              +EE  ++ +S      S AK+ T      ++ KL K                       
Sbjct  1240  TREERQKQRDSSSPKISSPAKNSTKVIPVGEDMKLPKDDNGNEIHDGSPRDAGVDYGLKI  1299

Query  4321  -------ARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNENEQKI  4479
                     ++ + NN   +Q   +D   S  +  D +T+  S     ++ +   E  +  
Sbjct  1300  KFLEDELVKALEANNTYKVQ---LDRMLSEARHNDSETRRNSKAEAEKAAKERYERSR--  1354

Query  4480  SQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             S LE ELK+I ERYLHMSL+YAEVE Q+ +LVM LKA
Sbjct  1355  SSLETELKDIRERYLHMSLRYAEVEAQREELVMKLKA  1391


 Score =   290 bits (743),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 203/523 (39%), Positives = 293/523 (56%), Gaps = 70/523 (13%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L +++ +    SG++  F FS+ +ALQVP+GWDKL VS++SVE GK I+K  KA V 
Sbjct  1     MFRLHKNRPA---KSGERVDFKFSHFKALQVPRGWDKLFVSIVSVETGKPIAKSSKAVVR  57

Query  241   NGTCQWTE----SLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NG CQWTE    S+W  ++ +S  ++   FK ++SMGS+R+GILGE TVN+  Y +S +S
Sbjct  58    NGNCQWTETLSESIWISQDDSSKEMEDYFFKLVLSMGSARSGILGETTVNMSDYISSTSS  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERN-  579
             +PVSLPL+KC  GTVL  +I CLTPR     +E   T+   EE N+    +D+KS   N 
Sbjct  118   VPVSLPLKKCTYGTVLQVKINCLTPRKRLSDEESKETSCQFEEPNANGLDVDSKSNGSNS  177

Query  580   ------------------------------------NSLPSMEDSLGRDSLssasnssav  651
                                                 NS  S E S+ RD+ S  SN S  
Sbjct  178   TFGRSVGSSSMKDFGLTSNPGEPGSRGSSFSASGSHNSYDSAEGSIRRDNASPGSNLSGE  237

Query  652   vnnaIRRLESTESG-----GSAPWssysygspksnnspnklsisCQEKHPEYTEEEIGQC  816
              N+ I R +ST+S      G+ P          S ++ +  +        ++TE  +   
Sbjct  238   GNHLIGRQDSTDSPISTTHGNYP------ADAPSPSNHSSFNSRINHSRKDFTESPLTTT  291

Query  817   SLHITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAH  996
                       +  IEEL AEA+MWE NAR++M+ +E LR EF++QS++ A++ +ELS A+
Sbjct  292   DSSKNLLEAAEFTIEELHAEAKMWERNARKVMLDLEILRTEFSDQSKKQANLNVELSAAY  351

Query  997   TESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSL  1176
              E + L  +++ L++L E S  KQ   EN+    + T    K ++DELKFQ ES +NL+L
Sbjct  352   AERDGLKKEVEHLQLLFENSVVKQTGTENVTSLEEGTSQNEKALQDELKFQKESVANLAL  411

Query  1177  QLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKST  1356
             QL +SQESN ELVSVLQE+EET++K+++E+ENL  L  +          GD +N   K+T
Sbjct  412   QLERSQESNIELVSVLQELEETIEKQEMELENLSELQEK---------FGDMENSIKKTT  462

Query  1357  EQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIE  1485
             E    E +  + +LQ LQES   L+  +   E+A EEK HEIE
Sbjct  463   E----ENRYLKLQLQQLQESENKLQVMVQQLEQALEEKTHEIE  501



>ref|XP_010918589.1| PREDICTED: myosin-11-like [Elaeis guineensis]
Length=1568

 Score =   356 bits (914),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 329/959 (34%), Positives = 524/959 (55%), Gaps = 79/959 (8%)
 Frame = +1

Query  1903  FQAFKCKGCDLNVKLHACCVKATDK--QATEITVNPSEGQRDEIDSRNFTLKDVSDRNRY  2076
              Q +K + CDL +KL     +  +K  + TE+       Q  ++ S  F   DV    R 
Sbjct  627   LQQYKDQACDLEIKLQKSQAEIEEKNLELTELQQKLENFQHADLGS--F---DVVTERRE  681

Query  2077  SEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKDISRGTDPMAQ  2256
             +E  +T ++  L   +  QL I   +V  +     S  N E  + + +K +   TD +  
Sbjct  682   TESWSTSEMPRLFSEMNNQLHIALSHVRDLCCDGNSVANREYDSDSDFK-VPITTDTITV  740

Query  2257  KEHAKAVFDKLVQLLRARLVSCTN-----DKYSEDGARTEVNNTYEIKDKSDYGCSTEKD  2421
             KE A  + +KL++L  A L  C +     D   E G    V+ T E+K+        +K+
Sbjct  741   KEQAGVLTNKLLEL-NALLSGCKSVFQHADIMVEKGG---VDGT-EVKE--------QKN  787

Query  2422  PCSSHQGYKNFK-ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANK  2598
                  Q  +N K E++ + +SI   +   NSK+ E K G L ++  +  L H +R+L + 
Sbjct  788   NSLLEQEIENLKAEMQSRSKSISEELEESNSKIEEFKAGMLLKEQEIDILKHSKRELEDL  847

Query  2599  IYDHQMVAWMVEKDMEKVQTEKDDITSDSMRE---EMMVVTGRIFGNIS-EKIQEMKILE  2766
             I + Q     +E+D+   + E + ITS S+ +   +++ +T  I  ++S  KI E K +E
Sbjct  848   ISNLQKDKSQLEEDLAIARRE-NSITSKSLEDVHHDLLELTSTIDSHMSANKILERKSIE  906

Query  2767  LENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDE  2946
             LE+ K ELE  + E+E+EN+QLSER+SGLEAQLRH T+  E  R+EL+   + + +L+DE
Sbjct  907   LESCKNELELNISEMEQENVQLSERISGLEAQLRHLTNEKESKRLELEDSRSLIMDLKDE  966

Query  2947  IRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQIL  3126
             I + + + E+Q++ELKQ+L E Q R LD+QEE+E L++++ KLQ+T ESLIEEC+SLQ L
Sbjct  967   IEKKQAEMETQKVELKQKLQESQIRLLDAQEEAEVLRRSHSKLQSTVESLIEECNSLQKL  1026

Query  3127  NGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSE  3306
               +LRRQ+L L  +   LE EL + Q   S    R+E LE KLSS+ ++ +SKE  + SE
Sbjct  1027  TEDLRRQKLGLHERITHLEIELDESQTKSSDFCKRVEFLEVKLSSLQKDIASKETSLLSE  1086

Query  3307  LEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASE  3486
             LE I  + KE  E L     + +++   K  E+E  +++  HL  Q     D ++  A +
Sbjct  1087  LESIFQEHKEHAEGLRQAHIMLNKIQSEKTVEVENLEREIAHLTAQASSTHDEQERAALD  1146

Query  3487  GSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVV  3666
               HE+ SL +    L+ +LQE+ + +++ E +L T + E + KV  L+  LNA K ++ +
Sbjct  1147  AVHEVSSLRSNKAKLECSLQEVNEKVKLYETELQTLRQESKNKVQGLVDLLNASKQSEEM  1206

Query  3667  LEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFL  3846
             L       +R +E+V SSE   K + + LE KL  S+ E+ Q  +  S LK++L KI+ L
Sbjct  1207  LMTDIKHTKRLMEDVKSSEEKFKRMANELELKLKASDYEKQQTMEEISRLKVQLQKISHL  1266

Query  3847  RDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECR  4026
             +DE+L  K SL++ KF+  ++E  LQ +  E EELK +K SL +++  MQ +  + E+ R
Sbjct  1267  QDEILVFKSSLDEAKFEKGKVEELLQSVTEECEELKTEKVSLKEKVANMQKAFYDGEDDR  1326

Query  4027  LRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSK  4206
               ++ LEEK+LRLE DLTA+E   A +AELKN+L + +R NS+ + KI+ LE E+  L +
Sbjct  1327  RSRIALEEKLLRLESDLTAKEASYAYEAELKNELNRIRRTNSEYQRKIQSLEQEKDELMR  1386

Query  4207  ELQSVQEELNRK-----ENSVPSPS-----------------HSVAKDKTTSCKEQKLSK  4320
             E Q ++ E+  K     +  + S S                 +S  +DK     E+K+  
Sbjct  1387  EAQLIEREVMTKNDQCRDGRISSESAIERHTSEHHEMERQAQNSQNRDKHFHAGEEKILG  1446

Query  4321  ARSSQCNNCETIQIVTIDDCSSRCQVGDD------------KTQF-KSLQPEGQS-----  4446
                 Q ++ ET Q+    D  S+  + +             K Q  + +  EG++     
Sbjct  1447  ENELQ-DHTETPQVSKEVDLESKVHLLEHKLAEALETNNMYKVQLQRFIDDEGKNQTEVL  1505

Query  4447  --TRSGNE----NEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
               T S N+    +  KIS LEAELK++ ERYL MSL+YAEVE Q+ +LVM LK+++ ++
Sbjct  1506  NKTTSNNDTKISDNDKISSLEAELKDMQERYLQMSLQYAEVEAQREELVMKLKSMKKEK  1564


 Score =   174 bits (441),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 9/180 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RHKS   D  GD+  F  SN QA QVPKGWD+L +S+IS+  GKTI+K  K +V+
Sbjct  1    MFKLHRHKS---DRLGDRIEFKLSNFQAFQVPKGWDRLFLSIISLGTGKTIAKSSKTTVH  57

Query  241  NGTCQWTESL----WSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             GTCQWTES+    +  +N AS  L+   FK +VSMGS+R G LGE T+N+  Y +S  S
Sbjct  58   GGTCQWTESISESIFVSQNGASKELEECQFKIVVSMGSARTGFLGEVTLNLTDYLSSRDS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
             P+SLPL+KCN GT+L   I+C TP++  R  +    A++ E+ N+  + +DNKS+  +N
Sbjct  118  GPLSLPLKKCNYGTLLQLRIQCATPKSKSRDGKSWREASHLEDLNANDDDMDNKSDGSDN  177



>ref|XP_008803435.1| PREDICTED: myosin heavy chain, cardiac muscle isoform-like [Phoenix 
dactylifera]
Length=1438

 Score =   348 bits (893),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 275/762 (36%), Positives = 441/762 (58%), Gaps = 42/762 (6%)
 Frame = +1

Query  2440  GYKNFKELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMV  2619
             G  + +E++ + + I   +   NSK+ E+K G L ++     L H +R L + I + Q  
Sbjct  675   GSFDIEEMQSRSKGINKELEESNSKIEELKAGMLFKEKETDILKHSKRGLEDLISNLQKD  734

Query  2620  AWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQE  2787
                VE+D+     E + +TS   + +R ++M +T  I  +IS  KI E K +ELE+ K E
Sbjct  735   KSQVEEDLATAHRE-NSMTSKCLEDVRHDLMELTSTIESHISANKILERKSIELESCKNE  793

Query  2788  LESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKD  2967
             LE  + E+E+EN+QLSER+SGLEAQLRH T+  E  R+EL+   + + +L+DEI + + +
Sbjct  794   LELHISEMEQENVQLSERISGLEAQLRHLTNEKESKRLELEDSRSLIVDLKDEIEKKQAE  853

Query  2968  KESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQ  3147
              E+Q++ELKQ+L E QKR L+++EE+E L+++  KLQ+T ESLIEEC SLQ L  +LRRQ
Sbjct  854   METQKVELKQKLQESQKRLLEAKEEAEVLRRSRSKLQSTVESLIEECSSLQKLTEDLRRQ  913

Query  3148  RLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQ  3327
             +LEL      LE EL + Q   S    +++ LE KLSS+ ++ +SKE  + SELE I  +
Sbjct  914   KLELHEHITHLEIELDESQTKSSDFCKKVQFLEVKLSSLQKDIASKETSLLSELESIFQE  973

Query  3328  TKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHS  3507
              KE +E L     +  ++   K  E+E  +++  HL  Q+    D ++  A +  HE+ S
Sbjct  974   HKEHEEGLRQAHIMLDKIQSEKTVEVENLEREIAHLTAQVSSTHDEQERAALDAVHEVSS  1033

Query  3508  LFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDK  3687
             L ++   L+ +LQE+ + +++ E +L T + E + KV+ L+  LNA K ++ +L      
Sbjct  1034  LRSDKAKLECSLQEVNEKVKLYETELQTLRQESKNKVHGLVDLLNASKQSEEMLMTDIKH  1093

Query  3688  LQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLAL  3867
             +QR +E+V SSE   K + + LE KL  S+ E+ Q  +  S LK++L KIA L+DE+L L
Sbjct  1094  MQRLMEDVKSSEEKYKRMANELELKLKASDYEKQQTMEEISRLKVQLQKIAHLQDEILVL  1153

Query  3868  KGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLE  4047
             K SL+++KF+  +LE  L+ +  E EE+K +K SL +++  MQ +  + E+ R  ++ LE
Sbjct  1154  KSSLDEVKFEKGKLEELLRSVTEECEEMKTEKVSLKEKVANMQKAFYDGEDDRRSRIALE  1213

Query  4048  EKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQE  4227
             EK+LRLE DL A+E   A +AELKN+L + KR NS+ + KI+    E+  L ++ Q ++ 
Sbjct  1214  EKLLRLESDLIAKEASYAYEAELKNELNRIKRTNSEYQRKIQSFAQEKDELMRKAQLIEW  1273

Query  4228  EL-----NRKENSVPSPS-----------------HSVAKDKTTSCKEQKLSKARSSQCN  4341
             E+       +++ V S S                 +S  +DK  +  EQK+S   +   +
Sbjct  1274  EVMPNNDQSRDDKVSSESGMERHTSEHHEMERRAQNSQKRDKHFNASEQKIS-GENELRD  1332

Query  4342  NCETIQIVTIDDCSSRCQVGDD--------------KTQFKSLQPEGQSTRSGNENEQKI  4479
             + E  Q+    D  S+  + ++              K Q + L     +  +   N  KI
Sbjct  1333  HMERPQVSKEVDLESKVHLLENRLAEALETKNMYKGKNQTEVLNKTTSNNDTKISNNDKI  1392

Query  4480  SQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             S LE ELK++ ERYL MSL+YAEVE Q+ +LVM LK+++ ++
Sbjct  1393  SSLEVELKDMQERYLQMSLQYAEVEAQREELVMKLKSMKKEK  1434


 Score =   174 bits (442),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 119/176 (68%), Gaps = 9/176 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+S   D  GD+  F FSN QA QVPKGWD+L +S+ISVE GKTI+K  K +V+
Sbjct  1    MFKLHRHRS---DRLGDRIEFKFSNFQAFQVPKGWDRLFLSIISVETGKTIAKSSKTTVH  57

Query  241  NGTCQWTESL----WSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             GTCQWTE+L    +  +N AS  L+   FK +VSMGS+R+GILGE T+N+  Y +S  S
Sbjct  58   GGTCQWTETLSESVFVSQNDASKELEECQFKIVVSMGSARSGILGEVTLNLTDYLSSRDS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSE  570
              +SLPL+KCN GT+L   I+C TP++  R  +     ++ E+ N+  + ++NKS+
Sbjct  118  GSLSLPLKKCNYGTILQLRIQCATPKSKSRDRKSWRETSHLEDLNANNDDMENKSD  173



>ref|XP_008241355.1| PREDICTED: cingulin-like [Prunus mume]
Length=1453

 Score =   337 bits (864),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 243/598 (41%), Positives = 380/598 (64%), Gaps = 9/598 (2%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCL--EEDVGLKALNHCRRDLANKIYDHQMVAWMV  2631
             ELE+K   +G  +    S++ +++   L  EE++G+  L   + +L  K+ D Q     +
Sbjct  654   ELEIKVTELGKELTENRSEIAKLEANLLTKEEEIGV--LRQVQNELEAKVSDLQTEKIEL  711

Query  2632  EKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNISE-KIQEMKILELENEKQELESC  2799
             E+ ME V  E  DI+S   + +R ++ V++  +  ++S  K+ E K  ELE +K EL+  
Sbjct  712   EEQMEIVLRE-SDISSKCLNDLRNDLTVLSSSVNSHVSSNKVLERKSSELEADKCELDLH  770

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             V ELE+EN+QLS  +S LEAQ R+ TD  E +++E     +   +LQDEI  L+ + ES 
Sbjct  771   VSELEQENIQLSAHISALEAQQRYLTDEKEANQLESDKSKSYCLSLQDEISRLKIEVESD  830

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
             ++ELKQ+L  ++ +W +++EE EYLK+ANPKLQATAESLIEEC+SLQ  N EL++Q+LEL
Sbjct  831   KVELKQKLKHLESQWSEAREECEYLKRANPKLQATAESLIEECNSLQKSNEELKKQKLEL  890

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
             + QC+LLEA+L +   S + C  R+E LE  LS +LE  +SKE+ +NSEL+ +L +   +
Sbjct  891   QEQCSLLEAKLNQSHKSFTDCSKRVEVLEKDLSLMLENIASKEESLNSELDALLEENMTY  950

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             +E+L ++ESL +++   K +E+E  QQ+   L  ++       +  AS+  HE   L AE
Sbjct  951   REKLTLEESLFNEMYLEKATEVESLQQEVEQLTRKISATKKEREQLASDAIHEASRLRAE  1010

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
               ML+  LQE+Q     TE +L   + E E K+  L  EL A K NQ    A  ++L + 
Sbjct  1011  KAMLESALQEVQSKAIQTENELNVMRTETEPKLQGLSAELAASKQNQESTMADHERLLKL  1070

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
              E+  SSE+ LK  +++LE KL +S+ ER QL + +++LK++L K+   ++EVLA K  L
Sbjct  1071  FESYKSSEAKLKTTVNDLELKLTVSDYERQQLVEESTNLKVQLQKLTDCQNEVLAFKNEL  1130

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             +   F+ E+LEA L  I  E E+LKA+K+S  ++++ ++ ++ ELE+C+  KV+LEEK+L
Sbjct  1131  DAATFEKEKLEALLHSISEECEDLKAEKSSFHEKISTLEKALFELEDCKRNKVLLEEKIL  1190

Query  4060  RLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
             ++EGDL A+E +CA+DAELKN+L Q +R N Q + KIK LE ER    +  Q++++EL
Sbjct  1191  QMEGDLIAKEALCAQDAELKNELNQIRRANEQYQQKIKLLEEERSECLRRSQALEQEL  1248


 Score =   290 bits (742),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 205/523 (39%), Positives = 291/523 (56%), Gaps = 70/523 (13%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L +++ +    SG++  F FS+ +ALQVP+GWDKL VS++SVE GK I+K  KA V 
Sbjct  1     MFRLHKNRPA---KSGERVDFKFSHFKALQVPRGWDKLFVSIVSVETGKPIAKSSKAVVR  57

Query  241   NGTCQWTE----SLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NG CQWTE    S+W  ++ +S  ++   FK ++SMGS+R+GILGEATVN+  Y +S +S
Sbjct  58    NGNCQWTETLSESIWISQDDSSKEMEDYFFKLVLSMGSARSGILGEATVNMSDYISSTSS  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERN-  579
             +PVSLPL+KC  GTVL  +I CLTPR     +E   T+ + EE N+    +D+KS   N 
Sbjct  118   VPVSLPLKKCTYGTVLQVKINCLTPRKRLSDEESKETSYHFEEPNASGLDVDSKSNGSNS  177

Query  580   ------------------------------------NSLPSMEDSLGRDSLssasnssav  651
                                                 NS  S E  + RD+ S  SN S  
Sbjct  178   TFGRSVGSSSMKDFGLTSNPGEPGSRGSSFSASGSHNSYDSAEGYMRRDNTSPGSNLSGE  237

Query  652   vnnaIRRLESTESG-----GSAPWssysygspksnnspnklsisCQEKHPEYTEEEIGQC  816
              N+ I R +ST S      G+ P          S ++ +  +        ++TE  +   
Sbjct  238   GNHLIGRQDSTNSPISTTHGNYP------ADAPSPSNHSSFNSRINHSQKDFTESPLTTT  291

Query  817   SLHITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAH  996
                       +  IEEL AEA+MWE NAR+LM+ +E LR EF++QS+  A++ +ELS A+
Sbjct  292   DSSKNLLEAAEFTIEELHAEAKMWERNARKLMLDLEILRTEFSDQSKNQANLNVELSAAY  351

Query  997   TESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSL  1176
              E + L  +++ L++L E S  KQ   E+L      T    K ++DELKFQ ES +NL+L
Sbjct  352   AERDGLKKEVEHLQLLFENSVVKQTGTEDLTSLEGGTSQNEKALQDELKFQKESVANLAL  411

Query  1177  QLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKST  1356
             QL +SQESN ELVSVLQE+EET++K+K+E+ENL  L S+          GD +N    +T
Sbjct  412   QLERSQESNIELVSVLQELEETIEKQKVELENLSELESK---------LGDMENSIKITT  462

Query  1357  EQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIE  1485
             E    E +  + +LQ LQES   L+  +   E+A EEK HEIE
Sbjct  463   E----ENRYLKLQLQQLQESENKLQLMVQQLEQALEEKNHEIE  501


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  4480  SQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             S LE ELK+I ERYLHMSL+YAEVE Q+ +LVM LKA
Sbjct  1408  SSLETELKDIRERYLHMSLRYAEVEAQREELVMKLKA  1444



>ref|XP_011101522.1| PREDICTED: restin homolog [Sesamum indicum]
Length=1522

 Score =   334 bits (857),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 293/891 (33%), Positives = 473/891 (53%), Gaps = 109/891 (12%)
 Frame = +1

Query  2089  TTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRNATFYKDI---SRGTDPMA--  2253
             T  D+D + PAL  QL  F  ++           ++ L +A   KD      G + +   
Sbjct  683   TIRDVDEMFPALLMQLQSFLGSIK-------KESDLSLLHANGSKDAICDMYGLESIHSF  735

Query  2254  QKEHAKAVFDKLVQLLRARLVSCTND--KYSEDGARTEVNNTYEIKDKSDYGCSTEKDPC  2427
             Q    K V +++V LL   L    N+     ED  R   +N  E + +     S   +  
Sbjct  736   QTARVKDVLNRIVLLLDTTLTEYENNFQNIEEDARREGESNACEGQSRK---ASVSLEES  792

Query  2428  SSHQGYKNFKELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYD  2607
             +   G  +  EL+   ES      T +  ++E     L  +  ++A ++ +  +  K+ +
Sbjct  793   TLEPGMSSKDELDSSDES------TCDCMVVEPNADTLRNEKEIEAQSYPKSSM--KLQN  844

Query  2608  HQMVAWMVEKDMEKVQTEKDDITSDSMREEMMVVTGRIFGNISEKIQEMKILELENEKQE  2787
             +  +   +++D     T   D + +S+ + +++ + +I      K+  +  +E EN + E
Sbjct  845   NMEI---IDRD----GTVTSDCSHNSISDMILLNSSKISHLSHNKVDRITFMEPENNQTE  897

Query  2788  LESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKD  2967
                 + ELE+EN+ LS+RVSGLEAQLR+ TD  ELSR+E QH  +Q+  LQ++IR LE++
Sbjct  898   WGKHLTELEEENIYLSQRVSGLEAQLRYLTDTRELSRLEFQHSESQVVVLQNQIRRLEEE  957

Query  2968  KESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQ  3147
              ESQ+L +K +L+EM+KRW ++QEE   L K N +LQ T ESLIEE +SLQ  NGELR Q
Sbjct  958   IESQKLNMKHKLLEMEKRWSEAQEECTSLSKLNIRLQTTTESLIEEYNSLQKFNGELREQ  1017

Query  3148  RLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQ  3327
             +L+L+ QC +LEAE RK Q S  SC   + +LE K S + +E ++K KI N+EL+   + 
Sbjct  1018  KLKLQNQCMVLEAEARKIQDSCCSCAENMGTLEVKYSLLTDEITAKGKIPNAELDCFNIP  1077

Query  3328  TKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHS  3507
              +E +++L+ ++ L ++    K  +    + K  ++  Q+    ++E  ++     + H 
Sbjct  1078  EEEHEDKLLKEKYLLNKTYMEKAKDAANLELKVAYVSGQVSTYVEKE-PRSLVAVAKKHY  1136

Query  3508  LFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDK  3687
              + +   L++++  +QQ+                    +L G   + + N+VVL    +K
Sbjct  1137  GYLDKSKLEMSIDGVQQD--------------------DLEG---SERENKVVLAGNQEK  1173

Query  3688  LQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLAL  3867
             LQ+   N++  ES  K +ID LES++ LSE ER +L + NS L  +L  +  L++EVL+L
Sbjct  1174  LQKLFNNIMHDESKRKSVIDELESRIGLSELERFRLEEENSVLHRQLQIVPELQNEVLSL  1233

Query  3868  KGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLE  4047
             + SL +MKF+N+ LEASL+ + G+ EELK ++ S++Q ++ MQ  V+E E+   +K  LE
Sbjct  1234  RVSLKEMKFQNQLLEASLESVSGDYEELKHERVSMVQSISSMQKEVSEAEDSIRKKNALE  1293

Query  4048  EKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQE  4227
             EK+LRLEGDL A++ +  +DAE+KN+L Q K  N QL  K+K LE  R  L + +Q+++E
Sbjct  1294  EKILRLEGDLVAKDALSVQDAEMKNELNQIKMANRQLLMKVKHLEDVREDLQRMVQALEE  1353

Query  4228  ELNR---------KENSVPSPSHSVAKDKTTSCKEQKLS-------KARSSQCNNCETIQ  4359
             ELN+         +++ +P       +D   +  ++KLS       K  + Q N   T+ 
Sbjct  1354  ELNQTRCHGANMIQQSKLPKGE----EDTVVAVGQRKLSIDPHQSHKYLNIQDNIGITVH  1409

Query  4360  IVTI----DDCSSRCQVG-------------------DDKTQFK----------SLQPEG  4440
              V      D C  R +V                    D +  +K          S++ E 
Sbjct  1410  QVQAFSERDRCFRRSRVPEMDYESRLKLLEDELVKALDSRDMYKSQLESVLAVASIKSEP  1469

Query  4441  QSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKAL  4593
             + T   +  E KIS LEAEL+EI ERYL +SLKYAEVE Q+ +LVM LKAL
Sbjct  1470  KETTGTSNTENKISLLEAELQEIRERYLQISLKYAEVEAQREQLVMKLKAL  1520


 Score =   285 bits (729),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 210/540 (39%), Positives = 300/540 (56%), Gaps = 77/540 (14%)
 Frame = +1

Query  46    FREREMFKLRRHKSST--SDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISK  219
              RE+ +F++ R K S+  +D S  KF F FS IQALQVPKGWDKL +SLIS E+ KTI K
Sbjct  2     IREK-IFRVHRRKPSSVGTDASAHKFDFTFSKIQALQVPKGWDKLYISLISSESAKTIRK  60

Query  220   LGKASVNNGTCQWTESLWSPENYASNGLD-HFKFLVSMGSSRAGILGEATVNVGHYRNSE  396
              GK SV NGTCQWTE L      +  G D H KF+VS GSS++GILGE T+N+  + +SE
Sbjct  61    SGKGSVKNGTCQWTEILSESICTSDVGGDYHLKFVVSTGSSKSGILGETTLNLAAFLSSE  120

Query  397   ASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEE---------ENSVCN  549
             +   VSLPL+KC+ GT L  E++CLTP+T+ R ++   T A+ +E          + V +
Sbjct  121   SPTLVSLPLKKCSYGTSLQVEVRCLTPQTNLRDEKWKETNAHKDETTDNDDMENRSEVSD  180

Query  550   GIDNKSEER-------NNSLP--------------------SMEDSLGRDSLssasnssa  648
                 KS E        N+S P                    SM+DS+GR S SS S  + 
Sbjct  181   STVTKSTESYSGSNFGNSSRPRELGSRETSFSASVSRYSFDSMDDSIGRQSFSSQSERNG  240

Query  649   vvnnaIRRLESTESGGSAPWssysygspksnnspnklsisCQEKHPEYTEEEIGQCSLHI  828
               N    R +S ES  S+ + SYS   P  +    +  +  +E       EE+ + S H 
Sbjct  241   PNNV-FGRQDSIESNDSSSYCSYSPHGPIRSVRSLQGPL-ARENQSNNQREELRRLS-HA  297

Query  829   TRTSIP-------------DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
               + +              DA ++EL+AEARMWE NAR++ V ME+LRKE ++Q   +  
Sbjct  298   AASLLQQHGSSSKMFKEDYDAIVQELEAEARMWEQNARKMAVDMESLRKELSDQKLSMTK  357

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQ  1149
             +  EL+ + +ES +L  +IK L+ LLEES  KQ        Q   T +I KE+EDE++  
Sbjct  358   LNTELANSQSESRKLTEEIKHLKSLLEESAEKQKVD-----QETETSSIQKELEDEMRLL  412

Query  1150  TESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGD  1329
              E+N NLS+QL+K+QESN EL+++LQEMEET++K+K+EI++L  +           S  D
Sbjct  413   KEANENLSIQLKKTQESNFELITILQEMEETMEKQKLEIKSLSEM-----------SKAD  461

Query  1330  EDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQ  1509
                  P+     S+     E +L + QE   +L++ I+  E   E+K+ E E+EQDL+ Q
Sbjct  462   SHEEVPQENNSSSL-----EIELVNSQELKRALQSEILVLESKLEDKVIETEIEQDLKNQ  516



>ref|XP_009375784.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=1304

 Score =   331 bits (848),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 240/598 (40%), Positives = 380/598 (64%), Gaps = 10/598 (2%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKM--LEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMV  2631
             ELE K   +G  +  K  K+  LEV     EE++ L  L   + +L  ++ + Q     +
Sbjct  671   ELESKVNELGKELTEKTFKIEKLEVNLLTKEEEISL--LRGVQNELQAEVSNLQKEKIEL  728

Query  2632  EKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESC  2799
             E+ ME V  E  DI+S   + +R E+MV++  +  ++S  K+ E K  ELE +K EL+  
Sbjct  729   EEHMEVVLRE-SDISSKCLNDLRNELMVLSRSVNSHVSTHKVLERKSSELEADKCELDLH  787

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             + ELE+EN+QLS R+S LEAQ R  TD  E +++EL++  +   +LQDEI  L  + ES 
Sbjct  788   LSELEQENIQLSARISALEAQQRCLTDEKEANQLELENSQSYSLSLQDEISRLNIEMESD  847

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
             ++ELKQ+L +++++W +++EE E+LK+ANPKLQATAE+LIEEC+S+Q  N ELR+Q+LEL
Sbjct  848   KVELKQKLKDLERQWSEAREECEFLKRANPKLQATAENLIEECNSIQNSNDELRKQKLEL  907

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
                C+LLEA+L + Q S ++C  R+E LE  LS +LE  +SKE+ +NSEL+ +L +  ++
Sbjct  908   HQLCSLLEAKLNQSQKSFTNCSKRVEVLEKDLSLMLENVTSKEESLNSELDALLDENMKY  967

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             KE+L ++ESL +++   K  E+E  Q++   L  Q     +  +G AS+   E   L  E
Sbjct  968   KEKLTLEESLFNKMYLEKTIEVERLQEEVERLTKQFAATHEEREGLASDAVQEASRLRTE  1027

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
              +ML+  LQE Q     TE +L   + E E K+  L  EL A K NQ    A  +KL + 
Sbjct  1028  KEMLQSALQEFQSKAIQTEDELNIMRTESEAKLQGLFAEL-ADKQNQESTTADHEKLLKL  1086

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
             LEN  SSE+ LK  +++LE KL +S+ E  Q+ + ++++K++  K+   ++EVLA K  L
Sbjct  1087  LENYKSSEAKLKTNVNDLELKLKVSDYEHQQVVEESTNMKVQFEKLTRCQEEVLAFKNEL  1146

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             +  KF+ E+LEA L  I  E E+LKA+K+S  ++++ ++ ++ +LE+C+  KV+LEEK L
Sbjct  1147  DATKFEKEKLEALLDSISEECEDLKAEKSSFHEKISTLEKALFDLEDCQRNKVLLEEKFL  1206

Query  4060  RLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
             ++EGDLTA + +CA+ AE+KN+L Q +R N Q + +I+ LE ER    ++ Q++++EL
Sbjct  1207  QMEGDLTAEKALCAQYAEMKNELNQIRRANEQYQLEIQLLEDERSEFLRKSQALEQEL  1264


 Score =   293 bits (750),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 192/475 (40%), Positives = 277/475 (58%), Gaps = 53/475 (11%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L +++ +    SG++  F FS+ +ALQVP+GWDKL VS++SVE GK I K  KA V 
Sbjct  1     MFRLHKNRPA---KSGERVDFKFSHFKALQVPRGWDKLFVSIVSVETGKPIVKSSKAVVR  57

Query  241   NGTCQWTE----SLWSPENYASNGL-DHF-KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NG CQWTE    S+W  ++ +S  + D+F K +VSMGS+R+GILGE +VN+  Y +S +S
Sbjct  58    NGNCQWTETLCESIWISQDESSKEMEDYFIKLVVSMGSARSGILGEVSVNMSDYISSTSS  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
              PVSLPL+KC+ GT+L  +I CLTPR     +E   T+ ++EE     +  D+KS+  N+
Sbjct  118   APVSLPLKKCSFGTILQVKINCLTPRKKLSDEESKETSFHSEEVIENGHDADSKSDGFNS  177

Query  583   SL-------------------------------------PSMEDSLGRDSLssasnssav  651
             S+                                      S E S+ +D++S  SN S  
Sbjct  178   SVVWSAGSSSRKDFGLISNPGEPGSQDSSFSASGSHRSYDSTEGSIRKDNMSMRSNLSVE  237

Query  652   vnnaIRRLESTES-----GGSAPWssysygspks-nnspnklsisCQEKHPEYTEEEIGQ  813
              N+ I R +ST S      G+ P    S  +  S N+  N   I  Q  H ++TE  +  
Sbjct  238   GNHQIGRQDSTTSLISTSHGNLPADISSPSNHSSFNSRINGSRIQSQNSHKDFTESSLST  297

Query  814   CSLHITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTA  993
                        +  IEEL AEA+MWE NAR+LM+ ++ +R EF++QS++ A+M +ELS A
Sbjct  298   TDSSKNLLDAAEVTIEELHAEAKMWERNARKLMLDLDIMRAEFSDQSKKQANMNVELSAA  357

Query  994   HTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLS  1173
             + E + L  +++ L +LLE +  KQ A+E+L  Q   T  I K  +DEL FQ ES +NLS
Sbjct  358   YAERDGLKKEVEHLHLLLENAMVKQTASEDLTSQDGGTPEIEKAFQDELNFQKESTANLS  417

Query  1174  LQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSR-SDVMGVINSCGDED  1335
             LQL +SQESN ELVSVLQE+EET++K+K+E+ENL  L S   D+  +IN   +E+
Sbjct  418   LQLERSQESNIELVSVLQELEETIEKQKVELENLSELQSTFGDMKNLINLTTEEN  472



>ref|XP_009375783.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=1460

 Score =   331 bits (849),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 240/598 (40%), Positives = 380/598 (64%), Gaps = 10/598 (2%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKM--LEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMV  2631
             ELE K   +G  +  K  K+  LEV     EE++ L  L   + +L  ++ + Q     +
Sbjct  671   ELESKVNELGKELTEKTFKIEKLEVNLLTKEEEISL--LRGVQNELQAEVSNLQKEKIEL  728

Query  2632  EKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESC  2799
             E+ ME V  E  DI+S   + +R E+MV++  +  ++S  K+ E K  ELE +K EL+  
Sbjct  729   EEHMEVVLRE-SDISSKCLNDLRNELMVLSRSVNSHVSTHKVLERKSSELEADKCELDLH  787

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             + ELE+EN+QLS R+S LEAQ R  TD  E +++EL++  +   +LQDEI  L  + ES 
Sbjct  788   LSELEQENIQLSARISALEAQQRCLTDEKEANQLELENSQSYSLSLQDEISRLNIEMESD  847

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
             ++ELKQ+L +++++W +++EE E+LK+ANPKLQATAE+LIEEC+S+Q  N ELR+Q+LEL
Sbjct  848   KVELKQKLKDLERQWSEAREECEFLKRANPKLQATAENLIEECNSIQNSNDELRKQKLEL  907

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
                C+LLEA+L + Q S ++C  R+E LE  LS +LE  +SKE+ +NSEL+ +L +  ++
Sbjct  908   HQLCSLLEAKLNQSQKSFTNCSKRVEVLEKDLSLMLENVTSKEESLNSELDALLDENMKY  967

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             KE+L ++ESL +++   K  E+E  Q++   L  Q     +  +G AS+   E   L  E
Sbjct  968   KEKLTLEESLFNKMYLEKTIEVERLQEEVERLTKQFAATHEEREGLASDAVQEASRLRTE  1027

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
              +ML+  LQE Q     TE +L   + E E K+  L  EL A K NQ    A  +KL + 
Sbjct  1028  KEMLQSALQEFQSKAIQTEDELNIMRTESEAKLQGLFAEL-ADKQNQESTTADHEKLLKL  1086

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
             LEN  SSE+ LK  +++LE KL +S+ E  Q+ + ++++K++  K+   ++EVLA K  L
Sbjct  1087  LENYKSSEAKLKTNVNDLELKLKVSDYEHQQVVEESTNMKVQFEKLTRCQEEVLAFKNEL  1146

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             +  KF+ E+LEA L  I  E E+LKA+K+S  ++++ ++ ++ +LE+C+  KV+LEEK L
Sbjct  1147  DATKFEKEKLEALLDSISEECEDLKAEKSSFHEKISTLEKALFDLEDCQRNKVLLEEKFL  1206

Query  4060  RLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
             ++EGDLTA + +CA+ AE+KN+L Q +R N Q + +I+ LE ER    ++ Q++++EL
Sbjct  1207  QMEGDLTAEKALCAQYAEMKNELNQIRRANEQYQLEIQLLEDERSEFLRKSQALEQEL  1264


 Score =   293 bits (750),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 192/475 (40%), Positives = 277/475 (58%), Gaps = 53/475 (11%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L +++ +    SG++  F FS+ +ALQVP+GWDKL VS++SVE GK I K  KA V 
Sbjct  1     MFRLHKNRPA---KSGERVDFKFSHFKALQVPRGWDKLFVSIVSVETGKPIVKSSKAVVR  57

Query  241   NGTCQWTE----SLWSPENYASNGL-DHF-KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NG CQWTE    S+W  ++ +S  + D+F K +VSMGS+R+GILGE +VN+  Y +S +S
Sbjct  58    NGNCQWTETLCESIWISQDESSKEMEDYFIKLVVSMGSARSGILGEVSVNMSDYISSTSS  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
              PVSLPL+KC+ GT+L  +I CLTPR     +E   T+ ++EE     +  D+KS+  N+
Sbjct  118   APVSLPLKKCSFGTILQVKINCLTPRKKLSDEESKETSFHSEEVIENGHDADSKSDGFNS  177

Query  583   SL-------------------------------------PSMEDSLGRDSLssasnssav  651
             S+                                      S E S+ +D++S  SN S  
Sbjct  178   SVVWSAGSSSRKDFGLISNPGEPGSQDSSFSASGSHRSYDSTEGSIRKDNMSMRSNLSVE  237

Query  652   vnnaIRRLESTES-----GGSAPWssysygspks-nnspnklsisCQEKHPEYTEEEIGQ  813
              N+ I R +ST S      G+ P    S  +  S N+  N   I  Q  H ++TE  +  
Sbjct  238   GNHQIGRQDSTTSLISTSHGNLPADISSPSNHSSFNSRINGSRIQSQNSHKDFTESSLST  297

Query  814   CSLHITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTA  993
                        +  IEEL AEA+MWE NAR+LM+ ++ +R EF++QS++ A+M +ELS A
Sbjct  298   TDSSKNLLDAAEVTIEELHAEAKMWERNARKLMLDLDIMRAEFSDQSKKQANMNVELSAA  357

Query  994   HTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLS  1173
             + E + L  +++ L +LLE +  KQ A+E+L  Q   T  I K  +DEL FQ ES +NLS
Sbjct  358   YAERDGLKKEVEHLHLLLENAMVKQTASEDLTSQDGGTPEIEKAFQDELNFQKESTANLS  417

Query  1174  LQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSR-SDVMGVINSCGDED  1335
             LQL +SQESN ELVSVLQE+EET++K+K+E+ENL  L S   D+  +IN   +E+
Sbjct  418   LQLERSQESNIELVSVLQELEETIEKQKVELENLSELQSTFGDMKNLINLTTEEN  472


 Score = 55.8 bits (133),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +1

Query  4441  QSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             Q++++   +E+  S LE ELK+I ERYLHMSL+YAEVE Q+ +LVM LK 
Sbjct  1403  QNSKAEERHERSRSSLETELKDIRERYLHMSLRYAEVEAQREELVMKLKV  1452



>emb|CBI30188.3| unnamed protein product [Vitis vinifera]
Length=1369

 Score =   328 bits (840),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 228/560 (41%), Positives = 345/560 (62%), Gaps = 74/560 (13%)
 Frame = +1

Query  2533  GCL---EEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMRE  2694
              CL   EE++GL  L   +R+  +++ + Q     +E+++E V  E  +ITS   D +R 
Sbjct  666   ACLLSKEEEIGL--LRQSQRESESQVSELQKEKTQLEENIEIVVRE-SNITSKCLDDLRN  722

Query  2695  EMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRH  2871
             ++MV++  +  ++S  +I   K+ ELEN K+ELE  + ELE EN+QLSER SGLEAQLR+
Sbjct  723   DLMVLSSSVDSHVSANRILRRKMSELENGKRELELHISELELENVQLSERTSGLEAQLRY  782

Query  2872  FTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEY  3051
              TD     ++EL++  +   + QDEIR L  + E+Q++ ++Q+L +MQ +W ++QEE +Y
Sbjct  783   LTDERASCQLELENSKSVASSFQDEIRRLAIEMETQKVVIEQKLQDMQTKWSEAQEECDY  842

Query  3052  LKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSR  3231
             LK+ANPKL+ATAE LIEEC SLQ  NGELR+Q+LEL     LLEA+LR+ Q   ++C  R
Sbjct  843   LKRANPKLKATAERLIEECSSLQKSNGELRKQKLELHEGSTLLEAKLRESQKRFANCSKR  902

Query  3232  IESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEY  3411
             +E LE  LSS+LE+ +SKEKI  SEL+++L + ++ KE+L++ ESL +Q    K +E+E 
Sbjct  903   VEVLEENLSSMLEDMASKEKIFTSELDILLQENRKQKEKLILGESLFNQRYSEKTAEVEK  962

Query  3412  PQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVT  3591
              Q+                                                   EV+ +T
Sbjct  963   LQK---------------------------------------------------EVQGLT  971

Query  3592  TQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklll  3771
             + +   ++ + ++  +  HK N  +LE           N  SSE  LK  + +LE KL +
Sbjct  972   SDLSISKQNHSML--MADHKKNLKLLE-----------NYRSSEEKLKTTLSDLELKLTV  1018

Query  3772  seserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEEL  3951
             SE ER QL +  +SLK++L K+A L+DEVLALK   +  KF+  ++EASL LI  +NEEL
Sbjct  1019  SEYERQQLLEETASLKVQLQKLAPLQDEVLALKAEFDAAKFERGKMEASLHLISADNEEL  1078

Query  3952  KADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLT  4131
             KA+K S I++++ ++ S +ELE+C+L +VVLEEK+LR+EGDLTARE  CA+DAELKN+L+
Sbjct  1079  KAEKISFIEKISSLETSTSELEDCKLNRVVLEEKILRMEGDLTAREAFCAQDAELKNELS  1138

Query  4132  QSKRVNSQLRWKIKQLELER  4191
             + +R   Q + K++QLE E+
Sbjct  1139  RIRREVRQFQRKVEQLEEEK  1158


 Score =   152 bits (385),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEA+MWE N+++LM+ +E LRKEF++QS+  A ++MELS A++E + L  +I +L
Sbjct  304   IEELRAEAKMWERNSQKLMLDLEILRKEFSDQSKNQATLDMELSAAYSERDALKKEIDQL  363

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             ++LLEES  KQ   E+   Q +   +I KE+EDE+KFQ ESN+NL+LQLR+SQESN ELV
Sbjct  364   KILLEESKMKQAMGES-TFQDEGATHIQKELEDEIKFQKESNANLALQLRRSQESNIELV  422

Query  1216  SVLQEMEETVQKKKIEIENLLAL  1284
             SVLQE+E T++K+KIE+E+L AL
Sbjct  423   SVLQELELTIEKQKIELEDLAAL  445


 Score =   144 bits (363),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 98/136 (72%), Gaps = 9/136 (7%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R+K++    SG++  F FSN QA QVPKGWDKL VS++SVE GK+I+K  KAS  
Sbjct  1    MFRLHRNKAA---KSGERVDFKFSNFQATQVPKGWDKLFVSIVSVETGKSIAKSSKASAR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQWT    ES+W  +   S  L+   FKF+V+MGS+R GILGEAT+N+  Y +S AS
Sbjct  58   NGNCQWTETLSESIWISQEDNSKDLEEFLFKFVVAMGSARTGILGEATINMASYMSSSAS  117

Query  403  IPVSLPLQKCNKGTVL  450
            + VSLPL+KCN GT+L
Sbjct  118  VSVSLPLKKCNHGTIL  133



>ref|XP_008387517.1| PREDICTED: sporulation-specific protein 15-like [Malus domestica]
Length=1459

 Score =   327 bits (839),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 231/596 (39%), Positives = 379/596 (64%), Gaps = 5/596 (1%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE K   +G  +  K  ++ +++   L  +  +  L   + +L  K+ D Q     +E+
Sbjct  671   ELESKVTELGKELTEKRFEIEKLEANLLTNEEEISLLKGVQNELEAKVSDLQKEKIQLEE  730

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVF  2805
              ME V  E  DI+S   + +R E+MV++  +  ++S  ++ E K  ELE +K EL+  + 
Sbjct  731   HMEVVLRE-SDISSKCLNDLRHELMVLSRSVNSHVSTHRVLERKSSELEADKCELDRHIS  789

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
             ELE+EN+QLS   S LEAQ+R  TD  E S++EL++  +   +LQDEI  L+ + ES ++
Sbjct  790   ELEQENIQLSASGSALEAQIRCLTDEKEASQLELENSQSYSLSLQDEISRLKTEMESDKV  849

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
             ELKQ+L +++ +W ++++E E+LK+ANP+LQATAESLIEEC+SLQ  N ELR+Q+LEL  
Sbjct  850   ELKQKLKDLESQWSEARDECEFLKRANPELQATAESLIEECNSLQXSNDELRKQKLELHQ  909

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
              C++LEA+L +   S ++C  R+E LE  LS +LE  +SKE+ +N EL+ +L +  ++KE
Sbjct  910   LCSVLEAKLNQSHESFTNCSKRVEVLEKDLSLMLENIASKEESLNLELDALLDENMKYKE  969

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             +L ++ESL +++   K  E+E  Q++   L   +    +  +  AS+   E   L  E +
Sbjct  970   KLTLEESLFNKMYLEKTVEVESLQEEVDRLTKLLAATQEEXEELASDAVQEASRLRTEKE  1029

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
             ML+  L+E+Q     TE +L   ++E E K+  L+ EL A K NQ V+ A  ++L + LE
Sbjct  1030  MLESALREVQSKAIQTEEELNIMRIETEAKLQGLVAELAASKQNQEVMMADHERLLKLLE  1089

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
             N  SSE+ LK  +++LE KL +S+ ER Q+ + + ++K+++ K+   ++EVLA    L+ 
Sbjct  1090  NYKSSEAKLKTTVNDLELKLTVSDYERHQVLEESINMKVQIEKLTHCQEEVLASNNELDA  1149

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
              KF+ E+LE  L  I  E ++LKA+K+S  ++++ ++N++ ELE+C+   V+LEEKVL++
Sbjct  1150  TKFEKEKLEVLLHSISEECQDLKAEKSSFHEKISTLENALFELEDCKRNNVLLEEKVLQM  1209

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
              GDLTA+E +CA+ AELKN+L Q +R N Q + KI+ LE ER    ++ Q++++EL
Sbjct  1210  XGDLTAKEALCAQYAELKNELNQIRRANEQYQLKIQLLEEERSEFLRKSQALEQEL  1265


 Score =   174 bits (442),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 129/193 (67%), Gaps = 10/193 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF++ +++ +    SG++  F FS+++ALQVP+GWDKL VS++SVE GK I+K  KA V 
Sbjct  1    MFRVHKNRPA---KSGERVDFKFSHLKALQVPRGWDKLFVSIVSVETGKPIAKSSKAVVR  57

Query  241  NGTCQWTE----SLWSPENYASNGL-DHF-KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQWTE    S+W  ++ +S  + D+F K ++SMGS+R+GILGE +VN+  Y +S +S
Sbjct  58   NGNCQWTETLCESIWISQDESSKEMEDYFIKLVISMGSARSGILGEVSVNMSDYISSTSS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
             PVSLPL+KC+ GT+L  +I CLTPR     +E   T  + EE N+  +  D+KS+  N 
Sbjct  118  APVSLPLKKCSFGTILQVKINCLTPRKRLSDEESKETRDHLEEANANGHDADSKSDGSNT  177

Query  583  S-LPSMEDSLGRD  618
            S + S   S G+D
Sbjct  178  SFVQSAGSSFGKD  190


 Score =   156 bits (395),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 156/240 (65%), Gaps = 18/240 (8%)
 Frame = +1

Query  781   HPEYTEEEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFA  945
             H + + ++  + SL  T +S       +  IEEL AEA+MWE NAR+LM+ ++ LR EF+
Sbjct  282   HSQNSRKDFKESSLKATDSSKNLLDAAEVTIEELHAEAKMWERNARKLMLDLDILRTEFS  341

Query  946   NQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKE  1125
             +QS++ A+M++ELS A+ E N L  +++ L++LLE S  KQ A+ENL  Q + T  I K 
Sbjct  342   DQSKKQANMKVELSAAYAERNGLKKEVEHLQLLLENSVVKQTASENLTYQDEVTPGIEKA  401

Query  1126  MEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVM  1305
             ++DELKFQ ES +NL+LQL +SQESN ELVSVLQE+EET++ +K+E+ENL  L S     
Sbjct  402   LQDELKFQKESVANLALQLERSQESNIELVSVLQELEETIENQKVELENLSELQS-----  456

Query  1306  GVINSCGDEDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIE  1485
                 + GD +N+   + E    E +  + +LQ LQES   L+ ++   E+A EEK HEIE
Sbjct  457   ----TFGDMENLIKLTRE----ENRNLKLQLQQLQESENKLQVAVQQFEQAVEEKNHEIE  508



>ref|XP_008392615.1| PREDICTED: myosin-11-like [Malus domestica]
Length=1460

 Score =   323 bits (828),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 238/598 (40%), Positives = 377/598 (63%), Gaps = 10/598 (2%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKM--LEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMV  2631
             ELE K + +G  +  K  ++  LEV     EE++GL  L   + +L  ++ + Q     +
Sbjct  671   ELESKVKELGKELTEKMFEIEKLEVNLLTKEEEIGL--LRGVQNELQAEVSNLQKEKIEL  728

Query  2632  EKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESC  2799
             E+ ME V  E  DI+S   + +R E+MV++  +  ++S  K+ E K  ELE +K EL+  
Sbjct  729   EEQMEVVLRE-GDISSKCLNDLRNELMVLSRSVNSHVSTHKVLERKSSELEADKCELDLH  787

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             + E ++EN+QLS  +S LEAQ R  TD  E +++EL +  +   +LQDEI  L  +  S 
Sbjct  788   LSEFQQENIQLSAHISALEAQQRCLTDEKEANQLELDNSQSYSLSLQDEISRLNIEMISD  847

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
             ++ELKQ+L +++++W +++EE E+LK ANPKLQ TAESLIEEC+S+Q  N ELR+Q+LEL
Sbjct  848   KVELKQKLKDLERQWSEAREECEFLKXANPKLQGTAESLIEECNSIQNSNDELRKQKLEL  907

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
                C+LLEA+L + Q S ++C  R+E LE  LS +LE  +SKE+ +NSEL+ +L +  ++
Sbjct  908   HQLCSLLEAKLNQSQESFTNCSKRVEVLEKDLSLMLENVTSKEESLNSELDALLDENMKY  967

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             KE+L ++ESL +++   K  E+E  Q++   L  Q     +  +G AS+   E   L  E
Sbjct  968   KEKLTLEESLFNKMYLEKTIEVESLQEEVERLTKQFAATHEEREGPASDAVQEASRLRTE  1027

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
              +ML+ TL E Q      E +L   + E E K+  L  EL A K NQ    A  +KL + 
Sbjct  1028  KEMLQSTLLEFQSKAIQMEDELNIMRTESEAKLQGLFAEL-ADKQNQESTTADHEKLLKL  1086

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
             LEN  SSE+  K  +++LE KL +S+ ER Q+ + ++++K++  K+   ++EVLA K  L
Sbjct  1087  LENYKSSEAKPKTNVNDLEXKLTVSDYERQQVVEESTNMKVZFEKLTRCQEEVLAFKNEL  1146

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             +  KF+ E+LEA L  I  E E+LKA+K+S  ++++ ++ ++ +LE+C+  KV+LEEK L
Sbjct  1147  DATKFEKEKLEALLDSISEECEDLKAEKSSFHEKISTLEKALFDLEDCQRNKVLLEEKFL  1206

Query  4060  RLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
             ++EGDLTA+E +CA+ AELKN+L Q +RVN Q + +I+ LE ER    ++ Q++++EL
Sbjct  1207  QMEGDLTAKEALCAQYAELKNELNQIRRVNEQYQLEIQLLEDERSEFLRKSQALEQEL  1264


 Score =   290 bits (743),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 208/524 (40%), Positives = 301/524 (57%), Gaps = 65/524 (12%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L +++ +    SG++  F FS+ +ALQVP+GWDKL VS++SVE GK I+K  KA V 
Sbjct  1     MFRLHKNRPA---KSGERVDFKFSHFKALQVPRGWDKLFVSIVSVETGKPIAKSSKAVVR  57

Query  241   NGTCQWTE----SLWSPENYASNGL-DHF-KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NG CQWTE    S+W  ++ +S  + D+F K ++SMGS+R+GILGE +VN+  Y +S +S
Sbjct  58    NGNCQWTETLCESIWISQDESSKEMEDYFIKLVISMGSTRSGILGEVSVNMSDYISSTSS  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
              PVSLPL+KC+ GT+L  +I CLTPR     +E   T+ ++EE     +  D+KS+  N+
Sbjct  118   APVSLPLKKCSFGTILQVKINCLTPRKKXSDEESKETSYHSEEVIEHGHDADSKSDGSNS  177

Query  583   SL-------------------------------------PSMEDSLGRDSLssasnssav  651
             S+                                      S E S+ RD++S+ SN S  
Sbjct  178   SVVWSAGSSSRKDFGLISNPGEPGSRDSSFSAXGSHRSYDSAEGSIRRDNMSARSNLSVE  237

Query  652   vnnaIRRLESTES-----GGSAPWssysygspks-nnspnklsisCQEKHPEYTEEEIGQ  813
              N+ I R +ST S      G+ P    S  +  S N+  N   I  Q    ++TE  +  
Sbjct  238   GNHLIGRQDSTTSLIXTTHGNFPADIRSLSNHSSFNSRVNGSGIQTQNSRKDFTESSLST  297

Query  814   CSLHITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTA  993
                        +  IEEL AEA+MWE NAR+LM+ ++ LR EF++QS++ A++ +ELS A
Sbjct  298   TDSSKNLLDAAEVTIEELHAEAKMWERNARKLMLDLDILRAEFSDQSKKQANIHVELSAA  357

Query  994   HTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLS  1173
             + E + L  +++ L +LLE +  KQ A+E+L  Q   T  I K  +DEL FQ ES +NLS
Sbjct  358   YAERDGLKKEVEHLHLLLENAMVKQTASEDLTSQDGGTPEIKKAFQDELNFQKESTANLS  417

Query  1174  LQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKS  1353
             LQL +SQESN ELVSVLQE+EET++K+K+E+ENL  L S         + GD +N+   +
Sbjct  418   LQLERSQESNIELVSVLQELEETIEKQKVELENLSELQS---------TFGDMENLINLT  468

Query  1354  TEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIE  1485
             TE    E +  + +LQ LQES   L+  +   E+  EEK HEIE
Sbjct  469   TE----ENRNLKLQLQQLQESENKLQVVVQQLEQTVEEKNHEIE  508



>ref|XP_009341080.1| PREDICTED: LOW QUALITY PROTEIN: myosin-11-like [Pyrus x bretschneideri]
Length=1450

 Score =   322 bits (824),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 229/596 (38%), Positives = 377/596 (63%), Gaps = 5/596 (1%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE K   +G  +  K  ++ +++   L  +  +  L   + +L  ++ D Q     +E+
Sbjct  662   ELESKVTELGKELTEKRFEIEKLEANLLTNEEEISLLKGVQNELEAEVSDLQKEKIQLEE  721

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVF  2805
              ME V  E  DI+S   + +R E+MV++  +  ++S  ++ E K  ELE +K EL+  + 
Sbjct  722   HMEVVLRE-SDISSKCLNDLRHELMVLSRSVNSHVSTHRVLERKSSELEADKCELDRHIS  780

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
             ELE+EN+QLS  VS LEAQ+R+ TD  E S++EL++  +   +LQDEI  L+ + ES ++
Sbjct  781   ELEQENIQLSASVSALEAQIRYLTDEKEASQLELENSQSYSLSLQDEIIRLKTEMESDKV  840

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
             ELKQ+L +++ +W ++++E E+LK+ANP+LQATAESLIEE +SLQ  N ELR+Q+LEL  
Sbjct  841   ELKQKLRDLESQWSEARDECEFLKRANPELQATAESLIEERNSLQNSNDELRKQKLELHQ  900

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
              C++LEA+L +   S ++C  R+E LE  LS +LE  +SKE+ +N EL+ +L +  ++KE
Sbjct  901   LCSVLEAKLNQSHKSFTNCSKRVEVLEQDLSLMLENIASKEESLNLELDALLDENMKYKE  960

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             +L ++ESL +++   K  E+E  Q++   L   +    +  +  AS+   E   L  E +
Sbjct  961   KLTLEESLFNKMYLEKTVEVESLQEEVDRLTKLLAATQEEREELASDAVQEASRLRTEKE  1020

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
             ML+  L+E+Q     TE +L   ++E E K+  L+ EL A K NQ V  A  ++L + LE
Sbjct  1021  MLESALREVQSKAIQTEEELNIMRIETEAKLQGLVAELAASKQNQEVTMADHERLLKLLE  1080

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
             N  SSE+ LK  +++LE +L +S+ ER Q+ + + ++K+++ K+   ++EVLA    L+ 
Sbjct  1081  NYKSSEAKLKTTVNDLELRLTVSDYERQQVLEESINMKVQIEKLTHCQEEVLAFNNELDA  1140

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
              KF+ E+LE  L  I  E  +LKA+K+S  ++++ ++ ++ ELE+C+   V LEEKVL++
Sbjct  1141  TKFEKEKLEVLLHSISEECRDLKAEKSSFHEKISTLEKALFELEDCKRNNVRLEEKVLQM  1200

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
             EGDLTA+E +CA+ AELKN+L Q +R N Q + KI+ LE ER    ++ Q++++EL
Sbjct  1201  EGDLTAKEALCAQYAELKNELNQIRRANEQYQLKIQLLEEERSDFLRKSQALEQEL  1256


 Score =   299 bits (765),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 192/457 (42%), Positives = 275/457 (60%), Gaps = 51/457 (11%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF++ +++ +    SG++  F FS+ +ALQVP+GWDKL VS++SVE GK I+K  KA V 
Sbjct  1     MFRVHKNRPA---KSGERVDFKFSHFKALQVPRGWDKLFVSIVSVETGKPIAKSSKAVVR  57

Query  241   NGTCQWTE----SLWSPENYASNGL-DHF-KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NG CQWTE    S+W  ++ +S  + D+F K ++SMGS+R+GILGE +VN+  Y +S +S
Sbjct  58    NGNCQWTETLCESIWISQDESSKEMEDYFIKLVISMGSARSGILGEVSVNMSDYISSTSS  117

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSE----  570
              PVSLPL+KC+ GT+L  +I CLTPR     +E   T+A+ EE N+  +  D+KS+    
Sbjct  118   APVSLPLKKCSFGTILQVKINCLTPRKRLSDEESKETSAHLEEANANGHDADSKSDGSSF  177

Query  571   --------------ERNNSLP---------SMEDSLGRDSLssasnssavvnnaIRR---  672
                            R +S           S E S+ RD++S  SN S   N+ I R   
Sbjct  178   GKDFGLISNPGEPGSRGSSFSTSGSHRSYDSAEGSIRRDNMSPRSNLSVEGNHLIGRQDS  237

Query  673   ---LESTESGGSAPWssysygspksnnspnklsisCQEKHPEYTEEEIGQCSLHITRTS-  840
                L ST  G   P    S  +  S NS           H + + ++  + SL  T +S 
Sbjct  238   ITPLISTTHGXXXPADIPSPSNNSSFNSRINGLG----NHSQNSRKDFKESSLRATDSSK  293

Query  841   ----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESN  1008
                   +  IEEL AEA+MWE NAR+LM+ ++ LR EF++QS++ A+M +ELS A+ E N
Sbjct  294   NLLDAAEVTIEELHAEAKMWERNARKLMLDLDILRTEFSDQSKKQANMNVELSAAYAERN  353

Query  1009  RLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRK  1188
              L  +++ L++LLE S  KQ A+E+L  Q + T  I K ++DELKFQ ES +NL+LQL +
Sbjct  354   GLKKEVEHLQLLLENSVVKQTASEDLTYQDEGTPEIEKALQDELKFQKESVANLALQLER  413

Query  1189  SQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSD  1299
             SQESN ELVSVLQE+EET++ +K+E+ENL  L S  D
Sbjct  414   SQESNIELVSVLQELEETIENQKVELENLSELQSTFD  450



>ref|XP_009384551.1| PREDICTED: GRIP and coiled-coil domain-containing protein 2-like 
[Musa acuminata subsp. malaccensis]
Length=1507

 Score =   314 bits (804),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 270/814 (33%), Positives = 448/814 (55%), Gaps = 57/814 (7%)
 Frame = +1

Query  2239  TDPMAQKEHAKAV---FDKLVQLLRARLVSCTN-DKYSEDGARTEVNNTYEIKDKSDYGC  2406
             TDP++QK  A+ +     +L  LLR  +  C +  ++   G    +NNT       D G 
Sbjct  722   TDPISQKNLAEDITKNLHELNTLLRENIFRCNSMSQHESSGINQRINNTEAPDQLKDEGF  781

Query  2407  STEKDPCSSHQGYKNFKELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRD  2586
               E++P                 E  GN   +K     E ++  L ++  +  L H  ++
Sbjct  782   -MEQEP-----------------EYAGNKTRSKEIFEHEFQSDLLLKEQEIDRLKHSNKE  823

Query  2587  LANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMREEMMVVTGRIFGNISE-KIQEMK  2757
             L + I   Q     +E+D   ++ E  D +   + +  ++MV+TG+I  ++S  K  E K
Sbjct  824   LEDLISYLQKEKCQLEEDFASLRRESSDTSKHLEHVEHDLMVLTGQIEYHVSSNKALERK  883

Query  2758  ILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNL  2937
              +ELE+ K ELE  V ELE++N++LSER+SGLEAQLR+ T+  E +R+EL+   + +  L
Sbjct  884   SMELESCKNELELHVSELEQDNVKLSERISGLEAQLRYITNEKESNRLELEDTISLIEEL  943

Query  2938  QDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSL  3117
             +DE+ +   + E Q+ ELKQ+L E QKR  ++ EES+  +++N KLQAT E+LIEEC+SL
Sbjct  944   KDEVEQQRDEMEMQKAELKQKLQETQKRLSEALEESDISRRSNLKLQATIENLIEECNSL  1003

Query  3118  QILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIM  3297
             Q L G+L+RQ+LEL  +   LE +L + +        +I+ LE KLSS+ ++  SKEK +
Sbjct  1004  QNLTGDLKRQKLELHERITRLEVDLNESKKKDFDFCDQIDLLELKLSSLQKDIGSKEKSL  1063

Query  3298  NSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGK  3477
              S+LE +    KE ++++     L +++      E+E  +++   L  QM    D  +  
Sbjct  1064  LSQLEKMFQDHKEHEDKIAKVHILLNRIELEITVEVENLEKEIADLTAQMSLNYDEREKV  1123

Query  3478  ASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTN  3657
             AS+  HE   L +E    + +LQE+   +E+ E  L   Q E + K+  L+  LNA K +
Sbjct  1124  ASDAIHEASLLRSEKARFECSLQEVNSKVELYETDLQALQQESKNKIQGLVDLLNASKQS  1183

Query  3658  QVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKI  3837
             + +L A  + +QR +E V  SE   + +  +LE +L  S+ E+    +  S L+++L K+
Sbjct  1184  EEMLMADIEHMQRIMEGVKYSEEKYRKLATDLELRLKTSDYEKQHAMEEISGLEVQLQKL  1243

Query  3838  AFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELE  4017
               L++ VL LKGSL++  F+  +LE  L+ +  E+EELKA+ T L+++++ MQ ++++ +
Sbjct  1244  FHLQNSVLDLKGSLDEADFEKRKLELLLESVTQESEELKAENTVLMEKVSIMQKALSDGQ  1303

Query  4018  ECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYY  4197
             + R  K+ L+EK++RLE DL+ +E     +AELKN+L++ KR NS+ +   + LE E   
Sbjct  1304  DDRRSKIALQEKLVRLESDLSVKEASYVYEAELKNELSRIKRTNSEYQRMFQNLEQENVE  1363

Query  4198  LSKELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVT-ID  4374
             L  ++Q+++EEL  +              KTT   E+  S+  S+ C++ E       +D
Sbjct  1364  LMNKVQNMEEELMLR--------------KTTHQDEKISSEDDSNSCDHTEVPDDSKEVD  1409

Query  4375  DCSSRCQVGDDKTQFKSLQPEGQS--------TRSGN---------ENEQKISQLEAELK  4503
               S     G + T+   +   G+          ++GN         EN  KIS LE ELK
Sbjct  1410  HESDIPLHGTEHTEAGGVNNMGKEQLKRGISRKQAGNIEALKKTLKENADKISSLETELK  1469

Query  4504  EISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             ++ ERYLHMSL+YAEVE Q+ +LVM LK+++ ++
Sbjct  1470  DMRERYLHMSLQYAEVEAQREELVMQLKSVKKEK  1503


 Score =   226 bits (575),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 166/468 (35%), Positives = 253/468 (54%), Gaps = 86/468 (18%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MFKL R++S   D  G+K  F  SN+QA++VP+GWDKL +S++SVE+GKTI++ G+A+V 
Sbjct  1     MFKLHRYRS---DRFGEKVEFKLSNLQAVKVPRGWDKLLLSIVSVESGKTIARTGRATVR  57

Query  241   NGTCQW--TESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIP  408
             +G CQW  TES+W  ++ AS  L+   FK +VS  SSR+ ++GE T+N+  Y +S    P
Sbjct  58    SGNCQWTETESIWVSQDDASKELEECRFKIVVSPASSRSVVIGEVTLNLADYLSSGEIGP  117

Query  409   VSLPLQKCNKGTVLNFEIKCLTP-----------RTSFRGDEVNSTAAYNEEENSVCNGI  555
             + LPL+KC+ GT L  +I+C TP            TS   D+ N     N+E +S  +G 
Sbjct  118   LLLPLKKCDSGTTLQVKIQCCTPISKSRVGKSWKETSHLDDQTN-----NDELDSKSDGS  172

Query  556   DN----------KSEERNNSLPSME-------------------DSLGRDSLssasn---  639
             DN           +   NNS P                      DSL R  LS  ++   
Sbjct  173   DNLINKSVGSSSSNHFGNNSYPDESGNRDTSFSASGSRHSSDSGDSLSRTGLSPKNSLNG  232

Query  640   -----ssavvnnaIRRLESTESGGSAPWssysygspksnnspnklsisCQEKHPEYTEEE  804
                        + I    ST  GGS P             S      S    H    ++ 
Sbjct  233   GQYIGRQDSSGSHISATYSTGPGGSNP-------------SSFNSRASVSSVHNNQWQDM  279

Query  805   IGQCSLHITRTSIPDAN-----------IEELKAEARMWELNARRLMVKMETLRKEFANQ  951
               Q S H T  S+  ++           IEEL+ E +MWE ++++L + +E L+KE + +
Sbjct  280   AAQTSEHGTVPSLRPSDSSKDLLESAEEIEELRDEVKMWERHSQQLKLDLELLKKENSEK  339

Query  952   SQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEME  1131
             S+   +++ +LS A +E + L  +++RL+  LEES +KQ   + +N + ++  ++ KE+E
Sbjct  340   SKHQVNLDRQLSAASSERDSLKLEVERLKAALEESTSKQ--TDIINFKNEDLVHVQKELE  397

Query  1132  DELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENL  1275
             DELKFQ +SN+NL+ QLRK+QESN ELV++LQE+EE  +K+++EI NL
Sbjct  398   DELKFQNDSNANLTQQLRKTQESNIELVAILQELEEITEKQRLEIANL  445



>ref|XP_011018825.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Populus euphratica]
Length=1374

 Score =   312 bits (799),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 257/709 (36%), Positives = 406/709 (57%), Gaps = 67/709 (9%)
 Frame = +1

Query  2563  ALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNI  2733
              L   +R+L  K+   Q     +E+ ME V T   DI +   + +R+++MV++  +  ++
Sbjct  692   TLQRYQRELEAKLSVLQNEKGQMEERMEIV-TRGGDIATKCLNDLRKDLMVLSSSVDSHV  750

Query  2734  S-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQ  2910
             S  KI E +  EL + KQELE  + EL++EN +LS  ++ LE Q+   TD  + +++EL+
Sbjct  751   SANKILEKRSSELASAKQELEIRLSELKQENEELSSHITVLEGQITQLTDDRKSTKLELE  810

Query  2911  HKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAE  3090
             +  TQ+  LQD++  L+ D E+Q  +LKQ L  +  +W ++QEE +YLK+ N  LQATAE
Sbjct  811   NSKTQVQILQDQVSRLKNDVETQTTDLKQNLQRLHDKWSEAQEECDYLKRENLNLQATAE  870

Query  3091  SLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILE  3270
             S+++EC SLQ   GEL RQ+LEL+  C  LEA+LR+     + C  R+  LE  +SS+LE
Sbjct  871   SIMQECSSLQKSIGELERQKLELQGHCTHLEAKLRESHRRFADCSRRVTVLEENISSVLE  930

Query  3271  ETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMF  3450
             +++SKEK + +ELE +L + ++  +R     SL +Q+    + E+E  Q++   L  Q+ 
Sbjct  931   DSASKEKKLITELETLLEENEKQNKRF----SLLNQMYLEMMVEVESLQREVGDLTKQLS  986

Query  3451  DPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELM  3630
                   +  ASE   E+  L A    L              E +L T+Q+E + KV  LM
Sbjct  987   ATQADRERIASEAVDEVSGLCAVIARL--------------ESELNTSQIESDTKVQGLM  1032

Query  3631  GELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANS  3810
             GEL A K NQ +L+  + ++ + L N IS E N K  + +LE KL +SE ER Q+ + ++
Sbjct  1033  GELAASKQNQEMLKVDNGRMSKLLTNYISCEENFKTTLSDLELKLTVSEYERQQVMEEST  1092

Query  3811  SLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTG  3990
              LK++LL+I  L+DEV+ALK  LN +K++ E+LE S +L+ GE +ELK +K+S I+++T 
Sbjct  1093  KLKVQLLEIGSLQDEVVALKNELNAIKYEKEKLETSFRLVSGECKELKIEKSSFIEKITI  1152

Query  3991  MQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKI  4170
              Q +V+ELE+ + + + LEEK+LR+EGDL A+E  C + AE+ ++LT+ KR N QL+ ++
Sbjct  1153  SQKAVSELEDSKQKIISLEEKLLRMEGDLMAKEAFCEQYAEINSELTRIKRANKQLQQQM  1212

Query  4171  KQLELERYYLSKELQSVQEEL------------NRKENSVP-----------SPSHSVAK  4281
             +Q+E ++       QS++ E+            + ++NS             SP      
Sbjct  1213  RQVEEDKLACLTRTQSLEGEVMFLMEQQQNQRDSERKNSYSNQLQEGDYGYKSPDGVDPA  1272

Query  4282  DKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGN  4461
              K+ S  E+ L+KA     NN   IQ+  +            K++ +   P  + + +  
Sbjct  1273  SKSHSL-EENLAKALEE--NNSYKIQLKRL------------KSEGRKSVPRSRKSTAEG  1317

Query  4462  E------NEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             E       E+  S LEAELK+I ERY HMSLKYAEVE  + +LVM LKA
Sbjct  1318  EVVPKEKFERTKSSLEAELKDIRERYFHMSLKYAEVEASREELVMKLKA  1366


 Score =   301 bits (771),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 194/465 (42%), Positives = 274/465 (59%), Gaps = 62/465 (13%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L + + +   +SG+K  F FS  +ALQVP+GWDKLSVS+ISVE GKTI+K  KA+V 
Sbjct  1     MFRLHKARPAAKSSSGEKIDFKFSYFKALQVPRGWDKLSVSIISVETGKTIAKTSKAAVR  60

Query  241   NGTCQWTESLWSPENYAS---NGLDH----FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             NG CQWTESL    + AS   +  +H    FKF+V+MGS+R+GILGEATVN+  Y +S  
Sbjct  61    NGNCQWTESLSESMSTASQDESSKEHDECLFKFVVAMGSARSGILGEATVNMASYMSSSD  120

Query  400   SIPVSLPLQKCNKGTVLNFEIKCLTPRTSF---------------------------RGD  498
             S+PVS PL++CN GT+L  +I+CLTPRT                             + +
Sbjct  121   SVPVSFPLKRCNHGTILQVKIQCLTPRTKLIRDDKSKETDSHKEDINADSQSHEVEIKSE  180

Query  499   EVNSTAAYNEE----ENSVCNGIDNKSEER----------NNSLPSMEDSLGRDSLssas  636
             E N T A +EE     +S C  +  + E+R          ++S  S ED   R+S S ++
Sbjct  181   ESNGTVAKSEESYSGRDSSCTSLPQEHEKRPEASFSNSDSHHSYDSAED-FTRESFSPSN  239

Query  637   nssavvnnaIR-RLESTESGGSAPWssysygspksnnspnklsisCQEKHPEYTEEEIGQ  813
             N S      I  +  S  S  S P  + S  +  S  S         E       +E   
Sbjct  240   NLSGDEPPLISGKPNSASSQKSYPIGNPSESNQASFKSRTT----LPENLSREDTQEFAT  295

Query  814   CSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEM  978
              SL ++ +S       +  +E+L+ EA+MWE NAR+LM+ ME LRKE++ QS+  A+M M
Sbjct  296   SSLRVSDSSKRLLETAEDTVEDLRNEAKMWERNARKLMLDMEILRKEYSEQSKNQANMYM  355

Query  979   ELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTES  1158
             ELS A  E + L  ++++L++LLE+S AK  A E+   Q    E  +KE+E+++ FQ ES
Sbjct  356   ELSAACAERDGLQKEVEQLKLLLEKSTAKPEALEDYTFQ---DEGAVKELENDVMFQRES  412

Query  1159  NSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSR  1293
             N+NLS+QL++SQESNAELVSVLQE+EET++K+K EI+NL AL S+
Sbjct  413   NANLSVQLKRSQESNAELVSVLQELEETIEKQKNEIDNLSALQSK  457



>ref|XP_006381364.1| hypothetical protein POPTR_0006s12200g [Populus trichocarpa]
 gb|ERP59161.1| hypothetical protein POPTR_0006s12200g [Populus trichocarpa]
Length=1228

 Score =   310 bits (794),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 257/706 (36%), Positives = 407/706 (58%), Gaps = 63/706 (9%)
 Frame = +1

Query  2566  LNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMREEMMVVTGRIFGNIS-  2736
             L   +R+L  K+   Q     +E+ ME V+ E D  T   + +R+++MV++  +  ++S 
Sbjct  547   LQRYQRELEAKLSVLQNEKGQMEERMEIVRREGDIATKCLNDLRKDLMVLSSSVDSHVSA  606

Query  2737  EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHK  2916
              KI E +  EL + KQELE  + EL++EN +LS  ++ LE Q+   TD  + +++EL++ 
Sbjct  607   NKILERRSSELASAKQELEIRLSELKQENEELSSHITVLEGQITQLTDERKSTKLELENS  666

Query  2917  GTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESL  3096
              TQ+  LQD++  L+ D E+Q  +LKQ L ++  +W ++QEE +YLK+ N  LQATAES+
Sbjct  667   KTQVQILQDQVSRLKNDVETQTTDLKQNLQQLHDQWSEAQEECDYLKRENLNLQATAESI  726

Query  3097  IEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEET  3276
             ++EC SLQ  NG L RQ LEL+  C  LEA+LR+     + C  R+  LE  +SS+LE++
Sbjct  727   MQECSSLQKSNGVLERQILELQGHCTHLEAKLRESHRRFADCSRRVTVLEENISSVLEDS  786

Query  3277  SSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDP  3456
             +SKEK + +ELE +L + ++  +R     SL +Q+    + E+E  Q++   L  Q+   
Sbjct  787   ASKEKKLITELETLLEENEKQNKRF----SLLNQMYLEMMVEVESLQREVGDLTKQLSAT  842

Query  3457  SDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGE  3636
                 +  ASE   E+  L A   + KL            E +L ++Q+E   KV  LMGE
Sbjct  843   QADRERIASEAVDEVSGLCA--VIAKL------------ESELNSSQIESNTKVQGLMGE  888

Query  3637  LNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSL  3816
             L A K NQ +L+  + ++ + L N IS E N K  + +LE KL +SE ER Q+ + ++ L
Sbjct  889   LAASKQNQEMLKVDNGRMSKLLTNYISCEENFKTTLSDLELKLTVSEYERQQVMEESTKL  948

Query  3817  KIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQ  3996
             K++LL+I  L+DEV+ LK  LN +K++ E+LE S +L+ GE +ELK +K+S I+++T +Q
Sbjct  949   KVQLLEIGSLQDEVVVLKNELNAIKYEKEKLETSFRLVSGECKELKIEKSSFIEKITILQ  1008

Query  3997  NSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQ  4176
              +V+ELE+ + + + LEEK+LR+EGDL A+E  C + AE+ ++LT+ KR N QL+ +++Q
Sbjct  1009  KAVSELEDSKQKIISLEEKLLRMEGDLMAKEAFCEQYAEINSELTRIKRANKQLQQQMRQ  1068

Query  4177  LELERYYLSKELQSVQEEL------------NRKENSVPS-----------PSHSVAKDK  4287
             +E ++       QS++ E+            + ++NS  +           P   V   K
Sbjct  1069  VEEDKLACLTRTQSLEGEVMFLKEQQQNQRDSERKNSYSNQLQEGDYGYKIPDGVVPASK  1128

Query  4288  TTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSG---  4458
             + S  E+ L+KA     NN   IQ+  +                KS+    +ST  G   
Sbjct  1129  SQSL-EENLAKALEE--NNSYKIQLKRLKSEGR-----------KSVPRSRKSTAEGEVV  1174

Query  4459  --NENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
                + E+  S LEAEL++I ERY HMSLKYAEVE  + +LVM LKA
Sbjct  1175  PKEKFERTKSSLEAELRDIRERYFHMSLKYAEVEANREELVMKLKA  1220


 Score =   147 bits (371),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 126/178 (71%), Gaps = 9/178 (5%)
 Frame = +1

Query  799   EEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRI  963
             +E    SL I+ +S       +  IE+L+ EA+MWE NAR+LM+ ME LRKE++ QS+  
Sbjct  145   QEFATSSLRISGSSKSLLETAEDTIEDLRNEAKMWERNARKLMLDMEILRKEYSEQSKNQ  204

Query  964   ADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELK  1143
             A+M MELS A  E + L  ++++L++LLE+S AK  A E+   Q    E  +KE+E+++ 
Sbjct  205   ANMYMELSAACAERDGLQKEVEQLKLLLEKSTAKPAALEDYTFQ---DEGAVKELENDVM  261

Query  1144  FQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSR-SDVMGVI  1314
             FQ ESN+NL+LQL++SQESNAELVSVLQE+EET++K+K EI+NL AL S+ SD+   I
Sbjct  262   FQRESNANLNLQLKRSQESNAELVSVLQELEETIEKQKDEIDNLSALQSKFSDMENSI  319



>ref|XP_004306171.1| PREDICTED: uncharacterized protein LOC101308313 [Fragaria vesca 
subsp. vesca]
Length=1467

 Score =   304 bits (778),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 269/793 (34%), Positives = 426/793 (54%), Gaps = 85/793 (11%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCL--EEDVGLKALNHCRRDLANKIYDHQMVAWMV  2631
             ELE+K   +   +  K +++ +++   L  EE+ G+  L     +L  +  D Q     +
Sbjct  668   ELEIKVTDLEKELTEKRTEIAKLEDNLLTKEEETGV--LRQVHNELEAQFSDLQREKVEL  725

Query  2632  EKDMEKVQTEKDDITS--DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCV  2802
             E+ ME V  E +  T   + +R +++V++  +  ++S  KI E K  ELE +K ELE  +
Sbjct  726   EEHMEIVLRESELTTKCLNDLRNDLVVLSSSVDTHVSTNKILEKKSSELEADKHELELHL  785

Query  2803  FELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQE  2982
              EL+++N QLSE++S +E QLR  TD  E +R+EL++  +   +LQDEI  L+ + ES +
Sbjct  786   SELQQQNTQLSEQISAVEVQLRCLTDEKEANRLELENSKSYSQSLQDEISTLKVEMESDK  845

Query  2983  LELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELK  3162
             +ELKQ+L+++Q +W +++EE E+LK+ NPKLQA+ E+LIEEC+ LQ  N ELR Q+LEL 
Sbjct  846   VELKQKLVDLQSQWSEAREECEFLKRENPKLQASIETLIEECNLLQKSNEELRTQKLELH  905

Query  3163  VQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFK  3342
              Q   LEA L + Q     C  R+E LE  L  ++E  +SKEKI+NSEL+ +  ++ +  
Sbjct  906   EQSTHLEARLTESQERFEDCSRRVEVLEQDLCVMMESIASKEKILNSELDALRDESIQHW  965

Query  3343  ERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAEN  3522
             E L+ ++SL +++   K  E E  QQ+   L  Q+ +     +  AS    E   L AE 
Sbjct  966   EELMSEQSLLNKMYLEKEIEAENLQQEVEQLTKQLSEIHKGSEELASGALQEASRLRAEK  1025

Query  3523  KMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWL  3702
               L+  LQE+Q  +   E +L   + EYE K+  L  +L A K  Q  + A  ++L R L
Sbjct  1026  VDLECALQEVQSRVIQAENELNIMRTEYEEKLQGLSVDLTASKQLQETMMADHERLLRLL  1085

Query  3703  ENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLN  3882
             EN  SSE+ LK  ++NLE KL +S+ E+ QL + +++LK++L  +   +D+ LA+K  L+
Sbjct  1086  ENYKSSEAKLKTAVNNLELKLTVSDYEQQQLVEESTNLKVQLQNLIHCQDQFLAVKKELD  1145

Query  3883  DMKFKNERLEASL--QL---------------------------------ICGENEELKA  3957
               K + E+LE+ L  QL                                 +  E E LKA
Sbjct  1146  VTKLEKEKLESLLDAQLEKLTHCQDQVLAIKTELEATKLEKEKSEELLDSVSEEYEYLKA  1205

Query  3958  DKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQS  4137
             +K S +++++ +   ++ELE+C+  K VLE K+L+++GDL A+E +CA+DAELKN+L Q 
Sbjct  1206  EKNSFLEKISTLDMVLSELEDCKHNKAVLERKILQMKGDLIAKEALCAQDAELKNELNQF  1265

Query  4138  KRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLS  4317
             +R N Q + K++ LE E+    +  QS+++EL       P+     ++  T   +++KLS
Sbjct  1266  RRANEQYQQKLQLLEEEKDVCRRRSQSLEQELKLIREEKPNQRDLKSRSSTKVTEDKKLS  1325

Query  4318  KA-------------RSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPE-------  4437
             K+             R     N +    +   D S R    D   + K L+ E       
Sbjct  1326  KSEMVKNTSHRRDNRRKPLVKNDKDDNGIDSRDGSPRDVTVDHGLKIKMLEDELVKAMEA  1385

Query  4438  ------------GQSTRSGNEN-----------EQKISQLEAELKEISERYLHMSLKYAE  4548
                          Q+    ++N           E+  S LE ELKEI ERYL MSL+YAE
Sbjct  1386  NNTYKLQLDRLVRQNHADAHQNSKAEVVAKDRFERSKSSLETELKEIRERYLSMSLRYAE  1445

Query  4549  VENQKGKLVMTLK  4587
             VE ++ +LVM LK
Sbjct  1446  VEAEREELVMKLK  1458


 Score =   179 bits (453),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 120/176 (68%), Gaps = 9/176 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF++ R++ +    SG++  F FS  +A+QVP+GWDKL VS++SVE GK I+K  KA V 
Sbjct  1    MFRIHRNRPA---KSGERIDFKFSQFKAVQVPRGWDKLFVSIVSVETGKPIAKSSKAVVR  57

Query  241  NGTCQWTE----SLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQW+E    S+W  ++  S  ++   FK +V+MGS+R+GILGEATVN+  Y  S ++
Sbjct  58   NGSCQWSEALSESIWISQDDNSKEMEDCFFKLVVAMGSARSGILGEATVNMSDYITSSST  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSE  570
             PVSLPL+KCN GTVL  +I CL PR   R  +   T+++ EE+N+  N +D KS+
Sbjct  118  APVSLPLKKCNYGTVLQVKINCLKPRARVRDVDSKETSSFLEEQNASGNFVDGKSD  173


 Score =   139 bits (351),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 93/240 (39%), Positives = 150/240 (63%), Gaps = 20/240 (8%)
 Frame = +1

Query  781   HPEYTEEEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFA  945
             H + + ++I    L  T +S       +  IEEL AEA+MWE NAR+LM+ ++ L+ EF+
Sbjct  281   HSQNSRKDIPGSPLRTTGSSKNLLETAEVTIEELHAEAKMWERNARKLMLDLDILKAEFS  340

Query  946   NQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKE  1125
             +QS++ A++ MELS A+ E + L  +++ L+V    S  +Q  +++L        +I K 
Sbjct  341   DQSKKQANLNMELSAAYAERDSLKKEVEHLKVSFGSSAMRQTGSKDL--PQVGVSHIEKA  398

Query  1126  MEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVM  1305
             ++DELKFQ ES +NL LQL++SQESN ELVS+LQE+EET++++K+E+ENLL L S+   M
Sbjct  399   LQDELKFQKESIANLDLQLKRSQESNIELVSILQELEETIEEQKMELENLLELQSKFSEM  458

Query  1306  GVINSCGDEDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIE  1485
                     E+++Q  + E  ++ +Q     LQ LQES   L++ +   E+A +EK  ++E
Sbjct  459   --------ENSIQITAEENSNLTRQ-----LQKLQESENKLQDMVQQLEQALDEKNCDVE  505



>ref|XP_009411507.1| PREDICTED: cingulin-like [Musa acuminata subsp. malaccensis]
Length=1497

 Score =   304 bits (778),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 245/691 (35%), Positives = 409/691 (59%), Gaps = 18/691 (3%)
 Frame = +1

Query  2566  LNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMREEMMVVTGRIFGNIS-  2736
             L H  ++LA+ I   Q     +E+D+  ++ E  D +     M  +++V+TG +  ++S 
Sbjct  810   LGHSNKELADLISSLQKEKCQLEEDLASLRQENIDNSKYLQDMEHDLLVLTGSVESHVSV  869

Query  2737  EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHK  2916
              K  E K +ELE+  +ELE  V ELE+EN++L+ER+SGLEAQLR+ T+  E +R+EL+  
Sbjct  870   NKTLERKSVELESCNKELELHVSELEQENVKLAERISGLEAQLRYLTNEKESNRLELEGT  929

Query  2917  GTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESL  3096
              +   +L+DE+ + + + E Q+ ELKQ+L E QKR   + EES+Y  ++N KLQAT  SL
Sbjct  930   RSLAADLKDEVEQQKAEMEMQKAELKQKLQETQKRLSVALEESDYSSRSNSKLQATIASL  989

Query  3097  IEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEET  3276
             IEEC SLQ LNG+L++Q+LE   +   LE EL + +        +++ LE KLS + ++ 
Sbjct  990   IEECSSLQKLNGDLKKQKLEFHERITHLEIELDESKKKNFDFCKQVDLLEIKLSLLQKDV  1049

Query  3277  SSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDP  3456
             + KEK + S+LE I    KE +ER+    SL +++   K  E+E  +++  +L  QM   
Sbjct  1050  ALKEKSLLSQLEHIFQDHKEHEERIDKAHSLLNKIELEKTVEVENLRKEMSNLTAQMSSN  1109

Query  3457  SDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGE  3636
              D ++   S+  HE   L ++   L+ +LQE+    ++ E  L T + E + K+  L+  
Sbjct  1110  HDDQEKITSDAVHEASILRSDKVKLECSLQEVNSKAKLYETDLQTLRQESKNKIQGLVDL  1169

Query  3637  LNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSL  3816
             LNA K ++ +L A  + +QR +++V SSE   + ++++LE KL  S+ E+ Q+ + ++ L
Sbjct  1170  LNASKQSEEMLMADIEHIQRTMDSVKSSEEKHRKMVNDLELKLKSSDYEKQQVMEESTGL  1229

Query  3817  KIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQ  3996
             K++L K++ L++ VL LKGSL+   F+  +LE  L+ +  E EELKA+K SL ++++ MQ
Sbjct  1230  KLQLQKLSELQNSVLDLKGSLDGADFEKRKLEELLKSVSEEYEELKAEKVSLTEKVSNMQ  1289

Query  3997  NSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQ  4176
              ++   E+ +  +VVL+EK+LRLE DL+ +E   A++AE KN+L + KR NS+ + K++ 
Sbjct  1290  KALCNSEDDKRSRVVLQEKLLRLESDLSIKEASYAQEAEFKNELNRIKRTNSEYQRKVQS  1349

Query  4177  LELERYYLSKELQSVQEELN-RKENSVPSPSHSVAKDKTTS-------CKEQKLSKARSS  4332
             LE E   L K++Q ++++L  RK +       S   DK  S        KE    +    
Sbjct  1350  LEQENLELMKKVQIMEKDLMLRKASCQDEKVSSEDDDKPHSHLEGPHCSKEVHEPERLLL  1409

Query  4333  QCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNENEQKISQLEAELKEIS  4512
             +  + + ++   +D+   +  V          + +     + NE+  KIS LEAEL+E+ 
Sbjct  1410  ETKHADAVEADNMDEVQHKRVVS-------GKEADHLLKNNVNEHTDKISSLEAELREMK  1462

Query  4513  ERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             ERYL+MSL+YAEVE Q+  LVM LK+++ ++
Sbjct  1463  ERYLNMSLRYAEVEAQREGLVMQLKSMKKEK  1493


 Score =   166 bits (421),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 124/179 (69%), Gaps = 9/179 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+S   D  G+K  F  SN+QA++VP+GW+KL +S++SV++GKTI+K GK++V 
Sbjct  1    MFKLHRHRS---DRFGEKVEFKLSNLQAIKVPRGWEKLFLSIVSVDSGKTIAKTGKSTVR  57

Query  241  NGTCQWT--ESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIP  408
            +G CQWT  ES+W  ++  S  L+  HFK +VS  S+R+ ILGE T+NV  Y   E S P
Sbjct  58   SGNCQWTGTESIWVSQDDVSKELEECHFKIVVSPASARSIILGEVTLNVADYLGKEESGP  117

Query  409  VSLPLQKCNKGTVLNFEIKCLTPRTSFR-GDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
            + LPL+KC+ GT L  +I+C+TP++ FR G     T ++ E+ +++ + +D+KS+  +N
Sbjct  118  LFLPLKKCDSGTTLQVKIQCVTPKSKFRVGKSWKDTTSHLEDHSNI-DDLDSKSDGSDN  175


 Score =   112 bits (279),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 97/140 (69%), Gaps = 2/140 (1%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL  E +MWE ++R+L + +E L+KE + +S+  AD++ +LS AH E + L  ++K L
Sbjct  314   IEELHDEVKMWERHSRQLKLDLEILKKEISEKSKHQADLDRQLSAAHNERDSLKQEVKHL  373

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +  LEES + +    N+  + ++   +  E+EDEL FQ +SN NL+ QL+K+QESN ELV
Sbjct  374   KAALEESMSNRTDVSNV--KNEDMVRVQMELEDELNFQKDSNVNLTQQLKKTQESNIELV  431

Query  1216  SVLQEMEETVQKKKIEIENL  1275
             ++LQE+EE  +K+K+E+ NL
Sbjct  432   AILQELEEITEKQKLELANL  451



>gb|KCW65269.1| hypothetical protein EUGRSUZ_G02735 [Eucalyptus grandis]
Length=1238

 Score =   296 bits (757),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 260/733 (35%), Positives = 384/733 (52%), Gaps = 115/733 (16%)
 Frame = +1

Query  2557  LKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKD-DITSDSMREEMMVVTGRIFGNI  2733
             +K L H +++L  ++ + +     V+  M+  +   D D +   + E  MV    +   +
Sbjct  560   VKTLQHLQKELETQLCNFEQENSKVDNKMKGTERGSDSDCSFCPLHEGKMVHASSMGPQV  619

Query  2734  SEKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQH  2913
             S      K  ELE EK ELE  + ELE+EN++LSER+ GLEAQL++ TD  E SR+ +Q 
Sbjct  620   SADKVIGKWSELEGEKNELEIHLSELEEENVRLSERICGLEAQLQYLTDERESSRLAIQF  679

Query  2914  KGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAES  3093
               +Q  N Q  I++LE + E+Q++  KQRL E+ K+ L++QEE +YLK AN K+QATAE+
Sbjct  680   SESQSSNFQSVIKKLEIEMEAQKVTAKQRLQEIHKQLLEAQEECKYLKVANMKVQATAEN  739

Query  3094  LIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEE  3273
             LIEEC SLQ LNGELR+Q +EL  +   LEAEL +   +     + IE LE K  S+LEE
Sbjct  740   LIEECSSLQKLNGELRKQNIELHERITFLEAELAESNEAFPHLSNEIEVLEEKFDSLLEE  799

Query  3274  TSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFD  3453
             ++ KEK +NSEL  +LL+ +   + + I+E+ ++   +    E E+P+     +VN +  
Sbjct  800   STLKEKALNSELNALLLENRRL-DNIFIREA-RTDTVKDSEEETEHPES----MVNNI--  851

Query  3454  PSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMG  3633
                                                            Q+EYE KV  L+G
Sbjct  852   -----------------------------------------------QLEYEAKVLGLIG  864

Query  3634  ELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSS  3813
             EL + K NQ VL     KL   LE+V S+ES L+    +L  KL  SE ER+QL +  S 
Sbjct  865   ELASSKQNQEVLIDGHHKLITLLEDVKSNESKLRNAARSLAMKLKASEYERVQLLEEISC  924

Query  3814  LKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGM  3993
             LK++L KI  L++EVLALK ++++  F+ ERLE S  ++  + EE+K ++ S +++++ +
Sbjct  925   LKVQLQKIELLQNEVLALKKTISETTFEKERLETSHHVLLADFEEMKVERESFVEKISTI  984

Query  3994  QNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIK  4173
             Q +++ELEEC+  KV L+E++LRLEGDLTARE + A++AELKN++ + KR  SQL+ + K
Sbjct  985   QKALSELEECKHAKVALQERILRLEGDLTAREALFAQEAELKNEVARMKRSYSQLQRRTK  1044

Query  4174  QLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSC-------KEQKLSKARSS  4332
              LE E+    K  Q+VQE++      +    + V K   TSC       K   +S+ +  
Sbjct  1045  CLEEEKEECQKSAQAVQEQVKH----MKEMGYDVYKPGNTSCLPVSYEVKPPLISEVQQK  1100

Query  4333  QCNNCETIQIVTIDDCSSRCQVG-------------DD----------------------  4407
             Q +  E IQ+    D     +V              DD                      
Sbjct  1101  Q-SPAEDIQVQHFPDDQGHLEVDQLCEENNKQRKCTDDPDLSLKISILQNELAEVLEAND  1159

Query  4408  --KTQFKSL----QPEGQSTRSG------NENEQKISQLEAELKEISERYLHMSLKYAEV  4551
               K Q KSL     P     R         +  Q  S LE EL  + E YL MSL+YAE 
Sbjct  1160  MYKMQLKSLLSTNNPSHMPKRMTEDALLETQPGQDKSSLEEELIHLRESYLQMSLRYAEA  1219

Query  4552  ENQKGKLVMTLKA  4590
             E Q+ +LVM LKA
Sbjct  1220  EAQREELVMKLKA  1232


 Score =   145 bits (365),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             +  +EEL+AEARMWE NA++LMV +E L++E  NQS+    +++ELS + TE + L  +I
Sbjct  18    EVTVEELRAEARMWEKNAQKLMVDIEKLQRESLNQSEHQETLKLELSASRTECHSLKQEI  77

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             +R ++LLE+   KQ A ++L LQ K  +N+ KE+E+E+KFQ E+N+NL+LQL+K+Q+SN 
Sbjct  78    ERQKILLEDLMMKQTAMDSLKLQEKGADNLQKELEEEIKFQKETNANLALQLKKTQDSNI  137

Query  1207  ELVSVLQEMEETVQKKKIEIENLLALNS  1290
             ELVSVLQEME+T++K+K+EI +LL+  S
Sbjct  138   ELVSVLQEMEDTIEKQKMEIADLLSAKS  165



>ref|XP_007027521.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY08023.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 1 [Theobroma cacao]
Length=1451

 Score =   295 bits (754),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 186/466 (40%), Positives = 272/466 (58%), Gaps = 71/466 (15%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MF+L  HK+  +  SG+K  F FSN +A+QVPKGWD+L +S+ISVE GKTI+K  KA V 
Sbjct  49    MFRL--HKTRPT-KSGEKIDFRFSNFKAVQVPKGWDRLFMSIISVENGKTIAKTSKAVVR  105

Query  241   NGTCQWTE----SLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             NGTCQWTE    S+W   N ASN ++   FK +V+MGS+R+GILGEATVN+  Y +S A 
Sbjct  106   NGTCQWTEALPESIWVSRNEASNVMEDCLFKLVVAMGSARSGILGEATVNMTDYISSTAV  165

Query  403   IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSE----  570
             +PVSLPL+KCN GT L  +I CLTPR     +E   T ++ EE N+  + +   S+    
Sbjct  166   VPVSLPLKKCNHGTNLLVKIHCLTPRLKLMDEEAKQTNSHGEENNTDPSHMSFNSDGPES  225

Query  571   ----------------------------ERNNSLPSMEDSLGRDSLssasnssavvnnaI  666
                                         + ++S  S E S+GR+S S+ SN S    N I
Sbjct  226   VESPPSQDLVSAPHQGELESREASFSTSDSHHSYDSAESSIGRESFSTVSNLSGDAQNLI  285

Query  667   RRLESTESGGSAPWssysygspksnnspnklsisCQEKHPEY-------------TEEEI  807
             +R +S  S  S P                 L    Q   P +              ++E+
Sbjct  286   QRRDSPTSQNSLPL------------GNCHLDDPSQSNDPSFDSQIMGSESTFLDNQQEL  333

Query  808   GQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADM  972
                SL +T +S       +  IEEL AEA+MWE  A +LM+ ++ LRKE  +QS+  A++
Sbjct  334   SASSLRVTDSSKNLLEAAEKTIEELHAEAKMWERKAEKLMLDLDILRKEHFDQSKNQANL  393

Query  973   EMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQT  1152
              MELS A+TE + L  +++++++LLE+S AKQ   E+ +++ +   +I KE+E+E+ FQ 
Sbjct  394   TMELSAANTERDGLRKEVEQMKLLLEKSMAKQTTLEDSSVRDEGVTHIQKELENEIGFQK  453

Query  1153  ESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNS  1290
             ESN NLSLQL++SQ++N ELVSV QE+E T++K+++++EN+ +L S
Sbjct  454   ESNDNLSLQLKRSQDANIELVSVFQELEGTIEKQRVDMENISSLQS  499


 Score =   287 bits (735),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 249/689 (36%), Positives = 403/689 (58%), Gaps = 40/689 (6%)
 Frame = +1

Query  2629  VEKDMEKVQTEKDDITS--DSMREEMMVVTGRIFGNISE-KIQEMKILELENEKQELESC  2799
             +E  ++ +Q E D  T   D +R +MMV+   +  + S  KI E K  ELE  K ELE  
Sbjct  765   LEDKLDVLQGESDIATKCLDDLRNDMMVLRSSMDSDDSAYKILESKSSELERVKHELEMH  824

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             + ELE EN QLS R+S LEAQL    D  + SRM+L+   +   +L+DEI     + E Q
Sbjct  825   LLELEDENKQLSLRLSLLEAQLEDLKDERDSSRMQLEDSKSLATSLKDEIARSRNEMEPQ  884

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
             + +++++L +   +WL SQ++ EYL++AN KLQATAE+LIEEC++ Q   GELR+++L+L
Sbjct  885   KTDMEEKLQDKHVQWLASQDKCEYLRRANTKLQATAETLIEECNAHQKSAGELRKEKLKL  944

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
                C  LEA+L+    +L  C  +IE LE  L+ ++E+ + K + +  EL+ I  + K+ 
Sbjct  945   DEHCAHLEAKLKDSDKNLIDCSKKIEVLEKNLTLMMEKFAHKGESLTLELDSIHDKNKKL  1004

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             +  L  +ES  +QL   K +E+E  +Q+  +L  Q+      ++  A++  H++  L  +
Sbjct  1005  EAELRREESSWNQLYLEKTNEVENIRQEVENLAMQLSATHHEKEKTANDALHQISGLRVD  1064

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
                L+  L+E +   + TE +L   Q E + K+ +L+ EL A + NQ +L  + +K  + 
Sbjct  1065  KVRLESALEEAESKTKCTENELKKLQTEDKTKMEDLLDELAASRENQEILMTEHEKALKL  1124

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
             LE+  SSE  LK  +++LE KL +SE +R  +++ +S++K++LLKI  L++ +LAL+   
Sbjct  1125  LESYKSSEGKLKTFVNDLELKLTVSEYDRQLVSEQSSNMKVQLLKIENLQENILALRDER  1184

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             N +K   E+LEASL+++ GE  +LKA+K S++++++ +Q  V+ELE+ + + V LEEK++
Sbjct  1185  NAIKSDKEKLEASLRIVSGECSDLKAEKNSIVEQISTLQKVVSELEDYKHKNVALEEKLV  1244

Query  4060  RLEGDLTAREVMCAKDAELKNDLTQSKRVNSQ--------------LRWKIKQLELERYY  4197
             ++EGDLT +E +  +DAELKN+L Q KR N Q              L  K + LE E+  
Sbjct  1245  KMEGDLTVKEALLTQDAELKNELHQIKRTNRQFQQQIEQLQEENDGLLIKAQTLE-EKLK  1303

Query  4198  LSKELQSVQEELN-------RKENSVP----SPSHSVAKDKTTSCK--EQKLSKARSSQC  4338
             L  E +  Q + N       R++N+      SP H+V  D  +  +  E +L+KA   + 
Sbjct  1304  LKAEEKQKQRQSNSHRNQHKREDNNYDFHDGSP-HAVGVDPVSKIQLLENELAKAM--EA  1360

Query  4339  NNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNENEQKISQLEAELKEISER  4518
             NN   +++  +    S  +     T  KS   EG+   +  + E+  S LEAEL++I ER
Sbjct  1361  NNKYKVRLNRL----SEGRKNQSNTPKKS-AIEGEVV-AKEKYERTKSSLEAELRDIRER  1414

Query  4519  YLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             YLHMSLKYAEVE Q+ +LVM L+ ++  R
Sbjct  1415  YLHMSLKYAEVEAQREELVMKLRGVKSMR  1443



>ref|XP_002519423.1| ATSMC2, putative [Ricinus communis]
 gb|EEF42837.1| ATSMC2, putative [Ricinus communis]
Length=1306

 Score =   288 bits (738),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 250/691 (36%), Positives = 400/691 (58%), Gaps = 56/691 (8%)
 Frame = +1

Query  2530  TGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMREEMM  2703
              G L ++  ++ L+  +R+L  K    Q     +E++ME V  E D      +++++++ 
Sbjct  660   AGLLSKEEQIENLHRYQRELEEKFSSLQKEKSQLEENMEIVSGESDIAMKCMNALQKDLT  719

Query  2704  VVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTD  2880
             V++  +  ++S  K+ E K  E+E+ K+ELE  + ELE+EN +LS  ++ +EAQ+R+ TD
Sbjct  720   VLSSSVNNHVSANKVLERKTSEIESSKRELEIHLSELEQENEELSACIAVMEAQIRNLTD  779

Query  2881  AMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKK  3060
               E   +EL++  +    +QDEI  L  + E+Q+ + KQ+L EM+ RW +++EE E+L+ 
Sbjct  780   DRESIELELENSKSNAVIIQDEIARLRNETETQKRDAKQKLEEMKNRWSEAEEELEHLRS  839

Query  3061  ANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIES  3240
             ANPKLQATAESL+EEC  LQ  NGEL+ ++LEL+ QCN LE +LR+   S S C  R+  
Sbjct  840   ANPKLQATAESLMEECSLLQKSNGELKMRKLELEGQCNHLETKLRESHRSFSDCSKRVSV  899

Query  3241  LEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQ  3420
             L+  + S+LE+++SKE+ ++SEL+ +L + ++  ++L    S+ +++   K+  +E  QQ
Sbjct  900   LQESICSLLEQSASKERSLSSELDALLKENEKQNKKL----SVVNEMYMEKMVLVENLQQ  955

Query  3421  KSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQM  3600
             +   L  ++    +  +   S+ ++E+  L              ++N+   E +L T  +
Sbjct  956   EIGDLTKKLSATQNERERITSDAANEVSKL--------------RENVAKVESELNTVNI  1001

Query  3601  EYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllses  3780
             E++ K+  L  EL + K +Q +L+A + K+ + LEN  S E N K  ++ LE  L +SE 
Sbjct  1002  EFKIKIQGLTNELASSKESQEMLKADNGKMLKLLENYRSREENFKTTLNGLELNLTVSEY  1061

Query  3781  erlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKAD  3960
             ER QL +   +LK +L KI  L DEVLALK  L  +K + E+L  SL+L   E EELK +
Sbjct  1062  ERQQLMEECKNLKAQLQKIESLEDEVLALKNELKAIKSEKEKLGTSLRLKSEECEELKTE  1121

Query  3961  KTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSK  4140
             K   I ++T +Q  V+ELE+C+  K  L+EK+ +LE DL A+E +C +DAELKN L + K
Sbjct  1122  KILCIDKITELQKEVSELEDCKQDKFALQEKLQQLESDLIAKEALCEQDAELKNQLNRIK  1181

Query  4141  RVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSK  4320
             R N QL+ + +QLE E+       QS++EEL             + KDK  S +E +   
Sbjct  1182  RTNKQLQQQHQQLEEEKQKCRTRAQSLEEEL------------IMMKDKQRSLRESRSVN  1229

Query  4321  ARSSQCNNCETIQIVTIDDCSSRCQVGDD-KTQFKSLQPEGQSTRSGNENEQKISQLEAE  4497
             + S+Q +  E ++    D+ S   +V +  K Q K L  E                 EAE
Sbjct  1230  SISNQ-HQRELLE----DEVSKSVEVNNGYKPQVKRLTSE-----------------EAE  1267

Query  4498  LKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             L++I ERY HMSLKYAEVE ++ +LVM LKA
Sbjct  1268  LRDIRERYFHMSLKYAEVEEEREELVMKLKA  1298


 Score =   181 bits (458),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/185 (48%), Positives = 123/185 (66%), Gaps = 10/185 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L  HK+  +  SG++  F FS  +  QVPKGWDKL VS+ISVE GKTI+K  KA+V 
Sbjct  1    MFRL--HKTKPAAKSGERIDFKFSQFKVHQVPKGWDKLFVSVISVETGKTIAKTSKAAVK  58

Query  241  NGTCQW----TESLW--SPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSE  396
            NG CQW    +ES+W  S +  +S  L+   +K LV+MGS+R+G+LGEA +N+  Y NS 
Sbjct  59   NGNCQWIDTVSESIWIASQDGQSSKELEDCPYKLLVAMGSARSGMLGEAILNMATYMNSS  118

Query  397  ASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEER  576
             S+PVS PL+KCN GT+L  +I+C+TPRT+ R  E   T +  E+ ++     + KSEE 
Sbjct  119  DSVPVSFPLKKCNHGTILQLKIQCVTPRTNIRDAESKGTNSSKEDIDADSKNSEIKSEES  178

Query  577  NNSLP  591
            +NS+ 
Sbjct  179  DNSIA  183


 Score =   137 bits (344),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 119/174 (68%), Gaps = 5/174 (3%)
 Frame = +1

Query  799   EEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRI  963
             +E    SL I+ +S       +  IEEL+ EA+MWE NAR+LM+ +E +RKE++ QS+  
Sbjct  287   QEFAALSLKISDSSKSLLEAAEDTIEELRGEAKMWERNARKLMLDLELVRKEYSEQSKNQ  346

Query  964   ADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELK  1143
              ++ +ELS A  E + L  ++++L++LLE++  K    E+L LQ      I+KE+E+E+K
Sbjct  347   LNLAIELSAACAERDGLQKEVEQLKLLLEKTMKKPSGLEDLELQDTGVNRIIKELENEIK  406

Query  1144  FQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVM  1305
             +Q ESN+NL+LQL +SQESNAELVSVLQE+E TV+K+K EI+N  A     D++
Sbjct  407   YQKESNANLTLQLNRSQESNAELVSVLQELEATVEKQKAEIKNDQAAEKNQDLV  460



>ref|XP_007027522.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY08024.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 2 [Theobroma cacao]
Length=1296

 Score =   285 bits (729),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 249/689 (36%), Positives = 403/689 (58%), Gaps = 40/689 (6%)
 Frame = +1

Query  2629  VEKDMEKVQTEKDDITS--DSMREEMMVVTGRIFGNISE-KIQEMKILELENEKQELESC  2799
             +E  ++ +Q E D  T   D +R +MMV+   +  + S  KI E K  ELE  K ELE  
Sbjct  610   LEDKLDVLQGESDIATKCLDDLRNDMMVLRSSMDSDDSAYKILESKSSELERVKHELEMH  669

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             + ELE EN QLS R+S LEAQL    D  + SRM+L+   +   +L+DEI     + E Q
Sbjct  670   LLELEDENKQLSLRLSLLEAQLEDLKDERDSSRMQLEDSKSLATSLKDEIARSRNEMEPQ  729

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
             + +++++L +   +WL SQ++ EYL++AN KLQATAE+LIEEC++ Q   GELR+++L+L
Sbjct  730   KTDMEEKLQDKHVQWLASQDKCEYLRRANTKLQATAETLIEECNAHQKSAGELRKEKLKL  789

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
                C  LEA+L+    +L  C  +IE LE  L+ ++E+ + K + +  EL+ I  + K+ 
Sbjct  790   DEHCAHLEAKLKDSDKNLIDCSKKIEVLEKNLTLMMEKFAHKGESLTLELDSIHDKNKKL  849

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             +  L  +ES  +QL   K +E+E  +Q+  +L  Q+      ++  A++  H++  L  +
Sbjct  850   EAELRREESSWNQLYLEKTNEVENIRQEVENLAMQLSATHHEKEKTANDALHQISGLRVD  909

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
                L+  L+E +   + TE +L   Q E + K+ +L+ EL A + NQ +L  + +K  + 
Sbjct  910   KVRLESALEEAESKTKCTENELKKLQTEDKTKMEDLLDELAASRENQEILMTEHEKALKL  969

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
             LE+  SSE  LK  +++LE KL +SE +R  +++ +S++K++LLKI  L++ +LAL+   
Sbjct  970   LESYKSSEGKLKTFVNDLELKLTVSEYDRQLVSEQSSNMKVQLLKIENLQENILALRDER  1029

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             N +K   E+LEASL+++ GE  +LKA+K S++++++ +Q  V+ELE+ + + V LEEK++
Sbjct  1030  NAIKSDKEKLEASLRIVSGECSDLKAEKNSIVEQISTLQKVVSELEDYKHKNVALEEKLV  1089

Query  4060  RLEGDLTAREVMCAKDAELKNDLTQSKRVNSQ--------------LRWKIKQLELERYY  4197
             ++EGDLT +E +  +DAELKN+L Q KR N Q              L  K + LE E+  
Sbjct  1090  KMEGDLTVKEALLTQDAELKNELHQIKRTNRQFQQQIEQLQEENDGLLIKAQTLE-EKLK  1148

Query  4198  LSKELQSVQEELN-------RKENSVP----SPSHSVAKDKTTSCK--EQKLSKARSSQC  4338
             L  E +  Q + N       R++N+      SP H+V  D  +  +  E +L+KA   + 
Sbjct  1149  LKAEEKQKQRQSNSHRNQHKREDNNYDFHDGSP-HAVGVDPVSKIQLLENELAKAM--EA  1205

Query  4339  NNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNENEQKISQLEAELKEISER  4518
             NN   +++  +    S  +     T  KS   EG+   +  + E+  S LEAEL++I ER
Sbjct  1206  NNKYKVRLNRL----SEGRKNQSNTPKKS-AIEGEVV-AKEKYERTKSSLEAELRDIRER  1259

Query  4519  YLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             YLHMSLKYAEVE Q+ +LVM L+ ++  R
Sbjct  1260  YLHMSLKYAEVEAQREELVMKLRGVKSMR  1288


 Score =   168 bits (426),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 122/353 (35%), Positives = 191/353 (54%), Gaps = 62/353 (18%)
 Frame = +1

Query  382   YRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDN  561
             Y +S A +PVSLPL+KCN GT L  +I CLTPR     +E   T ++ EE N+  + +  
Sbjct  4     YISSTAVVPVSLPLKKCNHGTNLLVKIHCLTPRLKLMDEEAKQTNSHGEENNTDPSHMSF  63

Query  562   KSE--------------------------------ERNNSLPSMEDSLGRDSLssasnss  645
              S+                                + ++S  S E S+GR+S S+ SN S
Sbjct  64    NSDGPESVESPPSQDLVSAPHQGELESREASFSTSDSHHSYDSAESSIGRESFSTVSNLS  123

Query  646   avvnnaIRRLESTESGGSAPWssysygspksnnspnklsisCQEKHPEY-----------  792
                 N I+R +S  S  S P  +     P             Q   P +           
Sbjct  124   GDAQNLIQRRDSPTSQNSLPLGNCHLDDP------------SQSNDPSFDSQIMGSESTF  171

Query  793   --TEEEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQ  951
                ++E+   SL +T +S       +  IEEL AEA+MWE  A +LM+ ++ LRKE  +Q
Sbjct  172   LDNQQELSASSLRVTDSSKNLLEAAEKTIEELHAEAKMWERKAEKLMLDLDILRKEHFDQ  231

Query  952   SQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEME  1131
             S+  A++ MELS A+TE + L  +++++++LLE+S AKQ   E+ +++ +   +I KE+E
Sbjct  232   SKNQANLTMELSAANTERDGLRKEVEQMKLLLEKSMAKQTTLEDSSVRDEGVTHIQKELE  291

Query  1132  DELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNS  1290
             +E+ FQ ESN NLSLQL++SQ++N ELVSV QE+E T++K+++++EN+ +L S
Sbjct  292   NEIGFQKESNDNLSLQLKRSQDANIELVSVFQELEGTIEKQRVDMENISSLQS  344



>ref|XP_010067188.1| PREDICTED: sporulation-specific protein 15-like isoform X2 [Eucalyptus 
grandis]
Length=1338

 Score =   283 bits (724),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 220/582 (38%), Positives = 333/582 (57%), Gaps = 60/582 (10%)
 Frame = +1

Query  2557  LKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKD-DITSDSMREEMMVVTGRIFGNI  2733
             +K L H +++L  ++ + +     V+  M+  +   D D +   + E  MV    +   +
Sbjct  657   VKTLQHLQKELETQLCNFEQENSKVDNKMKGTERGSDSDCSFCPLHEGKMVHASSMGPQV  716

Query  2734  SEKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQH  2913
             S      K  ELE EK ELE  + ELE+EN++LSER+ GLEAQL++ TD  E SR+ +Q 
Sbjct  717   SADKVIGKWSELEGEKNELEIHLSELEEENVRLSERICGLEAQLQYLTDERESSRLAIQF  776

Query  2914  KGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAES  3093
               +Q  N Q  I++LE + E+Q++  KQRL E+ K+ L++QEE +YLK AN K+QATAE+
Sbjct  777   SESQSSNFQSVIKKLEIEMEAQKVTAKQRLQEIHKQLLEAQEECKYLKVANMKVQATAEN  836

Query  3094  LIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEE  3273
             LIEEC SLQ LNGELR+Q +EL  +   LEAEL +   +     + IE LE K  S+LEE
Sbjct  837   LIEECSSLQKLNGELRKQNIELHERITFLEAELAESNEAFPHLSNEIEVLEEKFDSLLEE  896

Query  3274  TSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFD  3453
             ++ KEK +NSEL  +LL+ +   + + I+E+ ++   +    E E+P+     +VN +  
Sbjct  897   STLKEKALNSELNALLLENRRL-DNIFIREA-RTDTVKDSEEETEHPES----MVNNI--  948

Query  3454  PSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMG  3633
                                                            Q+EYE KV  L+G
Sbjct  949   -----------------------------------------------QLEYEAKVLGLIG  961

Query  3634  ELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSS  3813
             EL + K NQ VL     KL   LE+V S+ES L+    +L  KL  SE ER+QL +  S 
Sbjct  962   ELASSKQNQEVLIDGHHKLITLLEDVKSNESKLRNAARSLAMKLKASEYERVQLLEEISC  1021

Query  3814  LKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGM  3993
             LK++L KI  L++EVLALK ++++  F+ ERLE S  ++  + EE+K ++ S +++++ +
Sbjct  1022  LKVQLQKIELLQNEVLALKKTISETTFEKERLETSHHVLLADFEEMKVERESFVEKISTI  1081

Query  3994  QNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIK  4173
             Q +++ELEEC+  KV L+E++LRLEGDLTARE + A++AELKN++ + KR  SQL+ + K
Sbjct  1082  QKALSELEECKHAKVALQERILRLEGDLTAREALFAQEAELKNEVARMKRSYSQLQRRTK  1141

Query  4174  QLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSC  4299
              LE E+    K  Q+VQE++      +    + V K   TSC
Sbjct  1142  CLEEEKEECQKSAQAVQEQVKH----MKEMGYDVYKPGNTSC  1179


 Score =   145 bits (366),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             +  +EEL+AEARMWE NA++LMV +E L++E  NQS+    +++ELS + TE + L  +I
Sbjct  83    EVTVEELRAEARMWEKNAQKLMVDIEKLQRESLNQSEHQETLKLELSASRTECHSLKQEI  142

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             +R ++LLE+   KQ A ++L LQ K  +N+ KE+E+E+KFQ E+N+NL+LQL+K+Q+SN 
Sbjct  143   ERQKILLEDLMMKQTAMDSLKLQEKGADNLQKELEEEIKFQKETNANLALQLKKTQDSNI  202

Query  1207  ELVSVLQEMEETVQKKKIEIENLLALNS  1290
             ELVSVLQEME+T++K+K+EI +LL+  S
Sbjct  203   ELVSVLQEMEDTIEKQKMEIADLLSAKS  230



>gb|KCW65270.1| hypothetical protein EUGRSUZ_G02735 [Eucalyptus grandis]
Length=1167

 Score =   281 bits (719),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 220/582 (38%), Positives = 333/582 (57%), Gaps = 60/582 (10%)
 Frame = +1

Query  2557  LKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKD-DITSDSMREEMMVVTGRIFGNI  2733
             +K L H +++L  ++ + +     V+  M+  +   D D +   + E  MV    +   +
Sbjct  560   VKTLQHLQKELETQLCNFEQENSKVDNKMKGTERGSDSDCSFCPLHEGKMVHASSMGPQV  619

Query  2734  SEKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQH  2913
             S      K  ELE EK ELE  + ELE+EN++LSER+ GLEAQL++ TD  E SR+ +Q 
Sbjct  620   SADKVIGKWSELEGEKNELEIHLSELEEENVRLSERICGLEAQLQYLTDERESSRLAIQF  679

Query  2914  KGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAES  3093
               +Q  N Q  I++LE + E+Q++  KQRL E+ K+ L++QEE +YLK AN K+QATAE+
Sbjct  680   SESQSSNFQSVIKKLEIEMEAQKVTAKQRLQEIHKQLLEAQEECKYLKVANMKVQATAEN  739

Query  3094  LIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEE  3273
             LIEEC SLQ LNGELR+Q +EL  +   LEAEL +   +     + IE LE K  S+LEE
Sbjct  740   LIEECSSLQKLNGELRKQNIELHERITFLEAELAESNEAFPHLSNEIEVLEEKFDSLLEE  799

Query  3274  TSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFD  3453
             ++ KEK +NSEL  +LL+ +   + + I+E+ ++   +    E E+P+     +VN +  
Sbjct  800   STLKEKALNSELNALLLENRRL-DNIFIREA-RTDTVKDSEEETEHPES----MVNNI--  851

Query  3454  PSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMG  3633
                                                            Q+EYE KV  L+G
Sbjct  852   -----------------------------------------------QLEYEAKVLGLIG  864

Query  3634  ELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSS  3813
             EL + K NQ VL     KL   LE+V S+ES L+    +L  KL  SE ER+QL +  S 
Sbjct  865   ELASSKQNQEVLIDGHHKLITLLEDVKSNESKLRNAARSLAMKLKASEYERVQLLEEISC  924

Query  3814  LKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGM  3993
             LK++L KI  L++EVLALK ++++  F+ ERLE S  ++  + EE+K ++ S +++++ +
Sbjct  925   LKVQLQKIELLQNEVLALKKTISETTFEKERLETSHHVLLADFEEMKVERESFVEKISTI  984

Query  3994  QNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIK  4173
             Q +++ELEEC+  KV L+E++LRLEGDLTARE + A++AELKN++ + KR  SQL+ + K
Sbjct  985   QKALSELEECKHAKVALQERILRLEGDLTAREALFAQEAELKNEVARMKRSYSQLQRRTK  1044

Query  4174  QLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSC  4299
              LE E+    K  Q+VQE++      +    + V K   TSC
Sbjct  1045  CLEEEKEECQKSAQAVQEQVKH----MKEMGYDVYKPGNTSC  1082


 Score =   145 bits (366),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             +  +EEL+AEARMWE NA++LMV +E L++E  NQS+    +++ELS + TE + L  +I
Sbjct  18    EVTVEELRAEARMWEKNAQKLMVDIEKLQRESLNQSEHQETLKLELSASRTECHSLKQEI  77

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             +R ++LLE+   KQ A ++L LQ K  +N+ KE+E+E+KFQ E+N+NL+LQL+K+Q+SN 
Sbjct  78    ERQKILLEDLMMKQTAMDSLKLQEKGADNLQKELEEEIKFQKETNANLALQLKKTQDSNI  137

Query  1207  ELVSVLQEMEETVQKKKIEIENLLALNS  1290
             ELVSVLQEME+T++K+K+EI +LL+  S
Sbjct  138   ELVSVLQEMEDTIEKQKMEIADLLSAKS  165



>gb|KCW65268.1| hypothetical protein EUGRSUZ_G02735 [Eucalyptus grandis]
Length=1241

 Score =   281 bits (720),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 220/582 (38%), Positives = 333/582 (57%), Gaps = 60/582 (10%)
 Frame = +1

Query  2557  LKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKD-DITSDSMREEMMVVTGRIFGNI  2733
             +K L H +++L  ++ + +     V+  M+  +   D D +   + E  MV    +   +
Sbjct  560   VKTLQHLQKELETQLCNFEQENSKVDNKMKGTERGSDSDCSFCPLHEGKMVHASSMGPQV  619

Query  2734  SEKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQH  2913
             S      K  ELE EK ELE  + ELE+EN++LSER+ GLEAQL++ TD  E SR+ +Q 
Sbjct  620   SADKVIGKWSELEGEKNELEIHLSELEEENVRLSERICGLEAQLQYLTDERESSRLAIQF  679

Query  2914  KGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAES  3093
               +Q  N Q  I++LE + E+Q++  KQRL E+ K+ L++QEE +YLK AN K+QATAE+
Sbjct  680   SESQSSNFQSVIKKLEIEMEAQKVTAKQRLQEIHKQLLEAQEECKYLKVANMKVQATAEN  739

Query  3094  LIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEE  3273
             LIEEC SLQ LNGELR+Q +EL  +   LEAEL +   +     + IE LE K  S+LEE
Sbjct  740   LIEECSSLQKLNGELRKQNIELHERITFLEAELAESNEAFPHLSNEIEVLEEKFDSLLEE  799

Query  3274  TSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFD  3453
             ++ KEK +NSEL  +LL+ +   + + I+E+ ++   +    E E+P+     +VN +  
Sbjct  800   STLKEKALNSELNALLLENRRL-DNIFIREA-RTDTVKDSEEETEHPES----MVNNI--  851

Query  3454  PSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMG  3633
                                                            Q+EYE KV  L+G
Sbjct  852   -----------------------------------------------QLEYEAKVLGLIG  864

Query  3634  ELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSS  3813
             EL + K NQ VL     KL   LE+V S+ES L+    +L  KL  SE ER+QL +  S 
Sbjct  865   ELASSKQNQEVLIDGHHKLITLLEDVKSNESKLRNAARSLAMKLKASEYERVQLLEEISC  924

Query  3814  LKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGM  3993
             LK++L KI  L++EVLALK ++++  F+ ERLE S  ++  + EE+K ++ S +++++ +
Sbjct  925   LKVQLQKIELLQNEVLALKKTISETTFEKERLETSHHVLLADFEEMKVERESFVEKISTI  984

Query  3994  QNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIK  4173
             Q +++ELEEC+  KV L+E++LRLEGDLTARE + A++AELKN++ + KR  SQL+ + K
Sbjct  985   QKALSELEECKHAKVALQERILRLEGDLTAREALFAQEAELKNEVARMKRSYSQLQRRTK  1044

Query  4174  QLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSC  4299
              LE E+    K  Q+VQE++      +    + V K   TSC
Sbjct  1045  CLEEEKEECQKSAQAVQEQVKH----MKEMGYDVYKPGNTSC  1082


 Score =   145 bits (365),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             +  +EEL+AEARMWE NA++LMV +E L++E  NQS+    +++ELS + TE + L  +I
Sbjct  18    EVTVEELRAEARMWEKNAQKLMVDIEKLQRESLNQSEHQETLKLELSASRTECHSLKQEI  77

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             +R ++LLE+   KQ A ++L LQ K  +N+ KE+E+E+KFQ E+N+NL+LQL+K+Q+SN 
Sbjct  78    ERQKILLEDLMMKQTAMDSLKLQEKGADNLQKELEEEIKFQKETNANLALQLKKTQDSNI  137

Query  1207  ELVSVLQEMEETVQKKKIEIENLLALNS  1290
             ELVSVLQEME+T++K+K+EI +LL+  S
Sbjct  138   ELVSVLQEMEDTIEKQKMEIADLLSAKS  165



>ref|XP_010067187.1| PREDICTED: sporulation-specific protein 15-like isoform X1 [Eucalyptus 
grandis]
Length=1525

 Score =   283 bits (724),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 220/582 (38%), Positives = 333/582 (57%), Gaps = 60/582 (10%)
 Frame = +1

Query  2557  LKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKD-DITSDSMREEMMVVTGRIFGNI  2733
             +K L H +++L  ++ + +     V+  M+  +   D D +   + E  MV    +   +
Sbjct  844   VKTLQHLQKELETQLCNFEQENSKVDNKMKGTERGSDSDCSFCPLHEGKMVHASSMGPQV  903

Query  2734  SEKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQH  2913
             S      K  ELE EK ELE  + ELE+EN++LSER+ GLEAQL++ TD  E SR+ +Q 
Sbjct  904   SADKVIGKWSELEGEKNELEIHLSELEEENVRLSERICGLEAQLQYLTDERESSRLAIQF  963

Query  2914  KGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAES  3093
               +Q  N Q  I++LE + E+Q++  KQRL E+ K+ L++QEE +YLK AN K+QATAE+
Sbjct  964   SESQSSNFQSVIKKLEIEMEAQKVTAKQRLQEIHKQLLEAQEECKYLKVANMKVQATAEN  1023

Query  3094  LIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEE  3273
             LIEEC SLQ LNGELR+Q +EL  +   LEAEL +   +     + IE LE K  S+LEE
Sbjct  1024  LIEECSSLQKLNGELRKQNIELHERITFLEAELAESNEAFPHLSNEIEVLEEKFDSLLEE  1083

Query  3274  TSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFD  3453
             ++ KEK +NSEL  +LL+ +   + + I+E+ ++   +    E E+P+     +VN +  
Sbjct  1084  STLKEKALNSELNALLLENRRL-DNIFIREA-RTDTVKDSEEETEHPES----MVNNI--  1135

Query  3454  PSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMG  3633
                                                            Q+EYE KV  L+G
Sbjct  1136  -----------------------------------------------QLEYEAKVLGLIG  1148

Query  3634  ELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSS  3813
             EL + K NQ VL     KL   LE+V S+ES L+    +L  KL  SE ER+QL +  S 
Sbjct  1149  ELASSKQNQEVLIDGHHKLITLLEDVKSNESKLRNAARSLAMKLKASEYERVQLLEEISC  1208

Query  3814  LKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGM  3993
             LK++L KI  L++EVLALK ++++  F+ ERLE S  ++  + EE+K ++ S +++++ +
Sbjct  1209  LKVQLQKIELLQNEVLALKKTISETTFEKERLETSHHVLLADFEEMKVERESFVEKISTI  1268

Query  3994  QNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIK  4173
             Q +++ELEEC+  KV L+E++LRLEGDLTARE + A++AELKN++ + KR  SQL+ + K
Sbjct  1269  QKALSELEECKHAKVALQERILRLEGDLTAREALFAQEAELKNEVARMKRSYSQLQRRTK  1328

Query  4174  QLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSC  4299
              LE E+    K  Q+VQE++      +    + V K   TSC
Sbjct  1329  CLEEEKEECQKSAQAVQEQVKH----MKEMGYDVYKPGNTSC  1366


 Score =   158 bits (399),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 118/178 (66%), Gaps = 16/178 (9%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L + KS   D   ++F F  SN++ALQVPKGWDKLS+S+ISV+ GKTI +L K  V 
Sbjct  1    MFRLHKQKS---DELRERFDFQLSNLKALQVPKGWDKLSLSIISVDTGKTIKRLEKVPVW  57

Query  241  NGTCQWTESL--------WSPENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSE  396
            NG CQW+E++        +         L  FKF+V+MGSSR+ ILGEA++N+ +Y +S+
Sbjct  58   NGNCQWSETISKSILISKYDGPKDVEGCL--FKFVVTMGSSRSSILGEASINLANYISSK  115

Query  397  ASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSE  570
            AS+ VSL L+KCN+GT+L  +I CLTP+   R D  +S ++ +E      + +DNKS+
Sbjct  116  ASVLVSLQLKKCNQGTILQMKIHCLTPK--MRDDWKDSNSSLDEASIDY-DDVDNKSD  170


 Score =   145 bits (367),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             +  +EEL+AEARMWE NA++LMV +E L++E  NQS+    +++ELS + TE + L  +I
Sbjct  270   EVTVEELRAEARMWEKNAQKLMVDIEKLQRESLNQSEHQETLKLELSASRTECHSLKQEI  329

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             +R ++LLE+   KQ A ++L LQ K  +N+ KE+E+E+KFQ E+N+NL+LQL+K+Q+SN 
Sbjct  330   ERQKILLEDLMMKQTAMDSLKLQEKGADNLQKELEEEIKFQKETNANLALQLKKTQDSNI  389

Query  1207  ELVSVLQEMEETVQKKKIEIENLLALNS  1290
             ELVSVLQEME+T++K+K+EI +LL+  S
Sbjct  390   ELVSVLQEMEDTIEKQKMEIADLLSAKS  417



>ref|XP_010908043.1| PREDICTED: myosin heavy chain, skeletal muscle-like [Elaeis guineensis]
Length=1645

 Score =   278 bits (712),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 213/584 (36%), Positives = 351/584 (60%), Gaps = 5/584 (1%)
 Frame = +1

Query  2503  KNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS-  2679
             +NSKM E+K   L ++  +  L H +R+L + I++ Q     +E+D+     E   +TS 
Sbjct  791   RNSKMEELKVEMLLKEQEIDILKHSKRELEDIIFNLQNDKGQLEEDLAIAHGECS-VTSK  849

Query  2680  --DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSG  2850
               + +  ++M +T  I  ++S  K+ E K +ELE+ K+ELE  + E+E++N+QLSE +SG
Sbjct  850   YLEDVHHDLMELTSTIDSHMSANKMLERKSIELESYKKELELHISEMEQQNVQLSEHISG  909

Query  2851  LEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLD  3030
             LEAQLRH T+  EL+R+EL+   + + +L+D+I + E   E+Q +ELKQ+L E QK+  +
Sbjct  910   LEAQLRHLTNENELTRLELEDSRSLIMDLEDKIEKKESKMETQNVELKQKLQESQKQLFE  969

Query  3031  SQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHS  3210
              QEESE L++++ KLQ+  ESLIEEC SLQ L  +LR ++LE   +   LE  L + Q  
Sbjct  970   VQEESEVLRRSHSKLQSMVESLIEECSSLQKLTEDLRGEKLESHERITHLEVALDESQAK  1029

Query  3211  LSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQH  3390
              S    R+E LE +LSS+  + +SKEK++ SELE I  + KE +E L     + +++   
Sbjct  1030  SSYFRKRVEFLEVELSSLQNDIASKEKLLLSELESIFQEHKEHEEGLRQAHIMLNKIQSE  1089

Query  3391  KLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEI  3570
             K  E+E  +++  HL   +    D ++  A + +HE+  L ++   L+ +LQE+ + +++
Sbjct  1090  KAVEVENLEREFAHLTALLSSKHDEQERAALDAAHEVSCLQSDKAKLECSLQEVNEKVKL  1149

Query  3571  TEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDN  3750
              E ++ T + + +  V  L+  LNA K ++ +L      +QR LE+  SSE   + +   
Sbjct  1150  YETEVQTIRQDSKNMVQGLVDLLNASKQSEEMLMTDIKHMQRLLEDAKSSEEKFRNMAKE  1209

Query  3751  lesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLI  3930
             L+ K+  S+ E+ Q  +  S L ++L KI+ L+DE+L LK SL++ KF+  +LE  LQ +
Sbjct  1210  LKLKIKASDYEKQQTVEEISGLNVQLQKISHLQDEILVLKTSLDEAKFERGKLEELLQSL  1269

Query  3931  CGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDA  4110
               E EELK +K SL +++  MQ ++ + E+ R  ++ LEEK+LRLE  LTA+E   A + 
Sbjct  1270  TEECEELKTEKVSLKKKVADMQKALYDGEDDRCSRIALEEKLLRLESSLTAQEASYAYED  1329

Query  4111  ELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRK  4242
             ELKN+L   KR N   + +I+ LE E+  L ++ Q ++ EL  K
Sbjct  1330  ELKNELHAVKRTNKVYQREIQSLEQEKDELMRKTQLIERELMMK  1373


 Score =   152 bits (383),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 114/181 (63%), Gaps = 11/181 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RHK    D   D+  F FSN +A QVP+GW+KL +S+ISVE GK I+K  K +V 
Sbjct  1    MFKLHRHKF---DRLDDRVEFTFSNFEAFQVPRGWEKLFLSIISVETGKAIAKSSKTTVR  57

Query  241  NGTCQW----TESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             GTCQW    +ES+   ++ AS  L+   FK +VSMGS+R+GILGE  +N+  Y +S  S
Sbjct  58   GGTCQWAETLSESILVSQDDASKELEECQFKIVVSMGSARSGILGEVVLNLSDYLSSRDS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFR-GDEVNSTAAYNEEENSVCNGIDNKSEERN  579
             P+SL L KCN GT+L   I+C T ++  R G+    T+   ++ N+  + +DNK +E +
Sbjct  118  GPLSLSLNKCNYGTILQLRIQCATIKSKSRDGNSWGETSCL-QDLNTNNDDMDNKLDESD  176

Query  580  N  582
            N
Sbjct  177  N  177



>ref|XP_008649896.1| PREDICTED: myosin-11-like [Zea mays]
Length=1372

 Score =   270 bits (691),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 229/670 (34%), Positives = 380/670 (57%), Gaps = 42/670 (6%)
 Frame = +1

Query  2650  VQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEK  2817
             V  ++  ITS   D +R++++V++  I  ++S  K+ E  I+ELE+ K ELE  V ELE+
Sbjct  725   VSLKESSITSKCLDEVRKDILVLSSSIDSHVSANKVLERNIIELESCKAELELHVSELEQ  784

Query  2818  ENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQ  2997
             EN++LSER+SGLEAQL + T+  E S +++    + + NL+D++   + + E+Q LE KQ
Sbjct  785   ENIELSERISGLEAQLTYLTNEKESSELQIHDSRSLIINLKDKVERQQSEMETQRLEFKQ  844

Query  2998  RLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNL  3177
             +  E Q+R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L+RQ+LE+      
Sbjct  845   KQQESQRRLSETQDDSEVLRRSNSKLQSTVESLIEECSSLQNLTADLKRQKLEMHGHLTQ  904

Query  3178  LEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVI  3357
              E EL + +         +E LEAKLSS+ ++ SSKE+ + SELE I  +  E +ER+  
Sbjct  905   KEQELDESKKRNFEFSKTVEFLEAKLSSLHKDVSSKEQSLLSELESIFQEHMEQEERINR  964

Query  3358  KESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKL  3537
                + +++ + K  E+E  +++   L  Q+    +  +    +   E+  L A+   L+ 
Sbjct  965   AHFMLNKIEKEKTLEVENLKREVVSLTAQVSSTHEERESATLDAIREVSVLRADKAKLEA  1024

Query  3538  TLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVIS  3717
              LQ++   L   E +L   + E + K+  L+  LNA K ++ +L + ++ +++ +E   S
Sbjct  1025  NLQDVSTQLRHYESQLEDLRKESKNKIKGLVDSLNASKQSEEMLTSDAEHMKKLMEAARS  1084

Query  3718  SESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFK  3897
             +E  L+   + LE KL  S+ E+ Q+ +  S LK+++ KI  L+DEV  L+ SL++ KF 
Sbjct  1085  NEDTLRKTSNELELKLKSSDYEKQQMLEEISGLKLQVQKIMNLQDEVFKLQSSLDEAKFG  1144

Query  3898  NERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDL  4077
               +LE  L+ +  E EELKA K  L  +++ MQ ++   EE +  ++ ++ K++RLE DL
Sbjct  1145  KGKLEEILRSVTEECEELKAQKAMLTDKVSDMQETLRNGEEEKRNRIAMQAKLVRLESDL  1204

Query  4078  TAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQS----------VQE  4227
             +A E     +AELKN+L++ KR NS+ + KI+ LE E   L++ +Q+          V+E
Sbjct  1205  SASEASHVHEAELKNELSRIKRSNSEYQRKIQSLEQENEDLTRRVQTMEKGFEQMSHVKE  1264

Query  4228  ELNRKENSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDD  4407
              L ++E       +  A        E KL++A        E  ++               
Sbjct  1265  NLGKQE---LGGDNQAAIQSKIELLETKLAEA-------LEENKMY--------------  1300

Query  4408  KTQFKSLQPEGQSTRSGNE----NEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLV  4575
             + Q KS  PEGQ +    +    N  +I QLE EL+++ ER L+MSL+YAEVE Q+ +LV
Sbjct  1301  RAQQKSPMPEGQPSAGAGDGKEGNTDRILQLEGELRDMKERLLNMSLQYAEVEAQRERLV  1360

Query  4576  MTLKALQDQR  4605
             M LKA++  R
Sbjct  1361  MELKAMKKGR  1370


 Score =   134 bits (337),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 99/151 (66%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G++F F FSN +A+QVP   D+L +S++SV++G+TI+K  K +  
Sbjct  1    MFKLHRHRSS--DRVGERFDFRFSNFRAVQVPAVSDRLFLSIVSVDSGRTIAKSSKVASR  58

Query  241  NGTCQWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW +++  P  ++ + +        +K +VS+GS+++GILGE  +N+ ++ N    
Sbjct  59   SGICQWPDTILEPIWFSKDEVSKEFEDCQYKIIVSLGSTKSGILGEIFLNLSNFLNIVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL++CN GTVL  +++CL  ++   G
Sbjct  119  TAISLPLKRCNAGTVLQLKVQCLGTKSKLSG  149


 Score =   100 bits (248),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 102/150 (68%), Gaps = 6/150 (4%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A++  ELS A  E +   H+I+ L
Sbjct  316   IEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQHAELAGELSAAQAERDSYRHEIEEL  375

Query  1036  EVLLEESNAKQIAAENLNLQAKNTE--NILKEMEDELKFQTESNSNLSLQLRKSQESNAE  1209
             +  L++ N +Q     +    K ++  ++ KE+E E+KF  ESN++L++QL ++QESN E
Sbjct  376   KSSLQDVNTRQ----TITGTPKRSDWIDLQKELEGEVKFLRESNADLTIQLNRTQESNIE  431

Query  1210  LVSVLQEMEETVQKKKIEIENLLALNSRSD  1299
             L+S+LQE+EET++++++EI  +  +   +D
Sbjct  432   LLSILQELEETIEEQRVEISKISKVKQTAD  461



>tpg|DAA42840.1| TPA: hypothetical protein ZEAMMB73_571212 [Zea mays]
 tpg|DAA42841.1| TPA: hypothetical protein ZEAMMB73_571212 [Zea mays]
Length=1351

 Score =   268 bits (684),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 227/660 (34%), Positives = 373/660 (57%), Gaps = 43/660 (7%)
 Frame = +1

Query  2650  VQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEK  2817
             V  ++  ITS   D +R++++V++  I  ++S  K+ E  I+ELE+ K ELE  V ELE+
Sbjct  725   VSLKESSITSKCLDEVRKDILVLSSSIDSHVSANKVLERNIIELESCKAELELHVSELEQ  784

Query  2818  ENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQ  2997
             EN++LSER+SGLEAQL + T+  E S +++    + + NL+D++   + + E+Q LE KQ
Sbjct  785   ENIELSERISGLEAQLTYLTNEKESSELQIHDSRSLIINLKDKVERQQSEMETQRLEFKQ  844

Query  2998  RLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNL  3177
             +  E Q+R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L+RQ+LE+      
Sbjct  845   KQQESQRRLSETQDDSEVLRRSNSKLQSTVESLIEECSSLQNLTADLKRQKLEMHGHLTQ  904

Query  3178  LEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVI  3357
              E EL + +         +E LEAKLSS+ ++ SSKE+ + SELE I  +  E +ER+  
Sbjct  905   KEQELDESKKRNFEFSKTVEFLEAKLSSLHKDVSSKEQSLLSELESIFQEHMEQEERINR  964

Query  3358  KESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKL  3537
                + +++ + K  E+E  +++   L  Q+    +  +    +   E+  L A+   L+ 
Sbjct  965   AHFMLNKIEKEKTLEVENLKREVVSLTAQVSSTHEERESATLDAIREVSVLRADKAKLEA  1024

Query  3538  TLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVIS  3717
              LQ++   L   E +L   + E + K+  L+  LNA K ++ +L + ++ +++ +E   S
Sbjct  1025  NLQDVSTQLRHYESQLEDLRKESKNKIKGLVDSLNASKQSEEMLTSDAEHMKKLMEAARS  1084

Query  3718  SESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFK  3897
             +E  L+   + LE KL  S+ E+ Q+ +  S LK+++ KI  L+DEV  L+ SL++ KF 
Sbjct  1085  NEDTLRKTSNELELKLKSSDYEKQQMLEEISGLKLQVQKIMNLQDEVFKLQSSLDEAKFG  1144

Query  3898  NERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDL  4077
               +LE  L+ +  E EELKA K  L  +++ MQ ++   EE +  ++ ++ K++RLE DL
Sbjct  1145  KGKLEEILRSVTEECEELKAQKAMLTDKVSDMQETLRNGEEEKRNRIAMQAKLVRLESDL  1204

Query  4078  TAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVP  4257
             +A E     +AELKN+L++ KR NS+ + KI+ LE E            E+L R+E    
Sbjct  1205  SASEASHVHEAELKNELSRIKRSNSEYQRKIQSLEQE-----------NEDLTRRE---L  1250

Query  4258  SPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPE  4437
                +  A        E KL++A        E  ++               + Q KS  PE
Sbjct  1251  GGDNQAAIQSKIELLETKLAEA-------LEENKMY--------------RAQQKSPMPE  1289

Query  4438  GQSTRSGNE----NEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             GQ +    +    N  +I QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA++  R
Sbjct  1290  GQPSAGAGDGKEGNTDRILQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKAMKKGR  1349


 Score =   134 bits (338),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 99/151 (66%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G++F F FSN +A+QVP   D+L +S++SV++G+TI+K  K +  
Sbjct  1    MFKLHRHRSS--DRVGERFDFRFSNFRAVQVPAVSDRLFLSIVSVDSGRTIAKSSKVASR  58

Query  241  NGTCQWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW +++  P  ++ + +        +K +VS+GS+++GILGE  +N+ ++ N    
Sbjct  59   SGICQWPDTILEPIWFSKDEVSKEFEDCQYKIIVSLGSTKSGILGEIFLNLSNFLNIVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL++CN GTVL  +++CL  ++   G
Sbjct  119  TAISLPLKRCNAGTVLQLKVQCLGTKSKLSG  149


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 102/150 (68%), Gaps = 6/150 (4%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A++  ELS A  E +   H+I+ L
Sbjct  316   IEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQHAELAGELSAAQAERDSYRHEIEEL  375

Query  1036  EVLLEESNAKQIAAENLNLQAKNTE--NILKEMEDELKFQTESNSNLSLQLRKSQESNAE  1209
             +  L++ N +Q     +    K ++  ++ KE+E E+KF  ESN++L++QL ++QESN E
Sbjct  376   KSSLQDVNTRQ----TITGTPKRSDWIDLQKELEGEVKFLRESNADLTIQLNRTQESNIE  431

Query  1210  LVSVLQEMEETVQKKKIEIENLLALNSRSD  1299
             L+S+LQE+EET++++++EI  +  +   +D
Sbjct  432   LLSILQELEETIEEQRVEISKISKVKQTAD  461



>ref|XP_004986053.1| PREDICTED: myosin-11-like isoform X1 [Setaria italica]
Length=1371

 Score =   266 bits (679),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 222/655 (34%), Positives = 375/655 (57%), Gaps = 27/655 (4%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +R++++V++  I  ++S  K+ +  ++ELE+ K ELE  + ELE+EN++LSE
Sbjct  732   ITSKCLDEVRQDILVLSSSIDSHVSANKVLQRNVIELESCKAELELHISELEQENIELSE  791

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLEAQL + T+  E S +++      + NL+D++   + + ESQ LE KQ+  E Q+
Sbjct  792   RISGLEAQLTYLTNEKESSELQIHDSKALIVNLKDKVECQQSEMESQRLEFKQKQQESQR  851

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L++Q+LEL       E EL +
Sbjct  852   RLSEAQDDSEVLRRSNSKLQSTVESLIEECSSLQNLIADLKKQKLELHGHLTQKEQELDE  911

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +         +E LEAKLS++ ++ SSKE+ + SELE I  +  E +ER+   + + ++
Sbjct  912   SKKRNFDFSKTVEFLEAKLSALQKDISSKEQSLLSELESIFQEHTEQEERINRAQFMLNK  971

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             +   K  E+E  +++   L  ++    +  +    +   E+  L A+   L+  LQ++  
Sbjct  972   IENEKTLEVENLEREVISLTARVSSTHEERENATLDAIREVSVLRADKAKLEANLQDVSA  1031

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L A ++ +++ +E   S+E  L+ 
Sbjct  1032  QLRHYESQLEDLRKESKNKIKGLVDSLNASKQSEEMLTADAEHMKKLMEAAKSNEDMLRK  1091

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
               + LE KL  S+ E+ Q+ +  S L +++ KI  L+DEV  L+ SL++ KF+  +LE  
Sbjct  1092  TSNELELKLKSSDYEKQQMLEEISGLNLQVQKIMNLQDEVFKLQSSLDEAKFEKGKLEEL  1151

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L+ +  + EELKA K  L  +++ MQ ++   EE R  ++ +  K+LRLE DL+A E   
Sbjct  1152  LRSVTEDCEELKAQKAMLTDKVSDMQETLKNGEEERRSRIAMHAKLLRLESDLSASEASH  1211

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ KR NS+ + K++ LE E   L++ +Q +++                 
Sbjct  1212  VHEAELKNELSRIKRSNSEYQRKLQSLEQENEDLARRVQVMEKGF---------------  1256

Query  4279  KDKTTSCKEQKLSK---ARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQST  4449
              +K +  KE+ L         Q +    IQ++      +  +    + Q KS  PEGQS 
Sbjct  1257  -EKMSHIKEENLGMQEIGGDDQADIQSKIQLLETKLAEALEENKLYRAQQKSPMPEGQSA  1315

Query  4450  RSGNENE---QKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
               G+ N+    ++ QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA +  R
Sbjct  1316  -GGDGNDGHTDRVLQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKATKKGR  1369


 Score =   138 bits (347),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 101/151 (67%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D +G+++ F FSN +A+QVP   D+L +S++SV++GKTI+K  KA+  
Sbjct  1    MFKLHRHRSS--DRAGERYDFRFSNFRAVQVPSVSDRLFLSIVSVDSGKTIAKSSKAASR  58

Query  241  NGTCQWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW +++  P  ++ + +        +K +VS+GS+++GILGE  +N+ ++ N    
Sbjct  59   SGICQWPDTILEPIWFSKDEVSKEYEECQYKIIVSVGSTKSGILGEIFLNLSNFLNLVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL++CN GTVL  +++CL  ++   G
Sbjct  119  TAISLPLKRCNSGTVLQLKVQCLGTKSKLSG  149


 Score = 99.0 bits (245),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 104/154 (68%), Gaps = 14/154 (9%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A++ +ELS A  E +   H+I+ L
Sbjct  316   IEELRDEAKMWERHSRKLKADLELLKKECSEKSKQQAELAVELSAAQAERDSYRHEIEEL  375

Query  1036  EVLLEESNAKQIA------AENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQE  1197
             +  L++ N +Q        A+ ++LQ        KE+E+E+K+  ESN++L++Q+ ++QE
Sbjct  376   KSSLQDVNTRQTITGIPKRADWIDLQ--------KELEEEVKYLKESNADLTIQVNRTQE  427

Query  1198  SNAELVSVLQEMEETVQKKKIEIENLLALNSRSD  1299
             +N EL+S+LQE+EET++++++EI  +  +   +D
Sbjct  428   ANIELLSILQELEETIEEQRVEISKISKVKQTAD  461



>ref|XP_004986054.1| PREDICTED: myosin-11-like isoform X2 [Setaria italica]
Length=1359

 Score =   265 bits (677),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 222/655 (34%), Positives = 375/655 (57%), Gaps = 27/655 (4%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +R++++V++  I  ++S  K+ +  ++ELE+ K ELE  + ELE+EN++LSE
Sbjct  720   ITSKCLDEVRQDILVLSSSIDSHVSANKVLQRNVIELESCKAELELHISELEQENIELSE  779

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLEAQL + T+  E S +++      + NL+D++   + + ESQ LE KQ+  E Q+
Sbjct  780   RISGLEAQLTYLTNEKESSELQIHDSKALIVNLKDKVECQQSEMESQRLEFKQKQQESQR  839

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L++Q+LEL       E EL +
Sbjct  840   RLSEAQDDSEVLRRSNSKLQSTVESLIEECSSLQNLIADLKKQKLELHGHLTQKEQELDE  899

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +         +E LEAKLS++ ++ SSKE+ + SELE I  +  E +ER+   + + ++
Sbjct  900   SKKRNFDFSKTVEFLEAKLSALQKDISSKEQSLLSELESIFQEHTEQEERINRAQFMLNK  959

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             +   K  E+E  +++   L  ++    +  +    +   E+  L A+   L+  LQ++  
Sbjct  960   IENEKTLEVENLEREVISLTARVSSTHEERENATLDAIREVSVLRADKAKLEANLQDVSA  1019

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L A ++ +++ +E   S+E  L+ 
Sbjct  1020  QLRHYESQLEDLRKESKNKIKGLVDSLNASKQSEEMLTADAEHMKKLMEAAKSNEDMLRK  1079

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
               + LE KL  S+ E+ Q+ +  S L +++ KI  L+DEV  L+ SL++ KF+  +LE  
Sbjct  1080  TSNELELKLKSSDYEKQQMLEEISGLNLQVQKIMNLQDEVFKLQSSLDEAKFEKGKLEEL  1139

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L+ +  + EELKA K  L  +++ MQ ++   EE R  ++ +  K+LRLE DL+A E   
Sbjct  1140  LRSVTEDCEELKAQKAMLTDKVSDMQETLKNGEEERRSRIAMHAKLLRLESDLSASEASH  1199

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ KR NS+ + K++ LE E   L++ +Q +++                 
Sbjct  1200  VHEAELKNELSRIKRSNSEYQRKLQSLEQENEDLARRVQVMEKGF---------------  1244

Query  4279  KDKTTSCKEQKLSK---ARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQST  4449
              +K +  KE+ L         Q +    IQ++      +  +    + Q KS  PEGQS 
Sbjct  1245  -EKMSHIKEENLGMQEIGGDDQADIQSKIQLLETKLAEALEENKLYRAQQKSPMPEGQSA  1303

Query  4450  RSGNENE---QKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
               G+ N+    ++ QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA +  R
Sbjct  1304  -GGDGNDGHTDRVLQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKATKKGR  1357


 Score =   138 bits (347),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 101/151 (67%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D +G+++ F FSN +A+QVP   D+L +S++SV++GKTI+K  KA+  
Sbjct  1    MFKLHRHRSS--DRAGERYDFRFSNFRAVQVPSVSDRLFLSIVSVDSGKTIAKSSKAASR  58

Query  241  NGTCQWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW +++  P  ++ + +        +K +VS+GS+++GILGE  +N+ ++ N    
Sbjct  59   SGICQWPDTILEPIWFSKDEVSKEYEECQYKIIVSVGSTKSGILGEIFLNLSNFLNLVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL++CN GTVL  +++CL  ++   G
Sbjct  119  TAISLPLKRCNSGTVLQLKVQCLGTKSKLSG  149


 Score = 98.6 bits (244),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 104/154 (68%), Gaps = 14/154 (9%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A++ +ELS A  E +   H+I+ L
Sbjct  304   IEELRDEAKMWERHSRKLKADLELLKKECSEKSKQQAELAVELSAAQAERDSYRHEIEEL  363

Query  1036  EVLLEESNAKQIA------AENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQE  1197
             +  L++ N +Q        A+ ++LQ        KE+E+E+K+  ESN++L++Q+ ++QE
Sbjct  364   KSSLQDVNTRQTITGIPKRADWIDLQ--------KELEEEVKYLKESNADLTIQVNRTQE  415

Query  1198  SNAELVSVLQEMEETVQKKKIEIENLLALNSRSD  1299
             +N EL+S+LQE+EET++++++EI  +  +   +D
Sbjct  416   ANIELLSILQELEETIEEQRVEISKISKVKQTAD  449



>gb|EAY88210.1| hypothetical protein OsI_09659 [Oryza sativa Indica Group]
Length=1363

 Score =   265 bits (677),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 225/645 (35%), Positives = 376/645 (58%), Gaps = 30/645 (5%)
 Frame = +1

Query  2680  DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLE  2856
             D +R++++V++  I  ++S  K+ E K+ ELE+ K +LE  + +LE+EN++LSER+SGLE
Sbjct  732   DEVRQDILVLSSSIDSHVSANKVLERKVTELESCKADLELHISDLEQENIELSERISGLE  791

Query  2857  AQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQ  3036
             AQL + T+  E S +++    + + NL+D++   + + E+Q LE KQ+  E Q++  ++Q
Sbjct  792   AQLTYMTNEKESSELQIHDSKSLIVNLKDKVERQQAEMETQRLEFKQKQQEAQRKLSEAQ  851

Query  3037  EESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAEL-RKYQHSL  3213
             ++SE L+++N KLQ+T ESLIEEC SLQ    EL+RQ+LEL       E EL    + +L
Sbjct  852   DDSEVLRRSNSKLQSTVESLIEECSSLQNQIAELKRQKLELHGHLTQQEQELDNSKKRNL  911

Query  3214  SSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHK  3393
               C + +E LEAKLSS+ ++ SSKE+ + SELE I  +  E +E++     + +++ + K
Sbjct  912   DFCKT-VEFLEAKLSSLQKDISSKEQSLLSELESIFQEHTEQEEKINRAHFMLNKIEKEK  970

Query  3394  LSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEIT  3573
               E+E  +++   L  Q     +  +    E   E+  L A+   L+ +LQ++   L   
Sbjct  971   TLEVENLEREVMSLTAQASSTQEERENATVEAIREVSVLRADKVKLEASLQDVSAQLRHY  1030

Query  3574  EVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNl  3753
             E +L   + E + K+  L+  LNA K ++ +L A ++ +++ +E+  S+E  L+     L
Sbjct  1031  ESQLEDLRKESKSKIKGLVDSLNASKQSEEMLAADAEHMKKLMEDAKSNEDKLRKSSGEL  1090

Query  3754  esklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLIC  3933
             E KL  S+ E+ Q+ +  S LK+++ KI  L+DEVL LK SL++ KF+  +LE   + + 
Sbjct  1091  ELKLKASDYEKQQMIEEISGLKLQVQKIMSLQDEVLKLKSSLDEAKFERGKLEELHRSVT  1150

Query  3934  GENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAE  4113
              E EELKA K  L  +++ MQ ++   EE +  ++ ++ K++RLE DL+A E     +AE
Sbjct  1151  EECEELKAQKAMLTDKMSNMQETLENGEEEKRSRIAMQAKLVRLESDLSAVEASHVHEAE  1210

Query  4114  LKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQS---VQEELNRKENSVPSPSHSVAKD  4284
             LKN+L + KR NS+ + KI+ LE E   L+ +L+    ++EE   K++   SP   V ++
Sbjct  1211  LKNELNRIKRSNSEYQRKIQSLEQENEDLTSQLEQMAHIKEEDLGKQDIGGSP---VNEE  1267

Query  4285  KTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNE  4464
                  K                 IQ++      +  +    + Q KS  P+GQ   +GN 
Sbjct  1268  SGIHLK-----------------IQVLEAKLAEALEENKMYRAQQKSPMPDGQCA-AGNG  1309

Query  4465  NE---QKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             NE   +++ QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA
Sbjct  1310  NESSNERVLQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKA  1354


 Score =   134 bits (336),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 97/151 (64%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G +F F FSN +A+QVP   D+L +S++SV+ GKT++K GKA+  
Sbjct  1    MFKLHRHRSS--DRVGQRFDFRFSNFRAVQVPAVSDRLFLSIVSVDTGKTVAKSGKAAAR  58

Query  241  NGTCQW----TESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW     ES+W  ++  S   D   +K +VS+GS ++G+LGE  +N+ ++ N    
Sbjct  59   SGICQWPDSILESIWFSQDEVSKEFDECQYKIVVSVGSIKSGVLGEIFLNLTNFLNLVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL++CN GTVL  +++ L  ++   G
Sbjct  119  TAISLPLKRCNSGTVLQLKVQYLGAKSKSSG  149


 Score =   105 bits (262),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 108/177 (61%), Gaps = 19/177 (11%)
 Frame = +1

Query  805   IGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
              GQ SL  + +S       +  IEEL+ EA+MWE ++R+L   +E L+KE + +S++  +
Sbjct  289   FGQLSLGTSDSSKELLEAAEETIEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQQTE  348

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAEN------LNLQAKNTENILKEME  1131
             +E ELS AH E +    +I+ L+  ++E   +Q           ++LQ        KE+E
Sbjct  349   LEAELSAAHAERDSYRQEIEELKSSMKEVTTRQKVGGTSKYGDWIDLQ--------KELE  400

Query  1132  DELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDV  1302
             D++KF  ESN+NLS+QL+ +QE+N ELVS+LQE+EET++++K EI  +  + + +D 
Sbjct  401   DDVKFLKESNANLSIQLKNTQEANIELVSILQELEETIEEQKAEISKISKVKNVTDA  457



>gb|AAN62776.1| Putative kinesin-related protein [Oryza sativa Japonica Group]
 gb|ABF93545.1| expressed protein [Oryza sativa Japonica Group]
Length=1363

 Score =   265 bits (676),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 224/645 (35%), Positives = 376/645 (58%), Gaps = 30/645 (5%)
 Frame = +1

Query  2680  DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLE  2856
             D +R++++V++  I  ++S  K+ E K+ ELE+ K +LE  + +LE+EN++LSER+SGLE
Sbjct  732   DEVRQDILVLSSSIDSHVSANKVLERKVTELESCKADLELHISDLEQENIELSERISGLE  791

Query  2857  AQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQ  3036
             AQL + T+  E S +++    + + NL+D++   + + E+Q LE KQ+  E Q++  ++Q
Sbjct  792   AQLTYMTNEKESSELQIHDSKSLIVNLKDKVERQQAEMETQRLEFKQKQQEAQRKLSEAQ  851

Query  3037  EESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAEL-RKYQHSL  3213
             ++SE L+++N KLQ+T ESLIEEC SLQ    EL+RQ+LEL       E EL    + +L
Sbjct  852   DDSEVLRRSNSKLQSTVESLIEECSSLQNQIAELKRQKLELHGHLTQQEQELDNSKKRNL  911

Query  3214  SSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHK  3393
               C + +E LEAKLSS+ ++ SSKE+ + SELE I  +  E +E++     + +++ + K
Sbjct  912   DFCKT-VEFLEAKLSSLQKDISSKEQSLLSELESIFQEHTEQEEKINRAHFMLNKIEKEK  970

Query  3394  LSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEIT  3573
               E+E  +++   L  Q     +  +    E   E+  L A+   L+ +LQ++   L   
Sbjct  971   TLEVENLEREVMSLTAQASSTQEERENATVEAIREVSVLRADKVKLEASLQDVSAQLRHY  1030

Query  3574  EVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNl  3753
             E +L   + E + K+  L+  LNA K ++ +L A ++ +++ +E+  S+E  L+     L
Sbjct  1031  ESQLEDLRKESKSKIKGLVDSLNASKQSEEMLAADAEHMKKLMEDAKSNEDKLRKSSGEL  1090

Query  3754  esklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLIC  3933
             E KL  ++ E+ Q+ +  S LK+++ KI  L+DEVL LK SL++ KF+  +LE   + + 
Sbjct  1091  ELKLKANDYEKQQMIEEISGLKLQVQKIMSLQDEVLKLKSSLDEAKFERGKLEELHRSVT  1150

Query  3934  GENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAE  4113
              E EELKA K  L  +++ MQ ++   EE +  ++ ++ K++RLE DL+A E     +AE
Sbjct  1151  EECEELKAQKAMLTDKMSNMQETLDNGEEEKRSRIAMQAKLVRLESDLSAVEASHVHEAE  1210

Query  4114  LKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQS---VQEELNRKENSVPSPSHSVAKD  4284
             LKN+L + KR NS+ + KI+ LE E   L+ +L+    ++EE   K++   SP   V ++
Sbjct  1211  LKNELNRIKRSNSEYQRKIQSLEQENEDLTSQLEQMAHIKEEDLGKQDIGGSP---VDEE  1267

Query  4285  KTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNE  4464
                  K                 IQ++      +  +    + Q KS  P+GQ   +GN 
Sbjct  1268  SGIHLK-----------------IQVLEAKLAEALEENKMYRAQQKSPMPDGQCA-AGNG  1309

Query  4465  NE---QKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             NE   +++ QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA
Sbjct  1310  NESSNERVLQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKA  1354


 Score =   134 bits (336),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 97/151 (64%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G +F F FSN +A+QVP   D+L +S++SV+ GKT++K GKA+  
Sbjct  1    MFKLHRHRSS--DRVGQRFDFRFSNFRAVQVPAVSDRLFLSIVSVDTGKTVAKSGKAAAR  58

Query  241  NGTCQW----TESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW     ES+W  ++  S   D   +K +VS+GS ++G+LGE  +N+ ++ N    
Sbjct  59   SGICQWPDSILESIWFSQDEVSKEFDECQYKIVVSVGSIKSGVLGEIFLNLTNFLNLVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL++CN GTVL  +++ L  ++   G
Sbjct  119  TAISLPLKRCNSGTVLQLKVQYLGAKSKSSG  149


 Score =   105 bits (262),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 108/177 (61%), Gaps = 19/177 (11%)
 Frame = +1

Query  805   IGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
              GQ SL  + +S       +  IEEL+ EA+MWE ++R+L   +E L+KE + +S++  +
Sbjct  289   FGQLSLGTSDSSKELLEAAEETIEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQQTE  348

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAEN------LNLQAKNTENILKEME  1131
             +E ELS AH E +    +I+ L+  ++E   +Q           ++LQ        KE+E
Sbjct  349   LEAELSAAHAERDSYRQEIEELKSSMKEVTTRQKVGGTSKYGDWIDLQ--------KELE  400

Query  1132  DELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDV  1302
             D++KF  ESN+NLS+QL+ +QE+N ELVS+LQE+EET++++K EI  +  + + +D 
Sbjct  401   DDVKFLKESNANLSIQLKNTQEANIELVSILQELEETIEEQKAEISKISKVKNVTDA  457



>gb|EAZ25290.1| hypothetical protein OsJ_09100 [Oryza sativa Japonica Group]
Length=1429

 Score =   265 bits (676),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 224/645 (35%), Positives = 376/645 (58%), Gaps = 30/645 (5%)
 Frame = +1

Query  2680  DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLE  2856
             D +R++++V++  I  ++S  K+ E K+ ELE+ K +LE  + +LE+EN++LSER+SGLE
Sbjct  798   DEVRQDILVLSSSIDSHVSANKVLERKVTELESCKADLELHISDLEQENIELSERISGLE  857

Query  2857  AQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQ  3036
             AQL + T+  E S +++    + + NL+D++   + + E+Q LE KQ+  E Q++  ++Q
Sbjct  858   AQLTYMTNEKESSELQIHDSKSLIVNLKDKVERQQAEMETQRLEFKQKQQEAQRKLSEAQ  917

Query  3037  EESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAEL-RKYQHSL  3213
             ++SE L+++N KLQ+T ESLIEEC SLQ    EL+RQ+LEL       E EL    + +L
Sbjct  918   DDSEVLRRSNSKLQSTVESLIEECSSLQNQIAELKRQKLELHGHLTQQEQELDNSKKRNL  977

Query  3214  SSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHK  3393
               C + +E LEAKLSS+ ++ SSKE+ + SELE I  +  E +E++     + +++ + K
Sbjct  978   DFCKT-VEFLEAKLSSLQKDISSKEQSLLSELESIFQEHTEQEEKINRAHFMLNKIEKEK  1036

Query  3394  LSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEIT  3573
               E+E  +++   L  Q     +  +    E   E+  L A+   L+ +LQ++   L   
Sbjct  1037  TLEVENLEREVMSLTAQASSTQEERENATVEAIREVSVLRADKVKLEASLQDVSAQLRHY  1096

Query  3574  EVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNl  3753
             E +L   + E + K+  L+  LNA K ++ +L A ++ +++ +E+  S+E  L+     L
Sbjct  1097  ESQLEDLRKESKSKIKGLVDSLNASKQSEEMLAADAEHMKKLMEDAKSNEDKLRKSSGEL  1156

Query  3754  esklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLIC  3933
             E KL  ++ E+ Q+ +  S LK+++ KI  L+DEVL LK SL++ KF+  +LE   + + 
Sbjct  1157  ELKLKANDYEKQQMIEEISGLKLQVQKIMSLQDEVLKLKSSLDEAKFERGKLEELHRSVT  1216

Query  3934  GENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAE  4113
              E EELKA K  L  +++ MQ ++   EE +  ++ ++ K++RLE DL+A E     +AE
Sbjct  1217  EECEELKAQKAMLTDKMSNMQETLDNGEEEKRSRIAMQAKLVRLESDLSAVEASHVHEAE  1276

Query  4114  LKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQS---VQEELNRKENSVPSPSHSVAKD  4284
             LKN+L + KR NS+ + KI+ LE E   L+ +L+    ++EE   K++   SP   V ++
Sbjct  1277  LKNELNRIKRSNSEYQRKIQSLEQENEDLTSQLEQMAHIKEEDLGKQDIGGSP---VDEE  1333

Query  4285  KTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNE  4464
                  K                 IQ++      +  +    + Q KS  P+GQ   +GN 
Sbjct  1334  SGIHLK-----------------IQVLEAKLAEALEENKMYRAQQKSPMPDGQCA-AGNG  1375

Query  4465  NE---QKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             NE   +++ QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA
Sbjct  1376  NESSNERVLQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKA  1420


 Score =   105 bits (262),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 110/173 (64%), Gaps = 11/173 (6%)
 Frame = +1

Query  805   IGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
              GQ SL  + +S       +  IEEL+ EA+MWE ++R+L   +E L+KE + +S++  +
Sbjct  355   FGQLSLGTSDSSKELLEAAEETIEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQQTE  414

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTE--NILKEMEDELK  1143
             +E ELS AH E +    +I+ L+  ++E   +Q     +   +K  +  ++ KE+ED++K
Sbjct  415   LEAELSAAHAERDSYRQEIEELKSSMKEVTTRQ----KVGGTSKYGDWIDLQKELEDDVK  470

Query  1144  FQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDV  1302
             F  ESN+NLS+QL+ +QE+N ELVS+LQE+EET++++K EI  +  + + +D 
Sbjct  471   FLKESNANLSIQLKNTQEANIELVSILQELEETIEEQKAEISKISKVKNVTDA  523


 Score =   100 bits (249),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 76/121 (63%), Gaps = 6/121 (5%)
 Frame = +1

Query  151  VPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQW----TESLWSPENYASNGLD--HF  312
            VP   D+L +S++SV+ GKT++K GKA+  +G CQW     ES+W  ++  S   D   +
Sbjct  95   VPAVSDRLFLSIVSVDTGKTVAKSGKAAARSGICQWPDSILESIWFSQDEVSKEFDECQY  154

Query  313  KFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
            K +VS+GS ++G+LGE  +N+ ++ N      +SLPL++CN GTVL  +++ L  ++   
Sbjct  155  KIVVSVGSIKSGVLGEIFLNLTNFLNLVDPTAISLPLKRCNSGTVLQLKVQYLGAKSKSS  214

Query  493  G  495
            G
Sbjct  215  G  215


 Score = 88.6 bits (218),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 8/96 (8%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G +F F FSN +A+QVP   D+L +S++SV+ GKT++K GKA+  
Sbjct  1    MFKLHRHRSS--DRVGQRFDFRFSNFRAVQVPAVSDRLFLSIVSVDTGKTVAKSGKAAAR  58

Query  241  NGTCQW----TESLWSPENYASNGLD--HFKFLVSM  330
            +G CQW     ES+W  ++  S   D   +K +VS+
Sbjct  59   SGICQWPDSILESIWFSQDEVSKEFDECQYKIVVSV  94



>ref|XP_006843081.1| hypothetical protein AMTR_s00140p00022750 [Amborella trichopoda]
 gb|ERN04756.1| hypothetical protein AMTR_s00140p00022750 [Amborella trichopoda]
Length=1537

 Score =   262 bits (669),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 189/525 (36%), Positives = 319/525 (61%), Gaps = 4/525 (1%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +R ++ V+T  +  ++S  K  E K+L+LE+EK ELE+ + ELE+EN+ LSE
Sbjct  803   ITSKCLDDVRHDLRVLTSSLESHVSVRKSLEKKLLDLESEKGELEAHLSELEEENVNLSE  862

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLEAQ+R+ T+  E  ++ELQ   ++  NLQ +I  L+ + E Q  EL+Q L + QK
Sbjct  863   RISGLEAQVRYLTEERESGKLELQISRSRAANLQSDIERLKLEMEKQINELRQTLQDGQK  922

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
                D+QEE +YLK+   +L+AT E+L+++CDSLQ +N +++ Q+LEL      LE  LRK
Sbjct  923   EASDAQEEVQYLKREKYRLEATFEALVKDCDSLQKMNVDMKMQKLELHEHYAELEGRLRK  982

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
               H  SS + +IE LE   SS+  E +SK++  + +LE     +KE  E+L+  ESL  Q
Sbjct  983   KLHECSSYIPKIEYLEMGFSSMQREVASKDQSFSRDLEAFFSASKEHNEKLMAVESLCDQ  1042

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             +   K  E+++ + +   L   +    +      +    E+ SL  +   L+ +L+E  +
Sbjct  1043  MLLEKTIEVDHLRSEVERLTTVISSTDNERRITETNTLLEVSSLREDKLKLESSLEEAHE  1102

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              ++  E +L   + +   +  EL+G L+  K  +  + A  ++++  L+ V SS+ N K 
Sbjct  1103  KVKWLETELSNIRHDSSSRAQELLGMLSDSKQKEEAVMADYERIKTLLDEVKSSDGNSKR  1162

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
             + + LE  L  SE+E+ +L + +  L  +L ++  +RDE +ALK +L++M+ +  R+EAS
Sbjct  1163  MANELEIMLRASENEKQKLKEESDDLTAQLERLINIRDEFVALKCTLDEMRLEKSRMEAS  1222

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L+ +   NE++K +K +L++++  MQ +V+E E+ +  K+ LEEK+LRLE DLTA++ + 
Sbjct  1223  LKFLSTGNEQMKVEKLALMEKIRDMQKAVSEGEDAKHSKIALEEKILRLECDLTAKDALS  1282

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
               +AE++N+L + KRVNSQ   KI+ LE E+    +  Q ++EEL
Sbjct  1283  VHEAEMRNELGRMKRVNSQFLRKIQYLEEEKDGYLRRAQVLEEEL  1327


 Score =   157 bits (396),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 117/190 (62%), Gaps = 9/190 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL R +S   +  G++  F FS +QALQVP+GWDKL VS+ISVE GK ++K  K+ V 
Sbjct  1    MFKLHRQRSH--EKLGERVDFKFSQLQALQVPRGWDKLFVSIISVETGKAVAKSNKSVVR  58

Query  241  NGTCQWT----ESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQWT    E++W  ++  S  L+   F+ +V+ GS+R+GILGE  +N+  Y  S+ S
Sbjct  59   NGNCQWTEVLSETIWVSQDDTSRVLEERPFRLVVATGSARSGILGEVNINLTDYMTSKVS  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSF-RGDEVNSTAAYNEEENSVCNGIDNKSEERN  579
             P   PL+KCN GT+L  +I+C T R ++ RG   N+ +   E++ S     D+KSE  +
Sbjct  119  APELFPLKKCNYGTLLQVKIQCPTQRPTYSRGKHGNTASIDEEDQISDYEDADSKSEGSD  178

Query  580  NSLPSMEDSL  609
            N + S   S 
Sbjct  179  NYVGSNRSSF  188


 Score =   112 bits (279),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 136/231 (59%), Gaps = 21/231 (9%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
             P+  +EEL+++A MWE NA +L  ++E+ RK  ++QS+   DM+M+      E + L  +
Sbjct  390   PELTVEELRSQAMMWERNAHKLEFELESQRKALSDQSRLNTDMDMDNVDLRAERDSLKLE  449

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I++++  ++ES  KQ  ++            LKE+++E+ FQ  SNS+LS QL K+QESN
Sbjct  450   IEQIKSRVQESTEKQKVSDGA---------TLKELKEEINFQKRSNSDLSSQLMKTQESN  500

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCG---------DEDNVQPKST  1356
              ELVS+LQE+EETV+K+K+EIE L A   + +V+    +CG         +E + +    
Sbjct  501   IELVSILQELEETVEKQKLEIETLSA---QRNVLPGPENCGLSHLSVKVSEESSEKLAEI  557

Query  1357  EQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQDLRAQ  1509
              ++  EK+  E +LQ L++S   L++ +   E   EE   EI+ E+ L+ Q
Sbjct  558   VEIEREKKRLEVQLQELEDSKERLQSVVESLETKLEEMDQEIQQERKLKNQ  608



>ref|XP_008660573.1| PREDICTED: myosin-11-like isoform X3 [Zea mays]
Length=1215

 Score =   258 bits (660),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 218/653 (33%), Positives = 372/653 (57%), Gaps = 24/653 (4%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +R++++V++  I  ++S  K+ E  ++ELE+ K ELE  V ELE+EN++LSE
Sbjct  577   ITSKCLDEVRKDILVLSSSIDSHVSTNKLLERNLVELESCKAELELHVSELEQENIELSE  636

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLE QL + T+  E S ++L    + + NL+D++   + + E+Q L+ KQ+  E Q+
Sbjct  637   RISGLETQLTYVTNEKESSELQLHDSRSLIINLKDKVECQQSEMETQRLQFKQKQQESQR  696

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L+RQ+LEL       E EL +
Sbjct  697   RLCEAQDDSEVLRRSNCKLQSTVESLIEECSSLQNLIADLKRQKLELHGHLTQKEQELDE  756

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +         +E LEAKL S+ ++ SSKE+ + SELE I  +  E +ER+     + ++
Sbjct  757   SKKKNFEFSKTVEFLEAKLLSLQKDISSKEQSLLSELENIFQEHMEQEERINRAHFMLNK  816

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             + + K  E+E  +++   L  Q+    +  +        E+  L A+N  L+  LQ++ +
Sbjct  817   IEKEKTLEVENLEREVVSLAAQVSSTHEERESATLNAIQEVSVLRADNAKLEANLQDVSE  876

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L + ++ +++ +E   S+E  L+ 
Sbjct  877   QLRCYESQLEDLRKESKSKIKGLVDSLNASKQSEEMLTSDAEHMKKLMEAAKSNEDALRK  936

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
               + LE KL  S+  + Q+ +  S LK+++ KI  L+DEV  L+ SL++ KF+  +LE  
Sbjct  937   TSNELELKLKSSDYVKQQMLEEISGLKLQVQKIMNLQDEVSKLQSSLDEAKFEKGKLEEF  996

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             ++ +  E +ELKA K  L  +++ MQ ++   EE    ++ +  K++RLE DLTA E   
Sbjct  997   VRSVTEECQELKAQKAMLTDKVSYMQETLRNGEEENRNRIAMHAKLMRLESDLTALEASH  1056

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ KR NS+ + KI+ L  E   L++ +Q +++   R    +     ++ 
Sbjct  1057  VHEAELKNELSRIKRSNSEYQRKIQSLGQENEDLTRRVQIMEKGFER----MSHAKENLG  1112

Query  4279  KDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSS----RCQVGDDKTQFKSLQPEGQS  4446
             K +     ++ +            TIQ++ I    +    +      K+     QP G  
Sbjct  1113  KQEIGGDNQEAIQS----------TIQLLEIKLAEALEENKIYRAQQKSSMSEGQPAGGD  1162

Query  4447  TRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
              + GN +  +I QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA++  R
Sbjct  1163  GKEGNTD--RILQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKAIKKGR  1213


 Score =   100 bits (249),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 99/139 (71%), Gaps = 6/139 (4%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A++ +ELS A  E +   H+I+ L
Sbjct  161   IEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQHAELAVELSAAQAERDSYRHEIEEL  220

Query  1036  EVLLEESNAKQIAAENLNLQAKNTE--NILKEMEDELKFQTESNSNLSLQLRKSQESNAE  1209
             +  L++ N +Q     +    K ++  ++ KE+E E+KF  ESN++L++QL ++QESN E
Sbjct  221   KSSLQDVNTRQ----TITGTPKRSDWIDLQKELEGEVKFLKESNTDLTIQLNRTQESNIE  276

Query  1210  LVSVLQEMEETVQKKKIEI  1266
             L+S+LQE+EET++++++EI
Sbjct  277   LLSILQELEETIEEQRVEI  295



>ref|XP_006649238.1| PREDICTED: myosin-11-like [Oryza brachyantha]
Length=1370

 Score =   259 bits (663),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 224/651 (34%), Positives = 368/651 (57%), Gaps = 30/651 (5%)
 Frame = +1

Query  2680  DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLE  2856
             D +R++++V++  I  ++S  K+ E K+ ELE+ K ELE  +  LE+EN++LSER+SGLE
Sbjct  739   DEVRQDILVLSSSIDSHVSANKVLERKVAELESCKAELELHISNLEQENVELSERISGLE  798

Query  2857  AQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQ  3036
             AQL + T+  + S +++    + + NL+D++   + + ESQ LE KQ+  E Q++  ++Q
Sbjct  799   AQLTYMTNEKDSSELQIHDSKSLIVNLKDKLERQQSEMESQRLEFKQKQQEAQRKLSEAQ  858

Query  3037  EESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLS  3216
             ++SE  +++N KLQ+T ESLIEEC SLQ    +L+RQ+LEL       E EL   +    
Sbjct  859   DDSEVQRRSNTKLQSTVESLIEECSSLQNQIADLKRQKLELHGHLTQQEQELDNSKKRNF  918

Query  3217  SCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKL  3396
                  +E LEAKLSS+ ++ SSKE+ + SELE I  +  E +ER+     + +++ + K 
Sbjct  919   DFGKTVEFLEAKLSSLQKDISSKEQSLLSELESIFQEHTEQEERINRAHFMLNKIEKEKT  978

Query  3397  SELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITE  3576
              E+E  +++   L  Q     +  +    E   E+  L A+   L+ +LQ++   L   E
Sbjct  979   LEVENLEREVMSLTAQTSSTQEERENATVEAIREVSVLRADKVKLEASLQDVSAQLRHYE  1038

Query  3577  VKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNle  3756
              +L   + E + K+  L+  LNA K ++ +L A ++ +++ +E   S+E  L+     LE
Sbjct  1039  SQLEDLRKESKSKIKGLVDSLNASKQSEEMLTADAEHMKKLMEVAKSNEDELRKSSGELE  1098

Query  3757  sklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICG  3936
              KL  S+ E+ Q+ +  S LK+++ KI  L+DEVL LK SL++ KF+  ++E  L     
Sbjct  1099  LKLKASDYEKQQMMEEISGLKLQVQKIMGLQDEVLKLKSSLDEAKFEKGKVEELLHSATE  1158

Query  3937  ENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAEL  4116
             E EELKA K  L  +++ MQ S+   EE +  +V ++ K++RLE DL+A E     +AEL
Sbjct  1159  ECEELKAQKAMLTDKVSNMQESLDNGEEKKRSRVAMQAKLVRLESDLSALEASHVHEAEL  1218

Query  4117  KNDLTQSKRVNSQLRWKIKQLELERYYLSKELQ-----SVQEELNRKENSVPSPSHSVAK  4281
             KN++ + KR NS+ + KI+ LE E   L++  Q      ++EE   K+    SP   V +
Sbjct  1219  KNEINRIKRSNSEYQRKIQSLEQENEDLTRRTQLEQMSHIKEEDLGKQEIGGSP---VDE  1275

Query  4282  DKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGN  4461
             + +   K                 IQ++      +  +    + Q KS  P+GQS  +G+
Sbjct  1276  EASIHLK-----------------IQLLEAKLAEALEENKMYRAQHKSPMPDGQSA-AGD  1317

Query  4462  ENE---QKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
               E    ++ QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA +  R
Sbjct  1318  GKESSNDRVLQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKAAKKGR  1368


 Score =   115 bits (288),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 95/151 (63%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G +F F F N +A+QVP   D+L +S++SV+ GKT++K  KA+ +
Sbjct  1    MFKLHRHRSS--DRVGQRFDFRFFNFRAVQVPAVSDRLFLSIVSVDTGKTVAKSSKAAAH  58

Query  241  NGTCQWT----ESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
             G CQW     E++W  ++  S   D   +K +VS+GS ++G+LGE  +N+ ++ N    
Sbjct  59   IGICQWPDNILETIWFSQDEVSKKFDECQYKIVVSVGSIKSGVLGEIFLNLTNFLNLVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL+KCN GTVL  +++ L  ++   G
Sbjct  119  TAISLPLKKCNSGTVLQLKVQYLGTKSKLSG  149


 Score =   108 bits (271),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 110/171 (64%), Gaps = 7/171 (4%)
 Frame = +1

Query  805   IGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
              GQ SL  + +S       +  IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A+
Sbjct  292   FGQVSLGTSDSSKELLEAAEETIEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQQAE  351

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQ  1149
             +E+ELS AH E +    +I  L+  ++E   +Q        +  +  ++ KE+ED++KF 
Sbjct  352   LEVELSAAHAERDSYRQEIDELKSSMQEVTTRQKVGGTS--KYGDWIDLQKELEDDIKFL  409

Query  1150  TESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDV  1302
              ESN+NLS+QL+ +QE+N ELVS+LQE+EET++++K EI  L  + + +D+
Sbjct  410   KESNANLSIQLKNTQEANIELVSILQELEETIEEQKTEISKLSKVRNVTDL  460



>ref|XP_008660572.1| PREDICTED: myosin-11-like isoform X2 [Zea mays]
Length=1370

 Score =   259 bits (662),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 218/653 (33%), Positives = 372/653 (57%), Gaps = 24/653 (4%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +R++++V++  I  ++S  K+ E  ++ELE+ K ELE  V ELE+EN++LSE
Sbjct  732   ITSKCLDEVRKDILVLSSSIDSHVSTNKLLERNLVELESCKAELELHVSELEQENIELSE  791

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLE QL + T+  E S ++L    + + NL+D++   + + E+Q L+ KQ+  E Q+
Sbjct  792   RISGLETQLTYVTNEKESSELQLHDSRSLIINLKDKVECQQSEMETQRLQFKQKQQESQR  851

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L+RQ+LEL       E EL +
Sbjct  852   RLCEAQDDSEVLRRSNCKLQSTVESLIEECSSLQNLIADLKRQKLELHGHLTQKEQELDE  911

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +         +E LEAKL S+ ++ SSKE+ + SELE I  +  E +ER+     + ++
Sbjct  912   SKKKNFEFSKTVEFLEAKLLSLQKDISSKEQSLLSELENIFQEHMEQEERINRAHFMLNK  971

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             + + K  E+E  +++   L  Q+    +  +        E+  L A+N  L+  LQ++ +
Sbjct  972   IEKEKTLEVENLEREVVSLAAQVSSTHEERESATLNAIQEVSVLRADNAKLEANLQDVSE  1031

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L + ++ +++ +E   S+E  L+ 
Sbjct  1032  QLRCYESQLEDLRKESKSKIKGLVDSLNASKQSEEMLTSDAEHMKKLMEAAKSNEDALRK  1091

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
               + LE KL  S+  + Q+ +  S LK+++ KI  L+DEV  L+ SL++ KF+  +LE  
Sbjct  1092  TSNELELKLKSSDYVKQQMLEEISGLKLQVQKIMNLQDEVSKLQSSLDEAKFEKGKLEEF  1151

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             ++ +  E +ELKA K  L  +++ MQ ++   EE    ++ +  K++RLE DLTA E   
Sbjct  1152  VRSVTEECQELKAQKAMLTDKVSYMQETLRNGEEENRNRIAMHAKLMRLESDLTALEASH  1211

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ KR NS+ + KI+ L  E   L++ +Q +++   R    +     ++ 
Sbjct  1212  VHEAELKNELSRIKRSNSEYQRKIQSLGQENEDLTRRVQIMEKGFER----MSHAKENLG  1267

Query  4279  KDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSS----RCQVGDDKTQFKSLQPEGQS  4446
             K +     ++ +            TIQ++ I    +    +      K+     QP G  
Sbjct  1268  KQEIGGDNQEAIQS----------TIQLLEIKLAEALEENKIYRAQQKSSMSEGQPAGGD  1317

Query  4447  TRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
              + GN +  +I QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA++  R
Sbjct  1318  GKEGNTD--RILQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKAIKKGR  1368


 Score =   125 bits (313),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 98/151 (65%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G++F F FSN +A+QVP   D+L +S++SV+ GKTI+K  K +  
Sbjct  1    MFKLHRHRSS--DRVGERFDFRFSNFRAVQVPAISDRLFLSIVSVDNGKTIAKSTKVASR  58

Query  241  NGTCQWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW +++  P  ++ + +        ++ +VS+GS+++GILGE  +N+ ++ N    
Sbjct  59   SGICQWPDTILEPIWFSKDQVSKEFQECQYRIIVSLGSAKSGILGEILLNLSNFLNLADP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL++CN GTVL  +++CL  ++   G
Sbjct  119  TAISLPLKRCNSGTVLQLKVQCLGTKSKLSG  149


 Score =   101 bits (251),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 110/168 (65%), Gaps = 11/168 (7%)
 Frame = +1

Query  784   PEYTEEEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFAN  948
             P+    ++ Q S+  + +S       +  IEEL+ EA+MWE ++R+L   +E L+KE + 
Sbjct  287   PKTFSNDLSQLSMGASDSSKDFLEAAEETIEELRDEAKMWERHSRKLKADLEMLKKECSE  346

Query  949   QSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTE--NILK  1122
             +S++ A++ +ELS A  E +   H+I+ L+  L++ N +Q     +    K ++  ++ K
Sbjct  347   KSKQHAELAVELSAAQAERDSYRHEIEELKSSLQDVNTRQ----TITGTPKRSDWIDLQK  402

Query  1123  EMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEI  1266
             E+E E+KF  ESN++L++QL ++QESN EL+S+LQE+EET++++++EI
Sbjct  403   ELEGEVKFLKESNTDLTIQLNRTQESNIELLSILQELEETIEEQRVEI  450



>ref|XP_008660571.1| PREDICTED: myosin-11-like isoform X1 [Zea mays]
Length=1443

 Score =   258 bits (660),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 218/653 (33%), Positives = 372/653 (57%), Gaps = 24/653 (4%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +R++++V++  I  ++S  K+ E  ++ELE+ K ELE  V ELE+EN++LSE
Sbjct  805   ITSKCLDEVRKDILVLSSSIDSHVSTNKLLERNLVELESCKAELELHVSELEQENIELSE  864

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLE QL + T+  E S ++L    + + NL+D++   + + E+Q L+ KQ+  E Q+
Sbjct  865   RISGLETQLTYVTNEKESSELQLHDSRSLIINLKDKVECQQSEMETQRLQFKQKQQESQR  924

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L+RQ+LEL       E EL +
Sbjct  925   RLCEAQDDSEVLRRSNCKLQSTVESLIEECSSLQNLIADLKRQKLELHGHLTQKEQELDE  984

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +         +E LEAKL S+ ++ SSKE+ + SELE I  +  E +ER+     + ++
Sbjct  985   SKKKNFEFSKTVEFLEAKLLSLQKDISSKEQSLLSELENIFQEHMEQEERINRAHFMLNK  1044

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             + + K  E+E  +++   L  Q+    +  +        E+  L A+N  L+  LQ++ +
Sbjct  1045  IEKEKTLEVENLEREVVSLAAQVSSTHEERESATLNAIQEVSVLRADNAKLEANLQDVSE  1104

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L + ++ +++ +E   S+E  L+ 
Sbjct  1105  QLRCYESQLEDLRKESKSKIKGLVDSLNASKQSEEMLTSDAEHMKKLMEAAKSNEDALRK  1164

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
               + LE KL  S+  + Q+ +  S LK+++ KI  L+DEV  L+ SL++ KF+  +LE  
Sbjct  1165  TSNELELKLKSSDYVKQQMLEEISGLKLQVQKIMNLQDEVSKLQSSLDEAKFEKGKLEEF  1224

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             ++ +  E +ELKA K  L  +++ MQ ++   EE    ++ +  K++RLE DLTA E   
Sbjct  1225  VRSVTEECQELKAQKAMLTDKVSYMQETLRNGEEENRNRIAMHAKLMRLESDLTALEASH  1284

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ KR NS+ + KI+ L  E   L++ +Q +++   R    +     ++ 
Sbjct  1285  VHEAELKNELSRIKRSNSEYQRKIQSLGQENEDLTRRVQIMEKGFER----MSHAKENLG  1340

Query  4279  KDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSS----RCQVGDDKTQFKSLQPEGQS  4446
             K +     ++ +            TIQ++ I    +    +      K+     QP G  
Sbjct  1341  KQEIGGDNQEAIQS----------TIQLLEIKLAEALEENKIYRAQQKSSMSEGQPAGGD  1390

Query  4447  TRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
              + GN +  +I QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA++  R
Sbjct  1391  GKEGNTD--RILQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKAIKKGR  1441


 Score =   102 bits (253),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 100/142 (70%), Gaps = 6/142 (4%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A++ +ELS A  E +   H+I+ L
Sbjct  389   IEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQHAELAVELSAAQAERDSYRHEIEEL  448

Query  1036  EVLLEESNAKQIAAENLNLQAKNTE--NILKEMEDELKFQTESNSNLSLQLRKSQESNAE  1209
             +  L++ N +Q     +    K ++  ++ KE+E E+KF  ESN++L++QL ++QESN E
Sbjct  449   KSSLQDVNTRQ----TITGTPKRSDWIDLQKELEGEVKFLKESNTDLTIQLNRTQESNIE  504

Query  1210  LVSVLQEMEETVQKKKIEIENL  1275
             L+S+LQE+EET++++++EI  +
Sbjct  505   LLSILQELEETIEEQRVEISKI  526


 Score = 90.9 bits (224),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 76/121 (63%), Gaps = 6/121 (5%)
 Frame = +1

Query  151  VPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYASNGLD------HF  312
            VP   D+L +S++SV+ GKTI+K  K +  +G CQW +++  P  ++ + +        +
Sbjct  102  VPAISDRLFLSIVSVDNGKTIAKSTKVASRSGICQWPDTILEPIWFSKDQVSKEFQECQY  161

Query  313  KFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
            + +VS+GS+++GILGE  +N+ ++ N      +SLPL++CN GTVL  +++CL  ++   
Sbjct  162  RIIVSLGSAKSGILGEILLNLSNFLNLADPTAISLPLKRCNSGTVLQLKVQCLGTKSKLS  221

Query  493  G  495
            G
Sbjct  222  G  222



>gb|AFW89859.1| hypothetical protein ZEAMMB73_951067 [Zea mays]
Length=1072

 Score =   255 bits (652),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 218/653 (33%), Positives = 372/653 (57%), Gaps = 24/653 (4%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +R++++V++  I  ++S  K+ E  ++ELE+ K ELE  V ELE+EN++LSE
Sbjct  434   ITSKCLDEVRKDILVLSSSIDSHVSTNKLLERNLVELESCKAELELHVSELEQENIELSE  493

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLE QL + T+  E S ++L    + + NL+D++   + + E+Q L+ KQ+  E Q+
Sbjct  494   RISGLETQLTYVTNEKESSELQLHDSRSLIINLKDKVECQQSEMETQRLQFKQKQQESQR  553

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L+RQ+LEL       E EL +
Sbjct  554   RLCEAQDDSEVLRRSNCKLQSTVESLIEECSSLQNLIADLKRQKLELHGHLTQKEQELDE  613

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +         +E LEAKL S+ ++ SSKE+ + SELE I  +  E +ER+     + ++
Sbjct  614   SKKKNFEFSKTVEFLEAKLLSLQKDISSKEQSLLSELENIFQEHMEQEERINRAHFMLNK  673

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             + + K  E+E  +++   L  Q+    +  +        E+  L A+N  L+  LQ++ +
Sbjct  674   IEKEKTLEVENLEREVVSLAAQVSSTHEERESATLNAIQEVSVLRADNAKLEANLQDVSE  733

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L + ++ +++ +E   S+E  L+ 
Sbjct  734   QLRCYESQLEDLRKESKSKIKGLVDSLNASKQSEEMLTSDAEHMKKLMEAAKSNEDALRK  793

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
               + LE KL  S+  + Q+ +  S LK+++ KI  L+DEV  L+ SL++ KF+  +LE  
Sbjct  794   TSNELELKLKSSDYVKQQMLEEISGLKLQVQKIMNLQDEVSKLQSSLDEAKFEKGKLEEF  853

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             ++ +  E +ELKA K  L  +++ MQ ++   EE    ++ +  K++RLE DLTA E   
Sbjct  854   VRSVTEECQELKAQKAMLTDKVSYMQETLRNGEEENRNRIAMHAKLMRLESDLTALEASH  913

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ KR NS+ + KI+ L  E   L++ +Q +++   R    +     ++ 
Sbjct  914   VHEAELKNELSRIKRSNSEYQRKIQSLGQENEDLTRRVQIMEKGFER----MSHAKENLG  969

Query  4279  KDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSS----RCQVGDDKTQFKSLQPEGQS  4446
             K +     ++ +            TIQ++ I    +    +      K+     QP G  
Sbjct  970   KQEIGGDNQEAIQS----------TIQLLEIKLAEALEENKIYRAQQKSSMSEGQPAGGD  1019

Query  4447  TRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
              + GN +  +I QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LKA++  R
Sbjct  1020  GKEGNTD--RILQLEGELRDMKERLLNMSLQYAEVEAQRERLVMELKAIKKGR  1070


 Score = 98.6 bits (244),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 99/139 (71%), Gaps = 6/139 (4%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A++ +ELS A  E +   H+I+ L
Sbjct  18    IEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQHAELAVELSAAQAERDSYRHEIEEL  77

Query  1036  EVLLEESNAKQIAAENLNLQAKNTE--NILKEMEDELKFQTESNSNLSLQLRKSQESNAE  1209
             +  L++ N +Q     +    K ++  ++ KE+E E+KF  ESN++L++QL ++QESN E
Sbjct  78    KSSLQDVNTRQ----TITGTPKRSDWIDLQKELEGEVKFLKESNTDLTIQLNRTQESNIE  133

Query  1210  LVSVLQEMEETVQKKKIEI  1266
             L+S+LQE+EET++++++EI
Sbjct  134   LLSILQELEETIEEQRVEI  152



>ref|XP_010050351.1| PREDICTED: sporulation-specific protein 15-like [Eucalyptus grandis]
 gb|KCW89312.1| hypothetical protein EUGRSUZ_A01602 [Eucalyptus grandis]
Length=1014

 Score =   253 bits (646),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 257/838 (31%), Positives = 418/838 (50%), Gaps = 153/838 (18%)
 Frame = +1

Query  2464  EVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDM  2643
             E KGE  G   +   +K  +VK   L ++  +  L  C   L   + D Q     +E+ +
Sbjct  196   EDKGEEFGKESVEDGNKERKVKEMLLLKEEEINNLRECHTKLEALVSDLQKEKTELEEKL  255

Query  2644  EKVQTEKDDITSD---SMREEMMVVTGRIFGNISEKIQEMKILELENEKQELESCVFELE  2814
             + +Q E  ++T+     ++ +++V++G +  ++S      K+LE ++          E+ 
Sbjct  256   QIMQRE-SEVTAKCLTDVQNDLVVLSGSVDSHVSAN----KMLERKS---------SEIG  301

Query  2815  KENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLC-NLQDEIRELEKDKESQELEL  2991
              EN+ LS R++  E QL +  D ME +++EL+ +   LC +L DEI +L    + Q+ +L
Sbjct  302   PENVALSMRIAEQEVQLSYLMDEMEATQLELE-RSRALCESLDDEISKLSFSSKKQKTQL  360

Query  2992  KQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQC  3171
             ++ + EMQ RW ++QEE ++LKK   +LQA  ESL EEC+SLQ LNG+L+ Q +EL    
Sbjct  361   EKEMKEMQNRWSEAQEECDHLKKERAQLQADVESLAEECNSLQELNGKLKMQNVEL----  416

Query  3172  NLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERL  3351
                  ELR     LS C +++E+LE  LS++L++ ++KE+   SE++ +L + +E KERL
Sbjct  417   ---HEELRS---CLSGCSTKVETLEENLSALLDDVTAKERTFKSEIDALLDENREQKERL  470

Query  3352  VIKESLQSQ-------------------------------------------LCQHKLSE  3402
              + ES+ +Q                                           LC  K +E
Sbjct  471   AVGESILNQIYADKTTEVENLRKEIEHLTNQISDIHNERERIVSDAAEEISKLCADK-AE  529

Query  3403  LEYP---------------QQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKL  3537
             LE                  Q+  HL NQ+ D  D  +   S+ + E+  L A+   L+L
Sbjct  530   LELALCETRSELQRKDCELNQEIEHLTNQISDIHDERERIVSDAAEEISKLCADKAELEL  589

Query  3538  TLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVIS  3717
              L+E Q  L+  + +L   Q +YER+V +L+ EL+A + ++  L+A   +L + LEN  S
Sbjct  590   ALRETQSELQRKDRELNEMQAQYERQVNDLIEELSASQEDRKALQATEQRLSKLLENHKS  649

Query  3718  SESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFK  3897
              E  L+  I+ LE +L + E +R +L D ++++K  + +   L D++  LK  L + K  
Sbjct  650   REEKLRTNINELELRLTVCEYDRQRLMDESTNMKAHVQQFENLHDQLSVLKIELTETKRD  709

Query  3898  NERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDL  4077
              E  +ASLQL+  E  +LKA+K  L+++++ +Q  V +LE+CR  KV+LEEK+ R+EG+L
Sbjct  710   KEEAKASLQLVSKECTDLKAEKNVLVEKISSLQELVNDLEDCRQSKVILEEKLQRMEGEL  769

Query  4078  TAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELN--RKENS  4251
              A++  C +  E+KN+L Q +R +   +   +QLE ++    +  ++ +EELN  R+E  
Sbjct  770   MAKQAKCDEAVEVKNELNQIRREHKHYQRMTQQLEEQKDEYLRRARASEEELNSMREEKR  829

Query  4252  VP-------SP---------SHSVAKDKTTS-----------------CKEQ-KLSKARS  4329
              P       SP         ++S  +D + S                  K+Q K+S AR 
Sbjct  830   KPKHVNNTRSPGLSKAHMKVANSATEDSSPSKRDIRKKPIMKNVRQQVVKDQPKMSNARH  889

Query  4330  S----QCNN--CETIQIVTIDDCSS---------RCQVGDDK-----TQFKSLQPEGQST  4449
                    NN   E+   V +D  S             V DD      ++     P   S 
Sbjct  890   HIEDIHINNSDVESCHDVGVDPRSKVSLLESDLVDSAVADDSDNIPLSRVPGGNPPPDSP  949

Query  4450  RSGNEN---------EQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQ  4596
             R              E+  S+LE+EL++I ERYLHMSLKYAEVE Q+  LVM LKA Q
Sbjct  950   RKATPEGEVVMRKKFERTKSRLESELRDIRERYLHMSLKYAEVEAQREVLVMKLKASQ  1007



>gb|KDP29215.1| hypothetical protein JCGZ_16604 [Jatropha curcas]
Length=1247

 Score =   243 bits (619),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 230/695 (33%), Positives = 387/695 (56%), Gaps = 67/695 (10%)
 Frame = +1

Query  2524  VKTGCL--EEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMR  2691
             ++TG L  EE++G   L + +R L +K+   Q     +E+++E V  E D  T   + +R
Sbjct  606   LETGLLSKEEEIG--NLKNYQRKLEDKLSVLQREKSQLEENVEIVIRENDIATKCLNDLR  663

Query  2692  EEMMVVTGRIFGNISEKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRH  2871
             +++MV+   +  N+S      K LE ++ KQ  +  + ELE+EN  L   +SGLE Q+R+
Sbjct  664   KDLMVLGSSVDTNVSAN----KTLERKSSKQNFKIHLSELEQENGDLLACISGLETQIRN  719

Query  2872  FTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEY  3051
              TDA +   +ELQ     +   QDE  +L  + E+Q+++ +++L EM             
Sbjct  720   LTDANKSMVLELQDSKFNVVKFQDETAKLRNEMETQKMDAEKKLEEMH------------  767

Query  3052  LKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSR  3231
                           L+EE  SLQ  N EL++Q+LELK  C+ LE +L+    + + C  R
Sbjct  768   -------------DLMEESSSLQKSNEELKKQKLELKGHCDRLEMKLKDLHRNFADCSKR  814

Query  3232  IESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEY  3411
             +  L+  +SS+LE+++SKE+ + SE++ +L + ++ K++L    S   Q+   K+ ++E 
Sbjct  815   VNVLQENISSLLEDSASKERSLTSEIDALLKENEKQKKKL----SELDQMHFEKMVQVEN  870

Query  3412  PQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVT  3591
              Q++   L  ++    +  D  AS+ ++E  SL              ++N+   E +L  
Sbjct  871   LQREVGELYKKLSVTEEERDRIASDSANEASSL--------------RKNITKLESELHA  916

Query  3592  TQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklll  3771
             +Q E + K+ +LM EL + K NQ +L+A + K+ + LEN    E   K  ++ +E KL +
Sbjct  917   SQTESKEKIQDLMDELASSKQNQEMLKADNGKMLKLLENYKLCEEKFKTALNGVELKLTV  976

Query  3772  seserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEEL  3951
             SE E+ QL + +++LK +LLKI  L+DEVLALK  +N +K + E+LE SL L   + +EL
Sbjct  977   SEYEKQQLIEESTNLKAQLLKIGTLQDEVLALKNEVNAIKTEKEKLEISLNLKAEDCKEL  1036

Query  3952  KADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLT  4131
               +K   I ++T +Q +++ELEE +   + LEEK+ +LE +L A+E +C +DA++KN+L 
Sbjct  1037  NIEKNLFIDKITDLQKTISELEEFKEDNLSLEEKIQKLESELIAKESLCEQDADVKNELN  1096

Query  4132  QSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQK  4311
               KR N QL+ +I+QLE  +   ++ +Q ++EEL   +    +P     K+      E +
Sbjct  1097  HIKRANKQLQQQIQQLEEVKEKSTRRIQILEEELIILKEKQRNPRK---KEGDNPVLEDE  1153

Query  4312  LSKARSSQCNNCETIQIVTIDDCSSRCQVGDD-KTQFKS-LQPEGQSTRSGNENEQKISQ  4485
             LSKA   + NN   +Q+  +   S + + G   K++ +S + P+ +  R+        S 
Sbjct  1154  LSKAM--EANNAFKVQVKRLTAESRKGRTGSPRKSKAESEVVPKEKFERTK-------SS  1204

Query  4486  LEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             LE ELKE+ ERY +MSLKYAEVE Q+ +LVM LKA
Sbjct  1205  LETELKELRERYFNMSLKYAEVEAQREELVMKLKA  1239


 Score =   179 bits (454),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 122/186 (66%), Gaps = 12/186 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L ++K++    SG++  F FS  +ALQVPKGWDKL VS+ISVE GKTI+K  KAS  
Sbjct  1    MFRLHKNKAA---KSGERIDFKFSQFKALQVPKGWDKLFVSIISVETGKTIAKSSKASSR  57

Query  241  NGTCQWTE----SLWSPENYASNGLDH-----FKFLVSMGSSRAGILGEATVNVGHYRNS  393
             GTCQWTE    S+W P++  S+         +K +++MGSSR+GILGEA +N+  Y +S
Sbjct  58   TGTCQWTETVSESIWVPQHVQSSSSKELEDCLYKLVLAMGSSRSGILGEALINMATYMSS  117

Query  394  EASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEE  573
               + VS PL+KCN GT+L  +I+CLTP+ + R  E   T ++ E+ N+     + KS+E
Sbjct  118  SDPVQVSFPLKKCNHGTILQLKIQCLTPKLNLRDSESKETNSHTEDLNTNSQDAEMKSDE  177

Query  574  RNNSLP  591
             +NSL 
Sbjct  178  SDNSLA  183


 Score =   143 bits (360),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 141/228 (62%), Gaps = 25/228 (11%)
 Frame = +1

Query  799   EEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRI  963
             +E    SL I+ +S       +A I++L++EA+ WE NAR+ M+ +E LRKE   QS+  
Sbjct  292   QEFAAQSLRISGSSKSLLEAAEATIKDLRSEAKKWEKNARKAMLDLEMLRKEHTEQSKYK  351

Query  964   ADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELK  1143
              +++M+LS A+ E + L  ++++L++LLE+S  K    E+   Q +   N++KE+EDE+K
Sbjct  352   VNLDMQLSAAYAERDGLQKEVEQLKLLLEKSKVKAGGLEDSTFQDEGVTNVIKELEDEIK  411

Query  1144  FQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSC  1323
             FQ ES +NLSL L +SQESN ELVSVLQE+EETV+K+K EIENL  L S+   M      
Sbjct  412   FQKESTANLSLLLNRSQESNVELVSVLQELEETVEKQKAEIENLSTLQSKFSDM------  465

Query  1324  GDEDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEE  1467
                     +S+ QV+V       ++Q LQES  +L+  +   EKA EE
Sbjct  466   --------ESSIQVNV------LQMQKLQESEKNLQAQVQELEKALEE  499



>ref|XP_003559014.1| PREDICTED: paramyosin-like [Brachypodium distachyon]
Length=1356

 Score =   242 bits (617),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 214/656 (33%), Positives = 368/656 (56%), Gaps = 41/656 (6%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +++++ V++  +  ++S  K+ E KI ELE+ K ELE  + ELE+EN++LSE
Sbjct  728   ITSKCLDELQQDIFVLSSSVDSHVSANKVLERKITELESCKAELELHISELEQENIELSE  787

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLEAQL + T+  E S +++    + + NL+D++   + + ++  LE KQ+  E Q+
Sbjct  788   RISGLEAQLSYMTNEKESSELQMHDSKSLVINLKDKVERQQVEMDTIRLEFKQKQQEAQR  847

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             +  ++Q++SE L+++N  LQ+T E+LIEEC SLQ L  +L+RQ+LEL  +    E EL  
Sbjct  848   KLTEAQDDSEVLRRSNSNLQSTVENLIEECSSLQNLIADLKRQKLELHGRFTQQEQELDN  907

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +         +E LE KL+S+ ++ SSKE+ + SELE I  +  E +E++     + ++
Sbjct  908   SKKRNFEFCKTVEFLETKLTSLQKDISSKEQSLLSELESIFQEHMEQEEKINRAHFMLNK  967

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             + + K  E+E  +++   L  Q+    +  +    +   E+  L A+   L+   + + +
Sbjct  968   IEKEKTLEVENLEREVMSLSAQVSSTHEERENATVDAIREVSILRADKAKLEANFENVSE  1027

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E ++   + E + K+  L+  LNA K ++ +L A ++ +++ +E   S+E +L+ 
Sbjct  1028  QLRHYESQIEDLRKESKNKIKGLVDSLNASKQSEEMLTADAEHMKKLMEAAKSNEDDLRM  1087

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
                 LE KL  S+ E+ QL +  S LK+++ KI  L+DEV  L+ SL++ KF+  +LE  
Sbjct  1088  TSGELELKLKSSDYEKQQLMEEISGLKLQVQKITSLQDEVFKLRNSLDETKFEKGKLEEL  1147

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
              Q +  E EELKA K  L  +++ M+ ++   EE +  +  ++ K++RLE DL+A E   
Sbjct  1148  QQSVTEECEELKAQKAMLTDKVSNMEETLKSGEEEKRSRRSMQAKLVRLESDLSASEASH  1207

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ +R NS+ + KI+ LE E   L+++ Q     L+ K++   S      
Sbjct  1208  VHEAELKNELSRIRRSNSEYQRKIQSLEQEIEDLTRQAQ-----LDGKQDIGYS------  1256

Query  4279  KDKTTSCKEQKLSKARSSQCNNCET-----IQIVTIDDCSSRCQVGDDKTQFKSLQPEGQ  4443
                                 +N ET     IQ++ +    +  +    + Q KS  PEGQ
Sbjct  1257  -------------------TDNGETDIQSKIQLLEMKLAEALEENRMYRAQEKSPMPEGQ  1297

Query  4444  STRSGNE--NEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             S     +  N  +I QLE EL+++ ER L+MSL+YAEVE Q+ +LVM LK ++  R
Sbjct  1298  SAGEDGKVNNTDRILQLEGELRDMKERLLNMSLEYAEVEAQRERLVMELKTIKKGR  1353


 Score =   128 bits (322),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 109/182 (60%), Gaps = 17/182 (9%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNS-GDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFKL RH+SS  D S G+++ F FS+ +A+QVP   D+L +S+ISV+ GKTI+K  K + 
Sbjct  1    MFKLHRHRSS--DRSVGERYEFRFSSFRAVQVPAVSDRLFLSIISVDTGKTIAKSSKTAA  58

Query  238  NNGTCQWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G CQW +S+  P  ++ + +        +K +VSMGS +  ILGE  +N+ ++ N   
Sbjct  59   RSGICQWPDSILEPIWFSRDEVSKEFYECQYKIVVSMGSIKTAILGEIFLNLSNFLNLVD  118

Query  400  SIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG--------DEVNSTAAYNEEENSVCNGI  555
               +SLPL++CN GTVL  +++C+  ++   G          V++ +  N++ ++  +G 
Sbjct  119  PTAISLPLKRCNSGTVLQLKVQCIGTKSKLSGMRSSKDMPPRVDNRSPINDDMDNKSDGS  178

Query  556  DN  561
            DN
Sbjct  179  DN  180


 Score = 99.4 bits (246),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 102/165 (62%), Gaps = 19/165 (12%)
 Frame = +1

Query  805   IGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
             I Q SL  + +S       +  IEEL+ EA+MWE ++R+L   +E L+KE + +S++  +
Sbjct  290   IAQSSLGTSDSSKDLLEAAEETIEELRDEAKMWERHSRKLKADLEALKKECSEKSRQQTE  349

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAEN------LNLQAKNTENILKEME  1131
             + +ELS AH E +    +I+ L+   +E   +Q  +        ++LQ        KE+E
Sbjct  350   LAVELSAAHAERDSYRQEIEELKSSRQEVTTRQTKSGTPKRGDWIDLQ--------KELE  401

Query  1132  DELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEI  1266
             DE+KF  ESN NL++QL+ +QE+N ELVS+LQE+EET+++++ EI
Sbjct  402   DEMKFLKESNLNLTVQLKNTQEANIELVSILQELEETIEEQRAEI  446



>ref|XP_004516962.1| PREDICTED: myosin-9-like [Cicer arietinum]
Length=721

 Score =   235 bits (600),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 214/662 (32%), Positives = 351/662 (53%), Gaps = 72/662 (11%)
 Frame = +1

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             + ++E EN QLS RVS LE ++R  T+  E    EL++   Q   L+++I E++ + +S 
Sbjct  58    ISDIEHENGQLSMRVSALEDEVRDLTNEQESQLSELENDRNQAARLREKIMEMQYEMDSS  117

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
               +LKQ+L   Q  W ++QEESEYL+  N +LQ T E+  +EC+S + LNG LR+Q+LEL
Sbjct  118   IEDLKQKLKATQFHWSEAQEESEYLRGENQQLQITIENPEDECNSFENLNGYLRQQKLEL  177

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
             +  C+L+ A LR+     + C  R+  LE K S +LE+ + KEK + S+++ IL    E 
Sbjct  178   EDNCSLMGARLRESSERFADCCGRVGFLEKKFSLMLEDIALKEKDLTSDMDGIL---DEN  234

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             K+ +   ++L ++L   K+ +++  + +  +L  +     D ++  AS    E+  L AE
Sbjct  235   KKHMAQGQNLLNELQMEKMVDIQNLKLEIENLSLKFSAAYDEKERIASNALLEVSELRAE  294

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
                L+    E Q  + + + ++ T Q +YE+K+ E   EL   KT   +  A+ +KL + 
Sbjct  295   KDKLEYAFGEAQSKVILFKTEVNTMQTQYEQKLKEQTTELADFKTKMEMQIAEHEKLAKL  354

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
             +E+  S E   K  I+ LESKL ++E ER +  D + +LK++L +     +E++ALK  L
Sbjct  355   VEDYKSRELKFKSTINALESKLTVTEYERHKYLDESGNLKVQLQQTRQSENEIMALKSEL  414

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             N    + ERLEASL L     E+LKA+ TSL Q+++ ++ + +ELE C+  +  +EE+++
Sbjct  415   NASNTEKERLEASLCLTSDLCEDLKAENTSLEQKVSRLETAASELEHCKRTRASIEERIM  474

Query  4060  RLEGDLTAREVMCA-KDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEE--  4230
             +LE DL ARE  CA  D EL N     KR+NSQL+  I+QLE E+    ++ Q+ +EE  
Sbjct  475   QLENDLKARETRCAHHDTELNN----IKRINSQLQQTIQQLEQEKAEFQRKAQAFEEELK  530

Query  4231  ------------LNRK---------ENSVPSPSHSVAKDKTTSC--------KEQKLSKA  4323
                         LNRK         +NS+   ++ V  ++  S         K+Q     
Sbjct  531   LFKEQKRNQVSKLNRKTVHDDQKASKNSMVKNTNQVRSNRKKSSLKNDREILKDQHDPYY  590

Query  4324  RSSQCNNCET--------IQIVTIDDCSSRCQVGDD-----------KTQFKSLQPEGQS  4446
              S   N  E+        +  V ++  S    +  +           + Q   L P+G++
Sbjct  591   SSKHQNEVESEHGLLDDNVHTVELEPVSKTQLLATELEKSEEAKNIYEVQLNRLSPQGRN  650

Query  4447  TRSGN--------------ENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTL  4584
              ++                + E+  S LE EL++I +RY HMSLKYAEVE+++ +LVM L
Sbjct  651   NQAEGPVKSMAEEEVVTKEKFERTKSMLEEELRDIQDRYFHMSLKYAEVESEREELVMKL  710

Query  4585  KA  4590
             K 
Sbjct  711   KV  712



>gb|ABI51615.1| RPG [Medicago truncatula]
 gb|KEH43340.1| myosin heavy chain-like protein, putative [Medicago truncatula]
Length=1255

 Score =   240 bits (613),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 178/484 (37%), Positives = 285/484 (59%), Gaps = 0/484 (0%)
 Frame = +1

Query  2797  CVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKES  2976
              +FELE E  QLSE++SGLEA++RH  +   L+ + L++    +  LQ EIR +E   E 
Sbjct  761   AIFELEAEVAQLSEQISGLEAEVRHLNEEKALTHLALENSENIVIYLQAEIRRMENINEG  820

Query  2977  QELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLE  3156
             Q+++LK     +QK+W ++QEE ++LK +N KLQAT E+LI+   +LQ+ NGELR +   
Sbjct  821   QKIDLKIMGESIQKKWTEAQEECDFLKGSNLKLQATNENLIQVSKTLQMANGELRMRNFA  880

Query  3157  LKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKE  3336
             L  +  +LE++L + Q + S  +  IE LE K +SILEE + KEK +N +LE +L ++ +
Sbjct  881   LHNRYTVLESKLGESQITFSDIMKFIEDLECKFTSILEEIALKEKTINVDLEALLQESIK  940

Query  3337  FKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFA  3516
               ER  I+E   +Q+   K +E+   Q++  HL +Q+ D  DR +  AS+   +++ L A
Sbjct  941   QNERFTIEERFLTQMYMEKAAEVSNLQREVEHLTDQISDIYDRHNIIASKVVLDVYDLCA  1000

Query  3517  ENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQR  3696
             +  + +  LQE Q+ +++ E KL   Q EYE  V+    EL A +     L    +K   
Sbjct  1001  DKAITESALQEEQEKVKLYEAKLDNLQAEYEITVHNYNKELAAMREKHETLMVNHEKTVV  1060

Query  3697  WLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGS  3876
              L +  S+E  L+ I+  LE +L  SE ERLQ  +  S L+++L K   L++E+  LK S
Sbjct  1061  LLGSSKSNEEKLEGIVRGLEVELKDSELERLQATEEISELEVQLQKTVVLQNELFILKKS  1120

Query  3877  LNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKV  4056
             L + + +  RLEAS Q++  E + LKA+K S +Q L   +   +E E+C+  KV LE+K+
Sbjct  1121  LYEAEIEYRRLEASYQMLSLEYDVLKAEKVSYMQRLLTTEKVTSEFEDCKRTKVELEDKI  1180

Query  4057  LRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELN  4236
             +RLE DLT +E     +A LK +L Q  R N +L  +   L  E     K+++S++E+L 
Sbjct  1181  IRLEWDLTTKEASWRNNARLKYELAQVTRENGELFKEKDSLRQENEEYQKKVKSLEEKLK  1240

Query  4237  RKEN  4248
             +K++
Sbjct  1241  QKDD  1244


 Score =   124 bits (311),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 102/177 (58%), Gaps = 11/177 (6%)
 Frame = +1

Query  55   REMFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKAS  234
            +E  KL R    + D   ++  F F + +AL++ KGW++L VS+I +E G+TI+K GKA 
Sbjct  20   KEKRKLCRSSRHSRDKFQERLDFKFYDFKALEIEKGWNQLFVSIICIETGETIAKSGKAL  79

Query  235  VNNGTCQWTESL----W-SPENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
            V NG C W +S+    W S  +   N     K LV+MGS R G LGEAT+N+  Y   E 
Sbjct  80   VKNGECDWEDSMLSTIWISDYSLQDNQACLLKLLVAMGSPRFGTLGEATINLSSYIGQE-  138

Query  400  SIPVSLPL-QKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKS  567
            +   SLPL   C++G +L  +I+CLTPR ++R D      +Y EE +   + +D+ S
Sbjct  139  TFTASLPLIHHCSRGAILQVKIQCLTPRRNYRKD----ANSYGEEMSVGYDDVDSIS  191


 Score =   100 bits (248),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 90/142 (63%), Gaps = 5/142 (4%)
 Frame = +1

Query  850   ANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIK  1029
               IE L  E +MWE  +R+LM  ++ LRKE   +S+   D+EMELS +  ES+ L  +I+
Sbjct  336   VTIELLHGEVKMWEEGSRKLMTDVDRLRKELQKKSKHKKDLEMELSASRKESSDLKEEIQ  395

Query  1030  RLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAE  1209
             RL  ++     KQ  + N  LQ +  +NI+KE++DE+ +Q   N +L ++L K+QESN +
Sbjct  396   RLTAMV-----KQNGSRNHRLQIEEMDNIIKELKDEINYQKGLNHDLEVKLNKTQESNID  450

Query  1210  LVSVLQEMEETVQKKKIEIENL  1275
             +VS+ +  E+ V+K+K+EI  L
Sbjct  451   IVSIFRNFEKKVEKQKMEIARL  472



>ref|XP_002468681.1| hypothetical protein SORBIDRAFT_01g050140 [Sorghum bicolor]
 gb|EER95679.1| hypothetical protein SORBIDRAFT_01g050140 [Sorghum bicolor]
Length=1232

 Score =   239 bits (610),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 190/541 (35%), Positives = 324/541 (60%), Gaps = 8/541 (1%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D +R++++V++  +  ++S  K+ E  I+ELE+ K ELE  V ELE+EN++LSE
Sbjct  690   ITSKCLDEVRKDILVLSSSLDSHVSTNKLLERNIVELESCKAELELHVSELEQENIELSE  749

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLEAQL + TD  E S +++    + + NL+D++   + + E+Q LE KQ+  E Q+
Sbjct  750   RISGLEAQLTYLTDEKESSELQMHDSRSLIINLKDKVERQQSEMETQRLEFKQKQQESQR  809

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             R  ++Q++SE L+++N KLQ+T ESLIEEC SLQ L  +L++Q+LEL       E EL +
Sbjct  810   RLSEAQDDSEVLRRSNSKLQSTVESLIEECSSLQNLTADLKKQKLELHGHLTQKEQELDE  869

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +         +E LEAKLSS+ ++ SSKE+ + SELE I  +  E +ER+     + ++
Sbjct  870   SKKRNFEFSKTVEFLEAKLSSLQKDISSKEQYLLSELESIFQEHMEQEERINRAHFMLNK  929

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             + + K  E+E  +++   L  Q+    +  +    +   E+  L A+N  L+  LQ++  
Sbjct  930   IEKEKNLEVENLEREVVSLTAQVSSTHEERESATLDAIREVSVLRADNAKLEANLQDVSA  989

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L + ++ +++ +E   S+E  L+ 
Sbjct  990   QLRHYESQLEDLRKESKNKIKGLVDSLNASKQSEEMLTSDAEHMKKLMEAAKSNEDALRK  1049

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
               + LE KL  S+ E+ Q+ +  S LK+++ KI  L+DEV  L+ SL+++KF+  +LE  
Sbjct  1050  TSNELELKLKSSDYEKQQMLEEISGLKLQVQKIMNLQDEVFKLQSSLDEVKFEKGKLEEF  1109

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L+ +  E EELKA K  L  +++ MQ ++   EE +  ++ ++ K++RLE DL+A E   
Sbjct  1110  LRSVTEECEELKAQKAMLTDKVSDMQETLRNGEEEKRNRIAMQAKLVRLESDLSASEASH  1169

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNR----KENSVPSPS  4266
               +AELKN+L++ KR NS+ + KI+ L+ E   L++ +Q +++   +    KEN     S
Sbjct  1170  VHEAELKNELSRIKRSNSEYQRKIQTLDQENEDLTRRIQIMEKNFEQMSHVKENLAKQVS  1229

Query  4267  H  4269
             H
Sbjct  1230  H  1230


 Score =   135 bits (341),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 98/150 (65%), Gaps = 8/150 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G++F F FSN +A+QVP   D+L +S++SV+ GKTI+K  K +  
Sbjct  1    MFKLHRHRSS--DRVGERFDFRFSNFRAVQVPAVSDRLFLSIVSVDNGKTIAKSSKVASR  58

Query  241  NGTCQWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW +++  P  ++ + +        +K +VS+GS+++GILGE  +N+ ++ N    
Sbjct  59   SGICQWPDTILEPIWFSKDEVSKEFEECQYKIIVSLGSTKSGILGEIFLNLSNFLNLVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
              +SLPL++CN GTVL  +++CL  ++  R
Sbjct  119  TAISLPLKRCNSGTVLQLKVQCLGTKSKLR  148


 Score =   102 bits (255),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 104/150 (69%), Gaps = 6/150 (4%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE ++R+L   +E L+KE + +S++ A++ +ELS A  E +   H+I+ L
Sbjct  294   IEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQQAELSVELSAAQAERDSYRHEIEEL  353

Query  1036  EVLLEESNAKQIAAENLNLQAKNTE--NILKEMEDELKFQTESNSNLSLQLRKSQESNAE  1209
             +  L++ N +QI    +    K ++  ++ KE+E E+KF  ESN++L++QL ++QESN E
Sbjct  354   KSSLQDVNTRQI----IKGTPKRSDWIDLQKELEGEVKFLKESNTDLTIQLNRTQESNIE  409

Query  1210  LVSVLQEMEETVQKKKIEIENLLALNSRSD  1299
             L+S+LQE+EET++++++EI  +  +   +D
Sbjct  410   LLSILQELEETIEEQRVEISKISKVKQTAD  439



>ref|XP_004496302.1| PREDICTED: centromere protein F-like [Cicer arietinum]
Length=1256

 Score =   239 bits (609),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 179/483 (37%), Positives = 284/483 (59%), Gaps = 0/483 (0%)
 Frame = +1

Query  2797  CVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKES  2976
              +F L++E  QLSER+SGLEA++R+  +  EL+ + L++    +  L+ EI+ +E   ES
Sbjct  718   ALFALKEEVAQLSERISGLEAEVRYLNEEKELTHLALENSENIVTYLKAEIKRMENINES  777

Query  2977  QELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLE  3156
             ++++LK     MQKRW ++QEE  +LK  N KLQA  E+LI+   +LQ  NG LR Q L 
Sbjct  778   RKVDLKIMGESMQKRWTEAQEECGFLKGGNLKLQAINENLIQVSKTLQATNGVLRMQNLA  837

Query  3157  LKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKE  3336
             L  +  +LE++L + Q + S  +  +E LE K +S+LEE + KEK +N ++E +L ++ +
Sbjct  838   LHNRYAVLESKLGESQIAFSDIMKLVEDLECKFTSMLEEIALKEKTINVDIEALLQESVK  897

Query  3337  FKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFA  3516
               ER +I+E   +Q+   K +E+   Q++  HL +Q+ D  DR    AS     ++ L +
Sbjct  898   QDERFIIEERFLTQMYMEKAAEVSNLQREVEHLTDQVSDIFDRHKIIASNVVLHVYDLCS  957

Query  3517  ENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQR  3696
             +  M +  LQE Q+ L++ E KL   Q EYE  V+    EL     NQ  L  K +K+  
Sbjct  958   DKAMTEAALQEEQEKLKLYEAKLDNLQAEYEVTVHNYNEELATMTENQENLMVKHEKVVL  1017

Query  3697  WLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGS  3876
              L N  S+E  LK I+  L  +L  SE ERLQ  +    L+++L K   L++E+  LK S
Sbjct  1018  LLGNSKSNEEKLKGIVRRLVVELKTSELERLQATEEIFELEVQLQKTEVLQNELFILKRS  1077

Query  3877  LNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKV  4056
             L ++KF+  RLE S Q++  E + LKA+K S +Q L+  +   +ELE+C+  KV LE+K+
Sbjct  1078  LYEVKFECRRLETSYQMLSLEYDVLKAEKVSCMQRLSTTEEVTSELEDCKRSKVELEDKI  1137

Query  4057  LRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELN  4236
              RLE DLT +E     +A+LK +L Q  R N +L  K + L+ E     K+++ ++E+L 
Sbjct  1138  FRLEWDLTTKEASWHSNAQLKYELAQVTRENGELFKKKEYLQQENEDYQKKVKVLEEKLK  1197

Query  4237  RKE  4245
             +K+
Sbjct  1198  QKD  1200


 Score =   122 bits (305),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 95/151 (63%), Gaps = 11/151 (7%)
 Frame = +1

Query  73   RRHKSSTSDNSGDKF----GFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            R+ KSS++ +S DKF     F F + +AL++ KGW++L VS+IS+E G+TI+K GKA V 
Sbjct  29   RKIKSSSTGHSRDKFEERLDFKFYDFKALEIEKGWNQLFVSIISMETGETIAKSGKALVQ  88

Query  241  NGTCQWTESL----W-SPENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASI  405
            NG C W +S+    W S  ++  N     K LV+MGS R G LGEAT+N+  Y   E + 
Sbjct  89   NGQCHWEDSMLSTIWISDYSHEDNEACLLKLLVAMGSPRFGTLGEATINLASYIVPE-TC  147

Query  406  PVSLPL-QKCNKGTVLNFEIKCLTPRTSFRG  495
              SLPL Q  + G +L  +I+CLTPR ++R 
Sbjct  148  TASLPLIQHGSHGAILQVKIQCLTPRRNYRS  178


 Score =   105 bits (263),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 111/183 (61%), Gaps = 9/183 (5%)
 Frame = +1

Query  850   ANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIK  1029
               IE L  E +MWE + R+L   +E LRKE   +S+   D+EMELS +  ES  L  +I+
Sbjct  293   VTIELLHGEVKMWEESTRKLTTDVERLRKELHKKSKHKKDLEMELSASRKESGDLKEEIQ  352

Query  1030  RLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAE  1209
             RL  ++++++++     NL LQ +  +N++KE++DE+ +Q   N +L ++L ++QESN +
Sbjct  353   RLTAMVKQNDSR-----NLRLQTEEMDNVIKELKDEINYQKGLNYDLEVKLNRTQESNID  407

Query  1210  LVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSV--EKQC  1383
             +VS+ +  E+ V+K+K+EI  L   N R D  G  NS G ED+ +   +  + V  EK  
Sbjct  408   IVSIFRNFEKMVEKQKMEIAELSRTNRRFD--GENNSRGIEDSEEEDFSLSIDVLPEKMR  465

Query  1384  QEF  1392
             +EF
Sbjct  466   KEF  468



>ref|XP_007144313.1| hypothetical protein PHAVU_007G145600g [Phaseolus vulgaris]
 gb|ESW16307.1| hypothetical protein PHAVU_007G145600g [Phaseolus vulgaris]
Length=1325

 Score =   239 bits (609),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 188/561 (34%), Positives = 316/561 (56%), Gaps = 19/561 (3%)
 Frame = +1

Query  2662  KDDITSDSMREEMMVVTGRIFGNISEKIQEMKILELENEK----------QELESC----  2799
             ++++T  S++E + +++ +   NI  K+        +N++             ESC    
Sbjct  754   QNEVTDCSVKENIFLISSQELRNIQAKLMSDSPPHTKNQQVGSSKNHVRNPSFESCDDEG  813

Query  2800  --VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKE  2973
               +F LE E +QLSERV  LEA++RH  +  E + + L++    + NLQ EIR +E+  E
Sbjct  814   NVLFGLEAEKVQLSERVLDLEAEMRHLIEEKESTHLALENTENVVKNLQAEIRRMEELNE  873

Query  2974  SQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRL  3153
             +QE+ELK R   MQK+W ++QEE  +LK AN +LQAT E LIEE  +LQ  N +LR Q L
Sbjct  874   AQEVELK-RKESMQKKWKEAQEECSFLKVANLELQATNEKLIEESKALQTTNDDLRMQNL  932

Query  3154  ELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTK  3333
             +L  QC +L+++L +   + S  L  +E L+ + +S+ EE + KEK +N +++ IL +++
Sbjct  933   DLHGQCTVLDSKLGESYIAFSDMLKLVEELKYQFTSMQEEIALKEKTINVDIDCILEESR  992

Query  3334  EFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLF  3513
             +  E+ + +E     +   K +E+ Y Q++  HL +Q+    DR +  AS    E++ L 
Sbjct  993   KQDEKFINEEKFLIHMNLEKTAEVGYLQREVEHLRDQISGIYDRHERMASNTVLEVYDLC  1052

Query  3514  AENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQ  3693
             A+  M++  LQ+ Q+N+ + E KL   Q EY+  +     EL A + NQ  L    + + 
Sbjct  1053  ADKAMIEAALQQEQENVRLHEAKLDNLQAEYKVMMQNNTEELAASRANQETLMVNHENVV  1112

Query  3694  RWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKG  3873
               L+ V S+E  LK  +  L+++L  SE ERL   +    L+++L K   L+DE+  LK 
Sbjct  1113  ALLDTVKSNEEKLKGTVRGLQAELKASELERLHATEEIFELEVQLQKTEMLQDEIFILKR  1172

Query  3874  SLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEK  4053
             SL + +F+  RLEAS Q +  E EELKA   S I+ ++  +   +ELE+C+  K+ LEEK
Sbjct  1173  SLYEAEFEFRRLEASYQTLSLEFEELKAKNVSYIRRISTTEKVTSELEDCKRSKIELEEK  1232

Query  4054  VLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
             +LRL+ +L  +E  C  +A+LK ++ +  + N++L  K   L+ E      +++  +E L
Sbjct  1233  ILRLQWNLKTKEASCLNNAQLKYEIAEMTKDNAELHRKKDFLQQENEEYKNKVKDFEERL  1292

Query  4234  NRKENSVPSPSHSVAKDKTTS  4296
              +K++     +   AKD +TS
Sbjct  1293  KQKKD--VKENQYDAKDCSTS  1311


 Score =   182 bits (462),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 150/452 (33%), Positives = 229/452 (51%), Gaps = 65/452 (14%)
 Frame = +1

Query  70    LRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGT  249
             L RH     D   ++  F F + QALQ+ KGW+ + VS+ISVE G+TI+K GKASV NG 
Sbjct  28    LSRH---GRDQCQERLDFKFFDFQALQIEKGWNNIFVSIISVETGETIAKSGKASVQNGK  84

Query  250   CQWTESLWSPENYASNGLDH-----FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVS  414
             C W +S+ S    + + L        K +V+MGS+R G LGEAT+N+  Y   E S   S
Sbjct  85    CHWEDSMLSTMWISHDLLQPNESFLLKLVVAMGSARFGTLGEATINLASYIKPEVS-TAS  143

Query  415   LPL-QKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVC-NGIDNKSEERNNSL  588
             LPL Q C+ GT+L  +I+CLT R+  R  E NS      EE SVC + +++ S+  +N+ 
Sbjct  144   LPLRQHCSHGTILQVKIQCLTQRSKHR-KEANSLV----EEMSVCSDDVNSISDVSDNTF  198

Query  589   PSMEDSLGRDSLssasnssavvnnaIRRLEST---ESG-------GSAPWssysygspks  738
                  S   D L +  +   + +  I  L +    ++G       G  P  S   G  K+
Sbjct  199   SRTSGSSYWDRLENTYHRRELSSKRISPLATCSDHDTGSSLSFWIGKFPQQSNVSGLKKN  258

Query  739   nnspnklsisCQEKHPEYTE---------------------EEIGQCS----LHITRT--  837
              N     + S    +P Y                       EE+G+ S      +TR+  
Sbjct  259   MNERQYSTYSENSNYPLYDTSGSIDSSPVTSSSGTRLQGKIEELGKVSHASDTRLTRSVG  318

Query  838   ------SIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHT  999
                    +    I+ L  EA+MWE NA +LMV +E L++    +S+   ++EMELS +  
Sbjct  319   SSNDLLGVAQVTIDLLHGEAKMWEENATKLMVDVERLQEHLHKKSKNKKELEMELSVSRK  378

Query  1000  ESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQ  1179
             E N L  +I+ L      S  KQ  + NL LQ +  +N +KE++DE+ +Q   N  L L 
Sbjct  379   EINTLKDEIQLL-----TSTIKQNDSRNLKLQIEEMDNTIKELKDEINYQKGLNCELEL-  432

Query  1180  LRKSQESNAELVSVLQEMEETVQKKKIEIENL  1275
             ++K+QE   +LVS+LQ++E+  +K++++I  L
Sbjct  433   IKKTQEPKIDLVSILQKLEKIKEKQEMKISGL  464



>ref|XP_010098844.1| hypothetical protein L484_022609 [Morus notabilis]
 gb|EXB75932.1| hypothetical protein L484_022609 [Morus notabilis]
Length=1390

 Score =   238 bits (608),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 207/582 (36%), Positives = 331/582 (57%), Gaps = 30/582 (5%)
 Frame = +1

Query  2419  DPCSSHQGYKNFK-ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLAN  2595
             D  +S Q  ++ K E E +   + N++  K S++ ++    L ++  +  L   + +L  
Sbjct  607   DDNASVQRLQSLKMEPEARLAEMDNDLPEKRSEVEKLHIDLLSKEEEISVLRKSQSELEA  666

Query  2596  KIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKIL  2763
             K+ D Q     +++ ME V  E  +ITS   + +R ++ V+T  +  +IS  K+ E K  
Sbjct  667   KVSDLQRDKTQLQEHMEVVLQE-SEITSKCLNDLRNDLAVLTSSMDPHISANKLLERKSS  725

Query  2764  ELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQD  2943
             ELE   +ELE  V ELE EN +LSE V+ LE +LR  T   E S++EL+   +    LQD
Sbjct  726   ELETGNRELELHVSELEGENAKLSELVASLEDELRCLTSEQESSQLELEKSKSHSMTLQD  785

Query  2944  EIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQI  3123
             EI  L  +  S++   KQ+L  M+ + L+ QEE EYL++ANPKLQ+T ESL+EEC+SLQ 
Sbjct  786   EINRLRIEMASEKETAKQKLENMEDQLLEVQEECEYLRRANPKLQSTVESLLEECNSLQK  845

Query  3124  LNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNS  3303
                EL  ++LEL  +C+LLEA+L +   S + C  R++ LE  LSS+L E +SKEK   S
Sbjct  846   SKEELSNEKLELHNRCSLLEAKLEESHLSFTDCSKRVDELEQCLSSVLAEFASKEKCFAS  905

Query  3304  ELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKAS  3483
             E+  ++ +    KE+   +E+L +Q+   K  E+E  QQ+   L+N++    +  +  +S
Sbjct  906   EIVALVDENLRHKEKFNQEENLLNQMYMEKAVEVENLQQEVELLINKLSAKHEENERISS  965

Query  3484  EGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQV  3663
             +   E+  L A+N  L   LQ+ +  ++ TE +L   Q +YE K+  L  EL A  +NQ 
Sbjct  966   DAMEELSRLRADNTKLDADLQQARSKIKKTEDELRIKQKDYEVKLKSLSSELAA--SNQ-  1022

Query  3664  VLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAF  3843
                   +KL +  EN  S E+ LK ++++LE +L   ESER +L + ++ LK++L K+A 
Sbjct  1023  ----DHEKLSKLSENYKSGEAKLKSVVNDLEIRLRALESERRELVEESAHLKVQLQKLAH  1078

Query  3844  LRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEEC  4023
             L  E+LA K  L++ K + E+LE S+     E E+LKA+K  L++ ++ ++ SV+ELE+C
Sbjct  1079  LEAEILAFKNELDETKIEKEKLEVSVLARSNECEDLKAEKNELVENVSFLKMSVSELEDC  1138

Query  4024  RLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVN  4149
             +  K+ LEE                 +DAELK +L Q +R N
Sbjct  1139  KSEKMALEE-----------------RDAELKKELNQIRREN  1163


 Score =   153 bits (387),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 103/246 (42%), Positives = 152/246 (62%), Gaps = 18/246 (7%)
 Frame = +1

Query  787   EYTEEEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQ  951
             E + +E    SL  T ++       +  IEEL+AEA+MWE NAR+LM+ ++ LR EF++Q
Sbjct  243   ENSRQEFPASSLTTTSSAKNFRDTAEGTIEELRAEAKMWERNARKLMLDLDILRGEFSDQ  302

Query  952   SQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEME  1131
             S+   ++ +EL  A+ E + L  ++++L   LE+S  KQ ++ NL    ++   I KE++
Sbjct  303   SKVQENLNLELLAAYDERDDLKKEVEQLRFSLEKSMVKQTSSGNLTSLGEDLPLIEKELK  362

Query  1132  DELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGV  1311
             DELKFQ ESN+NL+LQL+K+QESN ELVSVLQE+EET+ K+K EIE+LLAL S+   MG 
Sbjct  363   DELKFQKESNANLALQLKKTQESNIELVSVLQELEETIDKQKTEIEDLLALQSKVGDMGE  422

Query  1312  INSCGDEDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELE  1491
             I     E+N   + T+Q+           Q +QE   +L   +   E+A EEK  EIE  
Sbjct  423   ITDVNVEEN--KRLTDQI-----------QKMQEVEKNLNIEVKQLEQALEEKNQEIEKA  469

Query  1492  QDLRAQ  1509
             + L +Q
Sbjct  470   ESLNSQ  475


 Score =   141 bits (355),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (70%), Gaps = 8/125 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            M +L RH+ +    SGDK  F FS+ +ALQVPKGWDKL VS++SVE GKTI+K  KA+V+
Sbjct  1    MLRLHRHRQAA--KSGDKLDFKFSSFKALQVPKGWDKLVVSVVSVETGKTIAKTSKAAVH  58

Query  241  NGTCQWTESLWSPENYASNGLDH------FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQW+E+L      + +G         FK +V MGS+R+GILG+ATVN+  Y ++ AS
Sbjct  59   NGNCQWSETLSESIRVSQDGSSKEMEDCPFKLIVFMGSARSGILGDATVNMTDYMSTSAS  118

Query  403  IPVSL  417
            +PVSL
Sbjct  119  VPVSL  123



>ref|XP_006662573.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
[Oryza brachyantha]
Length=1425

 Score =   235 bits (600),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 210/651 (32%), Positives = 362/651 (56%), Gaps = 34/651 (5%)
 Frame = +1

Query  2686  MREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQ  2862
             +REE++V+T  +  ++S   + E KI ELE  K  LE  + +LE+EN++LS+ + G+EAQ
Sbjct  784   VREELLVLTSSVDSHVSTNNVLETKISELEIYKGSLELHISKLEQENIELSDSICGIEAQ  843

Query  2863  LRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEE  3042
             L + T  MELS ++L    + + +L D + + + + E+Q++ELK+  +E  +R  + QE+
Sbjct  844   LNYLTSEMELSMLQLDESRSLITDLNDNLIQQQAEVEAQKVELKKNQLESDRRLSEVQED  903

Query  3043  SEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSC  3222
             SE L+++N KLQ+T +  +EEC SLQ L  +L++Q+LE+      LE EL + +      
Sbjct  904   SETLRRSNAKLQSTVDRAVEECKSLQTLTADLKKQKLEVHGYAAHLEQELEQSKRKTMDF  963

Query  3223  LSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSE  3402
                +E L+AKLSS+ ++ S KE+ + SELE I  + KE +ER+     L +++ + K+ E
Sbjct  964   CKTLEFLDAKLSSLQKDISFKEQSLLSELENIFQEHKEHEERIKHAHFLLNKIEKEKIVE  1023

Query  3403  LEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVK  3582
             L   +++   L  Q+    +  +    +   E+  L A+   L+  L+++   +   + +
Sbjct  1024  LSNLEREVVSLTAQVSSTQEERENSTLDTIREVSILRADKAKLEANLEDVNAQMIHYKSQ  1083

Query  3583  LVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesk  3762
             L   Q E + K+  L+  LNA K N+ +L    D ++R +E+  S+E++L+  +  LE K
Sbjct  1084  LEDLQ-ESKAKIKGLVDSLNASKQNEEMLATDVDHMRRSIEDARSNENDLRKTLCELELK  1142

Query  3763  lllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGEN  3942
                S+ E+ Q+ +  S LKI++ KI+ L+DE+L L+ SL+  KF+  +LE  LQ +  E 
Sbjct  1143  FKSSDYEKHQIIEEISGLKIQVCKISALQDEILTLQNSLDKAKFEKGKLEGLLQSLSEEC  1202

Query  3943  EELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKN  4122
             EELK+ K     ++  +Q+++    E +  ++  + K + L+ D  A E     +AELK+
Sbjct  1203  EELKSQKGISTDKVACLQDTLNVANEEKQSEISKQTKPVMLDDDTPANETSHVLEAELKS  1262

Query  4123  DLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSCK  4302
             +L+  K  NS+ + KI  LE E   L +  Q +++EL                 KT   K
Sbjct  1263  ELSIIKGANSEYQQKIHSLEKENEDLMRRSQLMEKELEL---------------KTNQNK  1307

Query  4303  EQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDD------------KTQFKSLQPEGQS  4446
              + ++K  +    N ++  +  + +  S+ Q+ +             + Q KS  PEG S
Sbjct  1308  HENINKQGNDANENGDS-PVNDVPELQSKIQLLETRLAEALEESKLYRGQLKSPIPEGNS  1366

Query  4447  TRSG---NENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             T      N+N+ KISQLE+ELK++ ER L+MS++YAEVE Q+ +LVM LK 
Sbjct  1367  TNKDVKENDND-KISQLESELKDMQERLLNMSMQYAEVEAQREELVMELKT  1416


 Score =   118 bits (295),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 87/139 (63%), Gaps = 6/139 (4%)
 Frame = +1

Query  73   RRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTC  252
            R  +  +SD  G++  F FS  +A+QVP   D+L +S+++V+ GKTI+K  KA+  +G C
Sbjct  4    RLDRRGSSDRPGERVEFRFSGFRAVQVPVVSDRLILSIVAVDTGKTIAKSTKAAALSGIC  63

Query  253  QWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVS  414
            QW +S+  P  ++ + +         +F+VSMGS+  GILGE  +N+ +Y +S  S  +S
Sbjct  64   QWPDSILEPIWFSQDEVSKEFHDCQCRFVVSMGSTENGILGEVLLNMTNYLSSLDSNAIS  123

Query  415  LPLQKCNKGTVLNFEIKCL  471
            LPL+KCN GT L   I+CL
Sbjct  124  LPLEKCNSGTTLQLNIQCL  142


 Score =   102 bits (255),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             I+EL+ EA+MWE  +R+L   +ETL+KE A++S++ +++ +EL+ +++E + L  +I+ L
Sbjct  312   IDELRGEAKMWERKSRKLKRGLETLKKESADKSKKQSELALELAASNSERDALRQEIEEL  371

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +  LE++   QI + +   ++ +   + KE++D+++F  ESN NLS QL+K+Q++N ELV
Sbjct  372   KCSLEQATEHQIISGSP--RSGDVIELHKEVKDDIQFLKESNVNLSTQLKKTQDANIELV  429

Query  1216  SVLQEMEETVQKKKIEIENL  1275
             S+LQE+EET++ +++EI N+
Sbjct  430   SILQELEETIEVQRVEISNI  449



>gb|KHN37874.1| hypothetical protein glysoja_016998 [Glycine soja]
Length=1363

 Score =   235 bits (599),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 172/486 (35%), Positives = 285/486 (59%), Gaps = 0/486 (0%)
 Frame = +1

Query  2791  ESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDK  2970
             ++ +F L+ EN+QL ER+ GLEA++R   +  E + +  ++    + NLQ EIR +E   
Sbjct  846   DNALFGLKAENVQLYERMLGLEAEMRQLIEEKESTHLARENYENVVKNLQAEIRRMEALN  905

Query  2971  ESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQR  3150
             E+Q++ELK++   MQK+W++ QEE  +L+ AN +LQAT  +LIEE  + Q  N ELR Q 
Sbjct  906   EAQKVELKRKEESMQKKWIEVQEECSFLRVANLELQATNGNLIEESKTFQTTNDELRMQN  965

Query  3151  LELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQT  3330
             LEL  QC +L+++L + Q   S  L  +E LE K +S+LE+ + KEK ++ +L+ +L ++
Sbjct  966   LELHCQCTVLDSKLGESQIVFSGMLKLVEELECKFTSMLEDIALKEKTIDVDLDALLEES  1025

Query  3331  KEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSL  3510
             ++  ER  ++E+  + +   K +E    Q++  HL +Q+    DR    AS    E++ L
Sbjct  1026  RKLDERFTMEENFLTHMYLEKTAEAGNLQKEVEHLRDQISGICDRHKRMASNIVLEVYDL  1085

Query  3511  FAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKL  3690
              A+  ML+  LQE Q+   + + +L     EYE  V     EL A + NQ  L    +K+
Sbjct  1086  CADKAMLESALQEEQEKARLYDTELDNLGAEYEVMVQNYAEELAASRANQETLMVNHEKV  1145

Query  3691  QRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALK  3870
                LENV  ++  LK  +  LE++L  SE ERL+  +  S L+++L K   L+DE+  LK
Sbjct  1146  VVLLENVKLNDEKLKGRVRGLEAELKASELERLKATEEISELEVQLQKTEMLQDEIFILK  1205

Query  3871  GSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEE  4050
              SL + +F+  RLEAS Q++  E +ELKA   S  + ++  +   +ELE+C+  K+ LEE
Sbjct  1206  RSLYEAEFEFRRLEASYQMLSLECDELKAKNVSYNRRISTTEKVTSELEDCKRSKIELEE  1265

Query  4051  KVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEE  4230
             K LRL+ +LT +E  C  +A+LK ++ Q  R N +L  +   L+ E      +++ ++E+
Sbjct  1266  KNLRLQWNLTIKEASCHNNAQLKYEVAQMTRENGELHREKDSLQQENEEYKNKVKDLEEK  1325

Query  4231  LNRKEN  4248
             L +K++
Sbjct  1326  LKQKKD  1331


 Score =   211 bits (536),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 173/492 (35%), Positives = 269/492 (55%), Gaps = 51/492 (10%)
 Frame = +1

Query  67    KLRRHKSSTSDNSGDKF----GFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKAS  234
             K +R   + S ++ DKF     F F + QAL++ KGW+ L VS+IS+E G+TI+K GKA+
Sbjct  21    KGKRKICNLSGHNRDKFQERLDFKFYDFQALEIEKGWNNLFVSIISIETGETIAKSGKAA  80

Query  235   VNNGTCQWTESL----W-SPENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             V NG C W +S+    W S ++   N     K +V+MGS+R G LGEAT+N+  Y   E 
Sbjct  81    VQNGECHWEDSMPSTIWISDDSLQDNEGFLLKLVVAMGSARFGTLGEATINLASYIRPET  140

Query  400   SIPVSLPL-QKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVC-NGIDNKSEE  573
             S   SLPL Q C+ GT+L  +I+CLTPR+ +R D  NS      +E SVC + ++N   +
Sbjct  141   S-TASLPLRQHCSHGTILQVKIQCLTPRSKYRKD-ANSYV----DEMSVCSDDVENDQLQ  194

Query  574   RNNSLPSMEDSLGRDSLs-------sasnssavvnnaIRRLESTESGGSAPWssysygsp  732
             R + L +  D     SLS         SN S +  N   R +ST S         +  S 
Sbjct  195   RISPLATCSDHEIESSLSFWIGMSPQQSNVSGLKKNMNERQDSTYSKNGPYPLYDTSRST  254

Query  733   ksnnspnklsisCQEKHPEYTEEEIGQCS----LHITRT--------SIPDANIEELKAE  876
              S+   +      Q K      EE+G+ S      +TR+         +    I+ L  E
Sbjct  255   YSSPVRSISGTRMQGKM-----EELGKVSNASETKLTRSVSSSKDLLGVAQVTIDLLHGE  309

Query  877   ARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEES  1056
             A+MWE NAR+LMV +E LRK  + +S+   ++EMELS +H ES+ L  +I+RL  +++++
Sbjct  310   AKMWEENARKLMVDVERLRKHLSKKSKNKKELEMELSASHKESDALKEEIQRLTSMVKQN  369

Query  1057  NAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEME  1236
             +++     NL  Q +  +N ++E++DE+K+Q   N +L L+L K QES   LVS+LQ+++
Sbjct  370   DSR-----NLKFQIEEMDNTIRELQDEVKYQRGLNRDLELKLTKQQESKIGLVSILQKLQ  424

Query  1237  ETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKS--TEQVSVEKQCQEFKLQHLQ  1410
             +  +K+K+E+ + L++NS       INS   ED+ +     +++V  EK  +EF   H  
Sbjct  425   KINEKQKMEMAD-LSMNSLRFQDAEINSRVLEDSEEEDFSLSKEVLPEKMRKEF--CHSD  481

Query  1411  ESHMSLENSIIC  1446
                 + EN+I C
Sbjct  482   ADLGTYENAIRC  493



>gb|EMS60734.1| hypothetical protein TRIUR3_01845 [Triticum urartu]
Length=1350

 Score =   234 bits (597),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 212/646 (33%), Positives = 365/646 (57%), Gaps = 45/646 (7%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D ++++++V++  I  ++S  K+ E KI ELE+ K ELE  + ELE+EN++LSE
Sbjct  740   ITSKCLDELQQDILVLSSSIDSHVSANKVLERKINELESCKAELELHISELEQENIELSE  799

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLEAQL + T+  E S +++    + + +L+D++   + + ++Q +E KQ+  E Q+
Sbjct  800   RISGLEAQLSYITNEKESSELQMHDSKSLVISLKDKVERQQVEMDTQRVEFKQKQQETQR  859

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             +  ++Q++SE L+++N  LQ+T E+LIEEC SLQ L  +L++Q+LEL  +    E EL  
Sbjct  860   KLSEAQDDSEVLRRSNSNLQSTVENLIEECSSLQNLTADLKKQKLELHGRFMQQEQELDN  919

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +  +      +E LEAKLSS+ ++ SSKE+ + SELE I  +  E +E++     + ++
Sbjct  920   SKKRILDFCKTVEFLEAKLSSLQKDISSKEQSLLSELESIFQEHTEQEEKINRAHFMLNK  979

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             + + K  E+E  +++   L  Q+    +  +    +   E+  L AE   L+   + +  
Sbjct  980   IEKEKTLEVENLEREVVSLTAQVSSTHEERENATVDAIREVSVLRAEKAKLEANFENVSA  1039

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L A ++ +++ +E   S+E  L+ 
Sbjct  1040  QLRHYESQLEDLRKESKSKIKGLVDSLNASKQSEEMLTADAEHMKKLMETAKSNEDELRK  1099

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
                 LE KL  S+ ER Q+ +  S LK+++ KI  L+DEV  L+ SL++ KF+  +L+A 
Sbjct  1100  SSGELELKLKASDYERQQMMEEISDLKLQVQKITSLQDEVSKLRSSLDEAKFEKGKLKAL  1159

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L+ +  E EELKA K  L  +++ MQ ++   EE +  ++ ++ K++RLE D +A E   
Sbjct  1160  LESVTEECEELKAQKAMLTDKVSEMQETLDNGEEEKRSRISMQAKLVRLESDRSASEASH  1219

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ +R NS+ + KI+ LE E            E+L RK            
Sbjct  1220  VHEAELKNELSRIRRSNSEYQRKIQSLEQE-----------IEDLTRK------------  1256

Query  4279  KDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSG  4458
                      Q++  +   Q      IQI+      +  +    + Q KS   E QS  +G
Sbjct  1257  ---------QEIGDSTDIQSK----IQILETKLAEALEENRTYRAQQKSPIAEEQS--AG  1301

Query  4459  NENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQ  4596
              +   +I QLE +L+++ ER L+MSL+YAEVE Q+ +LVM LK+++
Sbjct  1302  GD---RILQLEGDLRDMKERLLNMSLEYAEVEAQRERLVMELKSVK  1344


 Score =   103 bits (256),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 93/169 (55%), Gaps = 14/169 (8%)
 Frame = +1

Query  115  FGFIFSNIQ---ALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQW----TESLW  273
            + F F   Q   ++ VP   D++ +S++SV+ GKTI+K  KA+  +G CQW    +E +W
Sbjct  20   YDFYFCRKQHSTSVSVPAVSDRMFLSIVSVDTGKTIAKSSKAAARSGICQWPDSISEPIW  79

Query  274  SPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
               +  S   D   +K +VS+GS R GILGE  +N+ ++ N      +S+PL++CN GTV
Sbjct  80   FSRDAVSKEFDECQYKIVVSVGSIRTGILGEIFLNLSNFLNLADPTAISMPLKRCNSGTV  139

Query  448  LNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVC---NGIDNKSEERNNS  585
            L  +++ L  +    G  V S+       +  C   + +DNKS+  +N+
Sbjct  140  LQLKVQSLGTKPKLGG--VRSSRDMPPRISDHCLINDDMDNKSDGSDNT  186


 Score =   100 bits (250),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 106/167 (63%), Gaps = 13/167 (8%)
 Frame = +1

Query  805   IGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
             I Q SL  T +S       +  IEEL+ EA+MWE ++R+L   +E L++E + +S++  +
Sbjct  295   IAQSSLGTTDSSKDLLEAAEETIEELRDEAKMWERHSRKLKADLEALKRECSEKSKQQTE  354

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNL-QAKNTE-------NILKE  1125
             + +ELS AH E +   H+I+ L+   +ES+ ++     L+  Q K+         N+ KE
Sbjct  355   LALELSAAHAERDSYRHEIEELKSSRQESSRQESFRPELSRRQIKSVTPKRGDWINMEKE  414

Query  1126  MEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEI  1266
             +EDE+KF  ESN+ L +QL+ +QE+N ELVS+LQE+EET+++++ EI
Sbjct  415   VEDEMKFLKESNATLQVQLKSTQEANIELVSILQELEETIEEQRAEI  461



>ref|XP_011094566.1| PREDICTED: golgin subfamily A member 4-like [Sesamum indicum]
Length=1408

 Score =   232 bits (592),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 207/605 (34%), Positives = 338/605 (56%), Gaps = 8/605 (1%)
 Frame = +1

Query  2779  KQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIREL  2958
             ++ELE  +  L++ENMQ  E +S LE Q+R   D  E    E     +   ++QDEI++L
Sbjct  795   QRELEITLSGLQEENMQFQECISCLETQVRQLKDEKEFYLQETDDFRSVAMSVQDEIQKL  854

Query  2959  EKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGEL  3138
             + + + Q L+L Q+  ++QKRWL +QEE EYLK+ N  LQA+   L EE   L   N EL
Sbjct  855   KVEMDIQILDLTQKSEDIQKRWLGAQEECEYLKEENKTLQASTAILEEERVKLLNSNSEL  914

Query  3139  RRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMI  3318
             +R   EL+  C+ L A+L + + SLS C  ++E LE  L+S+    + +E  + S+++ +
Sbjct  915   KRINQELQENCSSLAAQLSESKKSLSECTKKVEVLEDHLASMTNNFALRENSLKSKVDAL  974

Query  3319  LLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHE  3498
             + +  E KE+L+++E+L  Q+   K  E E  Q+   HL  Q+       +  + E S E
Sbjct  975   IKENSEHKEKLLLEENLH-QILSEKTIEFESLQKDVEHLHRQVSHGHKERERISREASTE  1033

Query  3499  MHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAK  3678
             +  L A+   L+ +LQE+Q   E+T+ +L     E + +V +L  +L A K +   L A 
Sbjct  1034  VSRLIADKAELQASLQEVQSEAELTKNELEAALQESKFQVDDLKSQLAAAKQSHERLRAD  1093

Query  3679  SDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEV  3858
              +++ + L N   SE  LK  ++ LE KL +S+ E  QL+   S LK++L  I+ L+DE+
Sbjct  1094  HERILKLLANYRKSEEKLKSEMNELELKLTISDYECQQLSKEMSILKVQLQNISGLQDEI  1153

Query  3859  LALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKV  4038
               LK  L   +   ++LE +L  + G+ E+LKA+K S  ++++  Q++++E EEC+++K+
Sbjct  1154  SILKSDLEGCRVNKDQLELALHTVSGDYEKLKAEKISFSEKISIFQDAMSEFEECKMKKL  1213

Query  4039  VLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQS  4218
              LEEK+L++E +LT +E++C ++AELK++LT+ KR N Q + K+ +LE E+    K+ Q 
Sbjct  1214  ELEEKLLQMEQELTVKELLCIQNAELKDELTELKRANMQFQQKMYRLEEEKDECLKKAQV  1273

Query  4219  VQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQV  4398
             ++E L   E    + SH    +   +     +   +  Q      ++    D   SR   
Sbjct  1274  LEENLKLMEG---ANSHDFHDESPLAV---SVDHKKKRQLPEGLDVKNKIRDQLESRTSA  1327

Query  4399  GDDKTQFKSLQPEGQSTRSGNEN-EQKISQLEAELKEISERYLHMSLKYAEVENQKGKLV  4575
             G       S +P         E  E+  S LE EL+++ ERYL MSLKYAEVE ++  LV
Sbjct  1328  GQKNYAVASKKPAADGEVVARERYERTKSSLETELRDLRERYLEMSLKYAEVEAEREDLV  1387

Query  4576  MTLKA  4590
             M LKA
Sbjct  1388  MKLKA  1392


 Score =   161 bits (408),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 109/180 (61%), Gaps = 14/180 (8%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL+R  +  S    ++  F FSN QALQVPKGWD+L VS+ISVE GKT++K GKA V 
Sbjct  1    MFKLQRQTNKAS-KPRERLDFKFSNFQALQVPKGWDRLVVSIISVETGKTLAKSGKAPVK  59

Query  241  NGTCQWT----ESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQWT    ES++ P + +S G +    K +VS GS+R+  LGEAT+NV  Y     S
Sbjct  60   NGYCQWTETLSESIYIPRDDSSKGYEESPVKLVVSAGSTRSSNLGEATINVAQYAGPRVS  119

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST-------AAYNEEENSVCNGIDN  561
              VSLPL+KC+ GT+L  +I+CL PR     +E   +       +  + E   V NG DN
Sbjct  120  AAVSLPLKKCSYGTILQAKIQCLIPRLKISDEESKYSNSQEKDQSVDHRETERVTNGSDN  179


 Score =   122 bits (306),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 111/163 (68%), Gaps = 4/163 (2%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             I+EL+AEA+MWE NAR+LM+ ++  RKEF++ S++ A++ +ELS A  E   L  +++ L
Sbjct  300   IDELRAEAKMWERNARKLMIDLDMSRKEFSDLSKKQAELVVELSAACAEREGLKREVEHL  359

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             ++ LE     Q + ENL +QA++   I K +E+E K+Q   N NL  QLR+SQESN ELV
Sbjct  360   KLELENLATTQASQENLLIQAESLMQIQKVLENETKYQKILNDNLGQQLRRSQESNIELV  419

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCG--DEDN  1338
             SVL E+EET+++++IEIENL +L  + D   + NS     EDN
Sbjct  420   SVLHELEETIEQQRIEIENLSSL--KLDFTDLENSIARNSEDN  460



>gb|EMT06721.1| hypothetical protein F775_07881 [Aegilops tauschii]
Length=1345

 Score =   228 bits (580),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 210/646 (33%), Positives = 363/646 (56%), Gaps = 45/646 (7%)
 Frame = +1

Query  2671  ITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSE  2838
             ITS   D ++++++V++  I  ++S  K+ E KI ELE+ K ELE  + ELE+EN++LSE
Sbjct  735   ITSKCLDELQQDILVLSSSIDSHVSANKVLERKINELESCKAELELHISELEQENIELSE  794

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R+SGLEAQL + T+  E S +++    + + +L+D++   + + ++Q +E KQ+  E Q+
Sbjct  795   RISGLEAQLSYITNEKESSELQMHDSKSLVISLKDKVERQQVEMDTQRVEFKQKQQETQR  854

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
             +  ++Q++SE L+++N  LQ+T E+LIEEC SLQ L  +L+RQ+LEL  +    E EL  
Sbjct  855   KLSEAQDDSEVLRRSNSNLQSTVENLIEECSSLQNLTADLKRQKLELHGRFMQQEQELDN  914

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
              +  +      +E LE+KLSS+ ++ S KE+ + SELE I  +  E +E++     + ++
Sbjct  915   SKKRILDFCKTVEFLESKLSSLQKDISCKEQSLLSELESIFQEHTEQEEKINRAHFMLNK  974

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             + + K  E+E  +++   L  Q+    +  +    +   E+  L AE   L+   + +  
Sbjct  975   IEKEKTLEVENLEREVVSLTAQVSSTHEERENATVDAIREVSVLRAEKAKLEANFENVSA  1034

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              L   E +L   + E + K+  L+  LNA K ++ +L A ++ +++ +E   S+E  L+ 
Sbjct  1035  QLRHYESQLEDLRKESKTKIKGLVDSLNASKQSEEMLTADAEHMKKLMEAAKSNEDELRK  1094

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
                 LE KL  S+ ER Q+ +  S LK+++ KI  L+DEV  L+ SL++  F+  +L+A 
Sbjct  1095  SSGELELKLKASDYERQQMMEEISDLKLQVQKITSLQDEVSKLRSSLDEAMFEKGKLKAL  1154

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L+ +  E EELKA K  L  +++ MQ ++   EE +  ++ ++ K++RLE D +A E   
Sbjct  1155  LESVTEECEELKAQKAMLTDKVSEMQETLDNGEEEKRSRISMQAKLVRLESDRSASEASH  1214

Query  4099  AKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVA  4278
               +AELKN+L++ +R NS+ + KI+ LE E            E+L RK            
Sbjct  1215  VHEAELKNELSRIRRSNSEYQRKIQSLEQE-----------IEDLTRK------------  1251

Query  4279  KDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSG  4458
                      Q++  +   Q      IQI+      +  +    + Q KS   E QS  +G
Sbjct  1252  ---------QEIGDSTDLQSK----IQILETKLAEALEENKMYRAQQKSPVAEEQS--AG  1296

Query  4459  NENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQ  4596
              +   +I QLE +L+++ ER L+MSL+YAEVE Q+ +LVM LK+++
Sbjct  1297  GD---RILQLEGDLRDMKERLLNMSLEYAEVEAQRERLVMELKSVK  1339


 Score =   127 bits (318),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 109/185 (59%), Gaps = 14/185 (8%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNS-GDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFKL RH+SS  D S G++F F FS+ +A+ VP   D++ +S++SV+ GKTI+K  KA+ 
Sbjct  1    MFKLHRHRSS--DRSVGERFEFRFSSFRAVMVPAVSDRMFLSIVSVDTGKTIAKSSKAAA  58

Query  238  NNGTCQW----TESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G CQW    +E +W   +  S   D   +K +VS+GS R GILGE  +N+ ++ N   
Sbjct  59   RSGICQWPDSISEPIWFSRDAVSKEFDECQYKIVVSVGSIRTGILGEIFLNLSNFLNLAD  118

Query  400  SIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVC---NGIDNKSE  570
               +S+PL++CN GTVL  +++ L  +    G  V S+       +  C   + +DNKS+
Sbjct  119  PTAISMPLKRCNSGTVLQLKVQSLGTKPKLGG--VRSSRDMPPRISDHCLINDDMDNKSD  176

Query  571  ERNNS  585
              +N+
Sbjct  177  GSDNT  181


 Score =   100 bits (250),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 107/167 (64%), Gaps = 13/167 (8%)
 Frame = +1

Query  805   IGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
             I Q SL  T +S       +  IEEL+ EA+MWE ++R+L   +E L++E + +S++  +
Sbjct  290   IAQSSLGTTDSSKDLLEAAEETIEELRDEAKMWERHSRKLKADLEALKRECSEKSKQQTE  349

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNL-QAKNTE-------NILKE  1125
             + +ELS AH E +   H+I+ L+   +ES+ ++     L+  Q K+         N+ KE
Sbjct  350   LALELSAAHAERDSYRHEIEELKSSRQESSRQESFRPELSRRQIKSVTPKRGDWINMEKE  409

Query  1126  MEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEI  1266
             +EDE+KF  ESN++L +QL+ +QE+N ELVS+LQE+EET+++++ EI
Sbjct  410   VEDEMKFLKESNASLQVQLKSTQEANIELVSILQELEETIEEQRAEI  456



>ref|XP_004516963.1| PREDICTED: myosin-9-like [Cicer arietinum]
Length=1268

 Score =   223 bits (567),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 282/479 (59%), Gaps = 8/479 (2%)
 Frame = +1

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             + ++E EN QLS RVS LE ++R  T+  E    EL++   Q   L+++I E++ + +S 
Sbjct  731   ISDIEHENGQLSMRVSALEDEVRDLTNEQESQLSELENDRNQAARLREKIMEMQYEMDSS  790

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
               +LKQ+L   Q  W ++QEESEYL+  N +LQ T E+L +EC+S + LNG LR+Q+LEL
Sbjct  791   IEDLKQKLKATQFHWSEAQEESEYLRGENQQLQITIENLEDECNSFEKLNGYLRQQKLEL  850

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
             +  C+L+ A LR      + C  R+  LE K S +LE+ + KEK + S+++ IL    E 
Sbjct  851   EDNCSLMGARLRASSERFADCCGRVGFLEKKFSLMLEDIALKEKDLTSDMDGIL---DEN  907

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             K+ +   ++L ++L   K+ +++  + +  +L  ++    D ++  AS    E+  L AE
Sbjct  908   KKHMAQGQNLLNELQMEKMVDIQNLKLEIENLSLKLSAAYDEKERIASNALLEVSELRAE  967

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
                L+    E Q  + + + ++ T Q +YE+K+ E   EL   KT   +  A+ +KL + 
Sbjct  968   KDKLEYAFGEAQSKVILFKTEVNTMQTQYEQKLKEQTTELADFKTKMEMQIAEHEKLAKL  1027

Query  3700  LENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSL  3879
             +E+  S E   K  I+ LESKL ++E ER +  D + +LK++L +     +E++ALK  L
Sbjct  1028  VEDYKSRELKFKSTINALESKLTVTEYERHKYLDESGNLKVQLQQTRQSENEIMALKSEL  1087

Query  3880  NDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVL  4059
             N    + ERLEASL L     E+LKA+ TSL Q+++ ++ + +ELE C+  +  +EE+++
Sbjct  1088  NASNTEKERLEASLCLTSDLCEDLKAENTSLEQKVSRLETAASELEHCKRTRASIEERIM  1147

Query  4060  RLEGDLTAREVMCA-KDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
             +LE DL ARE  CA  D EL N     KR+NSQL+  I+QLE E+    ++ Q+ +EEL
Sbjct  1148  QLENDLKARETRCAHHDTELNN----IKRINSQLQQTIQQLEQEKAEFQRKAQAFEEEL  1202


 Score =   174 bits (440),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL +H+S     SGD+  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K +V 
Sbjct  1    MFKLHKHRSP---KSGDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTIAKSSKVAVR  57

Query  241  NGTCQWT----ESLW-SPENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASI  405
            NG+CQW+    ES+W S +N +    D  K +V+MGS R+GILGEATV++  Y +S+A++
Sbjct  58   NGSCQWSDTFSESIWVSRDNSSKETDDCLKLIVAMGSLRSGILGEATVSMTSYVSSDAAV  117

Query  406  PVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAY  522
            P+S+PL KCN GT+LN  ++CL P+T  R  E + T ++
Sbjct  118  PLSIPLNKCNHGTILNVTVQCLAPKTKPRDQESSETKSH  156


 Score =   135 bits (341),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 140/220 (64%), Gaps = 9/220 (4%)
 Frame = +1

Query  799   EEIGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRI  963
             ++IG  S  +T  S       +   EEL+AEA+MWE+NAR+LM  +E L+ EF++QSQ++
Sbjct  273   QDIGASSSKMTNASNKSLEAAEDTSEELRAEAKMWEMNARKLMGDLEMLKTEFSDQSQKL  332

Query  964   ADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELK  1143
             A +EM+LS A+ E +    +I++L +    + A+Q   E+   Q +    I   ++DELK
Sbjct  333   AGLEMDLSAAYVERDSFKKEIEQLTLSSGHTIARQKTLEDSISQGECIPEIENAIKDELK  392

Query  1144  FQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSC  1323
             FQ ES +NLSLQL+KSQE+N ELVSVLQE+E+T++++K+EIENL +L S+   +      
Sbjct  393   FQKESTANLSLQLKKSQEANVELVSVLQELEQTIEQQKLEIENLSSLPSKLSTLEKSFQL  452

Query  1324  GDEDN-VQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSI  1440
              +E N V  +  EQ+   K+    K+Q L+E   +LE++I
Sbjct  453   SEEGNRVFKQQIEQLEESKKTLLAKVQELEE---ALEDTI  489



>ref|XP_008351680.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Malus domestica]
Length=994

 Score =   220 bits (561),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 169/429 (39%), Positives = 257/429 (60%), Gaps = 10/429 (2%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKM--LEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMV  2631
             ELE K + +G  +  K  ++  LEV     EE++GL  L   + +L  ++ + Q     +
Sbjct  563   ELESKVKELGKELTEKMFEIEKLEVNLLTKEEEIGL--LRGVQNELQAEVSNLQKEKIEL  620

Query  2632  EKDMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESC  2799
             E+ ME V  E  DI+S   + +R E+MV++  +  ++S  K+ E K  ELE +K EL+  
Sbjct  621   EEQMEVVLRE-GDISSKCLNDLRNELMVLSRSVNSHVSTHKVLERKSSELEADKCELDLH  679

Query  2800  VFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQ  2979
             + E ++EN+QLS  +S LEAQ R  TD  E +++EL +  +   +LQDEI  L  +  S 
Sbjct  680   LSEFQQENIQLSAHISALEAQQRCLTDEKEANQLELDNSQSYSLSLQDEISRLNIEMISD  739

Query  2980  ELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLEL  3159
             ++ELKQ+L +++++W +++EE E+LK ANPKLQ TAESLIEEC+S+Q  N ELR+Q+LEL
Sbjct  740   KVELKQKLKDLERQWSEAREECEFLKXANPKLQGTAESLIEECNSIQNSNDELRKQKLEL  799

Query  3160  KVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEF  3339
                C+LLEA+L + Q S ++C  R+E LE  LS +LE  +SKE+ +NSEL+ +L +  ++
Sbjct  800   HQLCSLLEAKLNQSQESFTNCSKRVEVLEKDLSLMLENVTSKEESLNSELDALLDENMKY  859

Query  3340  KERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAE  3519
             KE+L ++ESL +++   K  E+E  Q++   L  Q     +  +G AS+   E   L  E
Sbjct  860   KEKLTLEESLFNKMYLEKTIEVESLQEEVERLTKQFAATHEEREGPASDAVQEASRLRTE  919

Query  3520  NKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRW  3699
              +ML+ TL E Q      E +L   + E E K+  L  EL A K NQ    A  +KL + 
Sbjct  920   KEMLQSTLLEFQSKAIQMEDELNIMRTESEAKLQGLFAEL-ADKQNQESTTADHEKLLKL  978

Query  3700  LENVISSES  3726
             LEN  SSES
Sbjct  979   LENYKSSES  987


 Score =   213 bits (542),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 162/432 (38%), Positives = 235/432 (54%), Gaps = 72/432 (17%)
 Frame = +1

Query  304   DHF-KFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPR  480
             D+F K ++SMGS+R+GILGE +VN+  Y +S +S PVSLPL+KC+ GT+L  +I CLTPR
Sbjct  3     DYFIKLVISMGSTRSGILGEVSVNMSDYISSTSSAPVSLPLKKCSFGTILQVKINCLTPR  62

Query  481   TSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNNSL------------------------  588
                  +E   T+ ++EE     +  D+KS+  N+S+                        
Sbjct  63    KKLSDEESKETSYHSEEVIEHGHDADSKSDGSNSSVVWSAGSSSRKDFGLISNPGEPGSR  122

Query  589   -------------PSMEDSLGRDSLssasnssavvnnaIRRLESTESGGSAPWssysygs  729
                           S E S+ RD++S+ SN S   N+ I R +ST S             
Sbjct  123   DSSFSAXGSHRSYDSAEGSIRRDNMSARSNLSVEGNHLIGRQDSTTS-------------  169

Query  730   pksnnspnklsisCQEKHPEYTEEEIGQCSLHITRTSIPDANIEELKAEARMWELNARRL  909
                      + I  Q    ++TE  +             +  IEEL AEA+MWE NAR+L
Sbjct  170   --------LIXIQTQNSRKDFTESSLSTTDSSKNLLDAAEVTIEELHAEAKMWERNARKL  221

Query  910   MVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLN  1089
             M+ ++ LR EF++QS++ A++ +ELS A+ E + L  +++ L +LLE +  KQ A+E+L 
Sbjct  222   MLDLDILRAEFSDQSKKQANIHVELSAAYAERDGLKKEVEHLHLLLENAMVKQTASEDLT  281

Query  1090  LQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIE  1269
              Q   T  I K  +DEL FQ ES +NLSLQL +SQESN ELVSVLQE+EET++K+K+E+E
Sbjct  282   SQDGGTPEIKKAFQDELNFQKESTANLSLQLERSQESNIELVSVLQELEETIEKQKVELE  341

Query  1270  NLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFKLQHLQESHMSLENSIICQ  1449
             NL  L S         + GD +N+   +TE    E +  + +LQ LQES   L+  +   
Sbjct  342   NLSGLQS---------TFGDMENLINLTTE----ENRNLKLQLQQLQESENKLQVVVQQL  388

Query  1450  EKAQEEKIHEIE  1485
             E+  EEK HEIE
Sbjct  389   EQTVEEKNHEIE  400



>gb|KHN36452.1| hypothetical protein glysoja_041039 [Glycine soja]
Length=1394

 Score =   217 bits (552),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 171/485 (35%), Positives = 279/485 (58%), Gaps = 7/485 (1%)
 Frame = +1

Query  2779  KQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIREL  2958
             K ELE  + ++E+E  QLS RVS LEAQLR  T+  E    EL++  +Q   LQ++I E+
Sbjct  726   KHELELHILDIEQEKQQLSIRVSVLEAQLRDLTNEQEFRLSELENSRSQAARLQEKIMEM  785

Query  2959  EKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGEL  3138
             + + +S   +LKQ+LM  +  W ++QEE EYL+ AN KLQ T E L EEC S + LNG+L
Sbjct  786   QSEIDSSTEDLKQKLMVAKIHWSEAQEECEYLRGANQKLQITIEDLAEECSSFEKLNGDL  845

Query  3139  RRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMI  3318
             ++Q L+L+  C+ +EA LR+     S C   +E LE K    LE+ +SKEK + S+L+  
Sbjct  846   KQQNLKLEGYCSHMEARLRESDERFSKCSEGVELLEKKFDLKLEDIASKEKHLTSDLDGF  905

Query  3319  LLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHE  3498
               + ++  E+  +   L +Q+    + E +  + +   L  ++    D ++  AS    E
Sbjct  906   FYENRKHMEQAQV---LLNQMQMEMMVETQNLELEVEKLSLKLSAAHDEKERIASNAMLE  962

Query  3499  MHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAK  3678
             + +L A+   L+   +E Q  + + + ++   Q +YE+K+ +L  +L  +K    +L  +
Sbjct  963   VSTLRADKAKLESAFEEAQSKVSLAKKEVDMIQSQYEQKLEDLTTQLAEYKIKMEMLMTE  1022

Query  3679  SDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEV  3858
              +KL + +E+  S E   K  I+ LE KL ++E ER Q+ D +  LK++L +     +E+
Sbjct  1023  HEKLLKLVEDYKSRELKFKSTINALELKLTVTEYERQQVMDESGILKVQLQQTHQFENEI  1082

Query  3859  LALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKV  4038
             +ALK  L+    + ERLEASL L     E+LKA+K S   ++  ++ + +ELE+C+  + 
Sbjct  1083  IALKNELDASNSEKERLEASLCLTSELCEDLKAEKISSGLKILALEQAASELEDCKKTRA  1142

Query  4039  VLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQS  4218
              LEEK+L+LE DL A+E  CA+D E    L+ SKR+N Q +  I+ LE E+     + Q 
Sbjct  1143  SLEEKLLQLENDLKAKETRCAQDTE----LSHSKRINRQHQQTIQLLEQEKAEFQTKAQV  1198

Query  4219  VQEEL  4233
             ++EEL
Sbjct  1199  LEEEL  1203


 Score =   172 bits (437),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 111/157 (71%), Gaps = 9/157 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L +H++   + SGDK  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K SV 
Sbjct  1    MFRLHKHRA---EKSGDKIEFRISHLKALQVPKGWDKLYVSVVSVENGKTIAKSSKVSVR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQW+    ES+    + +S  +D    K +V+MGSSR+GILGEATV++  Y +S A+
Sbjct  58   NGGCQWSDNFSESISISRDNSSKEIDDCDLKLIVAMGSSRSGILGEATVSLTSYMSSGAA  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
            IP+S+PL KCN GTVL+  ++CLTPRT  R  E + T
Sbjct  118  IPLSIPLNKCNHGTVLHVTVQCLTPRTKLRDQESSET  154


 Score =   134 bits (336),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR+LM  ++ LR EF++QS+++A +EM+LS    E + L  ++++L+
Sbjct  300   EELRAEAKMWEMNARKLMGDLDMLRTEFSDQSKKLAGIEMDLSATQVERDGLKKEVEQLK  359

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             +  E+   +Q A E+   Q +    I   +++ELKF+ ESN+NLSLQL+KSQE+N ELVS
Sbjct  360   LSFEDPVVRQKALEDSVSQVEGIPEIENALKEELKFEKESNANLSLQLKKSQEANIELVS  419

Query  1219  VLQEMEETVQKKKIEIENLLAL  1284
             VLQE+EET++++K+EIENL +L
Sbjct  420   VLQELEETIEQQKVEIENLSSL  441



>ref|XP_006590187.1| PREDICTED: myosin-11-like [Glycine max]
Length=1320

 Score =   215 bits (548),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 158/434 (36%), Positives = 254/434 (59%), Gaps = 0/434 (0%)
 Frame = +1

Query  2791  ESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDK  2970
             ++ +F L+ EN+QL ER+ GLEA++R   +  E + +  ++    + NLQ EIR +E   
Sbjct  877   DNALFGLKAENVQLYERMLGLEAEMRQLIEEKESTHLARENYENVVKNLQAEIRRMEALN  936

Query  2971  ESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQR  3150
             E+Q++ELK++   MQK+W++ QEE  +L+ AN +LQAT  +LIEE  + Q  N ELR Q 
Sbjct  937   EAQKVELKRKEESMQKKWIEVQEECSFLRVANLELQATNGNLIEESKTFQTTNDELRMQN  996

Query  3151  LELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQT  3330
             LEL  QC +L+++L + Q   S  L  +E LE K +S+LE+ + KEK ++ +L+ +L ++
Sbjct  997   LELHCQCTVLDSKLGESQIVFSGMLKLVEELECKFTSMLEDIALKEKTIDVDLDALLEES  1056

Query  3331  KEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSL  3510
             ++  ER  ++E+  + +   K +E    Q++   L +Q+    DR    AS    E++ L
Sbjct  1057  RKLDERFTMEENFLTHMYLEKTAEAGNLQKEVEDLRDQISGICDRHKRMASNIVLEVYDL  1116

Query  3511  FAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKL  3690
              A+  ML+  LQE Q+   +   +L     EYE  V     EL A + NQ  L    +K+
Sbjct  1117  CADKAMLESALQEEQEKARLYNTELDNLGAEYEVMVQNYAEELAASRANQETLMVNHEKV  1176

Query  3691  QRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALK  3870
                LENV  ++  LK  +  LE++L  SE ERL+  +  S L+++L K   L+DE+  LK
Sbjct  1177  VVLLENVKLNDEKLKGRVRGLEAELKASELERLKATEEISELEVQLQKTEMLQDEIFILK  1236

Query  3871  GSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEE  4050
              SL + +F+  RLEAS Q++  E +ELKA   S  + ++  +   +ELE+C+  K+ LEE
Sbjct  1237  RSLYEAEFEFRRLEASYQMLSLECDELKAKNVSYNRRISTTEKVTSELEDCKRSKIELEE  1296

Query  4051  KVLRLEGDLTAREV  4092
             K LRL+ +LT +E 
Sbjct  1297  KNLRLQWNLTIKEA  1310


 Score =   211 bits (538),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 177/535 (33%), Positives = 280/535 (52%), Gaps = 71/535 (13%)
 Frame = +1

Query  67    KLRRHKSSTSDNSGDKF----GFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKAS  234
             K +R   + S ++ DKF     F F + QAL++ KGW+ L VS+IS+E G+TI+K GKA+
Sbjct  18    KGKRKICNLSGHNRDKFQERLDFKFYDFQALEIEKGWNNLFVSIISIETGETIAKSGKAA  77

Query  235   VNNGTCQWTESLWSPENYASNGLDH-----FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             V NG C W +S+ S    + + L        K +V+MGS+R G LGEAT+N+  Y   E 
Sbjct  78    VQNGECHWEDSMLSTIWISDDSLQDNEGFLLKLVVAMGSARFGTLGEATINLASYIRPET  137

Query  400   SIPVSLPL-QKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVC-NGIDNKSEE  573
             S   SLPL Q C+ GT+L  +I+CLTPR+ +R D  NS      +E SVC + +D+ S+ 
Sbjct  138   S-TASLPLRQHCSHGTILQVKIQCLTPRSKYRKD-ANSYV----DEMSVCSDDVDSISDV  191

Query  574   RNNSLPSMEDSLGRDSLssasnssavvnnaIRRLES-----TESG-----GSAPWssysy  723
              +N+      S   D L +      + +  I  L +      ES      G +P  S   
Sbjct  192   SDNTFSRTSGSSHWDHLENIYYRRELSSKRISPLATCSDHEIESSLSFWIGMSPQQSNVS  251

Query  724   gspksnnspnklsisCQEKHPEYTE---------------------EEIGQCS----LHI  828
             G  K+ N     + S    +P Y                       EE+G+ S      +
Sbjct  252   GLKKNMNERQDSTYSKNGPYPLYDTSRSTYSSPVRSISGTRMQGKMEELGKVSNASETKL  311

Query  829   TRT--------SIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMEL  984
             TR+         +    I+ L  EA+MWE NAR+LMV +E LRK  + +S+   ++EMEL
Sbjct  312   TRSVSSSKDLLGVAQVTIDLLHGEAKMWEENARKLMVDVERLRKHLSKKSKNKKELEMEL  371

Query  985   STAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNS  1164
             S +H ES+ L  +I+RL  ++++++++     NL  Q +  +N ++E++DE+K+Q   N 
Sbjct  372   SASHKESDALKEEIQRLTSMVKQNDSR-----NLKFQIEEMDNTIRELQDEVKYQRGLNR  426

Query  1165  NLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQ  1344
             +L L+L K QES  +LVS+LQ++++  +K+K+E+ + L++NS       INS   ED+ +
Sbjct  427   DLELKLTKQQESKIDLVSILQKLQKINEKQKMEMAD-LSMNSLRFQDAEINSRVLEDSEE  485

Query  1345  PKS--TEQVSVEKQCQEFKLQHLQESHMSLENSIIC-QEKAQEEKIHEIELEQDL  1500
                  +++V  EK  +EF   H      + EN+I C  E  + ++    ELE  L
Sbjct  486   EDFSLSKEVLPEKMRKEF--CHSDADLGTYENAIRCLHEGIELQEFRNWELEHQL  538



>ref|XP_009586795.1| PREDICTED: sporulation-specific protein 15-like [Nicotiana tomentosiformis]
Length=1396

 Score =   214 bits (544),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 207/659 (31%), Positives = 352/659 (53%), Gaps = 57/659 (9%)
 Frame = +1

Query  2740  KIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKG  2919
             K+ E K+  L++E+  LE  +  L ++N+        +EAQ+R  T   E  + EL+   
Sbjct  744   KLLERKLAHLDSERHTLEDQLVGLTEKNI-------NMEAQIRLMTVNRESRQSELEESR  796

Query  2920  TQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLI  3099
             T + NLQ+EI +LE + ++   +LK+ L +MQ  W  ++EE  +L   N KLQ + ++L+
Sbjct  797   TDVMNLQEEIGKLESEMKTNIADLKEELEDMQILWSQAREECGHLTNENEKLQESLQNLL  856

Query  3100  EECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETS  3279
             EE  ++Q  N EL R+ +EL  +   +EA+L + Q SLS+ L ++++LE  L+S+ ++ S
Sbjct  857   EEYKTIQQSNSELERKNVELHERRLHVEAQLCESQKSLSNSLIKVKALEENLNSMWKDFS  916

Query  3280  SKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPS  3459
              KE+ +N EL  ++ + K   E+LV +E L +     KL+E+E   ++   L  Q+ +  
Sbjct  917   LKEERLNVELTELIRENKNEIEKLVQQECLSTHRYSEKLTEVESLNKEVEQLTKQISEM-  975

Query  3460  DREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGEL  3639
             D E   AS+ ++E+ SL AEN ML   L++IQ  L +TE +L   ++E E K+ +     
Sbjct  976   DEERRLASDAANEVSSLRAENAMLVSALEDIQSKLTLTEKELSNVRIESELKIQDSRQSF  1035

Query  3640  NAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLK  3819
                      L    +K+ + L N  ++E  LK   ++LE +L L   E  +L + +++LK
Sbjct  1036  EK-------LTVDHEKILKHLSNYRANEEKLKTAFNDLELQLTLLRYEHQKLHEESANLK  1088

Query  3820  IELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQN  3999
              +L K   L+++V  LK  L +   + E+LEASL L+  + EE+KA+K S   +++  Q 
Sbjct  1089  FQLQKTKELQEDVDYLKSELKECMSEKEKLEASLNLVSVDCEEMKAEKASFASKISSFQK  1148

Query  4000  SVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQL  4179
              ++ELE    + + LEEKV ++E DLT +E  CA+  +LKN+L+++KR N Q + KI ++
Sbjct  1149  VLSELENSNRKGICLEEKVEKMESDLTEKEKFCAQVDDLKNELSETKRENEQYQQKIHKM  1208

Query  4180  ELERYYLSKELQSVQEELNRKE------------NSVPSPSHSVAK-----DKTTSCKEQ  4308
             E E+    +++Q+++ E+   E            N  P  ++          K    +E 
Sbjct  1209  EEEKDNCFRKVQALEAEVKMMEEEKKLYAKKFEQNDTPKSTNKYTNFNRVPQKLNQSQEL  1268

Query  4309  KLSKARSSQCNNCETIQIVTID-DCSSRCQVGDDK---------------TQFKSLQPEG  4440
              + +  S   +  E     +++ D  +R Q+ ++K                +FK+ + +G
Sbjct  1269  LVDRLHSDFESEGENGIAYSVEVDYLARIQLLENKLAEALEANKKYKIQLQRFKTEERKG  1328

Query  4441  QSTRSGNEN---------EQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
              S  S   +         E+  + LE ELK+I ERY  MSLKYAEVE Q+  LVM LKA
Sbjct  1329  HSPSSRKPDGDSEMVKRFERTKTLLETELKDIRERYFQMSLKYAEVEAQREDLVMKLKA  1387


 Score =   180 bits (457),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 127/189 (67%), Gaps = 10/189 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL +  +  +  SG++  F FSN QALQVPKGWD+LS+S+I VE GKTI+KLGK  V 
Sbjct  1    MFKLPKQNNKQA-KSGERVDFRFSNFQALQVPKGWDRLSLSIICVETGKTIAKLGKTLVK  59

Query  241  NGTCQWTESL----WSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQW E+L    W  ++ +S  L+   +KF+VSMGS+R+GILGE T+N+  Y  S  S
Sbjct  60   NGSCQWPETLLESVWILQDDSSLELEESLYKFVVSMGSARSGILGEGTINLASYVGSRLS  119

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
             PV LPL+KCN+GT L  +I CLTPR  FR DE  S+ + N +E  + + I +KS E +N
Sbjct  120  SPVLLPLKKCNQGTTLQVKIHCLTPRNKFR-DESKSSGS-NMKEQDLDHDITSKSNESDN  177

Query  583  SLPSMEDSL  609
             L +  D L
Sbjct  178  -LSAGSDGL  185


 Score =   113 bits (283),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 117/163 (72%), Gaps = 1/163 (1%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE NAR+LM+ ++ LR+EF+ QS++ AD+ M+LS A++E   L  +I+ L
Sbjct  303   IEELRIEAKMWERNARKLMLDLDILREEFSAQSKKQADLVMDLSAAYSERGSLKKEIENL  362

Query  1036  EVLLEESNAKQ-IAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAEL  1212
             +++LEES AK  +AAE+   Q+K   +I +E+E E++ Q E N++L+LQL+ SQESN EL
Sbjct  363   KLMLEESMAKHALAAEDSVFQSKGQNHIQEELEIEIRHQQELNASLALQLKGSQESNVEL  422

Query  1213  VSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNV  1341
             +S+LQE+EET++++K+EIE   +L  R   M    +   +D V
Sbjct  423   LSLLQELEETIEQQKVEIEKFSSLQLRLTDMKNSTTADSQDKV  465



>gb|EMS49272.1| hypothetical protein TRIUR3_32478 [Triticum urartu]
Length=1762

 Score =   209 bits (531),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 173/516 (34%), Positives = 289/516 (56%), Gaps = 10/516 (2%)
 Frame = +1

Query  2515  MLEVKTGCLEEDVGLK-----ALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS  2679
             +LE K   L   V LK      L HC  ++ N I D Q     +E+ +     E+  +TS
Sbjct  1124  VLETKINELVHTVMLKEQEINGLQHCTTEMENTISDIQKEKDQLEERL-AASLEESSMTS  1182

Query  2680  ---DSMREEMMVVTGRIFGNISE-KIQEMKILELENEKQELESCVFELEKENMQLSERVS  2847
                D  RE+++V+T  +  + S  K+ E KI ELE+ K ELE  V +LE+EN++ SE +S
Sbjct  1183  KCLDEAREDLLVLTSSVDSHASANKVLERKISELESRKVELELLVTKLEQENIEFSEFIS  1242

Query  2848  GLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWL  3027
              LE+QL   T   E +R+E+ +  + + NL+D + + + + E+Q+LE+KQ+ +E Q R  
Sbjct  1243  ELESQLTSLTSEEEATRLEMDYSISLIANLKDLVEQQQAEMEAQKLEMKQKHLESQTRLS  1302

Query  3028  DSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQH  3207
             + QE+SE L+++N KLQAT +S+ EEC SLQ L  +L++Q+LEL   C  LE +L + + 
Sbjct  1303  EVQEDSEALRRSNAKLQATIDSVAEECSSLQTLTADLKKQKLELHDHCAQLEQQLDQSKR  1362

Query  3208  SLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQ  3387
                      E LEAKLS++ +E + KE+ + SELE I  + KE +ER+     L  ++  
Sbjct  1363  KTMDLFETAEFLEAKLSTLQKEVTLKEQSLLSELENIFQEHKEHEERINSAHFLLHKIEN  1422

Query  3388  HKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLE  3567
              K+ E++  +++   L  Q+      +D  A +  HE+  L A+   L+  L+++   + 
Sbjct  1423  EKIGEVKNLEREVMSLTAQLSSTDGEKDSAALDSIHEVSILRADKAKLEANLEDVSAQMR  1482

Query  3568  ITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIID  3747
               + +L   + E + K+  L+  LNA K N+  L    + + R +E   S+E NL+   D
Sbjct  1483  HYQSQLEDLRTESKTKIKGLIDSLNASKHNEETLTTDVEHMTRLMEAARSNEENLRKTSD  1542

Query  3748  NlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQL  3927
              LE K   S+ E+ ++ +  S LKI++ K+A ++DEV  L+ SL+  KF+  +LE  +Q 
Sbjct  1543  ELELKYKSSDYEKQEVMEEISGLKIQVSKMASIQDEVFKLQSSLDQAKFEKTKLEERVQS  1602

Query  3928  ICGENEELKADKTSLIQELTGMQNSVTELEECRLRK  4035
             +  E EELK  K  L  +++ +Q+++ + +E   RK
Sbjct  1603  LSEECEELKVQKAMLTDQVSCIQSTLHDADEENRRK  1638


 Score =   110 bits (274),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 81/131 (62%), Gaps = 8/131 (6%)
 Frame = +1

Query  97   DNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWS  276
            D++G    F+   + A QVP   D+L +++ SV++GKTI+K  KA+  NG CQW +S+  
Sbjct  58   DDTGLLMNFLL--VLAQQVPVVSDRLLITITSVDSGKTIAKSSKAAAINGACQWHDSILH  115

Query  277  ----PENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNK  438
                P++  S        K +VSMGS+R  +LGEA +N+ +Y +S  S  +SLPL+ CN 
Sbjct  116  AIRFPKDEVSQEFQECQCKIVVSMGSTRTAVLGEAYLNLTNYLSSSDSTDISLPLKNCNS  175

Query  439  GTVLNFEIKCL  471
            GTVL  +I+CL
Sbjct  176  GTVLQLKIQCL  186


 Score = 57.4 bits (137),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 78/148 (53%), Gaps = 45/148 (30%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             +EEL+  A++WE ++R+L ++ +TL+ E A++S++ A++E +LS + +E + L  +I   
Sbjct  275   LEELRNAAKVWERHSRKLKIEQKTLKNECADKSKQQAELERQLSASLSEQDSLRQEI---  331

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
                      +Q+ A                                 QL K+QE+N ELV
Sbjct  332   ---------EQVTA---------------------------------QLNKTQETNIELV  349

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSD  1299
             S+LQE+EET++ +++E+  L  ++  +D
Sbjct  350   SILQELEETIELQRVEMSKLPQVSDVAD  377



>emb|CDP15309.1| unnamed protein product [Coffea canephora]
Length=1319

 Score =   207 bits (527),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 220/717 (31%), Positives = 376/717 (52%), Gaps = 54/717 (8%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE   +S+   +  K S+M +++   L ++         +R+L  ++ D Q     +E 
Sbjct  642   ELEADCQSLLKELSQKRSEMDKLQADLLSKEGQTNFHIQRQRELEIQVADLQTEKVQLEM  701

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNISEK-IQEMKILELENEKQELESCVF  2805
             + E ++ E + +TS   D ++ +  V++ R+  ++S K I E K+ ELE EK+ LE  + 
Sbjct  702   NNETIEREHE-VTSKCLDDLQNDFAVLSSRLDSHVSAKEILERKLAELELEKRNLEKKII  760

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
              LE E +QL ER+S ++ Q+    D  +  R+EL+   +   NLQ++IR LE + E+  +
Sbjct  761   LLEDEKLQLQERISVMDVQMTQLGDEQQSCRLELKDSKSLAMNLQNQIRRLEIEMEAHNV  820

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
                Q + + Q + L+SQ   E L+  N  LQA+   L EE   LQ LN EL+++ LEL  
Sbjct  821   SFNQNIQDKQDQLLESQRHCECLRAENQDLQASILRLGEERKILQKLNKELKKKELELHE  880

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
                 +   L   +   S C  ++E+LE  L+S LE  + KEK +NSELE IL + +  KE
Sbjct  881   HSEQMATRLENSEKCFSDCTRKVEALEENLNSTLEAFTLKEKSLNSELEAILQECRNEKE  940

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             +LV++E+L +Q+     SE++  Q++   L+ Q+    + ++   SE S E+ SL A+ +
Sbjct  941   KLVLQETLSNQMHFEMSSEVKNLQKEVESLMTQISVAHEEKEKAESEASLEIASLNADKR  1000

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
              L+  LQE+   LE++E    TT                                     
Sbjct  1001  KLEFALQEVNSKLELSEPSRRTT-------------------------------------  1023

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
                  E  LK  ++N+E KL LS+ E  QL + +++LK+   ++A L+ EV  LK  + +
Sbjct  1024  -----EEKLKTALNNIELKLTLSDYENQQLREESANLKVHFQRVADLQHEVSVLKSKVEE  1078

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
              +F+ E+LEAS Q + G+ E LKA+K S ++++  +Q ++T+ E+C+ + + LEEK+L++
Sbjct  1079  CRFEKEKLEASYQTVSGDYESLKAEKNSCVEKVLSLQKAMTDYEDCKQKAIALEEKLLQM  1138

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRKE  4245
             EG L ++E + A++A+L+ +L + ++V+ Q +  I QLE ++     ++Q+++ ++ ++ 
Sbjct  1139  EGALLSKETLSAQNADLEKELNEVRKVSKQYQQIISQLEEQKSECLLKVQALEMDVLKRH  1198

Query  4246  N-SVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQI-VTIDDCSSRCQVGDDKTQF  4419
             N           KD +    E     A +   +N   IQ+     +  S   +   K   
Sbjct  1199  NCDRKCDGKCSMKDGSPRPGEVADELAEALDEDNMHKIQLHSFSSEELSSETMACSKISV  1258

Query  4420  KSLQPEGQSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
                Q E +        E+  S LE EL+++ ERYL MSLKYAEVE Q+  LVM LKA
Sbjct  1259  VESQAEAR-----ERFERTKSSLETELRDLRERYLEMSLKYAEVEAQREDLVMKLKA  1310


 Score =   160 bits (404),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 119/202 (59%), Gaps = 28/202 (14%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL+R     S  SG++  F FSN QALQVPKGWD+L +S+ SVE+GKT+++LGKA V 
Sbjct  1    MFKLQRQNHRPS-KSGERVDFKFSNFQALQVPKGWDRLFLSMTSVESGKTVARLGKALVR  59

Query  241  NGTCQWTESL----WSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQWTE+L    W  ++ +S   +   FK +VSMGSSRAGILGEAT+NV    +S+AS
Sbjct  60   NGNCQWTETLLESVWITKDDSSKEPEECLFKLVVSMGSSRAGILGEATINVSCLMSSKAS  119

Query  403  IPVSLPLQKCNKGTVLN--------------------FEIKCLTPRTSFRGDEVNSTAAY  522
              V LPL+KCN  T+L                      +I+CLTPR + R    NS    
Sbjct  120  SAVILPLRKCNFETLLQPLASSSICLQPSFSLHLVARVKIQCLTPRPNIRHGSPNSNFKR  179

Query  523  NEEENSVCNGIDNKSEERNNSL  588
              E+      + + SE  +NSL
Sbjct  180  QNEDVDF-QALSSTSETADNSL  200


 Score =   149 bits (375),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +  IEEL+ EA+MWE NAR+LM+ ++ LRKEF  QS++ +D+ MELS A+ E + L  +
Sbjct  327   AEGTIEELRVEAKMWERNARKLMLDLDMLRKEFLGQSKKQSDLVMELSAAYAEHSGLKKE  386

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I++L V+LEES  KQ A E+  LQ++    I +E+E ELK+  +SN+NLSLQL++SQESN
Sbjct  387   IEQLNVMLEESTLKQRALEDSVLQSEGQTQIQEELESELKYHQQSNANLSLQLKRSQESN  446

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSRS  1296
              ELVS+LQE+E T++++KIEIENL AL+ +S
Sbjct  447   IELVSILQELEHTIEQQKIEIENLSALHLKS  477



>ref|XP_010325954.1| PREDICTED: ELKS/Rab6-interacting/CAST family member 1-like [Solanum 
lycopersicum]
Length=1374

 Score =   204 bits (520),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 254/901 (28%), Positives = 436/901 (48%), Gaps = 126/901 (14%)
 Frame = +1

Query  2077  SEPETTFDIDSLVPALCEQLGIFFHNVNGVEHMLFSPVNIELRN-----ATFYKDISRGT  2241
             SE E + D   LV    +QL + FH++    H + S V+ + ++     A   +D +R +
Sbjct  532   SENENSEDFTQLV----KQLEVAFHHLKRPWHKVSSSVSDQCKHHLENLANLNEDGARSS  587

Query  2242  DPMAQKEHAKAVFDKLVQLLRARLVSCTNDKYSEDGARTEVNNTYEIKDKSDYGCSTEKD  2421
               +        +FD L  LL  R+V C       +    E N   E     DYG   +  
Sbjct  588   KLLTTGCALTYLFD-LNNLLETRIVECGECLKQHEQEIQERNRKLE-----DYGLEVQAL  641

Query  2422  PCSSH----QGYKNFKELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDL  2589
               S      Q     KEL+ K   + +N                 E+   + L H +R+L
Sbjct  642   ESSKAELQIQCSGLLKELDKKYSELQSN-----------------EEEKRRLLEH-QREL  683

Query  2590  ANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMREEMMVVTGRIFGNISE-KIQEMKI  2760
               K+   Q     VE++M+ V  E    +S  D ++ +   +   +   +SE K+ + K+
Sbjct  684   EGKVSGLQKEKDQVEENMKIVSRESAKTSSCLDDLQSDYKELNNNMNALVSENKLMKRKL  743

Query  2761  LELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQ  2940
              +LE+EK  LE          + L+E+   +EAQ+R  T   E  + EL+   + + NLQ
Sbjct  744   AQLESEKHTLEDQF-------VGLTEKNENMEAQIRLMTVEGESRQSELEESTSVIMNLQ  796

Query  2941  DEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQ  3120
             +EI +LE + +     LK+ L +MQ  W  ++EE E+L   N KLQ + ++L+E      
Sbjct  797   EEIEKLESETKMSIANLKEELEDMQILWSQTREECEHLTNENEKLQGSLKNLLE------  850

Query  3121  ILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMN  3300
                  + R+ +E       LEA+L + Q+SLS+ L ++++LE  L S+ ++ S KE+ +N
Sbjct  851   -----MERKNVEQDEHRMQLEAQLHESQNSLSNSLIKVKALEENLDSMWKDFSLKEERLN  905

Query  3301  SELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKA  3480
             +EL+ ++ + K   E+LV +ESL +Q    KL E+E  +++   L  Q+ +  D E   A
Sbjct  906   AELDELIQENKNETEKLVQQESLSNQKYSEKLMEVERLEKEVEQLTKQISEM-DEERRLA  964

Query  3481  SEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQ  3660
             ++  +E+ SL ++ + L   + + +    +TE +L  ++  YE+                
Sbjct  965   TDSVNEVSSLRSDKEKLVSAIDDFKSKCTLTEKELAASRQSYEK----------------  1008

Query  3661  VVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIA  3840
               L     K+ + L N  ++E  LK  I++LE +L LS  E  +  + +++LK++L K  
Sbjct  1009  --LMVDHAKILKLLPNYRANEEKLKTSINDLELQLTLSRYEHQKFHEESANLKLQLQKAK  1066

Query  3841  FLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEE  4020
              L+DEV  LK  L +   + + LEASL+ I G+ EE+KA+K S   +++ +Q  +TELE 
Sbjct  1067  ELQDEVFNLKSELTECISEKQNLEASLEKISGDFEEMKAEKASFTSKISNLQKVLTELEN  1126

Query  4021  CRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYL  4200
                R++ LEEKV ++E +LT +E   A+  +L+ +L+++KR N Q R KI ++E E+   
Sbjct  1127  SNRRRICLEEKVQQMESELTEKEKFFAQVTDLRTELSETKRDNEQYRQKIYKMEEEKDNF  1186

Query  4201  SKELQSVQEELNRKE------------NSVPSPSHSV-----AKDKTTSCKEQKLSKARS  4329
              K++Q+++ E+   E            N  P  ++       A  K +  +E  + +  S
Sbjct  1187  LKKVQALEAEVKMMEEEKKLYAKKFEQNDTPKSNNKYTNFNRAPQKLSQSQELWVDRLHS  1246

Query  4330  SQ--------CNNCETIQIVTIDDCSSRCQVGDDK---------------TQFKSLQPEG  4440
              +         ++ + I    + D  +R Q+ ++K                +FK+ +  G
Sbjct  1247  DRKSSESEGENSSSDGITSSVVVDYLARIQLLENKLGEALEANKKYKIQLQRFKTEERRG  1306

Query  4441  QST---RSGNENE------QKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKAL  4593
              S    +S  +NE         + LEAELK+I ERY  MSLKYAEVE Q+  LVM LKA+
Sbjct  1307  HSPASKKSEGDNEMVKRFEHTKALLEAELKDIRERYFQMSLKYAEVEAQREDLVMKLKAV  1366

Query  4594  Q  4596
             +
Sbjct  1367  K  1367


 Score =   177 bits (450),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 126/180 (70%), Gaps = 9/180 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL++ ++   D SG++  F FSN Q LQVPKGWD+LS+S+I VE GKT++KLGK  V 
Sbjct  1    MFKLQK-QNYKQDKSGERVDFRFSNFQLLQVPKGWDRLSLSVICVETGKTVAKLGKTLVK  59

Query  241  NGTCQWTESL----WSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQW E+L    W  ++ +S  L+   +KF+VSMGS+R+G+LGE T+N+  Y  S  S
Sbjct  60   NGSCQWPETLLESVWISQDDSSLELEESVYKFVVSMGSARSGLLGEGTINLASYVGSRVS  119

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
             PV +PL+KCN+GT L  +I CLTP++ FR DE+ S+ +   +E+ + + +D+KS E  N
Sbjct  120  SPVLVPLKKCNQGTTLQVKIHCLTPKSKFR-DELKSSGS-GVKEHVLDHDVDSKSNESGN  177


 Score =   103 bits (258),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 105/140 (75%), Gaps = 3/140 (2%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE NAR+LM+ ++ LR+EFA+QS++ AD+ M+LS +++E   L  +I+ L
Sbjct  306   IEELRIEAKMWERNARKLMLDLDILREEFASQSKKQADLVMDLSASYSEQGNLKREIENL  365

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             ++ LEES +K   AE+   Q +  +   +E+E+E++ Q E N++L+LQL+ SQESN EL+
Sbjct  366   KLKLEESTSKHDVAEDSIFQPRGQK---EELENEVRHQQEFNASLALQLKGSQESNIELL  422

Query  1216  SVLQEMEETVQKKKIEIENL  1275
              +LQE+EET++++K+EIE  
Sbjct  423   VLLQELEETIEQQKVEIEKF  442



>gb|EAY79416.1| hypothetical protein OsI_34549 [Oryza sativa Indica Group]
Length=1550

 Score =   202 bits (514),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 179/546 (33%), Positives = 307/546 (56%), Gaps = 26/546 (5%)
 Frame = +1

Query  2680  DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLE  2856
             D MREE++++T  I  ++S   + E KI ELE+ K  LE  + +LE EN++LSE +SGLE
Sbjct  736   DEMREELLLLTSSIDSHVSTNNVLETKITELESCKVNLELHISKLEHENVELSEFISGLE  795

Query  2857  AQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDK----------------------  2970
             +QL +  +  ELS +++    + + NL+DE+ ++E  K                      
Sbjct  796   SQLTYLANEKELSMLQMDESRSLITNLKDELEQVEAQKVELKLQMDESRSLITNLKDELE  855

Query  2971  --ESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRR  3144
               E+Q++ELK+  +E  +R  + QE+SE L+++N KLQAT + ++EEC SLQ L  +L++
Sbjct  856   QVEAQKVELKENQLESHRRLSEVQEDSEALRRSNAKLQATVDHVVEECKSLQTLTADLKK  915

Query  3145  QRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILL  3324
             Q+LE+    + LE EL + +         +ESLEAKLSS+ E+ S KE+ + SELE I  
Sbjct  916   QKLEVHGYASHLEQELEQSKRKTMDFCKTLESLEAKLSSLQEDISLKEQSLLSELENIFQ  975

Query  3325  QTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMH  3504
             + KE +ER+     L +++ + K  EL   ++    L  Q+    +  +    +   E+ 
Sbjct  976   EHKEHEERIDRVHLLLNKIEKEKTVELSNLERDVISLTAQLSSTEEERESSTLDTIREVS  1035

Query  3505  SLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSD  3684
              L A+   L+  L+++   +   E +L   + E + K+ +L+  LNA K N+ +L    D
Sbjct  1036  ILRADKAKLEANLEDVNAQMIHYESQLEDLR-ESKTKIKDLVDSLNASKQNEEMLTTDVD  1094

Query  3685  KLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLA  3864
              ++R +E   S+E NL+  +  LE K   S+ E+ Q+ +  S LKI++ KIA L+DEVL 
Sbjct  1095  NMRRSIEAARSNEDNLRKTLCELELKSKSSDYEKQQIIEEISVLKIQVHKIAGLQDEVLT  1154

Query  3865  LKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVL  4044
             L+ SL++ KF+  +LE  +Q +  E EELKA K  L  +++ MQ+++    E +  ++  
Sbjct  1155  LQSSLDEAKFEKGKLEGLIQSLSEECEELKAQKGMLTDKVSCMQDTLNAANEGKQIEISA  1214

Query  4045  EEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQ  4224
             + K++ L  +   +E     +AELK++L+  +  NS+ + KI  L+ E   L++  Q ++
Sbjct  1215  QTKLVMLGDEPPVKETSDVLEAELKSELSIIRGANSEYQQKIHSLQEENEDLTRRNQLME  1274

Query  4225  EELNRK  4242
             +EL+ K
Sbjct  1275  KELDLK  1280


 Score =   116 bits (291),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 88/140 (63%), Gaps = 6/140 (4%)
 Frame = +1

Query  82   KSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWT  261
            +  +SD   ++  F FS  +A+QVP   D+L +S+++V+ GKTI+K  KA+  +G CQW 
Sbjct  7    RRGSSDRLRERVKFRFSGFRAVQVPVVSDRLMLSIVAVDTGKTIAKSTKAAALSGACQWP  66

Query  262  ----ESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPL  423
                ES+W  ++  S        +F+VSMGS+ +GILGE  +N+ +Y +S  S  +SLPL
Sbjct  67   DSILESIWFSQDQVSEEFQECQCRFVVSMGSTNSGILGEVFLNLTNYLSSLESTAISLPL  126

Query  424  QKCNKGTVLNFEIKCLTPRT  483
            ++C+ GT+L   I+CL  ++
Sbjct  127  KRCDSGTILQLNIQCLGAKS  146


 Score =   101 bits (252),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 145/256 (57%), Gaps = 16/256 (6%)
 Frame = +1

Query  3844  LRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEEC  4023
             L+DEVL L+ SL++ KF+N +LE  LQ +  E EELKA K  L  +++ MQ+++    E 
Sbjct  1295  LQDEVLMLQSSLDEAKFENGKLEGLLQSLSEECEELKAQKGMLTDKVSCMQDTLNAANEG  1354

Query  4024  RLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLS  4203
             +  ++  + K++ L  +   +E     +AELK++L+  +  NS+ + KI  L+ E   L+
Sbjct  1355  KQIEISAQTKLVMLGDEPPVKETSDVLEAELKSELSIIRGANSEYQQKIHSLQKENEDLT  1414

Query  4204  KELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCS  4383
             +  Q +++EL+ K         S  KD+ T+ +    ++   S  N    +Q   I    
Sbjct  1415  RRNQLMEKELDLK--------TSQNKDENTNKQGNDANENGDSPVNEVPELQ-SKIQLLE  1465

Query  4384  SRCQVGDD-----KTQFKSLQPEGQS-TRSGNEN-EQKISQLEAELKEISERYLHMSLKY  4542
             +R     +     + Q KS  PEG+S ++ G EN + KISQLE+ELK++ ER L++SL+Y
Sbjct  1466  TRLAEALEENKLYRGQLKSPMPEGKSASKDGKENDDDKISQLESELKDMQERLLNVSLQY  1525

Query  4543  AEVENQKGKLVMTLKA  4590
             AEVE Q+ +LVM LK 
Sbjct  1526  AEVEAQREELVMELKT  1541


 Score = 92.4 bits (228),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +1

Query  880   RMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESN  1059
             +MW+   R+L   +ETL+KE A++S++ +++E+ELS + +E + L  +I+ L+  LEE  
Sbjct  337   KMWQRKTRKLKQGLETLKKECADKSKQQSELELELSISISERDSLRQEIEELKRSLEEVT  396

Query  1060  AKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEE  1239
             A+Q  + +   ++ +   + KE+ED+++F  ESN++L+ QL K+QE+N ELVS+LQE+EE
Sbjct  397   ARQTISRSP--RSGDAIELQKEVEDDVQFLKESNASLATQLNKAQEANIELVSILQELEE  454

Query  1240  TVQKKKIEIENL  1275
             T++ ++ EI NL
Sbjct  455   TIEVQRAEISNL  466



>ref|XP_006354414.1| PREDICTED: myosin-11-like [Solanum tuberosum]
Length=1412

 Score =   202 bits (514),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 216/725 (30%), Positives = 377/725 (52%), Gaps = 89/725 (12%)
 Frame = +1

Query  2578  RRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS--DSMREEMMVVTGRIFGNISE-KIQ  2748
             +R+L  K+   Q     VE++M+ V  E    +S  D ++ +   ++  +   +SE K+ 
Sbjct  718   QRELEGKVSGLQKEKDQVEENMKIVSRESVMTSSCLDGLQSDYKELSNNMDARVSENKML  777

Query  2749  EMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQL  2928
             E K+ +LE++K  LE          + L+E+   +E+Q+R  T   E  + EL+   + +
Sbjct  778   EKKLAQLESDKHTLEDQF-------VGLTEKNENMESQIRLMTVEGESRQSELEESKSAI  830

Query  2929  CNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEEC  3108
              NLQ+EI +LE + ++   +LK+ L +MQ  W  ++E  E+L   N KLQ + ++L+E  
Sbjct  831   MNLQEEIEKLESETKTSIADLKEELEDMQILWSQAREVCEHLTDENEKLQESLQNLLE--  888

Query  3109  DSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKE  3288
               ++  N E    R++L       EA+L + Q SLS+ L ++++LE  L+++ ++ SSKE
Sbjct  889   --MERKNVEQNEHRMQL-------EAQLHESQKSLSNSLIKVKALEENLNAMWKDFSSKE  939

Query  3289  KIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDRE  3468
             + +N+EL+ ++ + K   E+LV +ESL +Q    KL E+E  +++   L  ++ +  D E
Sbjct  940   EKLNAELDELIQENKNEIEKLVQQESLSNQKYLEKLMEVETLEKEVEQLTKKISEM-DEE  998

Query  3469  DGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAH  3648
                A++  +E+ SL A+ + L   L + +    +TE +L  ++  YE+            
Sbjct  999   RRLAADTVNEVSSLRADKEKLVSALDDFESKCTLTEKELSASRQSYEK------------  1046

Query  3649  KTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIEL  3828
                   L     K+ + L N  ++E  LK  I++LE +L LS  E  +  + +++LK +L
Sbjct  1047  ------LMVDHAKILKLLPNYRANEEKLKTSINDLELQLTLSRYEHQKFHEESANLKFQL  1100

Query  3829  LKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVT  4008
              K   L+DEV  LK  L +   K E LEASL+ I G+ EE+KA+K S + +++ +Q  + 
Sbjct  1101  QKTKELQDEVFNLKSELTESISKKENLEASLEKISGDFEEMKAEKASFVGKISDLQKVLL  1160

Query  4009  ELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELE  4188
             ELE    R++ LEEKV ++E +LT +E  CA+  +L+N+L+++KR N Q R KI ++E +
Sbjct  1161  ELENSNRRRICLEEKVEQMESELTEKEKFCAQVTDLRNELSETKRDNEQYRQKIYKMEEK  1220

Query  4189  RYYLSKELQSVQEELNRKE------------NSVPSPSHSV-----AKDKTTSCKEQKLS  4317
             +    K++Q+++ E+   E            N  P  ++       A  K +  +E ++ 
Sbjct  1221  KDNCLKKVQALEAEVKMMEEEKKLYAKKFEQNDTPKSNNKYTNFNRAPQKLSQSQELRVD  1280

Query  4318  KARS------SQCNNCETIQIVTID--DCSSRCQVGDDK---------------TQFKSL  4428
             +  S      S+  N  + +I +    D  +R Q+ ++K                +FK+ 
Sbjct  1281  RLHSDHKSSESEGENSFSDKITSSVEVDYLARIQLLENKLAEALEANKKYKIQLQRFKTE  1340

Query  4429  QPEGQSTRSGNEN---------EQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMT  4581
             +  G S  S             E   + LE ELK+I ERY  MSLKYAEVE Q+  LVM 
Sbjct  1341  ERRGHSPASKKSEGDSEMVKRFEHTKALLETELKDIRERYFQMSLKYAEVEAQREDLVMK  1400

Query  4582  LKALQ  4596
             LKA++
Sbjct  1401  LKAVK  1405


 Score =   164 bits (415),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 125/199 (63%), Gaps = 28/199 (14%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQ-------------------VPKGWDKLSVS  183
            MFKL++ +++  DNSG++  F FSN Q LQ                   VPKGWD+L +S
Sbjct  1    MFKLQK-QNNKQDNSGERVDFRFSNFQLLQLYQGFEPKLLSSAEFVDRVVPKGWDRLFLS  59

Query  184  LISVEAGKTISKLGKASVNNGTCQWTESL----WSPENYASNGLDH--FKFLVSMGSSRA  345
            +I VE GKT +KLGK  V NG+CQW E+L    W  ++ +S  L+   +KF+VSMGS+R+
Sbjct  60   VICVETGKTAAKLGKTLVKNGSCQWPETLLESVWISQDDSSLELEESLYKFVVSMGSARS  119

Query  346  GILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYN  525
            G+LG  T+N+  Y  S  S PV +PL+KCN+GT L  +I CLTPR+ FR DE+ S+ +  
Sbjct  120  GLLGVGTINLASYVGSRMSSPVLVPLKKCNQGTTLQVKIHCLTPRSKFR-DELKSSGS-G  177

Query  526  EEENSVCNGIDNKSEERNN  582
             +E+ + + +D+KS E  N
Sbjct  178  VKEHGLDHDVDSKSNESGN  196


 Score =   102 bits (253),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 105/140 (75%), Gaps = 3/140 (2%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE NAR+LM+ ++ LR+EFA+QS++ AD+ M+LS +++E   L  +I+ L
Sbjct  344   IEELRIEAKMWERNARKLMLDLDILREEFASQSKKQADLVMDLSASYSEQGNLKREIENL  403

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +++LEES  K   AE+   Q +  +   +E+E+E++ Q E N++L+LQL+ SQESN EL+
Sbjct  404   KLMLEESTLKHDVAEDSIFQPRGQK---EELENEVRHQQEFNASLALQLKGSQESNIELL  460

Query  1216  SVLQEMEETVQKKKIEIENL  1275
             S+LQE+EET++++K EIE  
Sbjct  461   SLLQELEETIEQQKEEIEKF  480



>ref|XP_007145290.1| hypothetical protein PHAVU_007G226600g [Phaseolus vulgaris]
 gb|ESW17284.1| hypothetical protein PHAVU_007G226600g [Phaseolus vulgaris]
Length=1341

 Score =   201 bits (511),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 210/660 (32%), Positives = 329/660 (50%), Gaps = 103/660 (16%)
 Frame = +1

Query  2785  ELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEK  2964
             ELE  + + E+E  QLS RVS LEAQLR  T+  E    EL++  ++   LQ++I E++ 
Sbjct  719   ELELSISDREQERQQLSMRVSVLEAQLRDLTNEREFHLEELENSRSKAARLQEKIMEMQT  778

Query  2965  DKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRR  3144
                    E+     E Q RW ++QEE EYL+ AN  LQ T E+L EEC S++ +NGELR+
Sbjct  779   -------EIDSSTQEAQIRWSEAQEECEYLRVANRNLQNTIENLAEECSSVKKINGELRQ  831

Query  3145  QRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILL  3324
             ++L+++  C+L+ A LR+     + C  R+E LE   + +LE+ +SK K + S+L+ +  
Sbjct  832   EKLKVEEYCSLMGARLRESDERFAQCSERVEHLEESFTLMLEDIASKVKHLISDLDGLFY  891

Query  3325  QTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMH  3504
             + ++  E+    E+L +Q+   K+ E +  + +   L  ++      ++  AS    E+ 
Sbjct  892   ENRKHMEQ---GEALLNQMQMEKMVETQNLELEIEKLRLKLSAVYHEKEKIASNALLEVS  948

Query  3505  SLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSD  3684
             +L  +   L+   +E Q  + + + ++   Q + E+K+ +L  ++  +K    +L  + +
Sbjct  949   TLRDDKAKLESAFEEAQSKVILAQNEVDAMQSQNEQKLKDLTTQVAEYKIKVEMLTTEHE  1008

Query  3685  KLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLA  3864
             KL + +E+  S E   K  I+ LE KL ++E ER Q+ D + +LK++L +     +E +A
Sbjct  1009  KLLKLVEDSKSRELKFKSTINALELKLTVTEYERQQIMDESGNLKVKLQQNYKFENENIA  1068

Query  3865  LKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVL  4044
             L   LN  K + ERLEASL L     E+LKADKTSL                        
Sbjct  1069  LNNELNASKSEKERLEASLHLTSELCEDLKADKTSL------------------------  1104

Query  4045  EEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQ  4224
             EE++++LE DL ARE  C +D EL    + +KR+N Q +  I+ LE E+     + Q+++
Sbjct  1105  EERLVQLENDLKARETRCVQDTEL----SHNKRINRQHQQTIQLLEQEKAEFQTKAQALE  1160

Query  4225  EELN----RKENSVP------SPSHSVAKD--------------------KTTSCKEQK-  4311
             EEL     +K N V       SP H   K                     K  S K Q  
Sbjct  1161  EELKLIKEQKRNQVSKFNRKSSPVHDDTKASKNFGVKNTNQHRNNRKKSLKNDSIKYQSE  1220

Query  4312  -------------------LSK--------ARSSQCNNCETIQIVTIDDCSSRCQVGDDK  4410
                                LSK        A++++ NN E    V I    SR Q     
Sbjct  1221  VETELGLLDENIHAVEVDPLSKTQLHDNEQAKANEANNIE----VQIHRSPSRGQKIQVN  1276

Query  4411  TQFKSLQPEGQSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
                KS+  E     +  + E+  S LEAEL++I ERY HMSLKYAEVE ++ +LVM LKA
Sbjct  1277  GPVKSVAEE---LVTKEKFERTKSMLEAELRDIQERYFHMSLKYAEVEAEREELVMKLKA  1333


 Score =   171 bits (432),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 108/155 (70%), Gaps = 9/155 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L +H+++    SGD+  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K  V 
Sbjct  1    MFRLHKHRAA---KSGDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTIAKSSKVPVR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDHF--KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQW+    ES+W   N ++  +D F  K +V+MGSS++GILGEA+V++  Y +S A+
Sbjct  58   NGGCQWSDNFSESIWVSRNNSAKDIDDFVLKLIVAMGSSKSGILGEASVSLTSYMSSGAA  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVN  507
             P+S+PL KCN GT+L   ++CLTPRT     E N
Sbjct  118  TPLSIPLIKCNHGTILQVTVQCLTPRTKLSDQETN  152


 Score =   125 bits (315),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR++M  ++ LR E ++Q + +A ++M+LS A  E + L  +++ L+
Sbjct  292   EELRAEAKMWEMNARKVMGDLDELRTELSDQYKNLAGIKMDLSAAQVERDSLKQEVEHLK  351

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             +   +  A+Q A+E+   + +    I   +++ELKF+ ESN+NLSLQL++SQE+N ELVS
Sbjct  352   LSFGDPRARQRASEDSLSEGECISEIENALKEELKFEKESNANLSLQLKRSQEANLELVS  411

Query  1219  VLQEMEETVQKKKIEIENLLALNS  1290
             VLQE+EET++++KIEIENL +L S
Sbjct  412   VLQELEETIEQQKIEIENLSSLTS  435



>ref|XP_006594170.1| PREDICTED: early endosome antigen 1-like [Glycine max]
Length=1391

 Score =   199 bits (506),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 172/487 (35%), Positives = 277/487 (57%), Gaps = 15/487 (3%)
 Frame = +1

Query  2779  KQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIREL  2958
             K ELE  + ++E+E  QLS RVS LEAQLR  T+  E    EL+   +Q   LQ++I EL
Sbjct  726   KHELELHILDIEQEKQQLSIRVSVLEAQLRDLTNEQEFRLSELESSRSQAARLQEKITEL  785

Query  2959  EKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGEL  3138
             + + +S   +LKQ+L   Q  W ++QEE EYL+ AN KLQ T E+L EEC   + LNG+L
Sbjct  786   QSETDSSTEDLKQKLRVAQIHWSEAQEECEYLRGANQKLQITVENLAEECSYFEKLNGDL  845

Query  3139  RRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMI  3318
             ++Q L+L+  C+ +EA LR+     + C   +E LE K    LE+ +SKEK + S+ + I
Sbjct  846   KQQNLKLEEYCSHMEARLRESDERFAKCSEGVELLEKKFDLKLEDIASKEKHLTSDFDGI  905

Query  3319  LLQTKEFKER--LVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGS  3492
               + ++  E+   ++ +     + + +  ELE         V ++    D ++  AS   
Sbjct  906   FYENRKHMEQAHFLLNQMQMEMMVETQNLELE---------VEKLSAAYDEKERIASNAM  956

Query  3493  HEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLE  3672
              E+ +L A+   L+   +E Q  + + + ++   Q +YE+K+ +L  +L+ +K    +L 
Sbjct  957   LEVSTLRADKAKLESAFEEAQSKVILAKNEVDMMQSQYEQKLKDLTTQLSKYKIKIEMLM  1016

Query  3673  AKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRD  3852
              + +KL + +E+  S E   K  I+ LE KL ++E ER Q+ D + +LK++L +     +
Sbjct  1017  TEHEKLLKLVEDYKSRELKFKSTINALELKLTVTEYERQQVMDESGNLKVQLQQTQQFEN  1076

Query  3853  EVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLR  4032
             E++ALK  LN    K ERLEASL+L     E+LK +KTS   ++  ++ + +ELE+C+  
Sbjct  1077  EIIALKNELNASNSKKERLEASLRLTSELCEDLKEEKTSSELKILALETAESELEDCKRT  1136

Query  4033  KVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKEL  4212
             +  LEEK+L LE DL ARE  C +D E    L+ SKR+N Q +  I+ LE E+     + 
Sbjct  1137  RTSLEEKLLLLENDLKARESRCVQDTE----LSHSKRINRQHQQTIQLLEQEKAEFQTKA  1192

Query  4213  QSVQEEL  4233
             Q ++EEL
Sbjct  1193  QVLEEEL  1199


 Score =   177 bits (449),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 112/157 (71%), Gaps = 9/157 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L +H+ +    SGDK  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K SV 
Sbjct  1    MFRLHKHRIA---KSGDKIEFRISHLKALQVPKGWDKLFVSVVSVETGKTIAKSSKVSVR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDHF--KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQW+    ES+    + +S  +D +  K +V+MGSSR+GILGEATV++  YR+S A+
Sbjct  58   NGGCQWSDTFSESILVSRDNSSKEIDDYVLKLIVAMGSSRSGILGEATVSLTSYRSSGAA  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
            IP+S+PL KCN GTVL+  ++CLTPRT  R  E + T
Sbjct  118  IPLSIPLNKCNHGTVLHVTVQCLTPRTKLRDQESSET  154


 Score =   132 bits (333),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR+LM  ++ LR EF++QS+++A MEM+LS A  E + L  + ++L+
Sbjct  300   EELRAEAKMWEMNARKLMGDLDMLRTEFSDQSKKMAGMEMDLSAAQVERDSLKKEAEQLK  359

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             +  E+   +Q A E+   Q +    I   +++ELKF+ E N+NLSLQL++SQE+N ELVS
Sbjct  360   LSFEDPIVRQKALEDSMSQVEGIPEIENALKEELKFEKEFNANLSLQLKRSQEANIELVS  419

Query  1219  VLQEMEETVQKKKIEIENLLALNSR  1293
             VLQE+E+T++++K+EIENL +L S+
Sbjct  420   VLQELEDTIEQQKVEIENLSSLPSK  444


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  4480  SQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             S LEAEL++I ERY HMSLKYAEVE  + +LVM LKA + Q+
Sbjct  1346  SMLEAELRDIQERYFHMSLKYAEVEAMREELVMKLKATRKQK  1387



>gb|KHN48228.1| hypothetical protein glysoja_007897 [Glycine soja]
Length=1391

 Score =   199 bits (505),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 172/487 (35%), Positives = 279/487 (57%), Gaps = 15/487 (3%)
 Frame = +1

Query  2779  KQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIREL  2958
             K EL+  + ++E+E  QLS RVS LEAQLR  T+  E    EL++  +Q   LQ++I EL
Sbjct  726   KHELKLHILDIEQEKQQLSIRVSVLEAQLRDLTNEQEFHLSELENSRSQAARLQEKIMEL  785

Query  2959  EKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGEL  3138
             + + +S   +LKQ+L   Q  W ++QEE EYL+ AN KLQ T E+L EEC   + LNG+L
Sbjct  786   QSETDSSTEDLKQKLRVAQIHWSEAQEECEYLRGANQKLQITVENLAEECSYFEKLNGDL  845

Query  3139  RRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMI  3318
             ++Q L+L+  C+ +EA LR+     + C   +E LE K    LE+ +SKEK + S+L+ I
Sbjct  846   KQQNLKLEEYCSHMEARLRESDERFAKCSEGVELLEKKFDLKLEDIASKEKHLTSDLDGI  905

Query  3319  LLQTKEFKER--LVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGS  3492
               + ++  E+   ++ +     + + +  ELE         V ++    D ++  AS   
Sbjct  906   FYENRKHMEQAHFLLNQMQMEMMVETQNLELE---------VEKLSAAYDEKERIASNAM  956

Query  3493  HEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLE  3672
              E+ +L A+   L+   +E Q  + + + ++   Q +YE+K+ +L  +L+ +K    +L 
Sbjct  957   LEVSTLRADKAKLESAFEEAQSKVILAKNEVDMMQSQYEQKLKDLTTQLSKYKIKIEMLM  1016

Query  3673  AKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRD  3852
              + +KL + +E+  S E   K  I+ LE KL ++E ER Q+ D + +LK++L +     +
Sbjct  1017  TEHEKLLKLVEDYKSRELKFKSTINALELKLTVTEYERQQVMDESGNLKVQLQQTQQFEN  1076

Query  3853  EVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLR  4032
             E++ALK  LN    K ERLEASL+L     E+LK +KTS   ++  ++ + +ELE+C+  
Sbjct  1077  EIIALKNELNASNSKKERLEASLRLTSELCEDLKEEKTSSELKILALETAESELEDCKRI  1136

Query  4033  KVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKEL  4212
             +  LEEK+L LE DL ARE  C +D E    L+ SKR+N Q +  I+ LE E+     + 
Sbjct  1137  RTSLEEKLLLLENDLKARESRCVQDTE----LSHSKRINRQHQQTIQLLEQEKAEFQTKA  1192

Query  4213  QSVQEEL  4233
             Q ++EEL
Sbjct  1193  QVLEEEL  1199


 Score =   176 bits (446),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 111/157 (71%), Gaps = 9/157 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L +H+ +    SGDK  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K SV 
Sbjct  1    MFRLHKHRIA---KSGDKIEFRISHLKALQVPKGWDKLFVSVVSVETGKTIAKSSKVSVR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDHF--KFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQW+    ES+    + +S  +D +  K +V+MGSSR+GILGE TV++  YR+S A+
Sbjct  58   NGGCQWSDTFSESILVSRDNSSKEIDDYVLKLIVAMGSSRSGILGEVTVSLTSYRSSGAA  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
            IP+S+PL KCN GTVL+  ++CLTPRT  R  E + T
Sbjct  118  IPLSIPLNKCNHGTVLHVTVRCLTPRTKLRDQESSET  154


 Score =   132 bits (333),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR+LM  ++ LR EF++QS+++A MEM+LS A  E + L  + ++L+
Sbjct  300   EELRAEAKMWEMNARKLMGNLDMLRTEFSDQSKKMAGMEMDLSAAQVERDSLKKEAEQLK  359

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             +  E+   +Q A E+   Q +    I   +++ELKF+ E N+NLSLQL++SQE+N ELVS
Sbjct  360   LSFEDPIVRQKALEDSMSQVEGIPEIENALKEELKFEKEFNANLSLQLKRSQEANIELVS  419

Query  1219  VLQEMEETVQKKKIEIENLLALNSR  1293
             VLQE+E+T++++K+EIENL +L S+
Sbjct  420   VLQELEDTIEQQKVEIENLSSLPSK  444


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +1

Query  4480  SQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             S LEAEL++I ERY HMSLKYAEVE  + +LVM LKA + Q+
Sbjct  1346  SMLEAELRDIQERYFHMSLKYAEVEAMREELVMKLKATRKQK  1387



>ref|XP_006589841.1| PREDICTED: myosin-9-like [Glycine max]
Length=1230

 Score =   197 bits (500),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 157/462 (34%), Positives = 260/462 (56%), Gaps = 15/462 (3%)
 Frame = +1

Query  2854  EAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDS  3033
             EAQLR  T+  E    EL++  +Q   LQ++I E++ + +S   +LKQ+LM  +  W ++
Sbjct  591   EAQLRDLTNEQEFRLSELENSRSQAARLQEKIMEMQSEIDSSTEDLKQKLMVAKIHWSEA  650

Query  3034  QEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSL  3213
             QEE EYL+ AN KLQ T E L EEC S + LNG+L++Q L+L+  C+ +EA LR+     
Sbjct  651   QEECEYLRGANQKLQITIEDLAEECSSFEKLNGDLKQQNLKLEGYCSHMEARLRESDERF  710

Query  3214  SSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKER--LVIKESLQSQLCQ  3387
             S C   +E LE K    LE+ +SKEK + S+ + I  + ++  E+   ++ +     + +
Sbjct  711   SKCSEGVELLEKKFDLKLEDIASKEKHLTSDFDGIFYENRKHMEQAHFLLNQMQMEMMVE  770

Query  3388  HKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLE  3567
              +  ELE  +  + H         D ++  AS    E+ +L A+   L+   +E Q  + 
Sbjct  771   TQNLELEVEKLSAAH---------DEKERIASNAMLEVSTLRADKAKLESAFEEAQSKVS  821

Query  3568  ITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIID  3747
             + + ++   Q +YE+K+ +L  +L  +K    +L  + +KL + +E+  S E   K  I+
Sbjct  822   LAKKEVDMIQSQYEQKLEDLTTQLAEYKIKMEMLMTEHEKLLKLVEDYKSRELKFKSTIN  881

Query  3748  NlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQL  3927
              LE KL ++E ER Q+ D +  LK++L +     +E++ALK  L+    + ERLEASL L
Sbjct  882   ALELKLTVTEYERQQVMDESGILKVQLQQTHQFENEIIALKNELDASNSEKERLEASLCL  941

Query  3928  ICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKD  4107
                  E+LKA+K S   ++  ++ + +ELE+C+  +  LEEK+L+LE DL A+E  C +D
Sbjct  942   TSELCEDLKAEKISSGLKILALEQAASELEDCKKTRASLEEKLLQLENDLKAKETRCVQD  1001

Query  4108  AELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL  4233
              E    L+ SKR+N Q +  I+ LE E+     + Q ++EEL
Sbjct  1002  TE----LSHSKRINRQHQQTIQLLEQEKAEFQTKAQVLEEEL  1039


 Score =   146 bits (368),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = +1

Query  151  VPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWT----ESLWSPENYASNGLDH--F  312
            VPKGWDKL VS++SVE GKTI+K  K SV NG CQW+    ES+    + +S  +D    
Sbjct  34   VPKGWDKLFVSVVSVENGKTIAKSSKVSVRNGGCQWSDNFSESISISRDNSSKEIDDCDL  93

Query  313  KFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
            K +V+MGSSR+GILGEATV++  Y +S A+IP+S+PL KCN GTVL+  ++CLTPRT  R
Sbjct  94   KLIVAMGSSRSGILGEATVSLTSYMSSGAAIPLSIPLNKCNHGTVLHVTVQCLTPRTKLR  153

Query  493  GDEVNST  513
              E + T
Sbjct  154  DQESSET  160


 Score = 75.9 bits (185),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 92/160 (58%), Gaps = 14/160 (9%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR+LM  ++ LR EF++QS+++A +EM+LS    E + L  ++++L+
Sbjct  306   EELRAEAKMWEMNARKLMGDLDMLRTEFSDQSKKLAGIEMDLSATQVERDGLKKEVEQLK  365

Query  1039  VLLEESNAKQIAAENLNLQAKNT--------ENI------LKEMEDELKFQTESNSNLSL  1176
             +  E+   +Q A E+   Q + T        EN+        +++   +   E N +L  
Sbjct  366   LSFEDPVVRQKALEDSVSQVEETIEQQKVEIENLSSLPLKFSDLDKSFQQSIEGNKHLMQ  425

Query  1177  QLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRS  1296
             QL + +ES   L+  +QE+E T++ K    E+    N+R+
Sbjct  426   QLEQLEESKKSLLVKVQELEGTLEDKMRGTEHAKIQNNRT  465



>ref|XP_009780326.1| PREDICTED: sporulation-specific protein 15-like [Nicotiana sylvestris]
Length=1415

 Score =   194 bits (493),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 206/673 (31%), Positives = 352/673 (52%), Gaps = 71/673 (11%)
 Frame = +1

Query  2749  EMKILELENEKQE-------LESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMEL  2907
             E K+ +L+ EK         LE  + +LE EN  L E+   +EA  R  T   E  + EL
Sbjct  746   EAKVTDLQKEKDAQVSENKLLEGKLTQLESENDILKEKNENMEAH-RLMTVERESRQSEL  804

Query  2908  QHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATA  3087
             +   T + NLQ+EI +LE + ++   +LK+ L +MQ  W  ++EE  +L   N KLQ + 
Sbjct  805   EESRTNVMNLQEEIGKLESEMKTNIADLKEELEDMQILWSQAREECGHLTNENEKLQESL  864

Query  3088  ESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSIL  3267
             ++L+EE  ++Q  N E+ R+ LEL  +   LEA+L + Q   S+ L ++++LE  L+S+ 
Sbjct  865   QNLLEEYKTVQHSNSEMERENLELHERHLHLEAQLHESQKRSSNSLIKVKALEENLNSMW  924

Query  3268  EETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQM  3447
             ++ S +E+ +N+EL  ++ + K+  E+LV +ESL +Q    K +E++  +++   L  Q+
Sbjct  925   KDFSLEEERLNAELNELIQENKKEIEKLVQQESLSNQRYSEKSTEVKSLKKEVEQLTKQI  984

Query  3448  FDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYEL  3627
              +  D E   AS+  +E+ SL A N ML   L+++Q    +TE +L   ++E E K+ + 
Sbjct  985   SEM-DEERRLASDAVNEVSSLRANNAMLVSALEDVQSKFTLTEKELSNVRIESELKIQDS  1043

Query  3628  MGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADAN  3807
                          L    +K+ + L N  ++E  LK  I++LE +L LS  E  +L + +
Sbjct  1044  RRSFEK-------LTVDHEKILKLLPNYRANEEKLKTAINDLELQLTLSRYEHQKLHEES  1096

Query  3808  SSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELT  3987
             ++LK +L K   L+++V  LK  L + + + E+LEAS  +I  + E++KA+K S   +++
Sbjct  1097  ANLKCQLQKTKELQEDVDYLKSELKECRSEKEKLEASQNIISVDYEKMKAEKASSAGKIS  1156

Query  3988  GMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWK  4167
               Q  + ELE     ++ LE+K+ ++E DLT +E  CA+ A LKN+L+++KR N Q + K
Sbjct  1157  DFQKILAELENSNKNRICLEQKLEQMESDLTEKEKFCAQVAGLKNELSETKRENDQYQQK  1216

Query  4168  IKQLELERYYLSKELQSVQEELNRKE------------NSVPSPSHSVAKDKTTSCKEQK  4311
             I +++ E+    +++Q+++ E+   E            N+ P    S  K    +   QK
Sbjct  1217  IHKMKEEKDNFLRKVQALEAEVKMMEEEKKLYAKKFEQNNTPK---STNKYTNFNRVHQK  1273

Query  4312  LSKAR----------------SSQCNNCETIQIVTIDDCSSRCQVGDD------------  4407
             L++++                  +  + + I      D  +R Q+ ++            
Sbjct  1274  LNQSQELLVDRLHSDRKYSESEGENGSADGIAYSAEVDFLARIQLLENKLAEALEANKKY  1333

Query  4408  KTQFKSLQPE---GQSTRSGNEN---------EQKISQLEAELKEISERYLHMSLKYAEV  4551
             K Q + L+ E   G S  S   +         E+  + LE ELK+I ERY  MSLKYAEV
Sbjct  1334  KIQLQRLKTEERKGHSPSSRKPDGDSEMVKRFERTKTSLETELKDIRERYFQMSLKYAEV  1393

Query  4552  ENQKGKLVMTLKA  4590
             E Q+  LVM LKA
Sbjct  1394  EAQREDLVMKLKA  1406


 Score =   178 bits (451),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 128/189 (68%), Gaps = 10/189 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL++  +  +  SG++  F FSN QALQVPKGWD+L +S+I VE GKT++KLGK  V 
Sbjct  1    MFKLQKQNNKQT-KSGERVDFRFSNFQALQVPKGWDRLYLSIICVETGKTVAKLGKTLVK  59

Query  241  NGTCQWTESL----WSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQW E+L    W  ++ +S  L+   +KF+VSMGS+R+GILGE T+N+  Y  S  S
Sbjct  60   NGSCQWPETLLESVWILQDDSSLELEESLYKFVVSMGSARSGILGEGTINLASYVGSRLS  119

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNN  582
             PV LPL+KCN+GT L  +I CLTP++ FR DE  S+ + N +E  + + I +KS E +N
Sbjct  120  SPVLLPLKKCNQGTTLQLKIHCLTPKSKFR-DESKSSVS-NMKEQDLDHDITSKSNESDN  177

Query  583  SLPSMEDSL  609
             L +  D L
Sbjct  178  -LSAGSDGL  185


 Score =   112 bits (281),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+ EA+MWE NAR+LM+ ++ LR+EF+ QS++ AD+ M+LS A+++   L  +I+ L
Sbjct  303   IEELRIEAKMWERNARKLMLDLDILREEFSAQSKKQADLVMDLSAAYSDQGSLKKEIENL  362

Query  1036  EVLLEESNAKQIA-AENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAEL  1212
             +++LEES AK  A AE+   Q+K+  +I +E+E+E++ Q E N++L+LQL+ SQESN EL
Sbjct  363   KLMLEESTAKHTATAEDSVFQSKSQNHIQEELENEIRHQQELNASLALQLKGSQESNIEL  422

Query  1213  VSVLQEMEETVQKKKIEIENLLALNSR  1293
             +S+LQE+EET++++K+EIE   +L+ R
Sbjct  423   LSLLQELEETIEQQKVEIEKFSSLHLR  449



>gb|KHG04544.1| Trafficking kinesin-binding 1 [Gossypium arboreum]
Length=1132

 Score =   191 bits (484),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 155/432 (36%), Positives = 264/432 (61%), Gaps = 21/432 (5%)
 Frame = +1

Query  2884  MELSRMELQHKGTQ----LCNLQDEIRELE-----KDKESQELELKQ-RLMEMQKRWLDS  3033
             +E   +EL+ KGT+    L   + E++ LE     K +E+ EL + Q +L +M  + L +
Sbjct  648   LETQTIELEAKGTEVVKELTQKRTEMQTLEATLQSKKEENMELRMNQSKLQDMHHQLLAA  707

Query  3034  QEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSL  3213
             +++ EYL++ N KLQAT E+LIEEC+SL      LR+++ EL+  C  LEA+L++     
Sbjct  708   EDKCEYLRRENTKLQATNETLIEECNSLNKSAEGLRKEKSELEEHCAQLEAKLKE-----  762

Query  3214  SSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHK  3393
               C  ++E L+  L+ ++E+ +SKEK +  EL  I  ++K+ + +L ++ES  +Q+   K
Sbjct  763   --CSKKVEVLDENLTLVIEDFASKEKKLTLELNAIHDKSKKLEAKLKLEESSWNQMYLEK  820

Query  3394  LSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEIT  3573
              +E+E    +  +L  Q+      ++  A E S     L A+   L L L+E Q NL++T
Sbjct  821   TNEVENLVLEVENLGKQLSAAHHEKEKTACEIS----GLQADKLRLDLALEEAQSNLKLT  876

Query  3574  EVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNl  3753
               +    + E + +V +L+GEL A + N  +L A+ +K  + LE+  SSE  LK I++ L
Sbjct  877   LSEFKKIESEAKTQVEDLLGELTAARENHEILMAEHEKALKLLESYKSSEGKLKTIVNEL  936

Query  3754  esklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLIC  3933
             E KL +SE ER Q+++ ++++K++LLKI  L+D++ AL    N +K   E+LEASL LI 
Sbjct  937   ELKLTVSEYERQQVSEQSTNMKVQLLKIENLQDDISALTDERNAIKADKEKLEASLHLIS  996

Query  3934  GENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAE  4113
              E ++LKA+K   +Q+++ +Q  V+E+E+ +  K+VLEEK++R EGDL A++ +  +D E
Sbjct  997   RECDDLKAEKNYSMQQISTLQKVVSEIEDYKHDKIVLEEKLVRTEGDLVAKQALLMQDEE  1056

Query  4114  LKNDLTQSKRVN  4149
             +KN+L + K+ N
Sbjct  1057  IKNELNEIKQTN  1068


 Score =   156 bits (394),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/194 (43%), Positives = 114/194 (59%), Gaps = 31/194 (16%)
 Frame = +1

Query  61   MFKLR--RHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKAS  234
            MF+L   R     S+ SG+K  F FSN + +QVPKGWD+L +S+IS+E GKT++K  KA 
Sbjct  1    MFRLHKTRQTPPPSNKSGEKIDFTFSNFKLVQVPKGWDRLIMSIISMENGKTMAKTSKAV  60

Query  235  VNNGTCQWT----ESLWSPENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            V NG+CQWT    ES+W  +    +    FK +V+MGS+R+ ILGEATVN+  Y NS  +
Sbjct  61   VRNGSCQWTETLSESIWVSKTVMEDCF--FKLVVAMGSARSSILGEATVNMTGYINSTIT  118

Query  403  IPVSLPLQKCNKGTVL----------------------NFEIKCLTPRTSFRGDEVNSTA  516
            +PVSLPL+KCN GTVL                      + +I+CLTPR     +E   T 
Sbjct  119  VPVSLPLKKCNHGTVLQTKEPFARFGSGWTRFKAVGAAHMKIQCLTPRRKPMDNESKQT-  177

Query  517  AYNEEENSVCNGID  558
             +++E NS  +  D
Sbjct  178  NFHKEGNSTEHSPD  191


 Score =   130 bits (326),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 115/168 (68%), Gaps = 8/168 (5%)
 Frame = +1

Query  814   CSLHITRTSIPDAN--------IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
             C+    R++ P  N        IEEL AEA+M E NA +LM+ ++ LRKE+++QS+  A 
Sbjct  292   CAASTLRSTDPSKNLLEAAEKTIEELHAEAKMQERNADKLMLDLDMLRKEYSDQSKNNAI  351

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQ  1149
             + MELS A+ E N L  ++++L+ LLE+S AKQ   E+   +   T  + KE+E+E+KF 
Sbjct  352   LAMELSAANVERNGLQKEVEQLKTLLEKSMAKQPTYEDSTFEDAGTTLLHKELENEIKFL  411

Query  1150  TESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSR  1293
              ESN +L+LQL++SQ++N ELVSVLQE+E+T++KKK+E+  + AL S+
Sbjct  412   KESNDSLALQLKRSQDANVELVSVLQELEQTIEKKKVEMGTITALQSQ  459



>gb|EAZ16877.1| hypothetical protein OsJ_32355 [Oryza sativa Japonica Group]
Length=1578

 Score =   191 bits (484),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 179/574 (31%), Positives = 308/574 (54%), Gaps = 54/574 (9%)
 Frame = +1

Query  2680  DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLE  2856
             D MREE++++T  I  ++S   + E KI ELE+ K  LE  + +LE EN++LSE +SGLE
Sbjct  736   DEMREELLLLTSSIDSHVSTNNVLETKITELESCKVNLELHISKLEHENVELSEFISGLE  795

Query  2857  AQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDK----------------------  2970
             +QL +  +  ELS +++    + + NL+DE+ ++E  K                      
Sbjct  796   SQLTYLANEKELSMLQMDESRSLITNLKDELEQVEAQKVELKLQMDESRSLITNLKDELE  855

Query  2971  ------------------------------ESQELELKQRLMEMQKRWLDSQEESEYLKK  3060
                                           E+Q++ELK+  +E  +R  + QE+SE L++
Sbjct  856   QVEAQKVELKLQMDESRSLITNLKDELEQVEAQKVELKENQLESHRRLSEVQEDSEALRR  915

Query  3061  ANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIES  3240
             +N KLQAT + ++EEC SLQ L  +L++Q+LE+    + LE EL + +         +ES
Sbjct  916   SNAKLQATVDHVVEECKSLQTLTADLKKQKLEVHGYASHLEQELEQSKRKTMDFCKTLES  975

Query  3241  LEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQ  3420
             LEAKLSS+ E+ S KE+ + SELE I  + KE +ER+     L +++ + K  EL   ++
Sbjct  976   LEAKLSSLQEDISLKEQSLLSELENIFQEHKEHEERIDRVHLLLNKIEKEKTVELSNLER  1035

Query  3421  KSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQM  3600
             +   L  Q+    +  +    +   E+  L A+   L+  L+++   +   E +L   + 
Sbjct  1036  EVISLTAQLSSTEEERESSTLDTIREVSILRADKAKLEANLEDVNAQMIHYESQLEDLR-  1094

Query  3601  EYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllses  3780
             E + K+ +L+  LNA K N+ +L    D ++R +E   S+E NL+  +  LE K   S+ 
Sbjct  1095  ESKTKIKDLVDSLNASKQNEEMLTTDVDNMRRSIEAARSNEDNLRKTLCELELKSKSSDY  1154

Query  3781  erlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKAD  3960
             E+ Q+ +  S LKI++ KIA L+DEVL L+ SL++ KF+  +LE  +Q +  E EELKA 
Sbjct  1155  EKQQIIEEISVLKIQVHKIAGLQDEVLTLQSSLDEAKFEKGKLEGLIQSLSEECEELKAQ  1214

Query  3961  KTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSK  4140
             K  L  +++ MQ+++    E +  ++  + K++ L  +   +E     +AELK++L+  +
Sbjct  1215  KGMLTDKVSCMQDTLNAANEGKQIEISAQTKLVMLGDEPPVKETSDVLEAELKSELSIIR  1274

Query  4141  RVNSQLRWKIKQLELERYYLSKELQSVQEELNRK  4242
               NS+ + KI  L+ E   L++  Q +++EL+ K
Sbjct  1275  GANSEYQQKIYSLQEENEDLTRRNQLMEKELDLK  1308


 Score =   117 bits (293),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 97/166 (58%), Gaps = 14/166 (8%)
 Frame = +1

Query  82   KSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWT  261
            +  +SD   ++  F FS  +A+QVP   D+L +S+++V+ GKTI+K  KA+  +G CQW 
Sbjct  7    RRGSSDRLRERVKFRFSGFRAVQVPVVSDRLMLSIVAVDTGKTIAKSTKAAALSGACQWP  66

Query  262  ----ESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPL  423
                ES+W  ++  S        +F+VSMGS+ +GILGE  +N+ +Y +S  S  +SLPL
Sbjct  67   DSILESIWFSQDQVSEEFQECQCRFVVSMGSTNSGILGEVFLNLTNYLSSLESTAISLPL  126

Query  424  QKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDN  561
            ++C+ GT+L   I+CL  ++         T+  N++     +G D+
Sbjct  127  KRCDSGTILQLNIQCLGAKS--------KTSRTNDDTECTSDGFDS  164


 Score =   101 bits (251),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 145/256 (57%), Gaps = 16/256 (6%)
 Frame = +1

Query  3844  LRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEEC  4023
             L+DEVL L+ SL++ KF+N +LE  LQ +  E EELKA K  L  +++ MQ+++    E 
Sbjct  1323  LQDEVLMLQSSLDEAKFENGKLEGLLQSLSEECEELKAQKGMLTDKVSCMQDTLNAANEG  1382

Query  4024  RLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLS  4203
             +  ++  + K++ L  +   +E     +AELK++L+  +  NS+ + KI  L+ E   L+
Sbjct  1383  KQIEISAQTKLVMLGDEPPVKETSDVLEAELKSELSIIRGANSEYQQKIHSLQKENEDLT  1442

Query  4204  KELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCS  4383
             +  Q +++EL+ K         S  KD+ T+ +    ++   S  N    +Q   I    
Sbjct  1443  RRNQLMEKELDLK--------TSQNKDENTNKQGNDANENGDSPVNEVPELQ-SKIQLLE  1493

Query  4384  SRCQVGDD-----KTQFKSLQPEGQS-TRSGNEN-EQKISQLEAELKEISERYLHMSLKY  4542
             +R     +     + Q KS  PEG+S ++ G EN + KISQLE+ELK++ ER L++SL+Y
Sbjct  1494  TRLAEALEENKLYRGQLKSPMPEGKSASKDGKENDDDKISQLESELKDMQERLLNVSLQY  1553

Query  4543  AEVENQKGKLVMTLKA  4590
             AEVE Q+ +LVM LK 
Sbjct  1554  AEVEAQREELVMELKT  1569


 Score = 92.0 bits (227),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +1

Query  880   RMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESN  1059
             +MW+   R+L   +ETL+KE A++S++ +++E+ELS + +E + L  +I+ L+  LEE  
Sbjct  337   KMWQRKTRKLKQGLETLKKECADKSKQQSELELELSISISERDSLRQEIEELKRSLEEVT  396

Query  1060  AKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEE  1239
             A+Q  + +   ++ +   + KE+ED+++F  ESN++L+ QL K+QE+N ELVS+LQE+EE
Sbjct  397   ARQTISRSP--RSGDAIELQKEVEDDVQFLKESNASLATQLNKAQEANIELVSILQELEE  454

Query  1240  TVQKKKIEIENL  1275
             T++ ++ EI NL
Sbjct  455   TIEVQRAEISNL  466



>ref|NP_001065218.2| Os10g0547000 [Oryza sativa Japonica Group]
 gb|AAK20041.1|AC025783_1 putative kinesin-related protein [Oryza sativa Japonica Group]
 gb|AAP54893.1| Viral A-type inclusion protein repeat containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27132.2| Os10g0547000 [Oryza sativa Japonica Group]
Length=1578

 Score =   191 bits (484),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 179/574 (31%), Positives = 308/574 (54%), Gaps = 54/574 (9%)
 Frame = +1

Query  2680  DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLE  2856
             D MREE++++T  I  ++S   + E KI ELE+ K  LE  + +LE EN++LSE +SGLE
Sbjct  736   DEMREELLLLTSSIDSHVSTNNVLETKITELESCKVNLELHISKLEHENVELSEFISGLE  795

Query  2857  AQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDK----------------------  2970
             +QL +  +  ELS +++    + + NL+DE+ ++E  K                      
Sbjct  796   SQLTYLANEKELSMLQMDESRSLITNLKDELEQVEAQKVELKLQMDESRSLITNLKDELE  855

Query  2971  ------------------------------ESQELELKQRLMEMQKRWLDSQEESEYLKK  3060
                                           E+Q++ELK+  +E  +R  + QE+SE L++
Sbjct  856   QVEAQKVELKLQMDESRSLITNLKDELEQVEAQKVELKENQLESHRRLSEVQEDSEALRR  915

Query  3061  ANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIES  3240
             +N KLQAT + ++EEC SLQ L  +L++Q+LE+    + LE EL + +         +ES
Sbjct  916   SNAKLQATVDHVVEECKSLQTLTADLKKQKLEVHGYASHLEQELEQSKRKTMDFCKTLES  975

Query  3241  LEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQ  3420
             LEAKLSS+ E+ S KE+ + SELE I  + KE +ER+     L +++ + K  EL   ++
Sbjct  976   LEAKLSSLQEDISLKEQSLLSELENIFQEHKEHEERIDRVHLLLNKIEKEKTVELSNLER  1035

Query  3421  KSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQM  3600
             +   L  Q+    +  +    +   E+  L A+   L+  L+++   +   E +L   + 
Sbjct  1036  EVISLTAQLSSTEEERESSTLDTIREVSILRADKAKLEANLEDVNAQMIHYESQLEDLR-  1094

Query  3601  EYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllses  3780
             E + K+ +L+  LNA K N+ +L    D ++R +E   S+E NL+  +  LE K   S+ 
Sbjct  1095  ESKTKIKDLVDSLNASKQNEEMLTTDVDNMRRSIEAARSNEDNLRKTLCELELKSKSSDY  1154

Query  3781  erlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKAD  3960
             E+ Q+ +  S LKI++ KIA L+DEVL L+ SL++ KF+  +LE  +Q +  E EELKA 
Sbjct  1155  EKQQIIEEISVLKIQVHKIAGLQDEVLTLQSSLDEAKFEKGKLEGLIQSLSEECEELKAQ  1214

Query  3961  KTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSK  4140
             K  L  +++ MQ+++    E +  ++  + K++ L  +   +E     +AELK++L+  +
Sbjct  1215  KGMLTDKVSCMQDTLNAANEGKQIEISAQTKLVMLGDEPPVKETSDVLEAELKSELSIIR  1274

Query  4141  RVNSQLRWKIKQLELERYYLSKELQSVQEELNRK  4242
               NS+ + KI  L+ E   L++  Q +++EL+ K
Sbjct  1275  GANSEYQQKIYSLQEENEDLTRRNQLMEKELDLK  1308


 Score =   117 bits (293),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 97/166 (58%), Gaps = 14/166 (8%)
 Frame = +1

Query  82   KSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWT  261
            +  +SD   ++  F FS  +A+QVP   D+L +S+++V+ GKTI+K  KA+  +G CQW 
Sbjct  7    RRGSSDRLRERVKFRFSGFRAVQVPVVSDRLMLSIVAVDTGKTIAKSTKAAALSGACQWP  66

Query  262  ----ESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPL  423
                ES+W  ++  S        +F+VSMGS+ +GILGE  +N+ +Y +S  S  +SLPL
Sbjct  67   DSILESIWFSQDQVSEEFQECQCRFVVSMGSTNSGILGEVFLNLTNYLSSLESTAISLPL  126

Query  424  QKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDN  561
            ++C+ GT+L   I+CL  ++         T+  N++     +G D+
Sbjct  127  KRCDSGTILQLNIQCLGAKS--------KTSRTNDDTECTSDGFDS  164


 Score =   101 bits (251),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 145/256 (57%), Gaps = 16/256 (6%)
 Frame = +1

Query  3844  LRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEEC  4023
             L+DEVL L+ SL++ KF+N +LE  LQ +  E EELKA K  L  +++ MQ+++    E 
Sbjct  1323  LQDEVLMLQSSLDEAKFENGKLEGLLQSLSEECEELKAQKGMLTDKVSCMQDTLNAANEG  1382

Query  4024  RLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLS  4203
             +  ++  + K++ L  +   +E     +AELK++L+  +  NS+ + KI  L+ E   L+
Sbjct  1383  KQIEISAQTKLVMLGDEPPVKETSDVLEAELKSELSIIRGANSEYQQKIHSLQKENEDLT  1442

Query  4204  KELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCS  4383
             +  Q +++EL+ K         S  KD+ T+ +    ++   S  N    +Q   I    
Sbjct  1443  RRNQLMEKELDLK--------TSQNKDENTNKQGNDANENGDSPVNEVPELQ-SKIQLLE  1493

Query  4384  SRCQVGDD-----KTQFKSLQPEGQS-TRSGNEN-EQKISQLEAELKEISERYLHMSLKY  4542
             +R     +     + Q KS  PEG+S ++ G EN + KISQLE+ELK++ ER L++SL+Y
Sbjct  1494  TRLAEALEENKLYRGQLKSPMPEGKSASKDGKENDDDKISQLESELKDMQERLLNVSLQY  1553

Query  4543  AEVENQKGKLVMTLKA  4590
             AEVE Q+ +LVM LK 
Sbjct  1554  AEVEAQREELVMELKT  1569


 Score = 92.0 bits (227),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +1

Query  880   RMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESN  1059
             +MW+   R+L   +ETL+KE A++S++ +++E+ELS + +E + L  +I+ L+  LEE  
Sbjct  337   KMWQRKTRKLKQGLETLKKECADKSKQQSELELELSISISERDSLRQEIEELKRSLEEVT  396

Query  1060  AKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEE  1239
             A+Q  + +   ++ +   + KE+ED+++F  ESN++L+ QL K+QE+N ELVS+LQE+EE
Sbjct  397   ARQTISRSP--RSGDAIELQKEVEDDVQFLKESNASLATQLNKAQEANIELVSILQELEE  454

Query  1240  TVQKKKIEIENL  1275
             T++ ++ EI NL
Sbjct  455   TIEVQRAEISNL  466



>gb|ABI51616.1| RRP1 [Medicago truncatula]
Length=1228

 Score =   180 bits (456),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 146/423 (35%), Positives = 246/423 (58%), Gaps = 3/423 (1%)
 Frame = +1

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R++ L  +L   T  ME   +EL++   Q   LQ++I E++ + +S   +L+Q+L E Q 
Sbjct  659   RITDLNNELTDETSEMENLEVELENAKNQSARLQEKIAEMQSEMDSSIEDLEQKLKETQF  718

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
              W ++QEE EYL+  N +LQ T E+L EECDS + LNG LR+Q+LEL+  C+L+ A LR+
Sbjct  719   HWSEAQEECEYLRGENQQLQITIENLEEECDSFEKLNGYLRQQKLELEEYCSLMGARLRE  778

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
                       R+  LE K + +LEE +SKEK + SE++ IL    E ++ +   +SL +Q
Sbjct  779   SSERFDDYCERVGLLEKKFALMLEEITSKEKNLTSEMDGIL---DENRKHMDQGQSLLNQ  835

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             +   K+ E++  + +  +L  ++    D ++  AS    E+ +L A    L+    E+Q 
Sbjct  836   MQMEKIVEIQNLKLEIENLSLKLSAAYDEKERIASNALLEVSTLRAGKAKLEFAFGEVQS  895

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              + +++ ++   Q EY++K+ +L  EL   K     L A+ +KL   +E+  S E  LK 
Sbjct  896   EVILSKNEVNVMQTEYKQKLKDLTTELADFKFKMETLMAEHEKLSELVEDYKSRELKLKS  955

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
              I++LESKL  +E ER Q  D + + K++L +     +E++ALK  LN    + ERL+AS
Sbjct  956   TINSLESKLTDTEYERQQYMDESRNSKVQLQQTCQFENEIMALKSELNTSNTEKERLKAS  1015

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L L     E+LKA+ TS  ++++ ++ + +ELE C+  +  LEE++++LE DL AR+  C
Sbjct  1016  LCLKSELCEDLKAENTSFERKMSSLEKAASELEHCKRTRTSLEERLMQLENDLNARDARC  1075

Query  4099  AKD  4107
             A++
Sbjct  1076  AQE  1078


 Score =   168 bits (426),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 110/160 (69%), Gaps = 9/160 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL +H+S+    S D+  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K +V 
Sbjct  1    MFKLHKHRSA---KSSDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTIAKSSKVTVR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQW+    ES+W   +  S   D    K +V+MGS R+GILGEATV++  Y +S+A+
Sbjct  58   NGSCQWSDVFAESIWFSRDNLSKETDDCILKLIVAMGSLRSGILGEATVSMTSYASSDAA  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAY  522
            +P+S+PL KCN GTVLN  ++CLTPR   R  E   T ++
Sbjct  118  VPLSIPLNKCNHGTVLNVTVQCLTPRKKPRDQESRETNSH  157


 Score =   137 bits (344),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 137/209 (66%), Gaps = 13/209 (6%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR+L+  +E LR  F++QS+++  +EM+LSTA+ E + L  ++++L 
Sbjct  298   EELRAEAKMWEMNARKLLGDLEMLRTGFSDQSKKMEGLEMDLSTAYVERDNLKKEVEQLT  357

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             +   +   +Q   E+   Q ++   I   ++DELKFQ ESN+NLSLQL+KSQE+N ELVS
Sbjct  358   LSSGDPIVRQKTLEDSISQGESIPEIENALKDELKFQKESNANLSLQLKKSQEANVELVS  417

Query  1219  VLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFKL  1398
             VLQE+EET++++K+EIENL +L S+   +       +E N+       + ++      ++
Sbjct  418   VLQELEETIEQQKLEIENLSSLPSKLSALEKSFQVSEEGNM-------ILIQ------QI  464

Query  1399  QHLQESHMSLENSIICQEKAQEEKIHEIE  1485
             + L+ES  +L   +   E+A E KIH+IE
Sbjct  465   EQLEESKKNLLAMVQKLEEASENKIHDIE  493



>gb|KEH42115.1| myosin heavy chain-like protein, putative [Medicago truncatula]
Length=1230

 Score =   180 bits (456),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 146/423 (35%), Positives = 246/423 (58%), Gaps = 3/423 (1%)
 Frame = +1

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R++ L  +L   T  ME   +EL++   Q   LQ++I E++ + +S   +L+Q+L E Q 
Sbjct  659   RITDLNNELTDETSEMENLEVELENAKNQSARLQEKIAEMQSEMDSSIEDLEQKLKETQF  718

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
              W ++QEE EYL+  N +LQ T E+L EECDS + LNG LR+Q+LEL+  C+L+ A LR+
Sbjct  719   HWSEAQEECEYLRGENQQLQITIENLEEECDSFEKLNGYLRQQKLELEEYCSLMGARLRE  778

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
                       R+  LE K + +LEE +SKEK + SE++ IL    E ++ +   +SL +Q
Sbjct  779   SSERFDDYCERVGLLEKKFALMLEEITSKEKNLTSEMDGIL---DENRKHMDQGQSLLNQ  835

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             +   K+ E++  + +  +L  ++    D ++  AS    E+ +L A    L+    E+Q 
Sbjct  836   MQMEKIVEIQNLKLEIENLSLKLSAAYDEKERIASNALLEVSTLRAGKAKLEFAFGEVQS  895

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              + +++ ++   Q EY++K+ +L  EL   K     L A+ +KL   +E+  S E  LK 
Sbjct  896   EVILSKNEVNVMQTEYKQKLKDLTTELADFKFKMETLMAEHEKLSELVEDYKSRELKLKS  955

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
              I++LESKL  +E ER Q  D + + K++L +     +E++ALK  LN    + ERL+AS
Sbjct  956   TINSLESKLTDTEYERQQYMDESRNSKVQLQQTCQFENEIMALKSELNTSNTEKERLKAS  1015

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L L     E+LKA+ TS  ++++ ++ + +ELE C+  +  LEE++++LE DL AR+  C
Sbjct  1016  LCLKSELCEDLKAENTSFERKMSSLEKAASELEHCKRTRTSLEERLMQLENDLNARDARC  1075

Query  4099  AKD  4107
             A++
Sbjct  1076  AQE  1078


 Score =   169 bits (427),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 110/160 (69%), Gaps = 9/160 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL +H+S+    S D+  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K +V 
Sbjct  1    MFKLHKHRSA---KSSDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTIAKSSKVTVR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQW+    ES+W   +  S   D    K +V+MGS R+GILGEATV++  Y +S+A+
Sbjct  58   NGSCQWSDVFAESIWFSRDNLSKETDDCILKLIVAMGSLRSGILGEATVSMTSYASSDAA  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAY  522
            +P+S+PL KCN GTVLN  ++CLTPR   R  E   T ++
Sbjct  118  VPLSIPLNKCNHGTVLNVTVQCLTPRKKPRDQESRETNSH  157


 Score =   136 bits (343),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 137/209 (66%), Gaps = 13/209 (6%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR+L+  +E LR  F++QS+++  +EM+LSTA+ E + L  ++++L 
Sbjct  298   EELRAEAKMWEMNARKLLGDLEMLRTGFSDQSKKMEGLEMDLSTAYVERDNLKKEVEQLT  357

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             +   +   +Q   E+   Q ++   I   ++DELKFQ ESN+NLSLQL+KSQE+N ELVS
Sbjct  358   LSSGDPIVRQKTLEDSISQGESIPEIENALKDELKFQKESNANLSLQLKKSQEANVELVS  417

Query  1219  VLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFKL  1398
             VLQE+EET++++K+EIENL +L S+   +       +E N+       + ++      ++
Sbjct  418   VLQELEETIEQQKLEIENLSSLPSKLSALEKSFQVSEEGNM-------ILIQ------QI  464

Query  1399  QHLQESHMSLENSIICQEKAQEEKIHEIE  1485
             + L+ES  +L   +   E+A E KIH+IE
Sbjct  465   EQLEESKKNLLAMVQKLEEASENKIHDIE  493



>ref|XP_003590443.1| RRP1 [Medicago truncatula]
Length=1345

 Score =   179 bits (455),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 146/423 (35%), Positives = 246/423 (58%), Gaps = 3/423 (1%)
 Frame = +1

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R++ L  +L   T  ME   +EL++   Q   LQ++I E++ + +S   +L+Q+L E Q 
Sbjct  659   RITDLNNELTDETSEMENLEVELENAKNQSARLQEKIAEMQSEMDSSIEDLEQKLKETQF  718

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
              W ++QEE EYL+  N +LQ T E+L EECDS + LNG LR+Q+LEL+  C+L+ A LR+
Sbjct  719   HWSEAQEECEYLRGENQQLQITIENLEEECDSFEKLNGYLRQQKLELEEYCSLMGARLRE  778

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
                       R+  LE K + +LEE +SKEK + SE++ IL    E ++ +   +SL +Q
Sbjct  779   SSERFDDYCERVGLLEKKFALMLEEITSKEKNLTSEMDGIL---DENRKHMDQGQSLLNQ  835

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             +   K+ E++  + +  +L  ++    D ++  AS    E+ +L A    L+    E+Q 
Sbjct  836   MQMEKIVEIQNLKLEIENLSLKLSAAYDEKERIASNALLEVSTLRAGKAKLEFAFGEVQS  895

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              + +++ ++   Q EY++K+ +L  EL   K     L A+ +KL   +E+  S E  LK 
Sbjct  896   EVILSKNEVNVMQTEYKQKLKDLTTELADFKFKMETLMAEHEKLSELVEDYKSRELKLKS  955

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
              I++LESKL  +E ER Q  D + + K++L +     +E++ALK  LN    + ERL+AS
Sbjct  956   TINSLESKLTDTEYERQQYMDESRNSKVQLQQTCQFENEIMALKSELNTSNTEKERLKAS  1015

Query  3919  LQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMC  4098
             L L     E+LKA+ TS  ++++ ++ + +ELE C+  +  LEE++++LE DL AR+  C
Sbjct  1016  LCLKSELCEDLKAENTSFERKMSSLEKAASELEHCKRTRTSLEERLMQLENDLNARDARC  1075

Query  4099  AKD  4107
             A++
Sbjct  1076  AQE  1078


 Score =   168 bits (425),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 110/160 (69%), Gaps = 9/160 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL +H+S+    S D+  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K +V 
Sbjct  1    MFKLHKHRSA---KSSDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTIAKSSKVTVR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQW+    ES+W   +  S   D    K +V+MGS R+GILGEATV++  Y +S+A+
Sbjct  58   NGSCQWSDVFAESIWFSRDNLSKETDDCILKLIVAMGSLRSGILGEATVSMTSYASSDAA  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAY  522
            +P+S+PL KCN GTVLN  ++CLTPR   R  E   T ++
Sbjct  118  VPLSIPLNKCNHGTVLNVTVQCLTPRKKPRDQESRETNSH  157


 Score =   137 bits (344),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 137/209 (66%), Gaps = 13/209 (6%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR+L+  +E LR  F++QS+++  +EM+LSTA+ E + L  ++++L 
Sbjct  298   EELRAEAKMWEMNARKLLGDLEMLRTGFSDQSKKMEGLEMDLSTAYVERDNLKKEVEQLT  357

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             +   +   +Q   E+   Q ++   I   ++DELKFQ ESN+NLSLQL+KSQE+N ELVS
Sbjct  358   LSSGDPIVRQKTLEDSISQGESIPEIENALKDELKFQKESNANLSLQLKKSQEANVELVS  417

Query  1219  VLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFKL  1398
             VLQE+EET++++K+EIENL +L S+   +       +E N+       + ++      ++
Sbjct  418   VLQELEETIEQQKLEIENLSSLPSKLSALEKSFQVSEEGNM-------ILIQ------QI  464

Query  1399  QHLQESHMSLENSIICQEKAQEEKIHEIE  1485
             + L+ES  +L   +   E+A E KIH+IE
Sbjct  465   EQLEESKKNLLAMVQKLEEASENKIHDIE  493



>gb|EMT09074.1| hypothetical protein F775_03143 [Aegilops tauschii]
Length=1576

 Score =   178 bits (451),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 163/511 (32%), Positives = 271/511 (53%), Gaps = 30/511 (6%)
 Frame = +1

Query  2515  MLEVKTGCLEEDVGLK-----ALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS  2679
             +LE K   L   V LK      L HC  ++ N I D Q     +E+ +     E+  +TS
Sbjct  955   VLETKINELVRTVMLKEQEINGLQHCTTEMENTISDIQKEKDQLEERL-AASLEESSMTS  1013

Query  2680  ---DSMREEMMVVTGRIFGNISE-KIQEMKILELENEKQELESCVFELEKENMQLSERVS  2847
                D  RE+++V+T  +  + S  K+ E KI ELE+ K ELE  V +LE+EN++ SE +S
Sbjct  1014  KCLDEAREDLLVLTSSVDSHASANKVLETKISELESRKVELELLVTKLEQENIEFSEFIS  1073

Query  2848  GLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWL  3027
              LEAQL   T   E +R+E+ +    + NL+D + + + + E+Q+LE+KQ+ +E Q R  
Sbjct  1074  ELEAQLTSLTSEEESTRLEMDYSIALIANLKDLVEQQQAEMEAQKLEMKQKHLESQTRLS  1133

Query  3028  DSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQH  3207
             + QE+SE L+++N KLQAT +S+ EEC SLQ L  +L++Q+LEL   C  LE +L + + 
Sbjct  1134  EVQEDSEALRRSNAKLQATIDSVAEECSSLQTLTTDLKKQKLELHDHCAQLEQQLDQSKR  1193

Query  3208  SLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQ  3387
                      E LEAKLS++ +E + KE+ + SELE I  + KE +ER+     L  ++  
Sbjct  1194  KTMDLFETAEFLEAKLSTLQKEVTLKEQSLLSELENIFQEHKEHEERINSAHFLLHKIEN  1253

Query  3388  HKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLE  3567
              K+ E++  +++   L  Q+      ++  A +  HE+  L A+   L+  L+++   + 
Sbjct  1254  EKIGEVKNLEREVMSLTAQLSSTDGEKESAALDSIHEVSILRADKAKLEANLEDVSAQMR  1313

Query  3568  ITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIID  3747
               + +L   + E + K+  L+  LNA K N+  L    + + R +E   S+E NL+   D
Sbjct  1314  HYQSQLEDLRTESKTKIKGLIDSLNASKHNEETLTTDVEHMTRLMEAARSNEENLRKTSD  1373

Query  3748  NlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQL  3927
              LE K   S+ E+ ++ +  S LKI+                     KF+  +LE  LQ 
Sbjct  1374  ELELKYKSSDYEKQEVMEEISGLKIQ--------------------AKFEKTKLEERLQS  1413

Query  3928  ICGENEELKADKTSLIQELTGMQNSVTELEE  4020
             +  E EELK     L  +++ +Q+++ + +E
Sbjct  1414  LSEECEELKVQNAMLTDKVSCIQSTLHDADE  1444


 Score =   121 bits (304),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 80/128 (63%), Gaps = 6/128 (5%)
 Frame = +1

Query  106  GDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPEN  285
            G +  F FS   A+QVP   D+L +++ SV++GKTI+K  KA+  NG CQW +S+     
Sbjct  29   GVRMEFRFSGFHAVQVPVVSDRLLITITSVDSGKTIAKSSKAAAINGACQWHDSILQAIR  88

Query  286  YASNGLDH------FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
            +  + + H       K +VSMGS+R  +LGEA +N+ +Y +S  S  +SLPL KCN GTV
Sbjct  89   FPKDEVSHEFQECQCKIVVSMGSTRTAVLGEAYLNLTNYLSSSDSTDISLPLDKCNSGTV  148

Query  448  LNFEIKCL  471
            L  +I+CL
Sbjct  149  LQLKIQCL  156


 Score = 58.9 bits (141),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 78/148 (53%), Gaps = 45/148 (30%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             +EEL+  A+MWE ++R+L ++ +TL+ E A++S++ A++E +LS + +E + L  +I   
Sbjct  245   LEELRNAAKMWERHSRKLKIERKTLKNECADKSKQQAELERQLSASLSEQDSLRQEI---  301

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
                      +Q+ A                                 QL K+QE+N ELV
Sbjct  302   ---------EQVTA---------------------------------QLNKTQETNIELV  319

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSD  1299
             S+LQE+EET++ +++E+  L  ++  +D
Sbjct  320   SILQELEETIELQRVEMSKLPQVSDVAD  347



>ref|XP_004983763.1| PREDICTED: myosin heavy chain, striated muscle-like [Setaria 
italica]
Length=1196

 Score =   176 bits (446),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 148/433 (34%), Positives = 252/433 (58%), Gaps = 0/433 (0%)
 Frame = +1

Query  2755  KILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCN  2934
             KI ELEN+K ELE  +  LE E ++LSE +SG+EA+L + T   E   +++    T + +
Sbjct  643   KIHELENDKVELELHISRLEDEKIELSESISGMEAELTNLTSEYESCIVQMDDSRTLIID  702

Query  2935  LQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDS  3114
             L+D+++  + + E+Q++ELKQ+ +  QKR+ + QE+SE LK+ N KLQA  ++L+EEC S
Sbjct  703   LKDKVQWQQAELEAQKVELKQKHLAFQKRFSEVQEDSETLKRLNAKLQAKVDNLVEECSS  762

Query  3115  LQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKI  3294
             LQ L  +L++Q+LEL      LE EL   +   +     +E LEAKLSSI ++ SSKE+ 
Sbjct  763   LQALTADLKKQKLELHSCATQLEQELEHSKRKTTDFCKTVEFLEAKLSSIQKDISSKEQS  822

Query  3295  MNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDG  3474
                ELE +  + KE +ER+    SL +++ + K+ E+E  +++   L  Q+    +  + 
Sbjct  823   FLLELENVFQEHKEHEERINRAHSLLNKIEKEKIIEVENLEREIMSLTAQLSSTHEERES  882

Query  3475  KASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKT  3654
                +   E   L A+   L+  L ++ + L   E +L   + E + K+  L+  LN  K 
Sbjct  883   STLDTIREASILRADKAKLEANLNDVNEQLRHHESQLEDIRKESKSKIKSLLDSLNTSKQ  942

Query  3655  NQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLK  3834
             N+ +L+  ++ ++R +E   S+E NL+   + LE K   S+ E+ Q+ + NS LKI++ K
Sbjct  943   NEEMLKTDAEDMRRLMEAAKSNEENLRTTSNELELKFKSSDYEKHQIMEENSGLKIQVQK  1002

Query  3835  IAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTEL  4014
             IA L+DE+L L+ SL++ KF+  +LE  L+L+  E + LK  K  L  ++  MQ++   +
Sbjct  1003  IAGLQDELLKLQSSLDESKFEKGKLEELLRLLSEECDGLKVQKAMLTDKVAHMQDTSNNI  1062

Query  4015  EECRLRKVVLEEK  4053
              + +  K  ++ K
Sbjct  1063  GDEKQSKTAIQAK  1075


 Score =   128 bits (321),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 98/156 (63%), Gaps = 8/156 (5%)
 Frame = +1

Query  73   RRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTC  252
            R  +   SD  G++  F FSN++A+QVP   D+L +S+ISV+ GKTI++  KA+  NG C
Sbjct  3    RLSQRRASDRLGERVEFRFSNLRAVQVPVVSDRLLISIISVDTGKTIARSSKAAARNGIC  62

Query  253  QW----TESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVS  414
            QW     ESLW  ++ AS   +    +  VSMGS+++GILGE ++N+ +Y  S     +S
Sbjct  63   QWPDSILESLWFSQDEASKEFEDCQCRIAVSMGSTKSGILGEVSLNLTNYLGSVDPTAIS  122

Query  415  LPLQKCNKGTVLNFEIKCL--TPRTSFRGDEVNSTA  516
            LPL+KCN GTVL  +I+CL    ++S   D ++S A
Sbjct  123  LPLKKCNSGTVLQLKIQCLGMKSKSSPTDDVMDSKA  158


 Score = 99.0 bits (245),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL AEA+MWE ++R+L   +ETL+KE   +S++ +++ +ELS +  E   L  +I+ L
Sbjct  279   IEELLAEAQMWEAHSRQLKNDLETLQKECDEKSEKQSELLLELSASQAEQESLRQEIEEL  338

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             ++ LE + A+Q  A  L  ++ +  ++  E++DE++F  ESN NL++QL+K+Q++N ELV
Sbjct  339   KLSLEVATARQTVA-GL-AKSGDAIDVQHELKDEVQFLRESNENLTIQLKKTQDANIELV  396

Query  1216  SVLQEMEETVQKKKIEIENL  1275
             S+LQE+EETV+ ++ EI ++
Sbjct  397   SILQELEETVEAQRAEISSI  416


 Score = 62.4 bits (150),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +1

Query  4408  KTQFKSLQPEGQS-TRSGNEN-EQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMT  4581
             +TQ KS  PEGQS ++ G EN + KI+QLE+ELK++ +R L++S++YAEVE Q+ +LVM 
Sbjct  1125  RTQLKSPMPEGQSGSKDGEENNDDKIAQLESELKDMQDRLLNVSMQYAEVEAQREELVME  1184

Query  4582  LK  4587
             LK
Sbjct  1185  LK  1186



>ref|XP_004137997.1| PREDICTED: uncharacterized protein LOC101220815 [Cucumis sativus]
Length=1314

 Score =   174 bits (441),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 215/787 (27%), Positives = 362/787 (46%), Gaps = 157/787 (20%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE+  E +   +  K  ++ ++++  L +D  +K L      L  K  D Q     +++
Sbjct  599   ELEIIVEELSKELTLKKLEIEKLESSILSKDDEIKILEGLHNKLQAKYSDLQEEKNQIDE  658

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVF  2805
              M +V   + D +S   + +R E+  ++  +  ++S  K+ E K  EL+ +KQEL+  V 
Sbjct  659   KMMEVMLGESDGSSKGLNGLRNEVKALSNSVDLHVSANKLLESKYSELQFKKQELDLHVS  718

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
             ++E+E ++LSE +S LE+QL++     +  R+EL+   +   +LQDE  +L  + E++ +
Sbjct  719   QIEQERIRLSESISVLESQLKYMMGEKQSIRLELEDSKSHAVSLQDEFDKLRLEIETENV  778

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
             +LKQ L ++Q +   +Q++ EYL++   KL+A AE L+EE + L+  NGEL+ +  EL  
Sbjct  779   DLKQMLNDLQNQCAKAQDQCEYLQREKTKLEAAAEHLVEERNLLKKSNGELKNKNFELHE  838

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
                 LE+++++     +    RIE  E  LS  LE+ +SKE+ ++SEL+ I+ +  ++KE
Sbjct  839   GYFRLESKVKEPLERSAQYFRRIEDFEDYLSLGLEDFASKERFLSSELDSIVEENIKYKE  898

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             +L + ESL ++    K +E +       HL  Q                           
Sbjct  899   KLAMFESLSNETYWEKATEAQELHGAVVHLTKQ---------------------------  931

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
                  L   +++  I        +ME +  +  L+ EL+  K NQ  L A ++KL + LE
Sbjct  932   -----LSAAKKDFNI-------MRMESDENLTALISELSVSKQNQETLIADNEKLLKQLE  979

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
             N  S E  LK  +++LE KL +SE ER Q  +  ++ K++L K A  +DEV A    L  
Sbjct  980   NYKSLEVELKNSVNDLEQKLYVSEKERRQNEENLTNFKVQLQKTAHFQDEVFASSNKLE-  1038

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
                                                 Q +V ELE+ +  ++ LEEK+LR+
Sbjct  1039  ------------------------------------QKTVAELEDSKQSRIDLEEKLLRI  1062

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELER-------YYLSKELQSVQ  4224
                    E       +L+N+L + KR+NS+ + K+K LE E+         L  EL+ ++
Sbjct  1063  GSGSVVEETSFPGIDDLRNELCEIKRMNSKYQQKLKILEEEKDGCLKRSQSLEAELEHLK  1122

Query  4225  EE--LNRKENSVPSPSHSVAKDKTTSCKEQKL--------------SKARSSQCNNCETI  4356
             EE  + R+ +SV   S S   DK  + K+ KL               K +    N+ ++ 
Sbjct  1123  EEKQIQRESSSVRIHSLSKTNDKNMTSKDMKLLKNGAVKTVGQNHSGKKKPKDPNSNQSQ  1182

Query  4357  QIVTIDDCSSRCQVGDDKTQFKSLQPEGQS------------------------------  4446
               +      S C + D+        PE +S                              
Sbjct  1183  SQIKYRQDDSGCDIDDEGPHV----PEAKSISRIQMLEKELAEALEANKKYEDQLSRLVS  1238

Query  4447  -TRSGNENEQKISQLEAE------------------LKEISERYLHMSLKYAEVENQKGK  4569
              T++  EN   IS +E +                  LK+I ERY H+SLKYAEVE+Q+ +
Sbjct  1239  DTQNNKEN-SPISTIEGDVVKTKEGYESLNSDLEAELKDIRERYFHISLKYAEVEHQREE  1297

Query  4570  LVMTLKA  4590
             LVM LKA
Sbjct  1298  LVMKLKA  1304


 Score =   154 bits (390),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 105/160 (66%), Gaps = 12/160 (8%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R++ + S   G+KF F FSN +A QVPKGWDKL VS+IS + GK I +  KA V 
Sbjct  1    MFRLHRNRHAKS---GEKFDFKFSNFKATQVPKGWDKLFVSVISEQTGKAIVRSSKAPVR  57

Query  241  NGTCQWTESL----WSPENYASNGLD--HFKFLVSM---GSSRAGILGEATVNVGHYRNS  393
            NG+CQWTESL    W  ++  S   +  +FK +V+M   GS+R+ ILGE  VN+ +Y +S
Sbjct  58   NGSCQWTESLSDSIWVSQDEVSKEFEDCNFKLVVAMLYFGSARSNILGETMVNMTNYIDS  117

Query  394  EASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
            ++S  VSLPL+KCN GT+L  +I+CL P +  R  E   T
Sbjct  118  KSSSAVSLPLKKCNHGTILQVKIQCLAPISKVRSGEFKHT  157


 Score =   128 bits (322),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 113/164 (69%), Gaps = 1/164 (1%)
 Frame = +1

Query  826   ITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTES  1005
             +   S     IEEL+AEARMWE N+ +LM  ++ L+KEF++QS+    +   LS A  E 
Sbjct  260   VITGSAEATTIEELRAEARMWERNSHKLMADLDQLKKEFSDQSENQESLHAALSAATAEC  319

Query  1006  NRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLR  1185
             + L  ++++L+++ E+S  ++ + E+L+ Q     +IL E++DEL FQ E+N++L+LQL+
Sbjct  320   DGLRKELEQLKLVTEKSKQRRTSIEDLSYQ-DGEPHILNELKDELNFQKETNADLALQLK  378

Query  1186  KSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN  1317
             +SQESN ELVSVLQE+E T +K+K+EIE LLA + + D +  IN
Sbjct  379   RSQESNIELVSVLQELEATTEKQKLEIEELLARHQKDDDIENIN  422



>gb|KGN59033.1| hypothetical protein Csa_3G747640 [Cucumis sativus]
Length=1310

 Score =   174 bits (440),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 215/787 (27%), Positives = 362/787 (46%), Gaps = 157/787 (20%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE+  E +   +  K  ++ ++++  L +D  +K L      L  K  D Q     +++
Sbjct  595   ELEIIVEELSKELTLKKLEIEKLESSILSKDDEIKILEGLHNKLQAKYSDLQEEKNQIDE  654

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVF  2805
              M +V   + D +S   + +R E+  ++  +  ++S  K+ E K  EL+ +KQEL+  V 
Sbjct  655   KMMEVMLGESDGSSKGLNGLRNEVKALSNSVDLHVSANKLLESKYSELQFKKQELDLHVS  714

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
             ++E+E ++LSE +S LE+QL++     +  R+EL+   +   +LQDE  +L  + E++ +
Sbjct  715   QIEQERIRLSESISVLESQLKYMMGEKQSIRLELEDSKSHAVSLQDEFDKLRLEIETENV  774

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
             +LKQ L ++Q +   +Q++ EYL++   KL+A AE L+EE + L+  NGEL+ +  EL  
Sbjct  775   DLKQMLNDLQNQCAKAQDQCEYLQREKTKLEAAAEHLVEERNLLKKSNGELKNKNFELHE  834

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
                 LE+++++     +    RIE  E  LS  LE+ +SKE+ ++SEL+ I+ +  ++KE
Sbjct  835   GYFRLESKVKEPLERSAQYFRRIEDFEDYLSLGLEDFASKERFLSSELDSIVEENIKYKE  894

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             +L + ESL ++    K +E +       HL  Q                           
Sbjct  895   KLAMFESLSNETYWEKATEAQELHGAVVHLTKQ---------------------------  927

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
                  L   +++  I        +ME +  +  L+ EL+  K NQ  L A ++KL + LE
Sbjct  928   -----LSAAKKDFNI-------MRMESDENLTALISELSVSKQNQETLIADNEKLLKQLE  975

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
             N  S E  LK  +++LE KL +SE ER Q  +  ++ K++L K A  +DEV A    L  
Sbjct  976   NYKSLEVELKNSVNDLEQKLYVSEKERRQNEENLTNFKVQLQKTAHFQDEVFASSNKLE-  1034

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
                                                 Q +V ELE+ +  ++ LEEK+LR+
Sbjct  1035  ------------------------------------QKTVAELEDSKQSRIDLEEKLLRI  1058

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELER-------YYLSKELQSVQ  4224
                    E       +L+N+L + KR+NS+ + K+K LE E+         L  EL+ ++
Sbjct  1059  GSGSVVEETSFPGIDDLRNELCEIKRMNSKYQQKLKILEEEKDGCLKRSQSLEAELEHLK  1118

Query  4225  EE--LNRKENSVPSPSHSVAKDKTTSCKEQKL--------------SKARSSQCNNCETI  4356
             EE  + R+ +SV   S S   DK  + K+ KL               K +    N+ ++ 
Sbjct  1119  EEKQIQRESSSVRIHSLSKTNDKNMTSKDMKLLKNGAVKTVGQNHSGKKKPKDPNSNQSQ  1178

Query  4357  QIVTIDDCSSRCQVGDDKTQFKSLQPEGQS------------------------------  4446
               +      S C + D+        PE +S                              
Sbjct  1179  SQIKYRQDDSGCDIDDEGPHV----PEAKSISRIQMLEKELAEALEANKKYEDQLSRLVS  1234

Query  4447  -TRSGNENEQKISQLEAE------------------LKEISERYLHMSLKYAEVENQKGK  4569
              T++  EN   IS +E +                  LK+I ERY H+SLKYAEVE+Q+ +
Sbjct  1235  DTQNNKEN-SPISTIEGDVVKTKEGYESLNSDLEAELKDIRERYFHISLKYAEVEHQREE  1293

Query  4570  LVMTLKA  4590
             LVM LKA
Sbjct  1294  LVMKLKA  1300


 Score =   160 bits (404),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R++ + S   G+KF F FSN +A QVPKGWDKL VS+IS + GK I +  KA V 
Sbjct  1    MFRLHRNRHAKS---GEKFDFKFSNFKATQVPKGWDKLFVSVISEQTGKAIVRSSKAPVR  57

Query  241  NGTCQWTESL----WSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQWTESL    W  ++  S   +  +FK +V+MGS+R+ ILGE  VN+ +Y +S++S
Sbjct  58   NGSCQWTESLSDSIWVSQDEVSKEFEDCNFKLVVAMGSARSNILGETMVNMTNYIDSKSS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
              VSLPL+KCN GT+L  +I+CL P +  R  E   T
Sbjct  118  SAVSLPLKKCNHGTILQVKIQCLAPISKVRSGEFKHT  154


 Score =   128 bits (322),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEARMWE N+ +LM  ++ L+KEF++QS+    +   LS A  E + L  ++++L
Sbjct  266   IEELRAEARMWERNSHKLMADLDQLKKEFSDQSENQESLHAALSAATAECDGLRKELEQL  325

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +++ E+S  ++ + E+L+ Q     +IL E++DEL FQ E+N++L+LQL++SQESN ELV
Sbjct  326   KLVTEKSKQRRTSIEDLSYQ-DGEPHILNELKDELNFQKETNADLALQLKRSQESNIELV  384

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN  1317
             SVLQE+E T +K+K+EIE LLA + + D +  IN
Sbjct  385   SVLQELEATTEKQKLEIEELLARHQKDDDIENIN  418



>ref|XP_006360524.1| PREDICTED: uncharacterized protein LOC102594502 [Solanum tuberosum]
Length=160

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 8/133 (6%)
 Frame = +1

Query  76   RHKSSTS--DNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGT  249
            RHKSS+S  + SG +F F FSN+QA QVPKGWDKLS+SLISVE GKT+SK GKASV NG 
Sbjct  13   RHKSSSSFLEKSGHRFDFSFSNLQARQVPKGWDKLSLSLISVETGKTVSKSGKASVRNGN  72

Query  250  CQWTE----SLWSPENYASNGLDHF--KFLVSMGSSRAGILGEATVNVGHYRNSEASIPV  411
            C+WTE    S+W   +  SN  + F  KF+V+MGS+R+ ILGEA+VN+  +R+++A  PV
Sbjct  73   CKWTETWSQSMWITPDDISNNQEQFPLKFIVTMGSARSSILGEASVNLARFRDAKAFTPV  132

Query  412  SLPLQKCNKGTVL  450
            SLPL+KCN GTVL
Sbjct  133  SLPLKKCNHGTVL  145



>ref|XP_006381365.1| hypothetical protein POPTR_0006s12210g [Populus trichocarpa]
 gb|ERP59162.1| hypothetical protein POPTR_0006s12210g [Populus trichocarpa]
Length=147

 Score =   155 bits (392),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 103/147 (70%), Gaps = 10/147 (7%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L + + +   +SG+K  F FS  +ALQVP+GWDKLSVS+ISVE GKTI+K  KA+V 
Sbjct  1    MFRLHKARPAAKSSSGEKIDFKFSYFKALQVPRGWDKLSVSIISVETGKTIAKTSKAAVR  60

Query  241  NGTCQWTESL----WSPENYASNGLDH----FKFLVSMGSSRAGILGEATVNVGHYRNSE  396
            NG CQWTESL    W+     S+  +H    FKF+V+MGS+R+GILGEATVN+  Y +S 
Sbjct  61   NGNCQWTESLSESTWTASQDESSK-EHDDCLFKFVVAMGSARSGILGEATVNMASYMSSS  119

Query  397  ASIPVSLPLQKCNKGTVLNFEIKCLTP  477
              +PVS PL++CN GT+L   I CL P
Sbjct  120  DCVPVSFPLKRCNHGTILQLLI-CLDP  145



>gb|EYU41580.1| hypothetical protein MIMGU_mgv1a001004mg [Erythranthe guttata]
Length=915

 Score =   169 bits (427),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 179/564 (32%), Positives = 293/564 (52%), Gaps = 77/564 (14%)
 Frame = +1

Query  2935  LQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDS  3114
             L + I++L+ + ES   +L+++  +MQK+WL +QEE EYLK+   KL+ +          
Sbjct  408   LHERIKQLKDENESLTFDLERKFDDMQKQWLLAQEECEYLKQ-EMKLRNS----------  456

Query  3115  LQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKI  3294
                 N E+  +  EL+  C+ L A+L +   SLS C  ++E LE +L+S++++   +E  
Sbjct  457   ----NSEVETENQELRENCSALVAQLNESNKSLSDCSLKVELLEGRLASMVDDFEVRENG  512

Query  3295  MNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDG  3474
             + S+L+ ++ +    KE+L ++ESL  Q+   K +E E        L  Q+   + +E  
Sbjct  513   LKSQLDALVKENSCQKEKLALEESLH-QMYLEKSTEFE-------SLSKQLLSEARKERE  564

Query  3475  KAS-EGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHK  3651
             + S E S E+  L AE   L+ +L+E++   E  + KL     E E  + EL G+L   K
Sbjct  565   RISLEASGEISRLIAERDELRASLEEVKLKAESYDSKLEAAMRESELAIQELTGQLVDSK  624

Query  3652  TNQVVLEAKSDKLQRWLENVISSESN---LKCIIDNlesklllseserlqlADANSSLKI  3822
              +          L+R L ++   + N   LK  +++LE KL +S+ ER QL    S+LK+
Sbjct  625   RS----------LERALSSLAGYKRNDEKLKSELNDLELKLTISDYERQQLIKETSNLKV  674

Query  3823  ELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNS  4002
             +L  ++ LRDE+  LK  L D +    + E +L+ I G+ EE+KA+  +L +E       
Sbjct  675   QLQSLSILRDEISTLKSELEDCRVDKGKFEHALKTISGDYEEVKAE-NNLFKE------K  727

Query  4003  VTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLE  4182
             V+E EEC+  K+ LEEK+L++E +L+ +E++C +  +L+N+LT+ K+ N + + K+ +LE
Sbjct  728   VSEFEECKRTKLALEEKLLQMEKELSEKEILCVRKTDLENELTEMKKSNVEFQKKMYRLE  787

Query  4183  LERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQI  4362
              ER    K+ QS++E +                         KL + R+   NN      
Sbjct  788   EERDECLKKAQSLEENI-------------------------KLMEERNINNNNMHEEGG  822

Query  4363  VTID-DCSSRCQVGDDKTQ----FKSLQPEGQSTRS---GNENEQKISQLEAELKEISER  4518
                D D  S   +  D T     F++   EG    +       E+  S  E EL+E+ ER
Sbjct  823   YNRDFDGESPLAISVDPTTKQQLFENEVAEGSDANNRVLHGRYERTKSSFETELRELRER  882

Query  4519  YLHMSLKYAEVENQKGKLVMTLKA  4590
             YL MSLKYAEVE Q+  LVM LKA
Sbjct  883   YLEMSLKYAEVETQREDLVMQLKA  906


 Score = 95.5 bits (236),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +1

Query  883   MWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNA  1062
             MWE NAR+LM+ ++  +KEF++ S++  ++ +ELS  H E + L  ++ +L++ L+    
Sbjct  1     MWERNARKLMIDLDISKKEFSDLSKKEKELVVELSAEHAEKDGLNKEVAKLKLELQNRAI  60

Query  1063  KQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEET  1242
             K+ +      Q++    I K +E+E+K+Q + N NL  QL++SQESN ELVSVLQE+EET
Sbjct  61    KEDSVG----QSEGLVQIQKVLENEIKYQQDLNHNLDQQLKQSQESNIELVSVLQELEET  116

Query  1243  VQKKKIEIENL  1275
             ++K++I+IENL
Sbjct  117   IEKQRIKIENL  127



>gb|AES60694.2| myosin heavy chain-like protein, putative [Medicago truncatula]
Length=1285

 Score =   168 bits (426),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 110/160 (69%), Gaps = 9/160 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL +H+S+    S D+  F  S+++ALQVPKGWDKL VS++SVE GKTI+K  K +V 
Sbjct  1    MFKLHKHRSA---KSSDRIEFRISHLKALQVPKGWDKLFVSVVSVENGKTIAKSSKVTVR  57

Query  241  NGTCQWT----ESLWSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQW+    ES+W   +  S   D    K +V+MGS R+GILGEATV++  Y +S+A+
Sbjct  58   NGSCQWSDVFAESIWFSRDNLSKETDDCILKLIVAMGSLRSGILGEATVSMTSYASSDAA  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAY  522
            +P+S+PL KCN GTVLN  ++CLTPR   R  E   T ++
Sbjct  118  VPLSIPLNKCNHGTVLNVTVQCLTPRKKPRDQESRETNSH  157


 Score =   166 bits (421),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 149/462 (32%), Positives = 252/462 (55%), Gaps = 39/462 (8%)
 Frame = +1

Query  2734  SEKIQEMKILELENE----KQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRM  2901
             S+  QE++I +L NE      E+E+                                  +
Sbjct  652   SKSAQEVRITDLNNELTDETSEMENL--------------------------------EV  679

Query  2902  ELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQA  3081
             EL++   Q   LQ++I E++ + +S   +L+Q+L E Q  W ++QEE EYL+  N +LQ 
Sbjct  680   ELENAKNQSARLQEKIAEMQSEMDSSIEDLEQKLKETQFHWSEAQEECEYLRGENQQLQI  739

Query  3082  TAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSS  3261
             T E+L EECDS + LNG LR+Q+LEL+  C+L+ A LR+          R+  LE K + 
Sbjct  740   TIENLEEECDSFEKLNGYLRQQKLELEEYCSLMGARLRESSERFDDYCERVGLLEKKFAL  799

Query  3262  ILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVN  3441
             +LEE +SKEK + SE++ IL    E ++ +   +SL +Q+   K+ E++  + +  +L  
Sbjct  800   MLEEITSKEKNLTSEMDGIL---DENRKHMDQGQSLLNQMQMEKIVEIQNLKLEIENLSL  856

Query  3442  QMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVY  3621
             ++    D ++  AS    E+ +L A    L+    E+Q  + +++ ++   Q EY++K+ 
Sbjct  857   KLSAAYDEKERIASNALLEVSTLRAGKAKLEFAFGEVQSEVILSKNEVNVMQTEYKQKLK  916

Query  3622  ELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlAD  3801
             +L  EL   K     L A+ +KL   +E+  S E  LK  I++LESKL  +E ER Q  D
Sbjct  917   DLTTELADFKFKMETLMAEHEKLSELVEDYKSRELKLKSTINSLESKLTDTEYERQQYMD  976

Query  3802  ANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQE  3981
              + + K++L +     +E++ALK  LN    + ERL+ASL L     E+LKA+ TS  ++
Sbjct  977   ESRNSKVQLQQTCQFENEIMALKSELNTSNTEKERLKASLCLKSELCEDLKAENTSFERK  1036

Query  3982  LTGMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKD  4107
             ++ ++ + +ELE C+  +  LEE++++LE DL AR+  CA++
Sbjct  1037  MSSLEKAASELEHCKRTRTSLEERLMQLENDLNARDARCAQE  1078


 Score =   164 bits (415),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 195/631 (31%), Positives = 322/631 (51%), Gaps = 50/631 (8%)
 Frame = +1

Query  2839  RVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQK  3018
             R++ L  +L   T  ME   +EL++   Q   LQ++I E++ + +S   +L+Q+L E Q 
Sbjct  659   RITDLNNELTDETSEMENLEVELENAKNQSARLQEKIAEMQSEMDSSIEDLEQKLKETQF  718

Query  3019  RWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRK  3198
              W ++QEE EYL+  N +LQ T E+L EECDS + LNG LR+Q+LEL+  C+L+ A LR+
Sbjct  719   HWSEAQEECEYLRGENQQLQITIENLEEECDSFEKLNGYLRQQKLELEEYCSLMGARLRE  778

Query  3199  YQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQ  3378
                       R+  LE K + +LEE +SKEK + SE++ IL    E ++ +   +SL +Q
Sbjct  779   SSERFDDYCERVGLLEKKFALMLEEITSKEKNLTSEMDGIL---DENRKHMDQGQSLLNQ  835

Query  3379  LCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKMLKLTLQEIQQ  3558
             +   K+ E++  + +  +L  ++    D ++  AS    E+ +L A    L+    E+Q 
Sbjct  836   MQMEKIVEIQNLKLEIENLSLKLSAAYDEKERIASNALLEVSTLRAGKAKLEFAFGEVQS  895

Query  3559  NLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKC  3738
              + +++ ++   Q EY++K+ +L  EL   K     L A+ +KL   +E+  S E  LK 
Sbjct  896   EVILSKNEVNVMQTEYKQKLKDLTTELADFKFKMETLMAEHEKLSELVEDYKSRELKLKS  955

Query  3739  IIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEAS  3918
              I++LESKL  +E ER Q  D + + K++L +     +E++ALK  LN    + ERL+AS
Sbjct  956   TINSLESKLTDTEYERQQYMDESRNSKVQLQQTCQFENEIMALKSELNTSNTEKERLKAS  1015

Query  3919  LQL---IC----GEN-----------------EELKADKTSLIQELTGMQNSVTELE-EC  4023
             L L   +C     EN                 E  K  +TSL + L  ++N +   +  C
Sbjct  1016  LCLKSELCEDLKAENTSFERKMSSLEKAASELEHCKRTRTSLEERLMQLENDLNARDARC  1075

Query  4024  RLRKVVLEEKVLRLEGDLT------AREVMCAKDAELKNDLTQSK----RVNSQLRWKIK  4173
                K  L+EK   LE +L         +V       + +D   SK    +  +Q+R   K
Sbjct  1076  AQEKSKLQEKAQALEEELKLIKEQKRNQVSKLNRKPVNDDQKASKNSIIKNTNQVRSNRK  1135

Query  4174  QLELERYYLSKE-LQSVQEELN-RKENSVPSPSHSVAKDKTTSCKEQKLSKAR---SSQC  4338
             +  L+     +E L+  Q+  N RK  +     H +  +     + + +SK +   ++  
Sbjct  1136  KPSLKN---DREILKDQQDPYNSRKHQTEVESEHGLLDENVHVVEVEPVSKTQLLETAVE  1192

Query  4339  NNCETIQI--VTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNENEQKISQLEAELKEIS  4512
                E I I  V ++  SS+ +        KS+  E Q T+   E  + I  LE EL++I 
Sbjct  1193  KAKEAIDIYEVQLNRSSSQGRNNHANGPVKSIVEEEQVTKEKFERTKSI--LEEELRDIQ  1250

Query  4513  ERYLHMSLKYAEVENQKGKLVMTLKALQDQR  4605
             +RY HMSLKYAEVE+Q+ +LVM L+  + ++
Sbjct  1251  DRYFHMSLKYAEVESQREELVMKLRVAKSKK  1281


 Score =   136 bits (343),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 137/209 (66%), Gaps = 13/209 (6%)
 Frame = +1

Query  859   EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLE  1038
             EEL+AEA+MWE+NAR+L+  +E LR  F++QS+++  +EM+LSTA+ E + L  ++++L 
Sbjct  298   EELRAEAKMWEMNARKLLGDLEMLRTGFSDQSKKMEGLEMDLSTAYVERDNLKKEVEQLT  357

Query  1039  VLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVS  1218
             +   +   +Q   E+   Q ++   I   ++DELKFQ ESN+NLSLQL+KSQE+N ELVS
Sbjct  358   LSSGDPIVRQKTLEDSISQGESIPEIENALKDELKFQKESNANLSLQLKKSQEANVELVS  417

Query  1219  VLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEKQCQEFKL  1398
             VLQE+EET++++K+EIENL +L S+   +       +E N+       + ++      ++
Sbjct  418   VLQELEETIEQQKLEIENLSSLPSKLSALEKSFQVSEEGNM-------ILIQ------QI  464

Query  1399  QHLQESHMSLENSIICQEKAQEEKIHEIE  1485
             + L+ES  +L   +   E+A E KIH+IE
Sbjct  465   EQLEESKKNLLAMVQKLEEASENKIHDIE  493



>ref|XP_010234977.1| PREDICTED: myosin-11-like [Brachypodium distachyon]
 ref|XP_010234978.1| PREDICTED: myosin-11-like [Brachypodium distachyon]
Length=1727

 Score =   168 bits (426),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 146/433 (34%), Positives = 250/433 (58%), Gaps = 11/433 (3%)
 Frame = +1

Query  2710  TGRIFGNISEKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAME  2889
             +G +  N++ K+ E +  E+E +K      V +LE EN++LS  +S LEAQL   T   +
Sbjct  1171  SGSLVINLNYKV-EQQYAEMEAQKLH----VSKLEHENIELSRFISELEAQLTSLTSEND  1225

Query  2890  LSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANP  3069
              +++++ +  + + NL+D++ +   + ESQ LELKQ+ +E Q+R  + QE+SE L+++N 
Sbjct  1226  STKLQMDNSRSLITNLKDKVEQQHAEMESQMLELKQKYLESQRRLSEVQEDSEALRRSNS  1285

Query  3070  KLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEA  3249
             KLQATA+S++EEC+SLQ L  +L+ Q+LEL  +   LE EL + +  +      +E LEA
Sbjct  1286  KLQATADSVVEECNSLQTLTADLKMQKLELHGRSTQLEQELDQSKRKMMDFCKTVEFLEA  1345

Query  3250  KLSSILEETSSKEKIMNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSP  3429
             KLSS+ +E +SKE+ + +ELE I  + KE +ER+     L +++   K++E++  +++  
Sbjct  1346  KLSSLQKEITSKEQSLLAELENIFQEHKEHEERITRAHFLLNKIENEKIAEVKNLEREVM  1405

Query  3430  HLVNQMFDPSDREDGKASEGS-HEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEY  3606
              L  Q+   +D E G A   S HE+  L A+    K  L++    +   E +L     E 
Sbjct  1406  SLTAQV-SSTDGERGSADLDSIHEVSILRAD----KANLEDANAQMRHYESQLEDLHKES  1460

Query  3607  ERKVYELMGELNAHKTNQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseser  3786
             + K+  +   LNA K N+ +L    + ++  +E   S+E +L+   D LE +   S+ E+
Sbjct  1461  KTKIKGMADSLNASKQNEGMLTTDVEHMRGLMEAARSNEESLRKTSDELELRYKSSDYEK  1520

Query  3787  lqlADANSSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKT  3966
              Q+ +    LKI++ K+  L+DEV  LK SL   KF+  +LE  LQ +  E EE+K  K 
Sbjct  1521  QQIMEEICGLKIQVNKMTSLQDEVFNLKSSLEQAKFEKGKLEEHLQSLSEECEEVKTQKA  1580

Query  3967  SLIQELTGMQNSV  4005
              L  +L+ +Q+++
Sbjct  1581  MLTDKLSYLQSTL  1593


 Score =   114 bits (284),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 81/131 (62%), Gaps = 6/131 (5%)
 Frame = +1

Query  121  FIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYASNG  300
            F FS ++A++VP   D+L + +ISV  G TI+K  KA+  NG CQW +S+  P  ++ + 
Sbjct  3    FRFSGLRAVKVPVVSDRLLIKIISVVNGTTIAKSSKAAALNGICQWPKSILVPMWFSQDE  62

Query  301  LD------HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEI  462
            +         K +VSMGSS+  +LGE  +N+ +Y +S  S  +SLPL++CN GTVL  +I
Sbjct  63   VSKEFHERQCKIVVSMGSSKTAVLGEVFLNLTNYLSSSDSTAISLPLKRCNSGTVLQLKI  122

Query  463  KCLTPRTSFRG  495
            +CL  R+   G
Sbjct  123  RCLGARSKPSG  133


 Score = 68.9 bits (167),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/156 (33%), Positives = 93/156 (60%), Gaps = 6/156 (4%)
 Frame = +1

Query  838   SIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLM  1017
             SI D   E  +   +M E ++    ++ ET++ E A++ ++ A++ +ELS +++E + L 
Sbjct  247   SILDTAEETTEDGKKMLERHSGNFKIETETVKNECADKPKQQAEIALELSASYSEQDSLR  306

Query  1018  HDIKRLEVLLEESNAKQIAAENLNLQAKNTENIL--KEMEDELKFQTESNSNLSLQLRKS  1191
              +++ L+  L E  A Q  A       K+   I+   E+ DE++F   SN+NL+ QL K+
Sbjct  307   QEMEELKSSLGEVTAHQTIAGT----PKSGGAIVLQNEVIDEVQFLKLSNANLTAQLSKT  362

Query  1192  QESNAELVSVLQEMEETVQKKKIEIENLLALNSRSD  1299
             QE+N ELVS+LQE+EET++ +++E+  +  +N   D
Sbjct  363   QEANIELVSILQELEETIEIQRVEMSKVPHMNDVVD  398


 Score = 60.1 bits (144),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 86/147 (59%), Gaps = 4/147 (3%)
 Frame = +1

Query  2557  LKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS---DSMREEMMVVTGRIFG  2727
             ++ L H  +++ N I D Q     +E++      ++  +T    D +RE+++V+T  +  
Sbjct  609   IEGLLHSAKEMENIISDIQKEKNQLEEERLAASLKESSMTLKSLDEVREDLIVLTSSLDS  668

Query  2728  NIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRME  2904
             ++S  K+ E KI ELE+ K  LES V +LE EN++LSE +S LEAQL   T   E ++++
Sbjct  669   HVSANKVLENKISELESSKIGLESHVSKLENENIELSEFISELEAQLTSLTSENESTKLQ  728

Query  2905  LQHKGTQLCNLQDEIRELEKDKESQEL  2985
             +    + + NL+DE+ + + +  SQ+L
Sbjct  729   MDDYRSLIINLKDEVDQQQAEMGSQKL  755



>ref|XP_010050359.1| PREDICTED: uncharacterized protein LOC104438903 [Eucalyptus grandis]
 gb|KCW89311.1| hypothetical protein EUGRSUZ_A01601 [Eucalyptus grandis]
Length=381

 Score =   158 bits (400),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 112/172 (65%), Gaps = 11/172 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R++ +    SG++  F  S  +ALQVPKGWDKL VS+ISVE GKTI+K  KA V 
Sbjct  1    MFRLHRNRPA---KSGERLDFKLSQFKALQVPKGWDKLFVSIISVETGKTIAKSSKALVR  57

Query  241  NGTCQWTESL----WSPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NGTCQW E+L        + +S  L+    K ++SMGS+R+GILGEAT+N  +Y +S  S
Sbjct  58   NGTCQWAETLAESVLVSRDDSSKELEDCLIKLVISMGSARSGILGEATINATNYISSSNS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGID  558
            +P+S+PL+KCN GTVL  +I CLT RT  R D    T +   E NS  N +D
Sbjct  118  VPISIPLKKCNHGTVLQVKINCLTSRTKLRDDGSKETNSQVNELNS--NSLD  167


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL AEA+MWE NA++LM+ ++ +RKEF N S+   D++ME   A TE   L  ++++L
Sbjct  307   IEELHAEAKMWERNAQKLMLDLDMVRKEFFNLSKNHKDLDMEFLAAKTERESLRKEVEQL  366

Query  1036  EVLLEESNAKQ  1068
             ++LL+ S   Q
Sbjct  367   KLLLKNSQVDQ  377



>ref|XP_009397616.1| PREDICTED: myosin-11-like [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   162 bits (411),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L RHKS   D SGDK  F FSN+QA QVPKGWD+L +S+ISVE GKTI+K  KA+V 
Sbjct  1    MFRLNRHKS---DRSGDKVEFRFSNLQAFQVPKGWDRLLLSIISVETGKTIAKSSKATVR  57

Query  241  NGTCQWT--ESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIP  408
             GTCQWT  E +W  ++ AS  L+    KF++SMGS+R+ ILGE  +N+  Y +SE S  
Sbjct  58   GGTCQWTGPEVIWISQDDASKELEESQIKFVLSMGSARSVILGEIVLNLADYLSSEDSGS  117

Query  409  VSLPLQKCNKGTVLNFEIKCLTPRTSF  489
            + LPL+KC  GT L  +I+C TP + F
Sbjct  118  LLLPLKKCESGTTLQVKIQCATPISKF  144


 Score =   114 bits (286),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 140/223 (63%), Gaps = 0/223 (0%)
 Frame = +1

Query  2779  KQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIREL  2958
             K ELE  + +LE+EN+QL E +SGLE  L   T+A + +++EL++  + + +L++E    
Sbjct  581   KDELELHITKLEQENVQLLEHISGLETHLGCLTNAKQSTQLELENSRSLISDLKEENERK  640

Query  2959  EKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGEL  3138
             + + E Q+++  QRL + QK   ++ +E + LK +N  LQA+ +SLIEEC SLQ LN +L
Sbjct  641   QAEVEMQQMDANQRLRKSQKLLSEALQEYDILKISNSSLQASIDSLIEECSSLQNLNADL  700

Query  3139  RRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMI  3318
             + Q++EL      LE EL + +  +S   ++++++EAKLSS+    +SKEK + S+LE +
Sbjct  701   KMQKMELHDHVMHLEVELDQSRRKVSEFSNQVKNIEAKLSSLQIGITSKEKSLLSQLENL  760

Query  3319  LLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQM  3447
               + KE+K++L    ++  ++   K S+ E  Q++  HL  Q+
Sbjct  761   FQEHKEYKKKLSQTHAMLKKIESDKTSKTENLQRELAHLSEQI  803


 Score = 99.8 bits (247),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 101/147 (69%), Gaps = 7/147 (5%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             +EEL  E +MWE ++R+L   +E L+KE +++S+   +++MEL+ A+ E N L  ++++L
Sbjct  313   MEELHDEVKMWERHSRQLKHDIEILKKEISDKSKHQVNLDMELAAAYKEKNSLKQEVEQL  372

Query  1036  EVLLEESNAKQI-----AAENLNLQAKNTE--NILKEMEDELKFQTESNSNLSLQLRKSQ  1194
             ++ L+ES +K+       ++ +    KN +  N+ +E++DELK   ESN+ L+LQL KSQ
Sbjct  373   KIALKESISKRTNTATDESQEMTFSLKNQDMINMQEELKDELKLLKESNATLTLQLSKSQ  432

Query  1195  ESNAELVSVLQEMEETVQKKKIEIENL  1275
             ESN ELV ++Q++E+T++K+K+E E  
Sbjct  433   ESNIELVCIVQDLEQTIEKQKLESEKF  459


 Score = 70.1 bits (170),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 103/190 (54%), Gaps = 22/190 (12%)
 Frame = +1

Query  4081  AREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEEL-----NRKE  4245
             A+E  CA  AE K+++ Q +R N++ R  I+ L+ E   L ++ Q +++EL     ++++
Sbjct  817   AKEASCANGAESKSEICQMQRENNEYRRMIQSLQDEIDKLMRKTQLMEKELMLINEHKQD  876

Query  4246  NSVPS----------PSHSVAKDKTTSCKEQKLSKARSSQCNNCETIQIVTIDDCSSRCQ  4395
             + V S           SH     + +  ++  L  A   + NN   +Q       S+  Q
Sbjct  877   DKVCSEVNEKPHGTGTSHVTEVYRESKTQQHGLEFAEVVESNNMLKLQAKRF---STEEQ  933

Query  4396  VGDDKTQFKSLQPEGQSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLV  4575
             + DD    K +  E ++  +   +  KI+ LEAELK++ ERYLHMSL+YA+VE Q+ +LV
Sbjct  934   I-DDSEILKKIMTENKTMTT---DTNKIASLEAELKDMKERYLHMSLQYAQVEAQREELV  989

Query  4576  MTLKALQDQR  4605
             + LK++Q +R
Sbjct  990   LKLKSMQKER  999



>ref|XP_008442757.1| PREDICTED: myosin-2 heavy chain-like isoform X4 [Cucumis melo]
Length=1261

 Score =   159 bits (402),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R++ +    SG+KF F FSN +A QVPKGWDKL VS+IS + GKTI +  KASV 
Sbjct  1    MFRLHRNRHA---KSGEKFDFKFSNFKATQVPKGWDKLFVSVISEQTGKTIIRSSKASVR  57

Query  241  NGTCQWTESL----WSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQWTESL    W  ++  S   +  +FK +V+MGS+R+ ILGE  VN+ +Y +S++S
Sbjct  58   NGSCQWTESLSDSIWVSQDEVSKEFEDCNFKLVVAMGSARSNILGETMVNMTNYIDSKSS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
              VSLPL+KCN GT L  +I+CL   +  R  E   T
Sbjct  118  STVSLPLKKCNHGTTLQMKIQCLASISKVRSGEFKHT  154


 Score =   147 bits (370),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 180/630 (29%), Positives = 301/630 (48%), Gaps = 88/630 (14%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE+K E +   +  K  ++ ++++  L +D  +K L      L  K  D Q     +E+
Sbjct  547   ELEIKVEELSRELTEKKLEIEKLESSILSKDDEIKILEGLHNKLQAKYSDLQKEKNQIEE  606

Query  2638  DMEKVQTEKDDITS--DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFE  2808
              ME +  E D  +   + +R E+  ++  +  ++S  KI E K  EL+ +KQEL+  V +
Sbjct  607   KMEVILGESDSSSKCLNGLRNEVKALSNSVDLHVSANKILESKYSELQFKKQELDLHVSQ  666

Query  2809  LEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELE  2988
             +E+E ++LSE VS LE+QL++     +   +EL+   +    LQDE   L  + E++ ++
Sbjct  667   IEQERIRLSESVSVLESQLKYMMGEKQSICLELEDSKSHAVGLQDEFDRLRLEIETENVD  726

Query  2989  LKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQ  3168
             LKQ L ++Q +   +Q++ EYL++   KL+A AE L+EE + +Q  NGEL+ +  EL   
Sbjct  727   LKQMLNDLQNQCAKAQDQCEYLQREKTKLEAAAEHLVEERNLVQKSNGELKNKNFELHEG  786

Query  3169  CNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKER  3348
                LE+++++     +    RI+  E  LS  L++ +SKE+ ++SEL+ I+    ++KE+
Sbjct  787   YFRLESKVKESLERSAQYFRRIDDFEDYLSLELDDFASKERFLSSELDSIVEDNIKYKEK  846

Query  3349  LVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKM  3528
             L + ESL +++   K +     Q+    +V                  H    + A  K 
Sbjct  847   LAMLESLYNEIYLEKAT---VAQELHGSVV------------------HRTKQVSAAKKD  885

Query  3529  LKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLEN  3708
               +                   +ME +  +  L+ EL+  K NQ  L A ++KL + LEN
Sbjct  886   FNI------------------MRMESDENLTALISELSVSKQNQETLIADNEKLLKQLEN  927

Query  3709  VISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDM  3888
               S E  LK  +++LE KL +SE ER Q     ++LK++L K A  +DEV A    L   
Sbjct  928   YKSLEVELKNSVNDLELKLYVSEKERRQNEKQLTNLKVQLQKTAHFQDEVFASSNKLE--  985

Query  3889  KFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLE  4068
                                                Q +V ELE+ +   + LEEK+LRL 
Sbjct  986   -----------------------------------QKTVAELEDSKQSGIALEEKLLRLG  1010

Query  4069  GDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELER-------YYLSKELQSVQE  4227
                   E       +L+N+L + KR+NS  + K+K LE E+         L  EL+ ++E
Sbjct  1011  SGSVMEETSFPGIDDLRNELCEIKRMNSTYQQKLKILEEEKDGCLKRSQSLEAELKHLKE  1070

Query  4228  E--LNRKENSVPSPSHSVAKDKTTSCKEQK  4311
             E  + R+ +SV   S S   DK    K+ K
Sbjct  1071  EKQIQRESSSVRIHSLSKTNDKNRPSKDMK  1100


 Score =   125 bits (315),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEARMWE N+ +LM  ++ L+KEF++QS+    +   LS A  E + L  ++++L
Sbjct  267   IEELRAEARMWERNSHKLMADLDQLKKEFSDQSENQESLHAALSAATAECDGLRKELEQL  326

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +++ E+S  +Q + E+L+ Q     +ILK   DELKFQ E+N++L+LQL++SQESN ELV
Sbjct  327   KLVTEKSTQRQTSIEDLSYQ-DGEPHILK---DELKFQKETNADLALQLKRSQESNIELV  382

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN  1317
             SVLQE+E T +K+K+E+E LLA + + D +  IN
Sbjct  383   SVLQELEATTEKQKLELEELLARHQKDDDIENIN  416


 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  4435  EGQSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             EG   ++    E   S LEAELK+I ERY H+SLKYAEVE+Q+ +LVM LKA
Sbjct  1200  EGDVVKTKEGYESLNSALEAELKDIRERYFHISLKYAEVEHQREELVMKLKA  1251



>ref|XP_008442756.1| PREDICTED: myosin-2 heavy chain-like isoform X3 [Cucumis melo]
Length=1262

 Score =   159 bits (402),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R++ +    SG+KF F FSN +A QVPKGWDKL VS+IS + GKTI +  KASV 
Sbjct  1    MFRLHRNRHA---KSGEKFDFKFSNFKATQVPKGWDKLFVSVISEQTGKTIIRSSKASVR  57

Query  241  NGTCQWTESL----WSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQWTESL    W  ++  S   +  +FK +V+MGS+R+ ILGE  VN+ +Y +S++S
Sbjct  58   NGSCQWTESLSDSIWVSQDEVSKEFEDCNFKLVVAMGSARSNILGETMVNMTNYIDSKSS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
              VSLPL+KCN GT L  +I+CL   +  R  E   T
Sbjct  118  STVSLPLKKCNHGTTLQMKIQCLASISKVRSGEFKHT  154


 Score =   147 bits (370),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 180/630 (29%), Positives = 301/630 (48%), Gaps = 88/630 (14%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE+K E +   +  K  ++ ++++  L +D  +K L      L  K  D Q     +E+
Sbjct  548   ELEIKVEELSRELTEKKLEIEKLESSILSKDDEIKILEGLHNKLQAKYSDLQKEKNQIEE  607

Query  2638  DMEKVQTEKDDITS--DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFE  2808
              ME +  E D  +   + +R E+  ++  +  ++S  KI E K  EL+ +KQEL+  V +
Sbjct  608   KMEVILGESDSSSKCLNGLRNEVKALSNSVDLHVSANKILESKYSELQFKKQELDLHVSQ  667

Query  2809  LEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELE  2988
             +E+E ++LSE VS LE+QL++     +   +EL+   +    LQDE   L  + E++ ++
Sbjct  668   IEQERIRLSESVSVLESQLKYMMGEKQSICLELEDSKSHAVGLQDEFDRLRLEIETENVD  727

Query  2989  LKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQ  3168
             LKQ L ++Q +   +Q++ EYL++   KL+A AE L+EE + +Q  NGEL+ +  EL   
Sbjct  728   LKQMLNDLQNQCAKAQDQCEYLQREKTKLEAAAEHLVEERNLVQKSNGELKNKNFELHEG  787

Query  3169  CNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKER  3348
                LE+++++     +    RI+  E  LS  L++ +SKE+ ++SEL+ I+    ++KE+
Sbjct  788   YFRLESKVKESLERSAQYFRRIDDFEDYLSLELDDFASKERFLSSELDSIVEDNIKYKEK  847

Query  3349  LVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKM  3528
             L + ESL +++   K +     Q+    +V                  H    + A  K 
Sbjct  848   LAMLESLYNEIYLEKAT---VAQELHGSVV------------------HRTKQVSAAKKD  886

Query  3529  LKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLEN  3708
               +                   +ME +  +  L+ EL+  K NQ  L A ++KL + LEN
Sbjct  887   FNI------------------MRMESDENLTALISELSVSKQNQETLIADNEKLLKQLEN  928

Query  3709  VISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDM  3888
               S E  LK  +++LE KL +SE ER Q     ++LK++L K A  +DEV A    L   
Sbjct  929   YKSLEVELKNSVNDLELKLYVSEKERRQNEKQLTNLKVQLQKTAHFQDEVFASSNKLE--  986

Query  3889  KFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLE  4068
                                                Q +V ELE+ +   + LEEK+LRL 
Sbjct  987   -----------------------------------QKTVAELEDSKQSGIALEEKLLRLG  1011

Query  4069  GDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELER-------YYLSKELQSVQE  4227
                   E       +L+N+L + KR+NS  + K+K LE E+         L  EL+ ++E
Sbjct  1012  SGSVMEETSFPGIDDLRNELCEIKRMNSTYQQKLKILEEEKDGCLKRSQSLEAELKHLKE  1071

Query  4228  E--LNRKENSVPSPSHSVAKDKTTSCKEQK  4311
             E  + R+ +SV   S S   DK    K+ K
Sbjct  1072  EKQIQRESSSVRIHSLSKTNDKNRPSKDMK  1101


 Score =   125 bits (315),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEARMWE N+ +LM  ++ L+KEF++QS+    +   LS A  E + L  ++++L
Sbjct  267   IEELRAEARMWERNSHKLMADLDQLKKEFSDQSENQESLHAALSAATAECDGLRKELEQL  326

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +++ E+S  +Q + E+L+ Q     +ILK   DELKFQ E+N++L+LQL++SQESN ELV
Sbjct  327   KLVTEKSTQRQTSIEDLSYQ-DGEPHILK---DELKFQKETNADLALQLKRSQESNIELV  382

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN  1317
             SVLQE+E T +K+K+E+E LLA + + D +  IN
Sbjct  383   SVLQELEATTEKQKLELEELLARHQKDDDIENIN  416


 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  4435  EGQSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             EG   ++    E   S LEAELK+I ERY H+SLKYAEVE+Q+ +LVM LKA
Sbjct  1201  EGDVVKTKEGYESLNSALEAELKDIRERYFHISLKYAEVEHQREELVMKLKA  1252



>gb|AFW87945.1| hypothetical protein ZEAMMB73_520730 [Zea mays]
Length=1281

 Score =   159 bits (401),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 135/434 (31%), Positives = 243/434 (56%), Gaps = 0/434 (0%)
 Frame = +1

Query  2755  KILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCN  2934
             KI ELE  K ELE  +  LE E ++L E +SG+E +L + T   E   +++    T + +
Sbjct  701   KIHELEIYKVELELHISRLEDEKIELLESISGMEVELTNLTSEYESCIVQMDDSRTMIID  760

Query  2935  LQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDS  3114
             L+D++   + + E+Q++ELK++ +E QK +L++Q++SE L++ N KLQA   +L EE +S
Sbjct  761   LKDKVERNQMELEAQKVELKKKQLEFQKIFLEAQDDSEALRRLNAKLQAKVHNLTEEYNS  820

Query  3115  LQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKI  3294
             LQ L  +L++++LEL      LE +L   +   +   + ++ LE KLSSI ++ S KE+ 
Sbjct  821   LQELTDDLKKEKLELHSFAKQLEQKLEHSKRRTTDFCTTVDLLEVKLSSIQKDISLKEQS  880

Query  3295  MNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDG  3474
                EL+ I  + K+ +E++     L +++ + K  E+E  +++   L  Q+      +  
Sbjct  881   FLLELDNIFHEHKDHEEKINRAHFLLNKIDKEKAIEIENLEREVISLTAQLSSTHGEQAS  940

Query  3475  KASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKT  3654
                +   E   L A+   L+  L ++ + L   E  L     E +RK+  L   LN  K 
Sbjct  941   SMVDTIREASILRADKAKLQANLHDVNEQLRHYESLLEDIHKESKRKIKSLTDSLNVSKQ  1000

Query  3655  NQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLK  3834
             N+ +L+  ++ ++R +E   S+E NL+   + LE K   S+ E+ Q+ + N  LKI++ K
Sbjct  1001  NEEMLKIDAEAVRRLMEAAKSNEENLRITSNELELKYKSSDYEKQQIMEENYGLKIQVRK  1060

Query  3835  IAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTEL  4014
             IA ++DE+L ++ SL++ +F+ ERLE  L+LI  E +ELK     L  +++ MQ++   +
Sbjct  1061  IAGVQDELLEVQSSLDEAQFEKERLEGILRLISEECDELKVQNAMLTDKVSMMQDTSNNI  1120

Query  4015  EECRLRKVVLEEKV  4056
              E +  K  ++ K+
Sbjct  1121  IEEKQTKTSMQTKM  1134


 Score =   112 bits (281),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +1

Query  142  ALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWT----ESLWSPENYASNGLD-  306
            ++QVP   D+L +S+ISV+ GKTI++  KA+  NG CQW     ES+W   +  S   + 
Sbjct  100  SMQVPVVSDRLLLSIISVDTGKTIARSSKAAARNGICQWPDSILESIWFSRDEVSKEYED  159

Query  307  -HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRT  483
               + +VSMGS+R  ILGE  +N+ +Y +S+ S  +SLPL+KCN GT+L  +I+CL  ++
Sbjct  160  CRCRIVVSMGSTRGAILGEVFLNLNNYLSSDGSTAISLPLKKCNSGTILQLKIQCLGTKS  219

Query  484  SFRGDEVNSTAAYNEEENSVCNG  552
              R   V   ++++  + +  +G
Sbjct  220  KSRWSNVFQDSSFSPSQRNDSDG  242


 Score = 79.0 bits (193),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 91/141 (65%), Gaps = 2/141 (1%)
 Frame = +1

Query  877   ARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEES  1056
             A+MWE + ++L + +E L+KE   +S+   ++ +ELS +  E   L  +I+ L++ L+ +
Sbjct  326   AQMWESHYQKLKIDLEKLQKESDEKSKNQTEILLELSASQAEQESLRQEIEELKLSLKVA  385

Query  1057  NAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEME  1236
               +Q     ++ ++ +  ++  E++DE+ F  ESN NL++QL+KSQ++N ELVS+LQE+E
Sbjct  386   TERQTVG-GIS-KSGDAIDVQFELKDEVHFLRESNENLTMQLKKSQDANIELVSILQELE  443

Query  1237  ETVQKKKIEIENLLALNSRSD  1299
             ET++ ++  I N   +++  D
Sbjct  444   ETIEAQRTTISNFTQMSNMID  464



>ref|XP_008442754.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Cucumis melo]
Length=1309

 Score =   158 bits (400),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R++ +    SG+KF F FSN +A QVPKGWDKL VS+IS + GKTI +  KASV 
Sbjct  1    MFRLHRNRHA---KSGEKFDFKFSNFKATQVPKGWDKLFVSVISEQTGKTIIRSSKASVR  57

Query  241  NGTCQWTESL----WSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQWTESL    W  ++  S   +  +FK +V+MGS+R+ ILGE  VN+ +Y +S++S
Sbjct  58   NGSCQWTESLSDSIWVSQDEVSKEFEDCNFKLVVAMGSARSNILGETMVNMTNYIDSKSS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
              VSLPL+KCN GT L  +I+CL   +  R  E   T
Sbjct  118  STVSLPLKKCNHGTTLQMKIQCLASISKVRSGEFKHT  154


 Score =   147 bits (371),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 180/630 (29%), Positives = 301/630 (48%), Gaps = 88/630 (14%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE+K E +   +  K  ++ ++++  L +D  +K L      L  K  D Q     +E+
Sbjct  595   ELEIKVEELSRELTEKKLEIEKLESSILSKDDEIKILEGLHNKLQAKYSDLQKEKNQIEE  654

Query  2638  DMEKVQTEKDDITS--DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFE  2808
              ME +  E D  +   + +R E+  ++  +  ++S  KI E K  EL+ +KQEL+  V +
Sbjct  655   KMEVILGESDSSSKCLNGLRNEVKALSNSVDLHVSANKILESKYSELQFKKQELDLHVSQ  714

Query  2809  LEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELE  2988
             +E+E ++LSE VS LE+QL++     +   +EL+   +    LQDE   L  + E++ ++
Sbjct  715   IEQERIRLSESVSVLESQLKYMMGEKQSICLELEDSKSHAVGLQDEFDRLRLEIETENVD  774

Query  2989  LKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQ  3168
             LKQ L ++Q +   +Q++ EYL++   KL+A AE L+EE + +Q  NGEL+ +  EL   
Sbjct  775   LKQMLNDLQNQCAKAQDQCEYLQREKTKLEAAAEHLVEERNLVQKSNGELKNKNFELHEG  834

Query  3169  CNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKER  3348
                LE+++++     +    RI+  E  LS  L++ +SKE+ ++SEL+ I+    ++KE+
Sbjct  835   YFRLESKVKESLERSAQYFRRIDDFEDYLSLELDDFASKERFLSSELDSIVEDNIKYKEK  894

Query  3349  LVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKM  3528
             L + ESL +++   K +     Q+    +V                  H    + A  K 
Sbjct  895   LAMLESLYNEIYLEKAT---VAQELHGSVV------------------HRTKQVSAAKKD  933

Query  3529  LKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLEN  3708
               +                   +ME +  +  L+ EL+  K NQ  L A ++KL + LEN
Sbjct  934   FNI------------------MRMESDENLTALISELSVSKQNQETLIADNEKLLKQLEN  975

Query  3709  VISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDM  3888
               S E  LK  +++LE KL +SE ER Q     ++LK++L K A  +DEV A    L   
Sbjct  976   YKSLEVELKNSVNDLELKLYVSEKERRQNEKQLTNLKVQLQKTAHFQDEVFASSNKLE--  1033

Query  3889  KFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLE  4068
                                                Q +V ELE+ +   + LEEK+LRL 
Sbjct  1034  -----------------------------------QKTVAELEDSKQSGIALEEKLLRLG  1058

Query  4069  GDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELER-------YYLSKELQSVQE  4227
                   E       +L+N+L + KR+NS  + K+K LE E+         L  EL+ ++E
Sbjct  1059  SGSVMEETSFPGIDDLRNELCEIKRMNSTYQQKLKILEEEKDGCLKRSQSLEAELKHLKE  1118

Query  4228  E--LNRKENSVPSPSHSVAKDKTTSCKEQK  4311
             E  + R+ +SV   S S   DK    K+ K
Sbjct  1119  EKQIQRESSSVRIHSLSKTNDKNRPSKDMK  1148


 Score =   125 bits (315),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEARMWE N+ +LM  ++ L+KEF++QS+    +   LS A  E + L  ++++L
Sbjct  267   IEELRAEARMWERNSHKLMADLDQLKKEFSDQSENQESLHAALSAATAECDGLRKELEQL  326

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +++ E+S  +Q + E+L+ Q     +ILK   DELKFQ E+N++L+LQL++SQESN ELV
Sbjct  327   KLVTEKSTQRQTSIEDLSYQ-DGEPHILK---DELKFQKETNADLALQLKRSQESNIELV  382

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN  1317
             SVLQE+E T +K+K+E+E LLA + + D +  IN
Sbjct  383   SVLQELEATTEKQKLELEELLARHQKDDDIENIN  416


 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  4435  EGQSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             EG   ++    E   S LEAELK+I ERY H+SLKYAEVE+Q+ +LVM LKA
Sbjct  1248  EGDVVKTKEGYESLNSALEAELKDIRERYFHISLKYAEVEHQREELVMKLKA  1299



>ref|XP_008442755.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Cucumis melo]
Length=1308

 Score =   158 bits (400),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MF+L R++ +    SG+KF F FSN +A QVPKGWDKL VS+IS + GKTI +  KASV 
Sbjct  1    MFRLHRNRHA---KSGEKFDFKFSNFKATQVPKGWDKLFVSVISEQTGKTIIRSSKASVR  57

Query  241  NGTCQWTESL----WSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG+CQWTESL    W  ++  S   +  +FK +V+MGS+R+ ILGE  VN+ +Y +S++S
Sbjct  58   NGSCQWTESLSDSIWVSQDEVSKEFEDCNFKLVVAMGSARSNILGETMVNMTNYIDSKSS  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNST  513
              VSLPL+KCN GT L  +I+CL   +  R  E   T
Sbjct  118  STVSLPLKKCNHGTTLQMKIQCLASISKVRSGEFKHT  154


 Score =   147 bits (372),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 180/630 (29%), Positives = 301/630 (48%), Gaps = 88/630 (14%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE+K E +   +  K  ++ ++++  L +D  +K L      L  K  D Q     +E+
Sbjct  594   ELEIKVEELSRELTEKKLEIEKLESSILSKDDEIKILEGLHNKLQAKYSDLQKEKNQIEE  653

Query  2638  DMEKVQTEKDDITS--DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFE  2808
              ME +  E D  +   + +R E+  ++  +  ++S  KI E K  EL+ +KQEL+  V +
Sbjct  654   KMEVILGESDSSSKCLNGLRNEVKALSNSVDLHVSANKILESKYSELQFKKQELDLHVSQ  713

Query  2809  LEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELE  2988
             +E+E ++LSE VS LE+QL++     +   +EL+   +    LQDE   L  + E++ ++
Sbjct  714   IEQERIRLSESVSVLESQLKYMMGEKQSICLELEDSKSHAVGLQDEFDRLRLEIETENVD  773

Query  2989  LKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQ  3168
             LKQ L ++Q +   +Q++ EYL++   KL+A AE L+EE + +Q  NGEL+ +  EL   
Sbjct  774   LKQMLNDLQNQCAKAQDQCEYLQREKTKLEAAAEHLVEERNLVQKSNGELKNKNFELHEG  833

Query  3169  CNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKER  3348
                LE+++++     +    RI+  E  LS  L++ +SKE+ ++SEL+ I+    ++KE+
Sbjct  834   YFRLESKVKESLERSAQYFRRIDDFEDYLSLELDDFASKERFLSSELDSIVEDNIKYKEK  893

Query  3349  LVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENKM  3528
             L + ESL +++   K +     Q+    +V                  H    + A  K 
Sbjct  894   LAMLESLYNEIYLEKAT---VAQELHGSVV------------------HRTKQVSAAKKD  932

Query  3529  LKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLEN  3708
               +                   +ME +  +  L+ EL+  K NQ  L A ++KL + LEN
Sbjct  933   FNI------------------MRMESDENLTALISELSVSKQNQETLIADNEKLLKQLEN  974

Query  3709  VISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDM  3888
               S E  LK  +++LE KL +SE ER Q     ++LK++L K A  +DEV A    L   
Sbjct  975   YKSLEVELKNSVNDLELKLYVSEKERRQNEKQLTNLKVQLQKTAHFQDEVFASSNKLE--  1032

Query  3889  KFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLE  4068
                                                Q +V ELE+ +   + LEEK+LRL 
Sbjct  1033  -----------------------------------QKTVAELEDSKQSGIALEEKLLRLG  1057

Query  4069  GDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELER-------YYLSKELQSVQE  4227
                   E       +L+N+L + KR+NS  + K+K LE E+         L  EL+ ++E
Sbjct  1058  SGSVMEETSFPGIDDLRNELCEIKRMNSTYQQKLKILEEEKDGCLKRSQSLEAELKHLKE  1117

Query  4228  E--LNRKENSVPSPSHSVAKDKTTSCKEQK  4311
             E  + R+ +SV   S S   DK    K+ K
Sbjct  1118  EKQIQRESSSVRIHSLSKTNDKNRPSKDMK  1147


 Score =   125 bits (315),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEARMWE N+ +LM  ++ L+KEF++QS+    +   LS A  E + L  ++++L
Sbjct  266   IEELRAEARMWERNSHKLMADLDQLKKEFSDQSENQESLHAALSAATAECDGLRKELEQL  325

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +++ E+S  +Q + E+L+ Q     +ILK   DELKFQ E+N++L+LQL++SQESN ELV
Sbjct  326   KLVTEKSTQRQTSIEDLSYQ-DGEPHILK---DELKFQKETNADLALQLKRSQESNIELV  381

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN  1317
             SVLQE+E T +K+K+E+E LLA + + D +  IN
Sbjct  382   SVLQELEATTEKQKLELEELLARHQKDDDIENIN  415


 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  4435  EGQSTRSGNENEQKISQLEAELKEISERYLHMSLKYAEVENQKGKLVMTLKA  4590
             EG   ++    E   S LEAELK+I ERY H+SLKYAEVE+Q+ +LVM LKA
Sbjct  1247  EGDVVKTKEGYESLNSALEAELKDIRERYFHISLKYAEVEHQREELVMKLKA  1298



>ref|XP_008659974.1| PREDICTED: girdin-like isoform X1 [Zea mays]
 ref|XP_008659975.1| PREDICTED: girdin-like isoform X1 [Zea mays]
 ref|XP_008659976.1| PREDICTED: girdin-like isoform X1 [Zea mays]
 ref|XP_008659977.1| PREDICTED: girdin-like isoform X1 [Zea mays]
Length=1186

 Score =   157 bits (397),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 135/434 (31%), Positives = 243/434 (56%), Gaps = 0/434 (0%)
 Frame = +1

Query  2755  KILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCN  2934
             KI ELE  K ELE  +  LE E ++L E +SG+E +L + T   E   +++    T + +
Sbjct  633   KIHELEIYKVELELHISRLEDEKIELLESISGMEVELTNLTSEYESCIVQMDDSRTMIID  692

Query  2935  LQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDS  3114
             L+D++   + + E+Q++ELK++ +E QK +L++Q++SE L++ N KLQA   +L EE +S
Sbjct  693   LKDKVERNQMELEAQKVELKKKQLEFQKIFLEAQDDSEALRRLNAKLQAKVHNLTEEYNS  752

Query  3115  LQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKI  3294
             LQ L  +L++++LEL      LE +L   +   +   + ++ LE KLSSI ++ S KE+ 
Sbjct  753   LQELTDDLKKEKLELHSFAKQLEQKLEHSKRRTTDFCTTVDLLEVKLSSIQKDISLKEQS  812

Query  3295  MNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDG  3474
                EL+ I  + K+ +E++     L +++ + K  E+E  +++   L  Q+      +  
Sbjct  813   FLLELDNIFHEHKDHEEKINRAHFLLNKIDKEKAIEIENLEREVISLTAQLSSTHGEQAS  872

Query  3475  KASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKT  3654
                +   E   L A+   L+  L ++ + L   E  L     E +RK+  L   LN  K 
Sbjct  873   SMVDTIREASILRADKAKLQANLHDVNEQLRHYESLLEDIHKESKRKIKSLTDSLNVSKQ  932

Query  3655  NQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLK  3834
             N+ +L+  ++ ++R +E   S+E NL+   + LE K   S+ E+ Q+ + N  LKI++ K
Sbjct  933   NEEMLKIDAEAVRRLMEAAKSNEENLRITSNELELKYKSSDYEKQQIMEENYGLKIQVRK  992

Query  3835  IAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTEL  4014
             IA ++DE+L ++ SL++ +F+ ERLE  L+LI  E +ELK     L  +++ MQ++   +
Sbjct  993   IAGVQDELLEVQSSLDEAQFEKERLEGILRLISEECDELKVQNAMLTDKVSMMQDTSNNI  1052

Query  4015  EECRLRKVVLEEKV  4056
              E +  K  ++ K+
Sbjct  1053  IEEKQTKTSMQTKM  1066


 Score =   122 bits (305),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 100/160 (63%), Gaps = 10/160 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            M ++ RH+ S     G++  F F ++ A+QVP   D+L +S+ISV+ GKTI++  KA+  
Sbjct  1    MSRVNRHRPSG--RLGERVEFNFCSLCAVQVPVVSDRLLLSIISVDTGKTIARSSKAAAR  58

Query  241  NGTCQWT----ESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            NG CQW     ES+W   +  S   +    + +VSMGS+R  ILGE  +N+ +Y +S+ S
Sbjct  59   NGICQWPDSILESIWFSRDEVSKEYEDCRCRIVVSMGSTRGAILGEVFLNLNNYLSSDGS  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLT--PRTSFRGDEVNSTA  516
              +SLPL+KCN GT+L  +I+CL    ++S R D++++ +
Sbjct  119  TAISLPLKKCNSGTILQLKIQCLGTKSKSSPRNDDMDNKS  158


 Score = 78.2 bits (191),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 91/141 (65%), Gaps = 2/141 (1%)
 Frame = +1

Query  877   ARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEES  1056
             A+MWE + ++L + +E L+KE   +S+   ++ +ELS +  E   L  +I+ L++ L+ +
Sbjct  258   AQMWESHYQKLKIDLEKLQKESDEKSKNQTEILLELSASQAEQESLRQEIEELKLSLKVA  317

Query  1057  NAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEME  1236
               +Q     ++ ++ +  ++  E++DE+ F  ESN NL++QL+KSQ++N ELVS+LQE+E
Sbjct  318   TERQTVG-GIS-KSGDAIDVQFELKDEVHFLRESNENLTMQLKKSQDANIELVSILQELE  375

Query  1237  ETVQKKKIEIENLLALNSRSD  1299
             ET++ ++  I N   +++  D
Sbjct  376   ETIEAQRTTISNFTQMSNMID  396



>ref|XP_002464993.1| hypothetical protein SORBIDRAFT_01g030020 [Sorghum bicolor]
 gb|EER91991.1| hypothetical protein SORBIDRAFT_01g030020 [Sorghum bicolor]
Length=975

 Score =   156 bits (394),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 136/416 (33%), Positives = 243/416 (58%), Gaps = 0/416 (0%)
 Frame = +1

Query  2755  KILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCN  2934
             KI +LE  K ELE  +  LE E ++L E +SG+E +L + T   E   +++    T + +
Sbjct  418   KIHDLEICKVELEMYISRLEDEKLELLESISGMEVELTNLTSEYESCIVQMDDSRTMIID  477

Query  2935  LQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDS  3114
             L+D+++  + + E+Q++E+K++ +E QKR+ + QE+SE L++ N KLQA  ++LIE+C+S
Sbjct  478   LKDKVQLQQSELEAQKVEVKKKQLEFQKRFSEVQEDSEALRRLNAKLQAKVDNLIEDCNS  537

Query  3115  LQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKI  3294
             LQ L  +L++++LEL      LE EL   +   +     ++ LE KLSSI ++ SSKE+ 
Sbjct  538   LQALTDDLKKEKLELHSCVTQLEQELEHSKRKTTDFCRTVDFLEVKLSSIQKDISSKEQS  597

Query  3295  MNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDG  3474
                EL+ IL + KE +E++     L +++ + K  E+E  +++   L  Q+    + ++ 
Sbjct  598   FLLELDNILNEHKEHEEKINHAHYLLNKIDKEKTIEVENLEREVMSLTAQLSSTHEEQES  657

Query  3475  KASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKT  3654
                +   E   L A+   L+  L ++ + L   E +L   + E + K+  L   LN  K 
Sbjct  658   SMLDTIREASILRADKAKLQANLHDVNEQLRHYESQLEDVRKESKSKIKSLTDSLNVLKQ  717

Query  3655  NQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLK  3834
             N+ +L+A ++ ++R +E   S+E NL+   + LE K   S+ ++ Q+ + NS LKI++ K
Sbjct  718   NEEMLKADAEDMRRLMEAAKSNEENLRITSNELELKYKSSDYKKQQIMEENSGLKIQVQK  777

Query  3835  IAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNS  4002
             IA ++DE+L ++ SL++ KF+  RLE  LQL+  E +ELK  K  L  +++  Q++
Sbjct  778   IAGVQDELLKVQSSLDEAKFEKGRLEELLQLMSEECDELKVQKAMLTDKISHTQDT  833


 Score = 95.1 bits (235),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +A IEEL +EA+MWE+++++L   +ETL+KE   +S++  ++ + LS +  E   L  +
Sbjct  32    AEATIEELLSEAQMWEIHSQKLRNDLETLQKECDEKSKKQTEILLVLSASQAEQESLRQE  91

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             I+ L++ LE +NA+Q        ++ +  +I  E++DE++F  ESN NL+ QL+KSQ++N
Sbjct  92    IEELKLSLEVANAQQTVTGIP--KSGDAIDIQLELKDEVQFLRESNENLTTQLKKSQDAN  149

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNSRSD  1299
              ELVS+LQE+EET++ ++ EI N   +++  D
Sbjct  150   IELVSILQELEETIEAQRTEISNFTQMSNVID  181



>ref|XP_008659978.1| PREDICTED: girdin-like isoform X2 [Zea mays]
 ref|XP_008659979.1| PREDICTED: girdin-like isoform X2 [Zea mays]
Length=1033

 Score =   154 bits (390),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 135/434 (31%), Positives = 243/434 (56%), Gaps = 0/434 (0%)
 Frame = +1

Query  2755  KILELENEKQELESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCN  2934
             KI ELE  K ELE  +  LE E ++L E +SG+E +L + T   E   +++    T + +
Sbjct  480   KIHELEIYKVELELHISRLEDEKIELLESISGMEVELTNLTSEYESCIVQMDDSRTMIID  539

Query  2935  LQDEIRELEKDKESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDS  3114
             L+D++   + + E+Q++ELK++ +E QK +L++Q++SE L++ N KLQA   +L EE +S
Sbjct  540   LKDKVERNQMELEAQKVELKKKQLEFQKIFLEAQDDSEALRRLNAKLQAKVHNLTEEYNS  599

Query  3115  LQILNGELRRQRLELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKI  3294
             LQ L  +L++++LEL      LE +L   +   +   + ++ LE KLSSI ++ S KE+ 
Sbjct  600   LQELTDDLKKEKLELHSFAKQLEQKLEHSKRRTTDFCTTVDLLEVKLSSIQKDISLKEQS  659

Query  3295  MNSELEMILLQTKEFKERLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDG  3474
                EL+ I  + K+ +E++     L +++ + K  E+E  +++   L  Q+      +  
Sbjct  660   FLLELDNIFHEHKDHEEKINRAHFLLNKIDKEKAIEIENLEREVISLTAQLSSTHGEQAS  719

Query  3475  KASEGSHEMHSLFAENKMLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKT  3654
                +   E   L A+   L+  L ++ + L   E  L     E +RK+  L   LN  K 
Sbjct  720   SMVDTIREASILRADKAKLQANLHDVNEQLRHYESLLEDIHKESKRKIKSLTDSLNVSKQ  779

Query  3655  NQVVLEAKSDKLQRWLENVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLK  3834
             N+ +L+  ++ ++R +E   S+E NL+   + LE K   S+ E+ Q+ + N  LKI++ K
Sbjct  780   NEEMLKIDAEAVRRLMEAAKSNEENLRITSNELELKYKSSDYEKQQIMEENYGLKIQVRK  839

Query  3835  IAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTEL  4014
             IA ++DE+L ++ SL++ +F+ ERLE  L+LI  E +ELK     L  +++ MQ++   +
Sbjct  840   IAGVQDELLEVQSSLDEAQFEKERLEGILRLISEECDELKVQNAMLTDKVSMMQDTSNNI  899

Query  4015  EECRLRKVVLEEKV  4056
              E +  K  ++ K+
Sbjct  900   IEEKQTKTSMQTKM  913


 Score = 77.4 bits (189),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 91/141 (65%), Gaps = 2/141 (1%)
 Frame = +1

Query  877   ARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEES  1056
             A+MWE + ++L + +E L+KE   +S+   ++ +ELS +  E   L  +I+ L++ L+ +
Sbjct  105   AQMWESHYQKLKIDLEKLQKESDEKSKNQTEILLELSASQAEQESLRQEIEELKLSLKVA  164

Query  1057  NAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEME  1236
               +Q     ++ ++ +  ++  E++DE+ F  ESN NL++QL+KSQ++N ELVS+LQE+E
Sbjct  165   TERQTVG-GIS-KSGDAIDVQFELKDEVHFLRESNENLTMQLKKSQDANIELVSILQELE  222

Query  1237  ETVQKKKIEIENLLALNSRSD  1299
             ET++ ++  I N   +++  D
Sbjct  223   ETIEAQRTTISNFTQMSNMID  243



>ref|XP_010267312.1| PREDICTED: uncharacterized protein LOC104604589 [Nelumbo nucifera]
Length=188

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 6/142 (4%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL +HKS +   SG +  F FSN QALQVPKGW+KLSV ++S+E GKT SK  K +V 
Sbjct  1    MFKLHKHKSKSGSGSGKRIDFRFSNFQALQVPKGWEKLSVYVVSLETGKTTSKTSKVAVR  60

Query  241  NGTCQWT----ESLWSPENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIP  408
            +GTCQWT    ESLW       +     K    MGSS++GILGE  +N+  Y NS A++P
Sbjct  61   DGTCQWTETLIESLWVSRESKESEECLIKLF--MGSSKSGILGEVILNLTSYMNSSATVP  118

Query  409  VSLPLQKCNKGTVLNFEIKCLT  474
            +  PL+KCN GTVL  +I+CLT
Sbjct  119  LLFPLKKCNYGTVLQVKIQCLT  140



>ref|NP_001048692.1| Os03g0107400 [Oryza sativa Japonica Group]
 dbj|BAF10606.1| Os03g0107400, partial [Oryza sativa Japonica Group]
Length=950

 Score =   140 bits (353),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 145/216 (67%), Gaps = 3/216 (1%)
 Frame = +1

Query  2680  DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVSGLE  2856
             D +R++++V++  I  ++S  K+ E K+ ELE+ K +LE  + +LE+EN++LSER+SGLE
Sbjct  732   DEVRQDILVLSSSIDSHVSANKVLERKVTELESCKADLELHISDLEQENIELSERISGLE  791

Query  2857  AQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQELELKQRLMEMQKRWLDSQ  3036
             AQL + T+  E S +++    + + NL+D++   + + E+Q LE KQ+  E Q++  ++Q
Sbjct  792   AQLTYMTNEKESSELQIHDSKSLIVNLKDKVERQQAEMETQRLEFKQKQQEAQRKLSEAQ  851

Query  3037  EESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAEL-RKYQHSL  3213
             ++SE L+++N KLQ+T ESLIEEC SLQ    EL+RQ+LEL       E EL    + +L
Sbjct  852   DDSEVLRRSNSKLQSTVESLIEECSSLQNQIAELKRQKLELHGHLTQQEQELDNSKKRNL  911

Query  3214  SSCLSRIESLEAKLSSILEETSSKEKIMNSELEMIL  3321
               C + +E LEAKLSS+ ++ SSKE+ + SELE I 
Sbjct  912   DFCKT-VEFLEAKLSSLQKDISSKEQSLLSELESIF  946


 Score =   132 bits (332),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 97/151 (64%), Gaps = 8/151 (5%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFKL RH+SS  D  G +F F FSN +A+QVP   D+L +S++SV+ GKT++K GKA+  
Sbjct  1    MFKLHRHRSS--DRVGQRFDFRFSNFRAVQVPAVSDRLFLSIVSVDTGKTVAKSGKAAAR  58

Query  241  NGTCQW----TESLWSPENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G CQW     ES+W  ++  S   D   +K +VS+GS ++G+LGE  +N+ ++ N    
Sbjct  59   SGICQWPDSILESIWFSQDEVSKEFDECQYKIVVSVGSIKSGVLGEIFLNLTNFLNLVDP  118

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG  495
              +SLPL++CN GTVL  +++ L  ++   G
Sbjct  119  TAISLPLKRCNSGTVLQLKVQYLGAKSKSSG  149


 Score =   106 bits (264),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 108/171 (63%), Gaps = 7/171 (4%)
 Frame = +1

Query  805   IGQCSLHITRTS-----IPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIAD  969
              GQ SL  + +S       +  IEEL+ EA+MWE ++R+L   +E L+KE + +S++  +
Sbjct  289   FGQLSLGTSDSSKELLEAAEETIEELRDEAKMWERHSRKLKADLEMLKKECSEKSKQQTE  348

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQ  1149
             +E ELS AH E +    +I+ L+  ++E   +Q        +  +  ++ KE+ED++KF 
Sbjct  349   LEAELSAAHAERDSYRQEIEELKSSMKEVTTRQKVGGTS--KYGDWIDLQKELEDDVKFL  406

Query  1150  TESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDV  1302
              ESN+NLS+QL+ +QE+N ELVS+LQE+EET++++K EI  +  + + +D 
Sbjct  407   KESNANLSIQLKNTQEANIELVSILQELEETIEEQKAEISKISKVKNVTDA  457



>ref|XP_002316409.1| hypothetical protein POPTR_0010s23780g [Populus trichocarpa]
 gb|EEF02580.1| hypothetical protein POPTR_0010s23780g [Populus trichocarpa]
Length=242

 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 128/203 (63%), Gaps = 24/203 (12%)
 Frame = +1

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
             ML+ +LQE+   LE++E  L + QME E K++EL                        LE
Sbjct  13    MLEDSLQELHGKLELSESNLSSLQMESEIKLFEL------------------------LE  48

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
             +V S E   K I+  LE KL +S  E+ Q+ +  SSL+I+LLK + L+DE+  LK SLN+
Sbjct  49    DVKSKEEKHKSIVKGLELKLKVSAYEKQQVTEETSSLRIQLLKTSLLQDEIPDLKRSLNE  108

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
             +KF+N++LE+SL ++ G+NEELKADK   +QE+  MQ ++ EL +CR  KV  EEK+ RL
Sbjct  109   VKFENKKLESSLHILSGDNEELKADKILSMQEIPDMQRTIAELGDCRHGKVSREEKLFRL  168

Query  4066  EGDLTAREVMCAKDAELKNDLTQ  4134
             EGDLTAR+ + A+DAELK  L +
Sbjct  169   EGDLTARKAIGAQDAELKMSLPR  191



>ref|XP_004161275.1| PREDICTED: uncharacterized protein LOC101231969 [Cucumis sativus]
Length=1265

 Score =   135 bits (339),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 86/127 (68%), Gaps = 6/127 (5%)
 Frame = +1

Query  151  VPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESL----WSPENYASNGLD--HF  312
            VPKGWDKL VS+IS + GKTI +  KA V NG+CQWTESL    W  ++  S   +  +F
Sbjct  31   VPKGWDKLFVSVISEQTGKTIVRSSKAPVRNGSCQWTESLSDSIWVSQDEVSKEFEDCNF  90

Query  313  KFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
            K +V+MGS+R+ ILGE  VN+ +Y +S++S  VSLPL+KCN GT+L  +I+CL P +  R
Sbjct  91   KLVVAMGSARSNILGETMVNMTNYIDSKSSSAVSLPLKKCNHGTILQVKIQCLAPISKVR  150

Query  493  GDEVNST  513
              E   T
Sbjct  151  SGEFKHT  157


 Score =   127 bits (320),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 111/154 (72%), Gaps = 1/154 (1%)
 Frame = +1

Query  856   IEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRL  1035
             IEEL+AEARMWE N+ +LM  ++ L+KEF++QS+    +   LS A  E + L  ++++L
Sbjct  270   IEELRAEARMWERNSHKLMADLDQLKKEFSDQSENQESLHAALSAATAECDGLRKELEQL  329

Query  1036  EVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELV  1215
             +++ E+S  ++ + E+L+ Q     +IL E++DEL FQ E+N++L+LQL++SQESN ELV
Sbjct  330   KLVTEKSKQRRTSIEDLSYQ-DGEPHILNELKDELNFQKETNADLALQLKRSQESNIELV  388

Query  1216  SVLQEMEETVQKKKIEIENLLALNSRSDVMGVIN  1317
             SVLQE+E T +K+K+EIE LLA + + D +  IN
Sbjct  389   SVLQELEATTEKQKLEIEELLARHQQDDDIENIN  422


 Score =   124 bits (310),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 197/787 (25%), Positives = 332/787 (42%), Gaps = 206/787 (26%)
 Frame = +1

Query  2458  ELEVKGESIGNNVLTKNSKMLEVKTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEK  2637
             ELE+  E +   +  K  ++ ++++  L +D  +K L      L  K  D Q     +++
Sbjct  599   ELEIIVEELSKELTLKKLEIEKLESSILSKDDEIKILEGLHNKLQAKYSDLQEEKNQIDE  658

Query  2638  DMEKVQTEKDDITS---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVF  2805
              M +V   + D +S   + +R E+  ++  +  ++S  K+ E K  EL+ +KQEL+  V 
Sbjct  659   KMMEVMLGESDGSSKGLNGLRNEVKALSNSVDLHVSANKLLESKYSELQFKKQELDLHVS  718

Query  2806  ELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDKESQEL  2985
             ++E+E ++LSE +S LE+QL++     +  R+EL+   +   +LQDE  +L  + E++ +
Sbjct  719   QIEQERIRLSESISVLESQLKYMMGEKQSIRLELEDSKSHAVSLQDEFDKLRLEIETENV  778

Query  2986  ELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKV  3165
             +LK                                         Q+LN        +L+ 
Sbjct  779   DLK-----------------------------------------QMLN--------DLQN  789

Query  3166  QCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKIMNSELEMILLQTKEFKE  3345
             QC   + +L++     +    RIE  E  LS  LE+ +SKE+ ++SEL+ I+ +  ++KE
Sbjct  790   QCAKAQDQLKEPLERSAQYFRRIEDFEDYLSLGLEDFASKERFLSSELDSIVEENIKYKE  849

Query  3346  RLVIKESLQSQLCQHKLSELEYPQQKSPHLVNQMFDPSDREDGKASEGSHEMHSLFAENK  3525
             +L + ESL ++    K +E +       HL  Q                           
Sbjct  850   KLAMFESLSNETYWEKATEAQELHGAVVHLTKQ---------------------------  882

Query  3526  MLKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLE  3705
                  L   +++  I        +ME +  +  L+ EL+  K NQ  L A ++KL + LE
Sbjct  883   -----LSAAKKDFNIM-------RMESDENLTALISELSVSKQNQETLIADNEKLLKQLE  930

Query  3706  NVISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLND  3885
             N  S E  LK  +++LE KL +SE ER Q  +  ++ K++L K    +DEV A    L  
Sbjct  931   NYKSLEVELKNSVNDLEQKLYVSEKERRQNEENLTNFKVQLQKTVHFQDEVFASSNKLE-  989

Query  3886  MKFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRL  4065
                                                 Q +V ELE+ +  ++ LEEK+LR+
Sbjct  990   ------------------------------------QKTVAELEDSKQSRIALEEKLLRI  1013

Query  4066  EGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELER-------YYLSKELQSVQ  4224
                    E       +L+N+L++ KR+NS+ + K+K LE E+         L  EL+ ++
Sbjct  1014  GSGSVVEETSFPGIDDLRNELSEIKRMNSKYQQKLKILEEEKDGCLKRSQSLEAELEHLK  1073

Query  4225  EE--LNRKENSVPSPSHSVAKDKTTSCKEQKL--------------SKARSSQCNNCETI  4356
             EE  + R+ +SV   S S   DK    K+ KL               K +    N+ ++ 
Sbjct  1074  EEKQIQRESSSVRIHSLSKTNDKNMPSKDMKLLKNGAVKTVGQNHSGKKKPKDPNSNQSQ  1133

Query  4357  QIVTIDDCSSRCQVGDDKTQFKSLQPEGQS------------------------------  4446
               +      S C + D+        PE +S                              
Sbjct  1134  SQIKYRQDDSGCDIDDEGPHV----PEAKSISRIQMLEKELAEALEANKKYEDQLSRIVS  1189

Query  4447  -TRSGNENEQKISQLEAE------------------LKEISERYLHMSLKYAEVENQKGK  4569
              T++  EN   IS +E +                  LK+I ERY H+SLKYAEVE+Q+ +
Sbjct  1190  DTQNNKEN-SPISTIEGDVVKTKEGYESLNSDLEAELKDIRERYFHISLKYAEVEHQREE  1248

Query  4570  LVMTLKA  4590
             LVM LKA
Sbjct  1249  LVMKLKA  1255



>ref|XP_010090429.1| Putative AC transposase [Morus notabilis]
 gb|EXB39444.1| Putative AC transposase [Morus notabilis]
Length=635

 Score =   131 bits (329),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 153/238 (64%), Gaps = 0/238 (0%)
 Frame = +1

Query  3529  LKLTLQEIQQNLEITEVKLVTTQMEYERKVYELMGELNAHKTNQVVLEAKSDKLQRWLEN  3708
             L+  L+E+Q  +++ E+KL   Q+E E KV  L+ EL A K NQ ++ A  +K+Q+ LE+
Sbjct  176   LEAALEEVQGKVKMYEIKLEILQIESEAKVLRLVRELAASKQNQEIVIADYEKIQKMLED  235

Query  3709  VISSESNLKCIIDNlesklllseserlqlADANSSLKIELLKIAFLRDEVLALKGSLNDM  3888
               ++E  L  I+  LE KL  SE ER +LA+  S LKI L     L+DEV AL+ +L   
Sbjct  236   AKANEEKLDNILIRLELKLKASEYERQKLAEEVSRLKIRLQNTEVLQDEVFALRKALCVE  295

Query  3889  KFKNERLEASLQLICGENEELKADKTSLIQELTGMQNSVTELEECRLRKVVLEEKVLRLE  4068
             K + +RLEAS  ++ G+ EELK  + S  + ++ M+ +++EL +C+  K VLEEK+++LE
Sbjct  296   KTEKQRLEASFHIVSGDYEELKTKRVSYAERISNMEKAMSELGDCKHSKAVLEEKIMQLE  355

Query  4069  GDLTAREVMCAKDAELKNDLTQSKRVNSQLRWKIKQLELERYYLSKELQSVQEELNRK  4242
              DL ARE + ++   LKN+L Q +  N++L+ +I+ L+ E+   S+++Q+++EEL  K
Sbjct  356   WDLVAREALRSQIVVLKNELGQIRTANNELQRRIRHLKREKSESSRKVQALEEELREK  413



>ref|XP_011101561.1| PREDICTED: uncharacterized protein LOC105179614 [Sesamum indicum]
Length=146

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 6/118 (5%)
 Frame = +1

Query  58   EMFKLRRHKSST--SDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKA  231
            ++F++ R K S+  +D S  KF F FS IQALQVPKGWDKL +SLIS E+ KTI K GK 
Sbjct  5    KIFRVHRRKPSSVGTDASAHKFDFTFSKIQALQVPKGWDKLYISLISSESAKTIRKSGKG  64

Query  232  SVNNGTCQWTESLWSPENYASNGLD-HFKFLVSMGSSRAGILGEATVNV---GHYRNS  393
            SV NGTCQWTE L      +  G D H KF+VS GSS++GILGE T+N+   G YR+S
Sbjct  65   SVKNGTCQWTEILSESICTSDVGGDYHLKFVVSTGSSKSGILGETTLNLAEFGCYRDS  122



>gb|KHN00942.1| hypothetical protein glysoja_000610 [Glycine soja]
Length=650

 Score =   122 bits (305),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 111/168 (66%), Gaps = 1/168 (1%)
 Frame = +1

Query  2791  ESCVFELEKENMQLSERVSGLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEIRELEKDK  2970
             ++ +F L+ EN+QLSE++ GLEA++RH  +  E + + L++    + NLQ EIR +E   
Sbjct  466   DNALFGLKAENVQLSEKMLGLEAEMRHLIEEKESTHLALENSENVVENLQAEIRRMEALN  525

Query  2971  ESQELELKQRLMEMQKRWLDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQR  3150
             E+Q++ELK++   MQK+W+++QEE  +LK  N +LQAT   LIEE  + Q  N +LR Q 
Sbjct  526   EAQKVELKRKEESMQKKWIEAQEECSFLKVGNLELQATNGKLIEESKTFQT-NDQLRMQN  584

Query  3151  LELKVQCNLLEAELRKYQHSLSSCLSRIESLEAKLSSILEETSSKEKI  3294
             LEL  QC +L+++L + Q   S  L  +E LE K +S+LEE + KEKI
Sbjct  585   LELHCQCTVLDSKLGESQIVFSGMLKLVEELECKFTSMLEEIALKEKI  632



>ref|XP_010090428.1| hypothetical protein L484_007990 [Morus notabilis]
 gb|EXB39443.1| hypothetical protein L484_007990 [Morus notabilis]
Length=391

 Score =   119 bits (298),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 106/146 (73%), Gaps = 2/146 (1%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              +A I+ LKAEA MWE N+RRLM+ +E L+KE +++    A +E ELS    E + +  +
Sbjct  73    AEAAIQLLKAEAGMWEQNSRRLMMNVERLQKELSDEKIHRASLEDELSELCEECDGMKQE  132

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
             +++L++LLEE+  KQ   E+L   + + +   K++EDE+KFQ E+N+NLSLQL+KS E+N
Sbjct  133   VEQLKMLLEETREKQTVNEDL--ISNSMDQTWKDLEDEMKFQKEANANLSLQLKKSLEAN  190

Query  1204  AELVSVLQEMEETVQKKKIEIENLLA  1281
             AELV +LQE+E T++K+KIE++NL A
Sbjct  191   AELVIILQELESTIEKQKIEMDNLCA  216



>ref|XP_009789092.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009789098.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009789102.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009789109.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009789117.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X1 [Nicotiana sylvestris]
Length=2217

 Score =   122 bits (305),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 99/165 (60%), Gaps = 16/165 (10%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP-  279
            +K   +F     A  +P+ GWDKL +S I  ++GKTI+K  KA+V NGTC+W + ++   
Sbjct  12   NKVKVVFRLQFNATHIPQTGWDKLFISFIPADSGKTIAKTTKAAVRNGTCKWGDPIYETT  71

Query  280  ---ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIP--VSLPLQKCNK  438
               ++  S  LD   +K +V+MGSSR+ ILGEAT+N+  Y  +EAS P  V+LPLQ CN 
Sbjct  72   RLLQDVKSKQLDEKLYKLVVAMGSSRSSILGEATINLADY--AEASKPSDVALPLQGCNA  129

Query  439  GTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEE  573
            GT+L+  ++ LT +T FR  E          E  + +G DNK ++
Sbjct  130  GTILHVTVQLLTSKTGFREFE----QQREHRERGLQSGYDNKHDD  170



>ref|XP_009789123.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X2 [Nicotiana sylvestris]
Length=2022

 Score =   121 bits (304),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 99/165 (60%), Gaps = 16/165 (10%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP-  279
            +K   +F     A  +P+ GWDKL +S I  ++GKTI+K  KA+V NGTC+W + ++   
Sbjct  12   NKVKVVFRLQFNATHIPQTGWDKLFISFIPADSGKTIAKTTKAAVRNGTCKWGDPIYETT  71

Query  280  ---ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIP--VSLPLQKCNK  438
               ++  S  LD   +K +V+MGSSR+ ILGEAT+N+  Y  +EAS P  V+LPLQ CN 
Sbjct  72   RLLQDVKSKQLDEKLYKLVVAMGSSRSSILGEATINLADY--AEASKPSDVALPLQGCNA  129

Query  439  GTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEE  573
            GT+L+  ++ LT +T FR  E          E  + +G DNK ++
Sbjct  130  GTILHVTVQLLTSKTGFREFE----QQREHRERGLQSGYDNKHDD  170



>ref|XP_009789129.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
isoform X3 [Nicotiana sylvestris]
Length=2014

 Score =   121 bits (304),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 99/165 (60%), Gaps = 16/165 (10%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP-  279
            +K   +F     A  +P+ GWDKL +S I  ++GKTI+K  KA+V NGTC+W + ++   
Sbjct  12   NKVKVVFRLQFNATHIPQTGWDKLFISFIPADSGKTIAKTTKAAVRNGTCKWGDPIYETT  71

Query  280  ---ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIP--VSLPLQKCNK  438
               ++  S  LD   +K +V+MGSSR+ ILGEAT+N+  Y  +EAS P  V+LPLQ CN 
Sbjct  72   RLLQDVKSKQLDEKLYKLVVAMGSSRSSILGEATINLADY--AEASKPSDVALPLQGCNA  129

Query  439  GTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEE  573
            GT+L+  ++ LT +T FR  E          E  + +G DNK ++
Sbjct  130  GTILHVTVQLLTSKTGFREFE----QQREHRERGLQSGYDNKHDD  170



>ref|XP_009617621.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Nicotiana tomentosiformis]
 ref|XP_009617622.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Nicotiana tomentosiformis]
 ref|XP_009617623.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Nicotiana tomentosiformis]
 ref|XP_009617624.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Nicotiana tomentosiformis]
Length=2217

 Score =   121 bits (303),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 99/165 (60%), Gaps = 16/165 (10%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP-  279
            +K   +F     A  +P+ GWDKL +S IS ++GKTI+K  KA+V NGTC+W + ++   
Sbjct  12   NKVKVVFRLQFNATHIPQSGWDKLFISFISADSGKTIAKTTKAAVRNGTCKWGDPIYETT  71

Query  280  ---ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIP--VSLPLQKCNK  438
               ++  S   D   +K +V+MGSSR+ ILGEAT+N+  Y  +EAS P  V+LPLQ CN 
Sbjct  72   RLLQDVKSKQFDEKLYKLVVAMGSSRSSILGEATINLADY--AEASKPSAVALPLQGCNA  129

Query  439  GTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEE  573
            GT+L+  ++ LT +T FR  E          E  + +G DNK ++
Sbjct  130  GTILHVTVQLLTSKTGFREFEQQREL----RERGLQSGYDNKHDD  170



>ref|XP_004238511.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Solanum lycopersicum]
 ref|XP_010320146.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 
[Solanum lycopersicum]
Length=2156

 Score =   118 bits (295),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 88/138 (64%), Gaps = 12/138 (9%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP-  279
            +K   +F     A  +P+ GWDKL +S I  ++GKTI+K  KA+V NGTC+W + ++   
Sbjct  12   NKVKVVFRLQFNATHIPQTGWDKLFISFIPADSGKTIAKTTKANVRNGTCKWADPIYETT  71

Query  280  ---ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIP--VSLPLQKCNK  438
               ++  +   D   +K +VSMGSSR+ ILGEAT+N+  Y  +EAS P  V+LPLQ CN 
Sbjct  72   RLLQDVKTKQFDEKLYKLVVSMGSSRSSILGEATINLADY--AEASKPSAVALPLQGCNA  129

Query  439  GTVLNFEIKCLTPRTSFR  492
            GT+L+  ++ LT +T FR
Sbjct  130  GTILHVTVQLLTSKTGFR  147



>ref|XP_010273099.1| PREDICTED: trichohyalin [Nelumbo nucifera]
Length=1116

 Score =   116 bits (290),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 114/458 (25%), Positives = 209/458 (46%), Gaps = 67/458 (15%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVP-KGWDKLSVSLISVEAGKTISKLGKAS  234
             MFK  R +S       +K   +F    QA QVP  GW+ L VSL+ V+ GK   KL K +
Sbjct  1     MFKSARWRSDK-----NKIKAVFKLQFQATQVPLVGWETLIVSLVPVDVGKPTVKLEKTA  55

Query  235   VNNGTCQWTESLWSPENYA----SNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSE  396
             V +GTC+W   ++    +     +  ++   +  LVS GSS+AG+LGE +++  +Y  + 
Sbjct  56    VRDGTCRWENPIYETIKFVRETKTGKINEKVYHCLVSTGSSKAGLLGEVSIDFANYAEAI  115

Query  397   ASIPVSLPLQKCNKGTVLNFEIKCL----------------------TPRTSFRGDEVNS  510
                 +SLPL+  N G VL+  I+ +                      + R+     +++ 
Sbjct  116   KPFSISLPLKSSNSGAVLHVTIQRIQGNVDRREVGENGDVTVKFQDRSLRSQMSNSDIDE  175

Query  511   TAAYNEEENSVCNGI--DNKSEERNN---------SLPSMEDSLGRDSLssasnssavvn  657
             + + +  EN   N I   N   +RN          + P  + S GR++       +   +
Sbjct  176   SDSNDATENGPLNKIASQNAQAKRNPRSSIGFDVMTGPGSDSSSGRNTPRELGLKNNNAH  235

Query  658   naIRRLESTESGGSAPWssysygspksnnspnklsisCQEKHPEYTEEEIGQCSLHITRT  837
                R   S+ S  + P            N+        Q  + E++       SL  + +
Sbjct  236   QNPRSYLSSLSHSTMP-------QKPMVNATTTNYNVHQRSNTEWSMSSAPDGSLDGSTS  288

Query  838   SIPD------------ANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEME  981
             S  D             +IE+LK++  +    A    ++++TLRK+   +S+R  ++  E
Sbjct  289   SSEDTLLKESLSQASDVSIEKLKSDLFVLTRQAEVSELELQTLRKQIVKESKRGQELSRE  348

Query  982   LSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESN  1161
             +     E + L  + ++L+      + K   +  L  ++K+   +L+E+  EL ++ + N
Sbjct  349   VIGLKEERDALKKECEQLKASQHIEDTK--TSNKLQFESKDPWALLEEIRQELNYEKDIN  406

Query  1162  SNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENL  1275
             +NL LQL+K+QESN+EL+  +Q+++E +++K  EI +L
Sbjct  407   ANLRLQLQKTQESNSELILAVQDLDEMLEQKNKEISHL  444



>ref|XP_006354031.1| PREDICTED: centromere-associated protein E-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006354032.1| PREDICTED: centromere-associated protein E-like isoform X2 [Solanum 
tuberosum]
Length=2156

 Score =   112 bits (280),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 86/138 (62%), Gaps = 12/138 (9%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP-  279
            +K   +F     A   P+ GWDKL +S    ++GKTI+K  KA+V NGTC+W + ++   
Sbjct  12   NKVKVVFRLQFNATHTPQTGWDKLFISFSPADSGKTIAKTTKANVRNGTCKWADPIYETT  71

Query  280  ---ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIP--VSLPLQKCNK  438
               ++  +   D   +K +VSMGSSR+ ILGEAT+++  Y  +EAS P  V+LPLQ CN 
Sbjct  72   RLLQDVKTKQFDEKLYKLVVSMGSSRSSILGEATIDLADY--AEASKPSAVALPLQGCNA  129

Query  439  GTVLNFEIKCLTPRTSFR  492
            GT+L+  ++ LT +T FR
Sbjct  130  GTILHVTVQLLTSKTGFR  147



>ref|XP_006354033.1| PREDICTED: centromere-associated protein E-like isoform X3 [Solanum 
tuberosum]
Length=2087

 Score =   112 bits (279),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 86/138 (62%), Gaps = 12/138 (9%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP-  279
            +K   +F     A   P+ GWDKL +S    ++GKTI+K  KA+V NGTC+W + ++   
Sbjct  12   NKVKVVFRLQFNATHTPQTGWDKLFISFSPADSGKTIAKTTKANVRNGTCKWADPIYETT  71

Query  280  ---ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIP--VSLPLQKCNK  438
               ++  +   D   +K +VSMGSSR+ ILGEAT+++  Y  +EAS P  V+LPLQ CN 
Sbjct  72   RLLQDVKTKQFDEKLYKLVVSMGSSRSSILGEATIDLADY--AEASKPSAVALPLQGCNA  129

Query  439  GTVLNFEIKCLTPRTSFR  492
            GT+L+  ++ LT +T FR
Sbjct  130  GTILHVTVQLLTSKTGFR  147



>ref|XP_002513863.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF48446.1| ATP binding protein, putative [Ricinus communis]
Length=1998

 Score =   112 bits (279),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVP-KGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P  GWDKL +S I  ++GK  SK  KASV NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATHIPLVGWDKLFISFIPADSGKVTSKTTKASVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K +++MGSSR+ ILGEAT+N+ HY ++     ++LPL  C+ GT+
Sbjct  73   LLQDIKTKQYDEKLYKLVIAMGSSRSSILGEATINLAHYADALKPFVIALPLHGCDSGTI  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>gb|ABR17005.1| unknown [Picea sitchensis]
Length=537

 Score =   109 bits (273),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 91/168 (54%), Gaps = 11/168 (7%)
 Frame = +1

Query  136  IQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASNG  300
            + A QVP+ GWDKL VSLI VE GK  +K  K SV NG C+W++ ++      ++  +  
Sbjct  23   LHATQVPQPGWDKLFVSLIPVETGKATAKTTKVSVRNGNCKWSDPIYETTRLLQDAKTRK  82

Query  301  LDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLT  474
             D   FK +VSMGSSR G LGEA++N+  +        VSLPLQ C+ GT L+  ++ LT
Sbjct  83   FDEKLFKLVVSMGSSRYGCLGEASINLADFAEVVKPSSVSLPLQSCSFGTTLHVTVQHLT  142

Query  475  PRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNNSLPSMEDSLGRD  618
             +T FR  E        E    +   +D+  E   N+L + E   G D
Sbjct  143  AKTGFR--EFEQQREITERGIHISQTVDD--EPDGNALATEEKVYGDD  186



>ref|XP_010664285.1| PREDICTED: centromere-associated protein E [Vitis vinifera]
 ref|XP_010664286.1| PREDICTED: centromere-associated protein E [Vitis vinifera]
 ref|XP_010664287.1| PREDICTED: centromere-associated protein E [Vitis vinifera]
 ref|XP_010664288.1| PREDICTED: centromere-associated protein E [Vitis vinifera]
 ref|XP_010664289.1| PREDICTED: centromere-associated protein E [Vitis vinifera]
Length=1913

 Score =   109 bits (273),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 75/119 (63%), Gaps = 6/119 (5%)
 Frame = +1

Query  154  PKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASNGLDH--FK  315
            P GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++      ++  +   D   +K
Sbjct  29   PTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIYETTRLLQDAKTKQYDEKLYK  88

Query  316  FLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
             +V+MGSSR+ ILGEA +N+  Y +++    V+LPL  CN GTVL+  ++ LT +T FR
Sbjct  89   IIVAMGSSRSNILGEANINLADYSDAQKPSTVALPLHGCNSGTVLHVTVQLLTSKTGFR  147



>emb|CBI19108.3| unnamed protein product [Vitis vinifera]
Length=1038

 Score =   108 bits (270),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 75/119 (63%), Gaps = 6/119 (5%)
 Frame = +1

Query  154  PKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASNGLDH--FK  315
            P GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++      ++  +   D   +K
Sbjct  29   PTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIYETTRLLQDAKTKQYDEKLYK  88

Query  316  FLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
             +V+MGSSR+ ILGEA +N+  Y +++    V+LPL  CN GTVL+  ++ LT +T FR
Sbjct  89   IIVAMGSSRSNILGEANINLADYSDAQKPSTVALPLHGCNSGTVLHVTVQLLTSKTGFR  147



>ref|XP_006434057.1| hypothetical protein CICLE_v100033011mg, partial [Citrus clementina]
 gb|ESR47297.1| hypothetical protein CICLE_v100033011mg, partial [Citrus clementina]
Length=708

 Score =   107 bits (268),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 97/174 (56%), Gaps = 23/174 (13%)
 Frame = +1

Query  160  GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASNGLDH--FKFL  321
            GWDKL +S I  ++GK I K  KA+V NGTC+W + ++      ++  +   D   +KF+
Sbjct  31   GWDKLFISFIPADSGKAIGKTTKANVRNGTCKWADPIYETTRLLQDIKTKQYDEKLYKFV  90

Query  322  VSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDE  501
            V+MGSSR+ ILGEAT+N+  Y ++     VSLPL   + GT+L+  ++ LT +T FR  E
Sbjct  91   VAMGSSRSSILGEATINLADYADASKPSTVSLPLHGGDSGTILHVTVQLLTSKTGFREFE  150

Query  502  VN------STAAYNEE--ENSVCNGIDN---------KSEERNNSLPSMEDSLG  612
                       + N++   +  C GI+N         + ++++  LPS+E+  G
Sbjct  151  QQRELRERGLQSGNDQISPDQSCGGINNQLDKVNARVRFKDKSKELPSLEEEAG  204



>ref|XP_011098011.1| PREDICTED: sporulation-specific protein 15 [Sesamum indicum]
 ref|XP_011098020.1| PREDICTED: sporulation-specific protein 15 [Sesamum indicum]
 ref|XP_011098028.1| PREDICTED: sporulation-specific protein 15 [Sesamum indicum]
Length=1888

 Score =   108 bits (270),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPEN  285
            K   +F     A  +P+ GWDKL +S I  ++GK  +K  KA+V NG C+W + ++    
Sbjct  13   KVKVVFRLQFHATHIPQTGWDKLFISFIPADSGKATAKTTKANVRNGACKWADPIYETTR  72

Query  286  YASNGLDH------FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
               +  +       +K +V+MGSSRA  LGEAT+N+  Y ++     V+LPLQ CN GT+
Sbjct  73   LLQDSKNKQYDEKLYKIVVAMGSSRASTLGEATINLADYVDALKPSAVTLPLQGCNFGTI  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHITVQLLTSKTGFR  147



>emb|CDP01183.1| unnamed protein product [Coffea canephora]
Length=1950

 Score =   108 bits (270),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 81/136 (60%), Gaps = 8/136 (6%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP-  279
            +K   +F     A  +P+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++   
Sbjct  12   NKVKVVFRLQFHATHIPQSGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIYETT  71

Query  280  ---ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGT  444
               ++  S   D   +K +V+MGSSRA ILGEA +N+  Y ++     V+LPL  CN GT
Sbjct  72   RLLQDAKSKQYDEKLYKLVVAMGSSRASILGEAIINLADYADALKPSVVALPLHGCNHGT  131

Query  445  VLNFEIKCLTPRTSFR  492
            +L+  ++ LT +T FR
Sbjct  132  ILHVTVQLLTSKTGFR  147



>ref|XP_007018883.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 5, partial [Theobroma cacao]
 gb|EOY16108.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 5, partial [Theobroma cacao]
Length=1683

 Score =   107 bits (266),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P+ GWDKL +S I  ++GK   K  KA+V NGTC+W + ++    
Sbjct  13   KIKVVFRLQFHATHIPQSGWDKLHISFIPADSGKATLKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K LV+MGSSR+ +LGEAT+N+  Y ++     V+LPL  C+ G +
Sbjct  73   LLQDIKTKQFDEKLYKLLVAMGSSRSSLLGEATINLADYADASKPSIVALPLHSCDSGAI  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_007018882.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 4 [Theobroma cacao]
 gb|EOY16107.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 4 [Theobroma cacao]
Length=1695

 Score =   107 bits (266),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P+ GWDKL +S I  ++GK   K  KA+V NGTC+W + ++    
Sbjct  13   KIKVVFRLQFHATHIPQSGWDKLHISFIPADSGKATLKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K LV+MGSSR+ +LGEAT+N+  Y ++     V+LPL  C+ G +
Sbjct  73   LLQDIKTKQFDEKLYKLLVAMGSSRSSLLGEATINLADYADASKPSIVALPLHSCDSGAI  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_007018879.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007018880.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY16104.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY16105.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 1 [Theobroma cacao]
Length=1909

 Score =   107 bits (266),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P+ GWDKL +S I  ++GK   K  KA+V NGTC+W + ++    
Sbjct  13   KIKVVFRLQFHATHIPQSGWDKLHISFIPADSGKATLKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K LV+MGSSR+ +LGEAT+N+  Y ++     V+LPL  C+ G +
Sbjct  73   LLQDIKTKQFDEKLYKLLVAMGSSRSSLLGEATINLADYADASKPSIVALPLHSCDSGAI  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>gb|KDO80865.1| hypothetical protein CISIN_1g000199mg [Citrus sinensis]
 gb|KDO80866.1| hypothetical protein CISIN_1g000199mg [Citrus sinensis]
 gb|KDO80867.1| hypothetical protein CISIN_1g000199mg [Citrus sinensis]
Length=1872

 Score =   107 bits (266),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 102/190 (54%), Gaps = 27/190 (14%)
 Frame = +1

Query  112  KFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----  279
            +  F  ++IQ      GWDKL +S I  ++GK I K  KA+V NGTC+W + ++      
Sbjct  19   RLQFHATHIQ----QTGWDKLFISFIPADSGKAIGKTTKANVRNGTCKWADPIYETTRLL  74

Query  280  ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLN  453
            ++  +   D   +KF+V+MGSSR+ ILGEAT+N+  Y ++     V LPL   + GT+L+
Sbjct  75   QDIKTKQYDEKLYKFVVAMGSSRSSILGEATINLADYADASKPSTVLLPLHGGDSGTILH  134

Query  454  FEIKCLTPRTSFRGDEVN------STAAYNEE--ENSVCNGIDNKSE---------ERNN  582
              ++ LT +T FR  E           + N++   +  C GI+N+ +         +++ 
Sbjct  135  VTVQLLTSKTGFREFEQQRELRERGLQSGNDQISPDQSCGGINNQLDKVNARVRFKDKSK  194

Query  583  SLPSMEDSLG  612
             LPS+E+  G
Sbjct  195  ELPSLEEEAG  204



>ref|XP_007018881.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 3 [Theobroma cacao]
 gb|EOY16106.1| F-box and Leucine Rich Repeat domains containing protein, putative 
isoform 3 [Theobroma cacao]
Length=1781

 Score =   107 bits (266),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P+ GWDKL +S I  ++GK   K  KA+V NGTC+W + ++    
Sbjct  13   KIKVVFRLQFHATHIPQSGWDKLHISFIPADSGKATLKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K LV+MGSSR+ +LGEAT+N+  Y ++     V+LPL  C+ G +
Sbjct  73   LLQDIKTKQFDEKLYKLLVAMGSSRSSLLGEATINLADYADASKPSIVALPLHSCDSGAI  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>gb|KDO80868.1| hypothetical protein CISIN_1g000199mg [Citrus sinensis]
Length=1852

 Score =   107 bits (266),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 102/190 (54%), Gaps = 27/190 (14%)
 Frame = +1

Query  112  KFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----  279
            +  F  ++IQ      GWDKL +S I  ++GK I K  KA+V NGTC+W + ++      
Sbjct  19   RLQFHATHIQ----QTGWDKLFISFIPADSGKAIGKTTKANVRNGTCKWADPIYETTRLL  74

Query  280  ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLN  453
            ++  +   D   +KF+V+MGSSR+ ILGEAT+N+  Y ++     V LPL   + GT+L+
Sbjct  75   QDIKTKQYDEKLYKFVVAMGSSRSSILGEATINLADYADASKPSTVLLPLHGGDSGTILH  134

Query  454  FEIKCLTPRTSFRGDEVN------STAAYNEE--ENSVCNGIDNKSE---------ERNN  582
              ++ LT +T FR  E           + N++   +  C GI+N+ +         +++ 
Sbjct  135  VTVQLLTSKTGFREFEQQRELRERGLQSGNDQISPDQSCGGINNQLDKVNARVRFKDKSK  194

Query  583  SLPSMEDSLG  612
             LPS+E+  G
Sbjct  195  ELPSLEEEAG  204



>ref|XP_006472661.1| PREDICTED: golgin subfamily B member 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472662.1| PREDICTED: golgin subfamily B member 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472663.1| PREDICTED: golgin subfamily B member 1-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472664.1| PREDICTED: golgin subfamily B member 1-like isoform X4 [Citrus 
sinensis]
 ref|XP_006472665.1| PREDICTED: golgin subfamily B member 1-like isoform X5 [Citrus 
sinensis]
Length=2022

 Score =   107 bits (266),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 102/190 (54%), Gaps = 27/190 (14%)
 Frame = +1

Query  112  KFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----  279
            +  F  ++IQ      GWDKL +S I  ++GK I K  KA+V NGTC+W + ++      
Sbjct  19   RLQFHATHIQ----QTGWDKLFISFIPADSGKAIGKTTKANVRNGTCKWADPIYETTRLL  74

Query  280  ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLN  453
            ++  +   D   +KF+V+MGSSR+ ILGEAT+N+  Y ++     V LPL   + GT+L+
Sbjct  75   QDIKTKQYDEKLYKFVVAMGSSRSSILGEATINLADYADASKPSTVLLPLHGGDSGTILH  134

Query  454  FEIKCLTPRTSFRGDEVN------STAAYNEE--ENSVCNGIDNKSE---------ERNN  582
              ++ LT +T FR  E           + N++   +  C GI+N+ +         +++ 
Sbjct  135  VTVQLLTSKTGFREFEQQRELRERGLQSGNDQISPDQSCGGINNQLDKVNARVRFKDKSK  194

Query  583  SLPSMEDSLG  612
             LPS+E+  G
Sbjct  195  ELPSLEEEAG  204



>ref|XP_007225486.1| hypothetical protein PRUPE_ppa000087mg [Prunus persica]
 gb|EMJ26685.1| hypothetical protein PRUPE_ppa000087mg [Prunus persica]
Length=1863

 Score =   106 bits (264),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 77/124 (62%), Gaps = 7/124 (6%)
 Frame = +1

Query  142  ALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASNGLD  306
            A  VP+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++      ++  +   D
Sbjct  24   ATHVPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWGDPIYETTRLLQDTKTKQYD  83

Query  307  H--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPR  480
               +K +V+MGSSR+ +LGEA +N+  Y ++     V+LPL  C+ GTVL+  ++ LT +
Sbjct  84   EKLYKLVVTMGSSRSSVLGEANINLADYADASKPSSVALPLHGCDSGTVLHVTVQLLTSK  143

Query  481  TSFR  492
            T FR
Sbjct  144  TGFR  147



>ref|XP_008233976.1| PREDICTED: sporulation-specific protein 15 [Prunus mume]
Length=2229

 Score =   106 bits (264),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  VP+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATHVPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWGDPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K +V+MGSSR+ +LGEA +N+  Y ++     V LPL  C+ GTV
Sbjct  73   LLQDTKTKQYDEKLYKLVVTMGSSRSSVLGEANINLADYADASKPSSVGLPLHGCDSGTV  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_009409150.1| PREDICTED: sporulation-specific protein 15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409151.1| PREDICTED: sporulation-specific protein 15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409153.1| PREDICTED: sporulation-specific protein 15-like [Musa acuminata 
subsp. malaccensis]
Length=2019

 Score =   105 bits (262),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 7/134 (5%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP---  279
            K   +F     A  +P+GWDKL VS I ++ GK  +K  KA+V NG C+W + ++     
Sbjct  13   KVKVVFRLQFHATHIPQGWDKLFVSFIPIDTGKATAKTNKANVRNGICKWPDPVYETARL  72

Query  280  -ENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVL  450
             ++  +   D  H+K +V+MGS R   LGE  +N+  + ++     VSLPL  C+ GT+L
Sbjct  73   LQDTRTKNYDEKHYKLVVAMGSPRTSFLGEVNINLADFADALKPSSVSLPLNNCDFGTIL  132

Query  451  NFEIKCLTPRTSFR  492
            +  ++ LT +T FR
Sbjct  133  HVTVQLLTSKTGFR  146



>gb|KHG00623.1| Keratin, type I cytoskeletal 18 [Gossypium arboreum]
Length=1876

 Score =   105 bits (262),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 7/121 (6%)
 Frame = +1

Query  151  VPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASNGLDH--  309
            +P+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++      ++  +   D   
Sbjct  6    IPQSGWDKLYISFIPADSGKATTKTSKANVRNGTCKWADPIYETTRLLQDIKTKQFDEKL  65

Query  310  FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSF  489
            +K +V+MGSSR+G+LGEAT+N+  Y ++     V LPL  C+ G +L+  ++ LT +T F
Sbjct  66   YKLVVAMGSSRSGLLGEATINLADYADASKPSVVPLPLIGCDSGAILHVTVQLLTSKTGF  125

Query  490  R  492
            R
Sbjct  126  R  126



>ref|XP_010261173.1| PREDICTED: golgin subfamily A member 4-like [Nelumbo nucifera]
 ref|XP_010261174.1| PREDICTED: golgin subfamily A member 4-like [Nelumbo nucifera]
 ref|XP_010261175.1| PREDICTED: golgin subfamily A member 4-like [Nelumbo nucifera]
 ref|XP_010261176.1| PREDICTED: golgin subfamily A member 4-like [Nelumbo nucifera]
 ref|XP_010261177.1| PREDICTED: golgin subfamily A member 4-like [Nelumbo nucifera]
Length=2386

 Score =   104 bits (260),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 77/135 (57%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPEN  285
            K   +F     A  VP+ GWDKL +S I  ++ K  +K  KA+V NGTC+W + ++    
Sbjct  13   KIKVVFRLQFHATHVPQTGWDKLFISFIPADSEKVTAKTNKANVRNGTCKWADPIYETTR  72

Query  286  YASNGLDH------FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
               +          +K +V+MGSSR+ +LGEA +N+  Y ++     V+LPLQ C+ GT+
Sbjct  73   LLHDARTKQYDEKLYKLVVAMGSSRSSLLGEAYINLADYADASKPYAVALPLQGCSSGTM  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_010069783.1| PREDICTED: forkhead-associated domain-containing protein 1 isoform 
X2 [Eucalyptus grandis]
 gb|KCW58218.1| hypothetical protein EUGRSUZ_H00921 [Eucalyptus grandis]
Length=2192

 Score =   104 bits (260),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 92/166 (55%), Gaps = 9/166 (5%)
 Frame = +1

Query  136  IQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASNG  300
              A  +P+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++      ++  +  
Sbjct  22   FHATHIPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIYETTRLLQDIRTKQ  81

Query  301  LDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLT  474
             D   +K +V+MGSSR+ +LGEAT+N+  Y ++     V+L L+ C+ G +L+  ++ LT
Sbjct  82   YDEKPYKLVVAMGSSRSSLLGEATINLSDYADALKPSSVALSLRGCDSGAILHVTVQLLT  141

Query  475  PRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNNSLPSMEDSLG  612
             +T FR  E        E      +  + +SE  +  LPS ED +G
Sbjct  142  SKTGFR--EFEQQRELREGGLVTTSDQNGRSESVSGRLPSSEDVVG  185



>ref|XP_008378529.1| PREDICTED: golgin subfamily B member 1 [Malus domestica]
Length=2200

 Score =   104 bits (260),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  VP+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATHVPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWGDPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K +V+MGSSR+ ILGE  +N+  Y ++     V+LPL  C+ GTV
Sbjct  73   LLQDTKTKQYDEKLYKLVVTMGSSRSSILGETNINLADYADASKPSSVALPLLGCDSGTV  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_010069781.1| PREDICTED: forkhead-associated domain-containing protein 1 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010069782.1| PREDICTED: forkhead-associated domain-containing protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW58219.1| hypothetical protein EUGRSUZ_H00921 [Eucalyptus grandis]
Length=2195

 Score =   104 bits (260),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 92/166 (55%), Gaps = 9/166 (5%)
 Frame = +1

Query  136  IQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASNG  300
              A  +P+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++      ++  +  
Sbjct  22   FHATHIPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIYETTRLLQDIRTKQ  81

Query  301  LDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLT  474
             D   +K +V+MGSSR+ +LGEAT+N+  Y ++     V+L L+ C+ G +L+  ++ LT
Sbjct  82   YDEKPYKLVVAMGSSRSSLLGEATINLSDYADALKPSSVALSLRGCDSGAILHVTVQLLT  141

Query  475  PRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNNSLPSMEDSLG  612
             +T FR  E        E      +  + +SE  +  LPS ED +G
Sbjct  142  SKTGFR--EFEQQRELREGGLVTTSDQNGRSESVSGRLPSSEDVVG  185



>ref|XP_010269153.1| PREDICTED: golgin subfamily A member 4-like isoform X2 [Nelumbo 
nucifera]
Length=2209

 Score =   103 bits (257),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATHIPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K +++MGSSR+ +LGEA +N+  + ++     V+LPLQ C+ GTV
Sbjct  73   LLQDAKTKQYDEKMYKLVMAMGSSRSSLLGEAYINLADFADASKPSTVALPLQGCSHGTV  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_010269150.1| PREDICTED: golgin subfamily A member 4-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010269151.1| PREDICTED: golgin subfamily A member 4-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010269152.1| PREDICTED: golgin subfamily A member 4-like isoform X1 [Nelumbo 
nucifera]
Length=2429

 Score =   103 bits (257),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATHIPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K +++MGSSR+ +LGEA +N+  + ++     V+LPLQ C+ GTV
Sbjct  73   LLQDAKTKQYDEKMYKLVMAMGSSRSSLLGEAYINLADFADASKPSTVALPLQGCSHGTV  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_004301940.1| PREDICTED: uncharacterized protein LOC101305084 [Fragaria vesca 
subsp. vesca]
Length=2049

 Score =   103 bits (257),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFNATHIPQSGWDKLFISFIPADSGKATAKTTKANVRNGTCKWGDPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K +V+MGSSR+ +LGE  +N+  Y ++     V+LPL  C+ GT+
Sbjct  73   LLQDTKTKKFDEKLYKLVVTMGSSRSSVLGETNINLADYADASKPSSVALPLHGCDFGTI  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_009345521.1| PREDICTED: early endosome antigen 1 [Pyrus x bretschneideri]
 ref|XP_009345522.1| PREDICTED: early endosome antigen 1 [Pyrus x bretschneideri]
 ref|XP_009345523.1| PREDICTED: early endosome antigen 1 [Pyrus x bretschneideri]
Length=2199

 Score =   103 bits (257),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPE-  282
            K   +F     A  VP+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATHVPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWGDPIYETTR  72

Query  283  ---NYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
               +  +   D   +K +V+MGSSR+ ILGE  +N+  Y ++     V+LPL  C+ GTV
Sbjct  73   LLLDTKTKQYDEKLYKLVVTMGSSRSSILGETNINLADYADASKPSSVALPLLGCDSGTV  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_009380998.1| PREDICTED: nucleoprotein TPR-like [Musa acuminata subsp. malaccensis]
 ref|XP_009380999.1| PREDICTED: nucleoprotein TPR-like [Musa acuminata subsp. malaccensis]
 ref|XP_009381000.1| PREDICTED: nucleoprotein TPR-like [Musa acuminata subsp. malaccensis]
 ref|XP_009381001.1| PREDICTED: nucleoprotein TPR-like [Musa acuminata subsp. malaccensis]
Length=1968

 Score =   103 bits (256),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 77/134 (57%), Gaps = 7/134 (5%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP---  279
            K   +F     A  +P+GWDKL VS I ++ GK  +K  K +V NG C+W + ++     
Sbjct  13   KVKVVFRLQFHATHIPQGWDKLFVSFIPIDTGKATAKTNKVNVRNGNCKWPDPIYETTRL  72

Query  280  -ENYASNGLD--HFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVL  450
             ++  +   D  H+K +V+MGSSR+ +LG+ T+N+  + ++     +SLPL  C+  T L
Sbjct  73   LQDTRTKKYDEKHYKLVVAMGSSRSSLLGDVTINLAGFADALKPSSISLPLANCDFSTTL  132

Query  451  NFEIKCLTPRTSFR  492
            +  ++ LT +T FR
Sbjct  133  HVTVQLLTSKTGFR  146



>dbj|BAJ90692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=276

 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 144/263 (55%), Gaps = 41/263 (16%)
 Frame = +1

Query  3808  SSLKIELLKIAFLRDEVLALKGSLNDMKFKNERLEASLQLICGENEELKADKTSLIQELT  3987
             S LK+++ KI  L+DEV  L+ SL++ KF+  +L+A L+ +  E EELKA K  L  +++
Sbjct  49    SDLKLQVQKITSLQDEVSKLRISLDETKFEKGKLKALLESVTEECEELKAQKAMLTDKVS  108

Query  3988  GMQNSVTELEECRLRKVVLEEKVLRLEGDLTAREVMCAKDAELKNDLTQSKRVNSQLRWK  4167
              MQ ++   EE +  ++ ++ K++RLE DL+A E     +AELKN+L++ +R NS+ + K
Sbjct  109   DMQETLENGEEEKRSRISMQAKLVRLESDLSASEASHVHEAELKNELSRIRRSNSEYQRK  168

Query  4168  IKQLELERYYLSKELQSVQEELNRKENSVPSPSHSVAKDKTTSCKEQKLSKARSSQCNNC  4347
             I+ LE E            ++L RK                     Q++  +   Q    
Sbjct  169   IQSLEQE-----------IDDLTRK---------------------QEIGDSTDIQSK--  194

Query  4348  ETIQIVTIDDCSSRCQVGDDKTQFKSLQPEGQSTRSGNENEQKISQLEAELKEISERYLH  4527
               IQI+      +  +    + Q KS   E QS  +G +   +I QLE +L+++ ER L+
Sbjct  195   --IQILETKLAEALEENKMYRAQQKSPVSEEQS--AGGD---RILQLEGDLRDMKERLLN  247

Query  4528  MSLKYAEVENQKGKLVMTLKALQ  4596
             MSL+YAEVE Q+ +LVM LK+++
Sbjct  248   MSLEYAEVEAQRERLVMELKSVK  270



>ref|XP_002301031.2| hypothetical protein POPTR_0002s09230g [Populus trichocarpa]
 gb|EEE80304.2| hypothetical protein POPTR_0002s09230g [Populus trichocarpa]
Length=1969

 Score =   102 bits (255),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A Q+P+ GWDKL +S I  ++GK   K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATQIPQSGWDKLFISFIPADSGKATGKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K ++SMGSSR+ +LGEAT+N+  Y ++     V+LPL   + GT 
Sbjct  73   LLQDVKTKQYDEKLYKLVISMGSSRSSVLGEATINLADYADALKPSVVALPLHGSDSGTS  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_002301032.2| hypothetical protein POPTR_0002s09230g [Populus trichocarpa]
 gb|EEE80305.2| hypothetical protein POPTR_0002s09230g [Populus trichocarpa]
Length=2124

 Score =   102 bits (255),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A Q+P+ GWDKL +S I  ++GK   K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATQIPQSGWDKLFISFIPADSGKATGKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K ++SMGSSR+ +LGEAT+N+  Y ++     V+LPL   + GT 
Sbjct  73   LLQDVKTKQYDEKLYKLVISMGSSRSSVLGEATINLADYADALKPSVVALPLHGSDSGTS  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_010105863.1| hypothetical protein L484_021518 [Morus notabilis]
 gb|EXC06682.1| hypothetical protein L484_021518 [Morus notabilis]
Length=1998

 Score =   102 bits (255),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  +P+ GWDKL +S I  ++GK  +K  KA+V +G C+W + ++    
Sbjct  13   KVKVVFRLQFHATHIPQPGWDKLFISFIPADSGKATAKTTKANVRSGACKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K +V+MGSSR+ +LGEA +N+ HY ++     V+LPLQ C+ G  
Sbjct  73   LLQDIKTKQYDEKFYKLVVAMGSSRSSVLGEAIINLAHYADALKPSVVALPLQGCDSGAT  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_006386392.1| hypothetical protein POPTR_0002s09230g [Populus trichocarpa]
 gb|ERP64189.1| hypothetical protein POPTR_0002s09230g [Populus trichocarpa]
Length=2078

 Score =   102 bits (255),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A Q+P+ GWDKL +S I  ++GK   K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATQIPQSGWDKLFISFIPADSGKATGKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K ++SMGSSR+ +LGEAT+N+  Y ++     V+LPL   + GT 
Sbjct  73   LLQDVKTKQYDEKLYKLVISMGSSRSSVLGEATINLADYADALKPSVVALPLHGSDSGTS  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_006386393.1| hypothetical protein POPTR_0002s09230g [Populus trichocarpa]
 gb|ERP64190.1| hypothetical protein POPTR_0002s09230g [Populus trichocarpa]
Length=2055

 Score =   102 bits (255),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 79/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A Q+P+ GWDKL +S I  ++GK   K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATQIPQSGWDKLFISFIPADSGKATGKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K ++SMGSSR+ +LGEAT+N+  Y ++     V+LPL   + GT 
Sbjct  73   LLQDVKTKQYDEKLYKLVISMGSSRSSVLGEATINLADYADALKPSVVALPLHGSDSGTS  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_011027665.1| PREDICTED: LOW QUALITY PROTEIN: sporulation-specific protein 
15-like [Populus euphratica]
Length=2136

 Score =   102 bits (254),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 80/135 (59%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A Q+P+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATQIPQSGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K ++SMGSSR+ +LGEAT+N+  Y ++     V+LPL   + GT 
Sbjct  73   LLQDVKTKQYDEKLYKLVISMGSSRSSVLGEATINLADYADALKPSVVALPLHGSDSGTS  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_002985017.1| hypothetical protein SELMODRAFT_446143 [Selaginella moellendorffii]
 gb|EFJ13892.1| hypothetical protein SELMODRAFT_446143 [Selaginella moellendorffii]
Length=1827

 Score =   102 bits (254),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 74/123 (60%), Gaps = 6/123 (5%)
 Frame = +1

Query  133  NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYASNGLDH-  309
            +  A Q+   WDKL+VSL+S+++GK   K  KASV NG C W +++        +   H 
Sbjct  95   HFHATQIHTAWDKLAVSLVSLDSGKVTGKTRKASVRNGQCHWPDAVLETAKLILDMKTHM  154

Query  310  -----FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLT  474
                 +KF+V+ G SR+ +LGE  +N+  Y  + +   V+LPL+ C  GT+L+ +I+CLT
Sbjct  155  YDEKLYKFVVAKGFSRSCVLGEVIINITEYVTAASPTSVTLPLRFCYAGTLLHIKIQCLT  214

Query  475  PRT  483
            P++
Sbjct  215  PKS  217



>emb|CDY04701.1| BnaC05g17390D [Brassica napus]
Length=258

 Score = 97.4 bits (241),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 7/127 (6%)
 Frame = +1

Query  133  NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP----ENYASN  297
               A  VP+ GWDKL +S I  ++ K  +K  KA V NGTC+W + ++      ++  + 
Sbjct  21   QFHATHVPQAGWDKLFISFIPADSLKATAKTTKALVRNGTCKWGDPIYETTRLLQDTRTK  80

Query  298  GLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCL  471
              D   +K +V+MG+SR+ ILGEA +N+  Y ++     V+LPLQ C+ G +L+  ++ L
Sbjct  81   QFDEKLYKIVVAMGTSRSSILGEAMINLAEYADALKPFAVALPLQGCDSGAILHVTVQLL  140

Query  472  TPRTSFR  492
            T +T FR
Sbjct  141  TSKTGFR  147



>ref|XP_002986207.1| hypothetical protein SELMODRAFT_425230, partial [Selaginella 
moellendorffii]
 gb|EFJ12738.1| hypothetical protein SELMODRAFT_425230, partial [Selaginella 
moellendorffii]
Length=258

 Score = 97.1 bits (240),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 74/123 (60%), Gaps = 6/123 (5%)
 Frame = +1

Query  133  NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYASNGLDH-  309
            +  A Q+   WDKL+VSL+S+++GK   K  KASV NG C W +++        +   H 
Sbjct  95   HFHATQIHTAWDKLAVSLVSLDSGKVTGKTRKASVRNGQCHWPDAVLETAKLILDMKTHM  154

Query  310  -----FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLT  474
                 +KF+V+ G SR+ +LGE  +N+  Y  + +   V+LPL+ C  GT+L+ +I+CLT
Sbjct  155  YDEKLYKFVVAKGFSRSCVLGEVIINITEYVTAASPTSVTLPLRFCYAGTLLHIKIQCLT  214

Query  475  PRT  483
            P++
Sbjct  215  PKS  217



>ref|XP_002307400.2| hypothetical protein POPTR_0005s164502g, partial [Populus trichocarpa]
 gb|EEE94396.2| hypothetical protein POPTR_0005s164502g, partial [Populus trichocarpa]
Length=825

 Score =   100 bits (249),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 79/139 (57%), Gaps = 8/139 (6%)
 Frame = +1

Query  100  NSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLW  273
            N   K   +F     A  +P  GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++
Sbjct  9    NEKTKVKVVFRLQFHATHIPHPGWDKLFISFIPADSGKATAKTTKANVRNGTCKWADPIY  68

Query  274  SP----ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCN  435
                  ++  +   D   +K ++SMGSSR+ +LGEAT+N+  Y ++     V+LPL   +
Sbjct  69   ETTRLLQDVKTKRYDEKLYKLVISMGSSRSSVLGEATINLADYADALKPSVVALPLHGSD  128

Query  436  KGTVLNFEIKCLTPRTSFR  492
             GT L+  ++ LT +T FR
Sbjct  129  SGTALHVTVQLLTSKTGFR  147



>ref|XP_008338795.1| PREDICTED: early endosome antigen 1-like [Malus domestica]
 ref|XP_008338796.1| PREDICTED: early endosome antigen 1-like [Malus domestica]
Length=2201

 Score =   100 bits (248),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 78/135 (58%), Gaps = 8/135 (6%)
 Frame = +1

Query  112  KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSP--  279
            K   +F     A  VP+ GWDKL +S I  ++GK  +K  KA+V NGTC+W + ++    
Sbjct  13   KVKVVFRLQFHATNVPQTGWDKLFISFIPADSGKATAKTTKANVRNGTCKWGDPIYETTR  72

Query  280  --ENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
              ++  +   D   +K +V+MGSSR+ ILGE  +N+  Y ++     V+L L  C+ GTV
Sbjct  73   LLQDTKTKQYDEKLYKLVVTMGSSRSSILGETNINLADYADASKPSSVALLLLGCDSGTV  132

Query  448  LNFEIKCLTPRTSFR  492
            L+  ++ LT +T FR
Sbjct  133  LHVTVQLLTSKTGFR  147



>ref|XP_004511587.1| PREDICTED: myosin-11-like [Cicer arietinum]
Length=1051

 Score = 94.7 bits (234),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 103/424 (24%), Positives = 185/424 (44%), Gaps = 59/424 (14%)
 Frame = +1

Query  115   FGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYAS  294
             F   F+  Q LQ   G D L +S++  + G+   +L KA+V +G C+W   ++    +  
Sbjct  18    FKLHFNATQVLQ--SGVDALVLSIVPGDIGRPTKRLEKATVQDGNCRWENPVYETVKFIQ  75

Query  295   NGLDH------FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNF  456
             +          + FL+S G S+A  +GE ++N   Y ++     VSLP++  +   VL+ 
Sbjct  76    DPKTGKISDKIYNFLLSTGLSKASYIGEVSINFSDYVDATKPSHVSLPIRTSHCDAVLHI  135

Query  457   EIKCLTPRTSFR-----------------------GDEVNSTAAYNEEENSVCNGIDNKS  567
              I+ L   +  R                       GD   ST +Y  E+ S    I+  S
Sbjct  136   SIQKLQENSDQREEEECEVAKLKLDDRSLRNQLSNGDTDESTKSYFSEDVSTKAIINRTS  195

Query  568   EERNNSLPSMEDSLGRDSLssasnssavvnnaIRRLESTESGGSAPWssysygspksnns  747
                + +L S +DS G ++          +     +        + P  + S      +  
Sbjct  196   SGSDITLSSSDDSSGVETPREIGLRKTNIKLTTNQFIPAMHHAAEPAVNDSTSVHDLHPR  255

Query  748   pnklsisCQE--------KHPEYTEEEIGQCSLHITRTSIPDANIEELKAEARMWELNAR  903
                   S  E        K+P +        S+  ++       IE LKAE       AR
Sbjct  256   SQWELSSSSEIGLSTGDSKNPSH-----NALSMERSQQEASHLEIERLKAELAAL---AR  307

Query  904   RLMV---KMETLRKEFANQSQRIADMEMELSTAHTESNRLM---HDIKRLEVLLEESNAK  1065
             ++ V   +++TLRK+   +S+R  D+  E+     E + L    ++I+     ++++  +
Sbjct  308   QMNVSDIELQTLRKQIVKESKRGQDLTKEIIILKDERDALKIECNNIRLFHKRMDDAKVR  367

Query  1066  QIAA-ENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEET  1242
               +  EN +L A      ++E+  EL ++ ++N+NL LQL+K QESNAELV  +Q++EE 
Sbjct  368   NRSQLENGDLHA-----FVEEIRQELNYEKDTNANLRLQLKKMQESNAELVLAVQDLEEM  422

Query  1243  VQKK  1254
             +++K
Sbjct  423   LEQK  426



>gb|EYU29739.1| hypothetical protein MIMGU_mgv1a000817mg [Erythranthe guttata]
Length=975

 Score = 92.8 bits (229),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 98/401 (24%), Positives = 183/401 (46%), Gaps = 29/401 (7%)
 Frame = +1

Query  115   FGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYAS  294
             F   F   + LQ+  G D L +S++  + GK   K  KASV +G+C W   ++    ++ 
Sbjct  18    FKLQFHAAKVLQI--GEDALMISVVPSDIGKPTVKSDKASVRDGSCFWENPVYETVKFSR  75

Query  295   N---GLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNF  456
             +   G  H   + F+V  G S+AG++GEA+++  +Y  S     VSLP +      +L+ 
Sbjct  76    DPKSGKIHERIYHFVVGTGLSKAGVIGEASIDFSNYAESNKVSLVSLPFKTSKTEAILHV  135

Query  457   EIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKS-----EERNNSLPSMEDSLGRDS  621
              I+ +      R  E    A  N +++S+   +DN       +  ++ LPS +       
Sbjct  136   SIQRMNESIDNREVEETENAKSNYKDHSLKAQLDNGDLDGTIKSNSDELPSNKTVAHIAE  195

Query  622   LssasnssavvnnaIRRLESTESGGSAPWssysygspksnnspnklsisCQEKHPEYTEE  801
             L+    +S+  +  +   +S+  G   PW         +    +K        H E + +
Sbjct  196   LNGNRRASSGSDLTMSSSDSS-CGIEIPWQPQMKNEITNQRLRSKSDAQTPLVHWESSTD  254

Query  802   E--IGQCSLHITRTSIPDAN----IEELKAEARMWELNARRLMVKMETLRKEFANQSQRI  963
             +  I        R  + D +    I++LK++       A    ++++TLRK+   +S+R 
Sbjct  255   DSSITPRGEAFFRQELEDQSSDIVIDKLKSDISALSRQAEMSELELQTLRKQIVKESKRG  314

Query  964   ADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELK  1143
              D+  EL     E + L  + ++L         +     NL  +  +++ I++E+  EL 
Sbjct  315   QDLFKELVCLKEERDSLKGECEKL---------RSKTKTNLPYEGGDSKTIVEELRQELN  365

Query  1144  FQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEI  1266
                E NSNL +QL  SQESN EL+  +++++E +++K  E+
Sbjct  366   HAKELNSNLQIQLEFSQESNNELILAVRDLDELLEQKNREL  406



>ref|XP_002990755.1| hypothetical protein SELMODRAFT_429130 [Selaginella moellendorffii]
 gb|EFJ08204.1| hypothetical protein SELMODRAFT_429130 [Selaginella moellendorffii]
Length=1508

 Score = 92.4 bits (228),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 74/127 (58%), Gaps = 12/127 (9%)
 Frame = +1

Query  115  FGFIFSNIQALQVP-KGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYA  291
            F F+F    A +VP  GW+KL VSL S+E GKT +K  K+   +G C+W +++       
Sbjct  19   FKFVF---HATRVPHSGWEKLYVSLESIETGKTTAKTAKSVAQSGACRWPDAIIESTRLV  75

Query  292  ----SNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLN  453
                +N  +   +KF++ M  +R  +LGE T+N+  Y +  ++   + PL+ C+ GTVL+
Sbjct  76   HETRTNSYEAKLYKFVIGMSPTR--VLGEITLNLADYVSVTSAASYAFPLKSCSTGTVLH  133

Query  454  FEIKCLT  474
             +++CLT
Sbjct  134  IKLQCLT  140



>ref|XP_009340017.1| PREDICTED: early endosome antigen 1-like [Pyrus x bretschneideri]
Length=904

 Score = 91.7 bits (226),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 113/430 (26%), Positives = 198/430 (46%), Gaps = 58/430 (13%)
 Frame = +1

Query  112   KFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWT----ESLW  273
             K   +F    QA QVPK     L +SL+  + GK   KLGKA+V +GTC W     ES+ 
Sbjct  10    KIRAVFQLQFQATQVPKLKKPALMLSLVPDDVGKPTVKLGKAAVQDGTCIWENPVFESMK  69

Query  274   SPENYASNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
               E   +  L    + F+VS GSS++G LGEA+++          + V+LPL+  N G V
Sbjct  70    LIEEAKTGKLKEKIYHFIVSNGSSKSGYLGEASIDFADIVAETEPLTVTLPLKFANSGVV  129

Query  448   LNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNNSLPSMEDSLGRDSLs  627
             L+  I     R    GD+        E E S     D  S  R++S+ +   S   D   
Sbjct  130   LHVTIH----RIQEDGDQ-------REIEES-----DGPSLSRHSSVGNQNGSWDADG--  171

Query  628   sasnssavvnnaIRRLESTESGG----------SAPWssysygspksnnspnklsisCQE  777
                            L S E+GG          S P    S        +  + +   Q+
Sbjct  172   ------------SNHLRSNENGGYVQRDAASSLSPPEVQNSMPHNGQGGANVRKTHMHQK  219

Query  778   KHPEYTEEEIGQCSLHITRTSIPD------ANIEELKAEARMWELNARRLMVKMETLRKE  939
                +++ +E    SL I    +P       +++++L+ E  + +  A    +++++LRK+
Sbjct  220   SSLDWSSDESLFDSLDIVEDKLPAERVQAVSDVDKLRNEITVLKRQANLSELELQSLRKQ  279

Query  940   FANQSQRIADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENIL  1119
              A +S +  ++  ++ +   E + L    ++L+     SN KQ   + L  + ++T   L
Sbjct  280   MAKESNQGQNLSKQIVSLKEERDALKMVCEQLKSSQGRSNGKQ-TFKKLQPETEDTRAQL  338

Query  1120  KEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENL---LALNS  1290
             + M+ EL  + ++ ++L  QL ++Q+SN+ELV V++++++ + KK  EI +L   L    
Sbjct  339   EAMKQELSSEKKARTHLRSQLAQTQDSNSELVLVVKDLKDELGKKNREISDLSSQLEAEK  398

Query  1291  RSDVMGVINS  1320
              S +MG  ++
Sbjct  399   NSKMMGTYSA  408



>ref|XP_002986658.1| hypothetical protein SELMODRAFT_425588 [Selaginella moellendorffii]
 gb|EFJ12221.1| hypothetical protein SELMODRAFT_425588 [Selaginella moellendorffii]
Length=1508

 Score = 91.7 bits (226),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 74/127 (58%), Gaps = 12/127 (9%)
 Frame = +1

Query  115  FGFIFSNIQALQVP-KGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYA  291
            F F+F    A +VP  GW+KL VSL S+E GKT +K  K+   +G C+W +++       
Sbjct  19   FKFVF---HATRVPHSGWEKLYVSLESIETGKTTAKTAKSVAQSGACRWPDAIIESTRLV  75

Query  292  ----SNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLN  453
                +N  +   +KF++ M  +R  +LGE T+N+  Y +  ++   + PL+ C+ GTVL+
Sbjct  76   HETRTNSYEAKLYKFVLGMSPTR--VLGEITLNLADYVSVTSAASYAFPLKSCSTGTVLH  133

Query  454  FEIKCLT  474
             +++CLT
Sbjct  134  IKLQCLT  140



>ref|XP_008452021.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X2 [Cucumis melo]
Length=1078

 Score = 89.0 bits (219),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 118/451 (26%), Positives = 200/451 (44%), Gaps = 64/451 (14%)
 Frame = +1

Query  61    MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
             MFK  R +S  +    + F   F   Q  +   G D L +S+I  + GK   +L KA+V 
Sbjct  1     MFKSARWRSEKNRIKAE-FKLQFCATQVSEF--GGDSLIISVIPGDVGKPTVRLEKATVR  57

Query  241   NGTCQWTESLWSPENYASNGLDH---------FKFLVSMGSSRAGILGEATVNVGHYRNS  393
              G C+W    +    +    +D          + F VS    +AG++GE +++   Y  +
Sbjct  58    GGKCRWENPAYVTVKF---DVDQKTGKFTEKIYHFRVSTALIKAGLVGEVSIDFAKYAEA  114

Query  394   EASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRG-DEVN---------STAAY--NEEEN  537
                   SLPLQ  N   VL+  I+ +      R  DE +         S + Y  NE+ N
Sbjct  115   TKPFSASLPLQNSN-SAVLHIWIQRIQEHADQRDVDEYDGLKSRSQDESLSGYLNNEDVN  173

Query  538   SVC---NGIDNKSEERNN--------------SLPSMEDSLGRDSLssasnssavvnnaI  666
                   NG+ +++ ERN               +L S E S G DS          + N I
Sbjct  174   KNSQSENGLSDEA-ERNGEINGEHRTSSGSDITLSSYESSSGLDS---------PIENGI  223

Query  667   R-RLESTESGGSAPWssysygspksnnspnkl---sisCQEKHPEYTEEEIGQCSLHITR  834
             R  +    +G  +P +             N       S Q  H   T++  G   L + R
Sbjct  224   RNNIHQQPNGYLSPLNHSPVSHKSPARDENLTFPWKWSMQSDHVATTDDS-GVNGLVLGR  282

Query  835   TSIPDANI--EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESN  1008
              S  +A+I  EELK E  +    A    ++++TLRK+   +++R  D+  E+S    E +
Sbjct  283   -SKKEADIEIEELKTELSVLTRRADMSDMELQTLRKQIVKENKRSQDLMGEISILKAERD  341

Query  1009  RLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRK  1188
                 + ++L+   +  + +++  ++      +   +L+EM  EL ++ + N+NL LQL+K
Sbjct  342   EWRAECEKLKGFQKHMDVEKVKNKS-QFDGGDLRALLEEMRQELNYEKDLNANLRLQLQK  400

Query  1189  SQESNAELVSVLQEMEETVQKKKIEIENLLA  1281
             +QESN EL+  +Q++EE +++K  EI +L A
Sbjct  401   TQESNTELILAVQDLEEMLEQKNCEISDLYA  431



>ref|XP_004298729.1| PREDICTED: uncharacterized protein LOC101310796 [Fragaria vesca 
subsp. vesca]
Length=1028

 Score = 84.0 bits (206),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 86/175 (49%), Gaps = 15/175 (9%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QVPK G + L VS+I V+ GK   KL KA 
Sbjct  1    MFKSARWRSDK-----NKIKTVFKLQFHATQVPKLGVEALMVSVIPVDVGKPTVKLDKAV  55

Query  235  VNNGTCQWTESL-----WSPENYASNGLDH-FKFLVSMGSSRAGILGEATVNVGHYRNSE  396
            V +G+C+W  S+     + PE       +  + F++S GSS+A +LGE +V+   Y  + 
Sbjct  56   VRDGSCRWENSVLETVKFDPEPRTGKIKERLYNFVLSTGSSKASVLGEVSVDFAEYSEAT  115

Query  397  ASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDN  561
             +  VSLPL+  N   VL+  I+ L      R  E    A    ++NS+   + N
Sbjct  116  KATSVSLPLK--NSSAVLHVSIQKLQANADQREVEGCEDAKVKSQDNSLKRHLSN  168



>ref|XP_007210414.1| hypothetical protein PRUPE_ppa000546mg [Prunus persica]
 gb|EMJ11613.1| hypothetical protein PRUPE_ppa000546mg [Prunus persica]
Length=1103

 Score = 83.2 bits (204),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 86/182 (47%), Gaps = 27/182 (15%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QVPK G D L+VS+I  + GK   KL KA+
Sbjct  1    MFKSARWRSDK-----NKIKAVFKLQFHATQVPKLGVDTLTVSVIPGDVGKATVKLEKAT  55

Query  235  VNNGTCQWTESLWSPENYASNGLDH-------------FKFLVSMGSSRAGILGEATVNV  375
            V +G+C+W       EN A   +               + F+VS GSS+A +LG+ +V+ 
Sbjct  56   VRDGSCRW-------ENPAHETVKFVHEPKTGKIKECLYNFVVSTGSSKASVLGDVSVDF  108

Query  376  GHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGI  555
              Y  +  +  VSLPL+  N   VL+  I+ L      R +E    A    ++ S+ N +
Sbjct  109  ADYAEATKTSCVSLPLKNSNSNAVLHVTIQRLQENVDQREEEGCEDATVKSQDRSLKNHL  168

Query  556  DN  561
             N
Sbjct  169  SN  170


 Score = 56.6 bits (135),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 81/150 (54%), Gaps = 0/150 (0%)
 Frame = +1

Query  826   ITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTES  1005
             + R    D  IE+LKAE  +    A    ++++TLRK+   +S+R  D+  E+ +   E 
Sbjct  292   LPRERPSDDEIEKLKAELVVLARQADMSELELQTLRKQIVKESKRGQDLSKEVISLKEER  351

Query  1006  NRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLR  1185
             +    + ++L+   ++            L+  +   ++ E+  EL ++ +   NL LQL+
Sbjct  352   DAFKAECEKLKAFQKKRMDDAQIKNRFQLEGGDLRALVDEIRQELSYEKDLTFNLRLQLQ  411

Query  1186  KSQESNAELVSVLQEMEETVQKKKIEIENL  1275
             K+QESN+EL+  ++++EE +++K  EI ++
Sbjct  412   KTQESNSELILAVRDLEEILEQKNSEIADI  441



>ref|XP_008238875.1| PREDICTED: myosin-11 [Prunus mume]
Length=1097

 Score = 79.7 bits (195),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 74/152 (49%), Gaps = 27/152 (18%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QVPK G D L+VS+I  + GK   KL KA+
Sbjct  1    MFKSARWRSDK-----NKIKAVFKLQFHATQVPKLGVDTLTVSVIPGDVGKATVKLEKAT  55

Query  235  VNNGTCQWTESLWSPENYASNGLDH-------------FKFLVSMGSSRAGILGEATVNV  375
            V +G+C+W       EN A   +               + F+VS GSS+  +LGE +V+ 
Sbjct  56   VRDGSCRW-------ENPAHETVKFLREPKTGKIKECLYNFVVSTGSSKTSVLGEVSVDF  108

Query  376  GHYRNSEASIPVSLPLQKCNKGTVLNFEIKCL  471
              Y  +  +  VSLPL+  N   VL+  I+ L
Sbjct  109  ADYAEATKTSCVSLPLKNSNSNAVLHVTIQRL  140


 Score = 55.8 bits (133),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 81/150 (54%), Gaps = 0/150 (0%)
 Frame = +1

Query  826   ITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTES  1005
             + R    D  IE+LKAE  +    A    ++++TLRK+   +S+R  D+  E+ +   E 
Sbjct  286   LPRERPSDDEIEKLKAELLVLARQADMSELELQTLRKQIVKESKRGQDLSKEVISLKEER  345

Query  1006  NRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLR  1185
             +    + ++L+   ++            L+  +   ++ E+  EL ++ +   NL LQL+
Sbjct  346   DAFKAECEKLKAFQKKRIDDAQIKNRFQLEGGDLRALVDEIRQELSYEKDLTFNLRLQLQ  405

Query  1186  KSQESNAELVSVLQEMEETVQKKKIEIENL  1275
             K+QESN+EL+  ++++EE +++K  EI ++
Sbjct  406   KTQESNSELILAVRDLEEILEQKNSEIADI  435



>ref|XP_011015471.1| PREDICTED: LOW QUALITY PROTEIN: myosin heavy chain, striated 
muscle-like [Populus euphratica]
Length=1034

 Score = 79.7 bits (195),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 80/155 (52%), Gaps = 10/155 (6%)
 Frame = +1

Query  136  IQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPE---NYASNGL  303
             QA QVP+     L +SL+  + GKT  KL KA+V +G C W   ++          +G 
Sbjct  20   FQATQVPRQKKPALIISLVPEDVGKTTFKLEKAAVQDGICSWDNPVYVTVILIKEPKSGK  79

Query  304  DH---FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCLT  474
             H   + F+VS GSS++G LGEA+++   + +    + VSLPL+  N G VL+  I+ + 
Sbjct  80   LHEKIYHFIVSSGSSKSGYLGEASIDFADFADETEPLSVSLPLKFANSGAVLHVTIQKMH  139

Query  475  PRTSFRGDEVNSTAAYNEE---ENSVCNGIDNKSE  570
                 R  E N     +++   +N + NG  +K++
Sbjct  140  GDFDPRKIEDNEDPILSKDRNLKNQLSNGYTDKND  174



>gb|KDO60006.1| hypothetical protein CISIN_1g002248mg [Citrus sinensis]
 gb|KDO60007.1| hypothetical protein CISIN_1g002248mg [Citrus sinensis]
Length=947

 Score = 76.6 bits (187),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 79/163 (48%), Gaps = 16/163 (10%)
 Frame = +1

Query  100  NSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLW  273
            N  +K   +F    Q  QVPK     + +SL+  + GK   KL K  V NGTC W   ++
Sbjct  7    NDKNKIKAVFKLQFQCNQVPKLKKSAVMISLVPDDVGKPTFKLEKVPVQNGTCLWENPIY  66

Query  274  -------SPEN-YASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQK  429
                    P+  Y    + HF  +VS GSS++G LGEA+++   +      + +SLPL+ 
Sbjct  67   VTVKLIREPKTGYIKEKIYHF--IVSTGSSKSGFLGEASIDFADFAAETEPLTLSLPLKF  124

Query  430  CNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGID  558
             N G VL+  I+ +   T  R  E N     ++++ S CN  D
Sbjct  125  ANSGAVLHVTIEKMDGATDQRYIEENE----DKDQQSNCNTQD  163



>ref|XP_006490380.1| PREDICTED: myosin-2 heavy chain-like isoform X1 [Citrus sinensis]
 ref|XP_006490381.1| PREDICTED: myosin-2 heavy chain-like isoform X2 [Citrus sinensis]
Length=947

 Score = 76.6 bits (187),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 79/163 (48%), Gaps = 16/163 (10%)
 Frame = +1

Query  100  NSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLW  273
            N  +K   +F    Q  QVPK     + +SL+  + GK   KL K  V NGTC W   ++
Sbjct  7    NDKNKIKAVFKLQFQCNQVPKLKKSAVMISLVPDDVGKPTFKLEKVPVQNGTCLWENPIY  66

Query  274  -------SPEN-YASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQK  429
                    P+  Y    + HF  +VS GSS++G LGEA+++   +      + +SLPL+ 
Sbjct  67   VTVKLIREPKTGYIKEKIYHF--IVSTGSSKSGFLGEASIDFADFAAETEPLTLSLPLKF  124

Query  430  CNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGID  558
             N G VL+  I+ +   T  R  E N     ++++ S CN  D
Sbjct  125  ANSGAVLHVTIEKMDGATDQRYIEENE----DKDQQSNCNTQD  163



>ref|XP_006421913.1| hypothetical protein CICLE_v10004257mg [Citrus clementina]
 gb|ESR35153.1| hypothetical protein CICLE_v10004257mg [Citrus clementina]
Length=947

 Score = 76.3 bits (186),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 79/163 (48%), Gaps = 16/163 (10%)
 Frame = +1

Query  100  NSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLW  273
            N  +K   +F    Q  QVPK     + +SL+  + GK   KL K  V NGTC W   ++
Sbjct  7    NDKNKIKAVFKLQFQCNQVPKLKKSAVMISLVPDDVGKPTFKLEKVPVQNGTCLWENPIY  66

Query  274  -------SPEN-YASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQK  429
                    P+  Y    + HF  +VS GSS++G LGEA+++   +      + +SLPL+ 
Sbjct  67   VTVKLIREPKTGYIKEKIYHF--IVSTGSSKSGFLGEASIDFADFAAETEPLTLSLPLKF  124

Query  430  CNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGID  558
             N G VL+  I+ +   T  R  E N     ++++ S CN  D
Sbjct  125  ANSGAVLHVTIEKMDGATDQRYIEENE----DKDQQSNCNTQD  163



>gb|KHG28965.1| Sarcolemmal membrane-associated [Gossypium arboreum]
Length=565

 Score = 75.1 bits (183),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 88/267 (33%), Positives = 149/267 (56%), Gaps = 16/267 (6%)
 Frame = +1

Query  2509  SKMLEV---KTGCLEEDVGLKALNHCRRDLANKIYDHQMVAWMVEKDMEKVQTEKDDITS  2679
             +K++E+   K+  L +D  LKAL + +++L   I   +     +E++ME ++ E   +T+
Sbjct  148   AKLIEIEKLKSDNLAKDNELKALRNRQKELEAHICSVEKQKSQLEENMEIMRREVV-VTA  206

Query  2680  ---DSMREEMMVVTGRIFGNIS-EKIQEMKILELENEKQELESCVFELEKENMQLSERVS  2847
                D +R EMM +   +   +S  KI   K  ELE  K+ +E  + +LE+EN+ LSE + 
Sbjct  207   KFLDDLRSEMMELNSNMDSRMSANKILVKKPSELEEGKKGMEVYLSQLEEENLLLSEGLC  266

Query  2848  GLEAQLRHFTDAMELSRMELQHKGTQLCNLQDEI-RELEKDKESQELELKQRLMEMQKRW  3024
              LE +L +  D  E   +ELQ       N +DEI R LE + E +   + Q++ EMQ++W
Sbjct  267   CLEEKLMYPNDGREYCHVELQIPEFDATNFKDEIIRRLEDEMEVRTFVMIQKVEEMQRQW  326

Query  3025  LDSQEESEYLKKANPKLQATAESLIEECDSLQILNGELRRQRLELKVQCNLLEAELRKYQ  3204
                QEE E LK  N        +LIEEC  LQ  N +LR+Q++EL V+C +LE E ++  
Sbjct  327   SVVQEECECLKIENL-------TLIEECSMLQKANEDLRKQKMELNVRCTVLEVESKESA  379

Query  3205  HSLSSCLSRIESLEAKLSSILEETSSK  3285
             +  S+  +++++L+ +   + EE S++
Sbjct  380   NGCSNMPNKVDNLQRENQLLEEEISAQ  406



>ref|XP_010660906.1| PREDICTED: myosin-9 isoform X1 [Vitis vinifera]
Length=1109

 Score = 75.5 bits (184),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 17/145 (12%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S  S     K   +F    +A QVP+ G + L +S++  + GK   KL KA 
Sbjct  1    MFKSARWRSEKS-----KIKAVFKLQFRATQVPQLGVEALFLSVVPADVGKPTVKLEKAW  55

Query  235  VNNGTCQWTESLWSPENYASNGLDH------FKFLVSMGSSRAGILGEATVNVGHYRNSE  396
            +  G+  W  +++    +  +          + F+VS GSS+AG++GE +++   Y  +E
Sbjct  56   LEGGSYYWENAVYETVKFVQDPKSGKINDRIYHFIVSKGSSKAGLVGEVSIDFADY--AE  113

Query  397  ASIP--VSLPLQKCNKGTVLNFEIK  465
            A+ P  VSLPL+  N G VL+  I+
Sbjct  114  ATKPSSVSLPLKNSNSGAVLHVSIQ  138


 Score = 65.5 bits (158),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 82/144 (57%), Gaps = 1/144 (1%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
             PD  IE+LK +  +    A    ++++TLRK+   + +R  D+  E+     E + L  +
Sbjct  301   PDVAIEKLKTDFLVLARQAEMAELELQTLRKQIVKERKRGQDLSKEVGGLKEERDALKAE  360

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
              + L    + ++  +I    L  +  +   +L+E+  EL ++ + N+NL LQL+K+QESN
Sbjct  361   CENLRSFQKRTDQAKIK-NKLQFEGGDPRALLEELRQELSYEKDLNANLRLQLQKTQESN  419

Query  1204  AELVSVLQEMEETVQKKKIEIENL  1275
              EL+  +++++E +++K +EI NL
Sbjct  420   TELILAVRDLDEMLEQKNLEISNL  443



>ref|XP_004143922.1| PREDICTED: uncharacterized protein LOC101222480 [Cucumis sativus]
 gb|KGN50119.1| hypothetical protein Csa_5G154810 [Cucumis sativus]
Length=1070

 Score = 73.9 bits (180),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 76/151 (50%), Gaps = 11/151 (7%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGD-KFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S  +    + K  F  + +    V    D L++S++  + GK  ++L K +V
Sbjct  1    MFKSARWRSEKNKVKAEFKLQFYVTKVSQSVV----DALTLSVVPGDVGKPTARLDKVTV  56

Query  238  NNGTCQWTESLWSPENYASNGLDH------FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G+C+W   ++    +A +          + FLVSMG +++ + GE ++N+  Y ++  
Sbjct  57   RDGSCKWETPVYETVKFARDTKSGKINEKIYYFLVSMGRAKSKVFGEVSINLADYADATK  116

Query  400  SIPVSLPLQKCNKGTVLNFEIKCLTPRTSFR  492
            S  VSLPL+  N   VL+  I+ L  +   R
Sbjct  117  SSSVSLPLKNSNSDAVLHVLIQKLQAKIEPR  147


 Score = 70.9 bits (172),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 102/194 (53%), Gaps = 19/194 (10%)
 Frame = +1

Query  805   IGQCSLHITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMEL  984
             I +  L  T   + D  IE+LKAE   +   A    ++++TLRK+   +S+R  D+  E+
Sbjct  284   IKRSGLVTTSEKVADIEIEKLKAELVGFSRQAEVSELELQTLRKQIVKESKRGQDLSKEI  343

Query  985   STAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNS  1164
                  E + L  + ++L         K  +  N+  + K  E +L+EM++EL  + E NS
Sbjct  344   VILKEERDSLRAEYEKL---------KAKSKNNVEFEDKEIEALLEEMKEELNKEKELNS  394

Query  1165  NLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRS-------DVMGVINSC  1323
             NL LQL+K+Q+SN EL+  ++++EE +++K     + L L  RS       +    I+ C
Sbjct  395   NLRLQLQKTQKSNDELILAMRDLEEMLEQKN---GDRLRLYDRSRFSENAEEFYNSISKC  451

Query  1324  GDEDNVQPKSTEQV  1365
               ED+ + K+ E++
Sbjct  452   ESEDDEEQKALEKL  465



>ref|XP_010061052.1| PREDICTED: unconventional myosin-XVIIIa [Eucalyptus grandis]
 gb|KCW90705.1| hypothetical protein EUGRSUZ_A02791 [Eucalyptus grandis]
Length=974

 Score = 73.6 bits (179),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 69/145 (48%), Gaps = 17/145 (12%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGW-DKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F    QA QVPK     L++SL+     K   KL KA+
Sbjct  1    MFKSGRWRSDK-----NKIKAVFKLQFQATQVPKSKKSTLTISLVPDGVSKPTVKLEKAA  55

Query  235  VNNGTCQWTESLW--------SPENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRN  390
            V +G C W   ++        S        + HF  +VS GSS+AG LGEA+++   +  
Sbjct  56   VQDGICSWENPVYETVKLIIESKTGKVKEKIYHF--IVSAGSSKAGCLGEASIDFADFAA  113

Query  391  SEASIPVSLPLQKCNKGTVLNFEIK  465
                  +SLPL+  N G VL+  I+
Sbjct  114  ENEPYTLSLPLKFANSGAVLHVTIQ  138



>ref|XP_010473572.1| PREDICTED: golgin subfamily A member 6-like protein 22 [Camelina 
sativa]
Length=1034

 Score = 73.6 bits (179),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 97/421 (23%), Positives = 179/421 (43%), Gaps = 75/421 (18%)
 Frame = +1

Query  229   ASVNNGTCQWTESLWSPENY---ASNGLDH---FKFLVSM---GSSRAGILGEATVNVGH  381
             A V +G C+W   ++    +   A  G  +   +  +VS    GS+R G++GE +++   
Sbjct  54    AIVKDGHCRWEIPVYETVKFLKDAKTGKVNQRIYHLIVSSITPGSTRGGLVGETSIDFAD  113

Query  382   YRNSEASIPVSLPLQKCN-KGTVLNFEIK--------------CLTPRTSFRGDEVNSTA  516
             Y ++  +  VSLPL   N K  +L+  I+              C T R   +G ++ S  
Sbjct  114   YVDATKTCNVSLPLHNSNSKKALLHVSIQRQLEFDDPQRDVDECETLRKMSQGQDLKSHL  173

Query  517   AYNEEENSVCNGIDNKSEERNNSLPSMEDSLGRDSLssasnssavvnnaIRRLESTESGG  696
                    S+ +G+     E  NS+   E   G+ +              +RR  S ES  
Sbjct  174   -------SIGDGV-----ETGNSVSHEEGPFGKAA----------RFAELRRRASIESDS  211

Query  697   SAPWssysygspksnnspnklsisCQEKH--------PEYTEEEIGQCSLH---------  825
             +   +           +   L    +  H        P  +E E    S H         
Sbjct  212   TMSSTGSVIEPNTPEEAAKPLRHPTKHLHSAKNLFEEPRVSESEWSGSSDHGGISTDDST  271

Query  826   ----------ITRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADME  975
                        TR S+ +  +E+LK E       A    +++++LRK+   +++R  D+ 
Sbjct  272   NSSNDTTARDTTRNSLDEDEVEKLKTEVAGLTRQADLSEMELQSLRKQIVKETKRSQDLL  331

Query  976   MELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTE  1155
              E+++   E + L  D +R +V  ++   +      L  + ++   +L+E  +EL ++ +
Sbjct  332   REVNSLKQERDTLKQDCERHKVS-DKHQGESKMRNRLQFEGRDPWILLEETREELDYEKD  390

Query  1156  SNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSD-VMGVINSCGDE  1332
                NL LQL+K+QESN+EL+  +Q++EE +++K  E  +L + +  SD +   + S  DE
Sbjct  391   RIFNLRLQLQKTQESNSELILAVQDLEEMLEEKSKEGADLPSKSRTSDEIQESMRSETDE  450

Query  1333  D  1335
             D
Sbjct  451   D  451



>ref|XP_006476583.1| PREDICTED: intracellular protein transport protein USO1-like 
[Citrus sinensis]
Length=1160

 Score = 72.4 bits (176),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 73/143 (51%), Gaps = 13/143 (9%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QV + G + L +S++ ++ GK   +L KA+
Sbjct  1    MFKSARWRSDK-----NKIKAVFKLQFHATQVAQLGENALMISVVPLDVGKPTVRLEKAA  55

Query  235  VNNGTCQWTESLWSPENYA----SNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSE  396
            + +G C+W  S++    +     S  +    + F+VS G S+AG +GEA+++   Y  + 
Sbjct  56   IEDGCCRWLNSVYETVKFVREPKSGKISERIYNFIVSTGLSKAGFVGEASIDFADYAEAS  115

Query  397  ASIPVSLPLQKCNKGTVLNFEIK  465
             +  VSLPL+      VL+  I+
Sbjct  116  KTSTVSLPLKYSRSKAVLHVSIQ  138


 Score = 64.3 bits (155),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 84/142 (59%), Gaps = 1/142 (1%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             D  IE+LK+E       A    ++++TLRK+   +S+R  D+  E+ +   E + L  D 
Sbjct  292   DIEIEKLKSELVALARQADLSELELQTLRKQIVKESKRAQDLSREVISLKEEKDLLKLDC  351

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             ++L+   +  +  ++    L+ Q  +   +L+E+  EL ++ + N+NL LQL+K+QESNA
Sbjct  352   EKLKTFQKRMDEAKVR-NKLHFQGGDPWVLLEEIRQELSYEKDLNANLRLQLQKTQESNA  410

Query  1207  ELVSVLQEMEETVQKKKIEIEN  1272
             EL+  +Q+++E +++K  +I N
Sbjct  411   ELILAVQDLDEMLEQKNKDISN  432



>gb|KDO76201.1| hypothetical protein CISIN_1g001085mg [Citrus sinensis]
Length=1160

 Score = 72.4 bits (176),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 73/143 (51%), Gaps = 13/143 (9%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QV + G + L +S++ ++ GK   +L KA+
Sbjct  1    MFKSARWRSDK-----NKIKAVFKLQFHATQVAQLGENALMISVVPLDVGKPTVRLEKAA  55

Query  235  VNNGTCQWTESLWSPENYA----SNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSE  396
            + +G C+W  S++    +     S  +    + F+VS G S+AG +GEA+++   Y  + 
Sbjct  56   IEDGCCRWLNSVYETVKFVREPKSGKISERIYNFIVSTGLSKAGFVGEASIDFADYAEAS  115

Query  397  ASIPVSLPLQKCNKGTVLNFEIK  465
             +  VSLPL+      VL+  I+
Sbjct  116  KTSTVSLPLKYSRSKAVLHVSIQ  138


 Score = 65.5 bits (158),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 84/142 (59%), Gaps = 1/142 (1%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             D  IE+LK+E       A    ++++TLRK+   +S+R  D+  E+ +   E + L  D 
Sbjct  292   DIEIEKLKSELVALARQADLSELELQTLRKQIVKESKRAQDLSREVISLKEEKDLLKLDC  351

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             ++L+   +  +  ++    L+ Q  +   +L+E+  EL ++ + N+NL LQL+K+QESNA
Sbjct  352   EKLKTFQKRMDEAKVR-NKLHFQGGDPWVLLEEIRQELSYEKDLNANLRLQLQKTQESNA  410

Query  1207  ELVSVLQEMEETVQKKKIEIEN  1272
             EL+  +Q+++E +++K  EI N
Sbjct  411   ELILAVQDLDEMLEQKNREISN  432



>ref|XP_010089136.1| hypothetical protein L484_024311 [Morus notabilis]
 gb|EXB37383.1| hypothetical protein L484_024311 [Morus notabilis]
Length=1269

 Score = 72.0 bits (175),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 88/183 (48%), Gaps = 30/183 (16%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QV + G D L VS+I V+ GK   +L KA+
Sbjct  1    MFKPARWRSEK-----NKVKAVFKLQFHATQVSRLGVDSLIVSVIPVDVGKPSVRLDKAT  55

Query  235  VNNGTCQWTESLWSPENY--------ASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRN  390
            V +G C+W   ++    +         S  +  ++F VS GS++AG++G+ +++   Y  
Sbjct  56   VKDGNCRWENPVYETVKFFREPRTGKISEKI--YRFSVSNGSAKAGVIGDVSIDFAAYAE  113

Query  391  SEASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSE  570
            +  +  +SLPL+  N   +L+  I+ L              A +++ E   C+    KS+
Sbjct  114  ANKASTISLPLKNSNSDAILHVVIQRL-------------QANFDQREVEECDATKPKSQ  160

Query  571  ERN  579
            +R+
Sbjct  161  DRS  163



>ref|XP_009619461.1| PREDICTED: myosin heavy chain, striated muscle-like isoform X1 
[Nicotiana tomentosiformis]
Length=1070

 Score = 71.2 bits (173),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 72/142 (51%), Gaps = 14/142 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S       +K   +F     A QV    D L +S++  + GK   KL KA V
Sbjct  1    MFKSARWRSEK-----NKIKVVFKLQFHATQV--AGDALMISVVPADVGKPTLKLEKAIV  53

Query  238  NNGTCQWTESLWSPENY---ASNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G+C W ++++          +G  H   + F++  GSS+AG++GEA+++  ++  +  
Sbjct  54   RDGSCYWDKAVFETVKLIQEPKSGKIHEKIYYFILGTGSSKAGVVGEASIDFSNHAEASK  113

Query  400  SIPVSLPLQKCNKGTVLNFEIK  465
               V+LPL+    G VL+  I+
Sbjct  114  ISSVALPLKNSKSGAVLHVSIQ  135



>ref|XP_009619462.1| PREDICTED: myosin heavy chain, striated muscle-like isoform X2 
[Nicotiana tomentosiformis]
Length=1069

 Score = 71.2 bits (173),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 72/142 (51%), Gaps = 14/142 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S       +K   +F     A QV    D L +S++  + GK   KL KA V
Sbjct  1    MFKSARWRSEK-----NKIKVVFKLQFHATQV--AGDALMISVVPADVGKPTLKLEKAIV  53

Query  238  NNGTCQWTESLWSPENY---ASNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G+C W ++++          +G  H   + F++  GSS+AG++GEA+++  ++  +  
Sbjct  54   RDGSCYWDKAVFETVKLIQEPKSGKIHEKIYYFILGTGSSKAGVVGEASIDFSNHAEASK  113

Query  400  SIPVSLPLQKCNKGTVLNFEIK  465
               V+LPL+    G VL+  I+
Sbjct  114  ISSVALPLKNSKSGAVLHVSIQ  135



>ref|XP_009785547.1| PREDICTED: myosin heavy chain, striated muscle-like isoform X2 
[Nicotiana sylvestris]
Length=1069

 Score = 70.9 bits (172),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 72/142 (51%), Gaps = 14/142 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S       +K   +F     A QV    D L +S++  + GK   KL KA V
Sbjct  1    MFKSARWRSEK-----NKIKAVFKLQFHATQV--AGDALMISVVPADVGKPTLKLEKAIV  53

Query  238  NNGTCQWTESLWSPENY---ASNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G+C W ++++          +G  H   + F++  GSS+AG++GEA+++  ++  +  
Sbjct  54   RDGSCYWDKAVFETVKLIQEPKSGKIHEKIYYFILGTGSSKAGVVGEASIDFSNHAEASK  113

Query  400  SIPVSLPLQKCNKGTVLNFEIK  465
               V+LPL+    G VL+  I+
Sbjct  114  ISSVALPLKNSKSGAVLHVSIQ  135



>ref|XP_009785546.1| PREDICTED: myosin heavy chain, striated muscle-like isoform X1 
[Nicotiana sylvestris]
Length=1070

 Score = 70.9 bits (172),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 72/142 (51%), Gaps = 14/142 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S       +K   +F     A QV    D L +S++  + GK   KL KA V
Sbjct  1    MFKSARWRSEK-----NKIKAVFKLQFHATQV--AGDALMISVVPADVGKPTLKLEKAIV  53

Query  238  NNGTCQWTESLWSPENY---ASNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G+C W ++++          +G  H   + F++  GSS+AG++GEA+++  ++  +  
Sbjct  54   RDGSCYWDKAVFETVKLIQEPKSGKIHEKIYYFILGTGSSKAGVVGEASIDFSNHAEASK  113

Query  400  SIPVSLPLQKCNKGTVLNFEIK  465
               V+LPL+    G VL+  I+
Sbjct  114  ISSVALPLKNSKSGAVLHVSIQ  135



>ref|XP_006439561.1| hypothetical protein CICLE_v10018577mg [Citrus clementina]
 gb|ESR52801.1| hypothetical protein CICLE_v10018577mg [Citrus clementina]
Length=1160

 Score = 70.5 bits (171),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 72/143 (50%), Gaps = 13/143 (9%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QV + G + L +S++ ++ GK   +L K +
Sbjct  1    MFKSARWRSDK-----NKIKAVFKLQFHATQVAQLGENALMISVVPLDVGKPTVRLEKTA  55

Query  235  VNNGTCQWTESLWSPENYA----SNGLDH--FKFLVSMGSSRAGILGEATVNVGHYRNSE  396
            + +G C+W  S++    +     S  +    + F+VS G S+AG +GEA+++   Y  + 
Sbjct  56   IEDGCCRWLNSVYETVKFVREPKSGKISERIYNFIVSTGLSKAGFVGEASIDFADYAEAS  115

Query  397  ASIPVSLPLQKCNKGTVLNFEIK  465
             +  VSLPL+      VL+  I+
Sbjct  116  KTSTVSLPLKYSRSKAVLHVSIQ  138


 Score = 65.5 bits (158),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 84/142 (59%), Gaps = 1/142 (1%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             D  IE+LK+E       A    ++++TLRK+   +S+R  D+  E+ +   E + L  D 
Sbjct  292   DIEIEKLKSELVALARQADLSELELQTLRKQIVKESKRAQDLSREVISLKEEKDLLKLDC  351

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             ++L+   +  +  ++    L+ Q  +   +L+E+  EL ++ + N+NL LQL+K+QESNA
Sbjct  352   EKLKTFQKRMDEAKVR-NKLHFQGGDPWVLLEEIRQELSYEKDLNANLRLQLQKTQESNA  410

Query  1207  ELVSVLQEMEETVQKKKIEIEN  1272
             EL+  +Q+++E +++K  EI N
Sbjct  411   ELILAVQDLDEMLEQKNREISN  432



>gb|EPS69111.1| hypothetical protein M569_05650, partial [Genlisea aurea]
Length=1035

 Score = 70.5 bits (171),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 70/142 (49%), Gaps = 12/142 (8%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S       ++   +F     A +V  G + L++SL+  +AGK  SK   A+V
Sbjct  1    MFKSARWRSDK-----NRIRVVFKLQFHAAKVLFGDNPLTISLVPADAGKPTSKSDAAAV  55

Query  238  NNGTCQWTESLWSPENY---ASNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
              G+C W   ++    +     +G  H   + F+V  GSS+ G++GEA++++  Y     
Sbjct  56   REGSCLWENPVYESVKFNRDPKSGKIHEKIYYFVVGTGSSKFGVIGEASLDLSKYVEQRK  115

Query  400  SIPVSLPLQKCNKGTVLNFEIK  465
               +SLPL+      VLN  I+
Sbjct  116  VTLLSLPLKTSKSEAVLNVSIQ  137



>ref|XP_004245619.1| PREDICTED: cingulin isoform X1 [Solanum lycopersicum]
Length=1080

 Score = 69.7 bits (169),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 79/172 (46%), Gaps = 17/172 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFK  R +S  +      F   F   Q  QV KG D L VS++  + GK   +  KA+V 
Sbjct  1    MFKSSRWRSEKNKIKA-VFKLQFHATQVSQV-KG-DALMVSVVPADVGKPTVRSEKATVR  57

Query  241  NGTCQWTESLWSPENYA---SNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G+C W   +     +      G  H   + F+V  GSS+ G++GEA+++   Y ++   
Sbjct  58   DGSCYWENGVLETVKFVREPKTGKIHERIYNFVVGTGSSKTGLVGEASIDFSSYADATKV  117

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGID  558
              VSLPL+      VL+  I+    R     D+    +   E EN+  N +D
Sbjct  118  SLVSLPLKNSKSEAVLHVSIQ----RIQDSADQ----SVVEETENAKVNSLD  161


 Score = 58.9 bits (141),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 110/194 (57%), Gaps = 18/194 (9%)
 Frame = +1

Query  817   SLHITRTSIPDANI-EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTA  993
             +L +T TS  D+++ E+LK +       A    ++++TLRK+   +S+R  D+  E+++ 
Sbjct  287   ALLLTLTSQEDSDVVEKLKTDLIAMARQADMTDLELQTLRKQIVRESKRGMDLSKEVTSL  346

Query  994   HTESNRLMHDIKRLEV---LLEESNAK-QIAAENLNLQAKNTENILKEMEDELKFQTESN  1161
               E + L  +  + +     ++++ +K ++  +N ++QA     ++ E+  EL +Q + N
Sbjct  347   KEERDALKEECDKYKASQRRMDDTRSKDKLIYDNGDIQA-----LVDELRQELNYQKDLN  401

Query  1162  SNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSD--------VMGVIN  1317
             +NL +QL+K+QESN+EL+  +++++E +++K  EI +L   ++ SD        +    N
Sbjct  402   ANLQIQLQKTQESNSELILAVRDLDEMLEQKNKEITSLPNKSTTSDDAEKFPDVISNSKN  461

Query  1318  SCGDEDNVQPKSTE  1359
                DED+ + K+ E
Sbjct  462   EMSDEDDEEQKALE  475



>ref|XP_010533683.1| PREDICTED: myosin-13 isoform X1 [Tarenaya hassleriana]
Length=1020

 Score = 69.3 bits (168),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 66/128 (52%), Gaps = 9/128 (7%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWS--  276
            ++   +F     A QVP+    +L++SL+  + GK  S+L  A V  G C+W   ++   
Sbjct  12   NRMKVVFRLQFHATQVPQLNAKRLTLSLVPGDVGKPTSRLENAVVQEGFCRWESPIYETV  71

Query  277  -----PENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKG  441
                 P+    N   +   + +MGSSR+G++GEA+++   Y  S  +  +SLPL+  N  
Sbjct  72   KFVQEPKTGMVNQRVYHLTVSTMGSSRSGLVGEASIDFADYAASTKAFNISLPLRNSNSK  131

Query  442  TVLNFEIK  465
             +L+  ++
Sbjct  132  AMLHVTVQ  139



>ref|XP_010533684.1| PREDICTED: myosin-13 isoform X2 [Tarenaya hassleriana]
Length=1006

 Score = 68.9 bits (167),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 66/128 (52%), Gaps = 9/128 (7%)
 Frame = +1

Query  109  DKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWS--  276
            ++   +F     A QVP+    +L++SL+  + GK  S+L  A V  G C+W   ++   
Sbjct  12   NRMKVVFRLQFHATQVPQLNAKRLTLSLVPGDVGKPTSRLENAVVQEGFCRWESPIYETV  71

Query  277  -----PENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKG  441
                 P+    N   +   + +MGSSR+G++GEA+++   Y  S  +  +SLPL+  N  
Sbjct  72   KFVQEPKTGMVNQRVYHLTVSTMGSSRSGLVGEASIDFADYAASTKAFNISLPLRNSNSK  131

Query  442  TVLNFEIK  465
             +L+  ++
Sbjct  132  AMLHVTVQ  139



>ref|XP_010325416.1| PREDICTED: cingulin isoform X2 [Solanum lycopersicum]
Length=1077

 Score = 68.9 bits (167),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 80/173 (46%), Gaps = 22/173 (13%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S       +K   +F     A QV KG D L VS++  + GK   +  KA+V
Sbjct  1    MFKSSRWRSE-----KNKIKAVFKLQFHATQV-KG-DALMVSVVPADVGKPTVRSEKATV  53

Query  238  NNGTCQWTESLWSPENYA---SNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G+C W   +     +      G  H   + F+V  GSS+ G++GEA+++   Y ++  
Sbjct  54   RDGSCYWENGVLETVKFVREPKTGKIHERIYNFVVGTGSSKTGLVGEASIDFSSYADATK  113

Query  400  SIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGID  558
               VSLPL+      VL+  I+    R     D+    +   E EN+  N +D
Sbjct  114  VSLVSLPLKNSKSEAVLHVSIQ----RIQDSADQ----SVVEETENAKVNSLD  158


 Score = 59.3 bits (142),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 110/194 (57%), Gaps = 18/194 (9%)
 Frame = +1

Query  817   SLHITRTSIPDANI-EELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTA  993
             +L +T TS  D+++ E+LK +       A    ++++TLRK+   +S+R  D+  E+++ 
Sbjct  284   ALLLTLTSQEDSDVVEKLKTDLIAMARQADMTDLELQTLRKQIVRESKRGMDLSKEVTSL  343

Query  994   HTESNRLMHDIKRLEV---LLEESNAK-QIAAENLNLQAKNTENILKEMEDELKFQTESN  1161
               E + L  +  + +     ++++ +K ++  +N ++QA     ++ E+  EL +Q + N
Sbjct  344   KEERDALKEECDKYKASQRRMDDTRSKDKLIYDNGDIQA-----LVDELRQELNYQKDLN  398

Query  1162  SNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSD--------VMGVIN  1317
             +NL +QL+K+QESN+EL+  +++++E +++K  EI +L   ++ SD        +    N
Sbjct  399   ANLQIQLQKTQESNSELILAVRDLDEMLEQKNKEITSLPNKSTTSDDAEKFPDVISNSKN  458

Query  1318  SCGDEDNVQPKSTE  1359
                DED+ + K+ E
Sbjct  459   EMSDEDDEEQKALE  472



>ref|XP_007040183.1| Myosin heavy chain-related protein, putative [Theobroma cacao]
 gb|EOY24684.1| Myosin heavy chain-related protein, putative [Theobroma cacao]
Length=1091

 Score = 68.6 bits (166),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 75/152 (49%), Gaps = 25/152 (16%)
 Frame = +1

Query  34   RIEQFREREMFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTI  213
            R E+ R + +FKL+ H +  +            N+QAL +         S++  + GK  
Sbjct  8    RSEKNRIKSVFKLQFHATQVTQ----------LNVQALMI---------SVVPGDGGKPT  48

Query  214  SKLGKASVNNGTCQWTESLWSPENYA----SNGLDH--FKFLVSMGSSRAGILGEATVNV  375
            +KL KA+V +G C+W   ++    +     +  ++   + F++S G  + G++GEA+VN 
Sbjct  49   TKLDKATVQDGNCRWENPVYETVKFVREPKTGKINEKIYHFILSTGLGKGGLVGEASVNF  108

Query  376  GHYRNSEASIPVSLPLQKCNKGTVLNFEIKCL  471
              Y  +  +  VSLPL+  N   +L+  I+ L
Sbjct  109  AVYAEAIKTSTVSLPLKNSNSKAILHVSIQRL  140


 Score = 60.5 bits (145),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             D  IE+LK E      +A    ++++TLRK+   +S+R  D+  E+ T   E + L  + 
Sbjct  293   DNEIEKLKNELIALSRHADVSDLELQTLRKQIVKESKRGQDLSREVVTLKEERDELKLEC  352

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
             ++L+   +  +  +  +  +  ++ +   +++E+  EL ++   NSNL LQL+K+QESNA
Sbjct  353   EKLKAFQKRMDDGKTES-RVQFESGDPWVLVEEIRQELNYEKHLNSNLRLQLQKTQESNA  411

Query  1207  ELVSVLQEMEETVQKKKIEIEN  1272
             EL+  +Q++EE +  K +EI N
Sbjct  412   ELILAVQDLEEMLDAKNMEISN  433



>gb|KDP25462.1| hypothetical protein JCGZ_20618 [Jatropha curcas]
Length=1087

 Score = 68.2 bits (165),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 114/219 (52%), Gaps = 12/219 (5%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             D  IE+LKAE            ++++TLRK+   +S+R  D+  E++    E + L  + 
Sbjct  301   DIEIEKLKAEIVTLTRQVDMSDLELQTLRKQIVKESKRGQDLSREVTVLKEERDVLKAEC  360

Query  1027  KRLEVL---LEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQE  1197
             ++L+     +EE+ +K  +         +   +L E+  EL ++ E N NL LQLRK+QE
Sbjct  361   EKLKAFQKRIEETKSKNKS----QFDCGDPRALLDEIRQELNYEKELNVNLRLQLRKTQE  416

Query  1198  SNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVEK  1377
             SNAEL+  ++++EE V++K  E+ +  +  SRS    +  S  D+D  Q    E V   +
Sbjct  417   SNAELILAVKDLEEIVEQKNKEMSD-FSNKSRSSYNAISRSDTDDDEEQKALEELVKEHR  475

Query  1378  QCQEFKLQHLQESHMSLENSIICQEKAQEEKIHEIELEQ  1494
               +E  L  L++  M L + I    + ++E   EI++EQ
Sbjct  476   DAKETYL--LEQKVMDLVSEIEIYRRDKDE--LEIQIEQ  510


 Score = 60.8 bits (146),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (47%), Gaps = 13/145 (9%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MF+  R +     N  +K   +F     A QV +   D L +S++  + GK  ++L K  
Sbjct  1    MFRSTRWR-----NEKNKIKAVFKLQFHATQVTQLNVDALVISVVPGDVGKPTARLEKGI  55

Query  235  VNNGTCQWTESLWSPENYASNGLD------HFKFLVSMGSSRAGILGEATVNVGHYRNSE  396
              +GTC W   ++    +  +          + F+VS GSS+  ++GE ++++ +Y  + 
Sbjct  56   FRDGTCGWEYPVYETVKFTRDSRTGKINERTYHFIVSTGSSKNSLVGEVSIDLANYAEAT  115

Query  397  ASIPVSLPLQKCNKGTVLNFEIKCL  471
             S  VSLPL+       L+  I+ L
Sbjct  116  KSSTVSLPLKNSKSNGFLHVSIQKL  140



>ref|XP_004244607.1| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 2 [Solanum lycopersicum]
Length=1064

 Score = 67.8 bits (164),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 75/154 (49%), Gaps = 12/154 (8%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFK  R +S  +   G  F   F    A QV    D L +S++  + GK   KL KA V 
Sbjct  1    MFKSARWRSEKNKIKG-VFKLQF---HATQV--AGDALMISVVPADVGKPTLKLEKAPVR  54

Query  241  NGTCQWTESLWSPENYA---SNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G+C W +++     +     +G  H   + F++  GS ++G+ GEA ++  +Y  +   
Sbjct  55   DGSCYWEKAVLETVKFIQEPKSGKIHEKIYYFILGTGSLKSGVAGEALIDFSNYAEASKI  114

Query  403  IPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDEV  504
              VSLPL+    G +L+  I+ +   +  R +E+
Sbjct  115  SSVSLPLKNSKSGALLHVSIQRIQDSSDQRVEEI  148


 Score = 58.9 bits (141),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 100/181 (55%), Gaps = 25/181 (14%)
 Frame = +1

Query  862   ELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEV  1041
             EL A AR  E++     ++++TLRK+   +S+R  D+  E+++   E + L  +  +L+ 
Sbjct  306   ELAAFARQVEVSD----LELQTLRKQIVKESRRGQDLLKEVASLKNERDALKEECDKLKA  361

Query  1042  LLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSV  1221
              L   N  + + + L  +  + + ++ E+  EL +Q E N+NL +QL+K+QESN+EL+  
Sbjct  362   SLRRLNEAK-SKDKLLYKQGDLQTLVSELRQELAYQKELNANLEIQLQKTQESNSELILA  420

Query  1222  LQEMEETVQKK-------------KIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQ  1362
             +++++E +++K               + ENL  + S++D++       DED+   K+ EQ
Sbjct  421   VRDLDEMLEQKNKQNVCFCNKSTTSCDAENLPDVLSKNDMI-------DEDDEDQKALEQ  473

Query  1363  V  1365
             +
Sbjct  474   L  474



>ref|XP_004503761.1| PREDICTED: myosin-11-like isoform X1 [Cicer arietinum]
 ref|XP_004503762.1| PREDICTED: myosin-11-like isoform X2 [Cicer arietinum]
Length=1078

 Score = 67.8 bits (164),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 75/155 (48%), Gaps = 15/155 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFK R  K+         F   F   Q LQ   G D L++S++  + GK  ++L KA+VN
Sbjct  1    MFKWRSDKNRVKT----VFKLHFHVTQVLQ--SGVDSLALSIVPGDIGKPTTRLEKATVN  54

Query  241  NGTCQWTESLW-------SPENYASNGLDHFKFLVSMGSSRA-GILGEATVNVGHYRNSE  396
             G C+W   ++        P+N   +   ++ F++SMG S+A  I GE +++   Y  + 
Sbjct  55   GGICKWENPVYETVKFIQDPKNGKFSDKIYY-FVLSMGLSKASSIFGEVSIDFSDYAEAT  113

Query  397  ASIPVSLPLQKCNKGTVLNFEIKCLTPRTSFRGDE  501
                +SLP++  +   VL+  I+ L      R +E
Sbjct  114  KLSSISLPVKNSHSDAVLHVSIQRLQENNDKREEE  148


 Score = 55.8 bits (133),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 104/192 (54%), Gaps = 16/192 (8%)
 Frame = +1

Query  817   SLHITRTSIP------DANIEELKAEARMWELNARRLMV---KMETLRKEFANQSQRIAD  969
             S H ++ S+P         IE  K +A +  L AR++ V   +++TLRK+   +S+R  +
Sbjct  283   STHGSQDSLPREKSHQALGIENEKLKAELAAL-ARQVDVSDMELQTLRKQIVKESKRGQE  341

Query  970   MEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQ  1149
             +  E+++   E + L  + + L       +  ++++ +  L + +   +++E+  EL ++
Sbjct  342   LAKEVTSLKDERDTLKKECENLRSFRSRMDKAKVSSRS-QLDSGDLHTLVEEIRQELSYE  400

Query  1150  TESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIE----NLLALNSRSDVMG-VI  1314
              + N+NL LQL+K+QESNAELV  +Q+++  +++K  E      N    N  S  +G  +
Sbjct  401   KDLNANLRLQLKKTQESNAELVLAVQDLDAMLEQKNRETHGVSNNFKQTNKNSRELGRSL  460

Query  1315  NSCGDEDNVQPK  1350
             +SC  +D+ + K
Sbjct  461   SSCETDDDEEQK  472



>ref|XP_006352281.1| PREDICTED: myosin-11-like [Solanum tuberosum]
Length=1064

 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 14/142 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S       +K   +F     A QV    D L +S++  + GK   KL KA V
Sbjct  1    MFKSARWRSEK-----NKIKVVFKLQFHATQV--AGDALMISVVPADVGKPTLKLEKAPV  53

Query  238  NNGTCQWTESLWSPENY---ASNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G+C W +++     +     +G  H   + F++  GS ++G+ GEA ++  +Y  +  
Sbjct  54   RDGSCYWEKAVLETVKFIQEPKSGKIHEKIYYFILGTGSLKSGVAGEALIDFSNYAEASK  113

Query  400  SIPVSLPLQKCNKGTVLNFEIK  465
               +SLPL+    G +L+  I+
Sbjct  114  ISSISLPLKNSKSGALLHVSIQ  135


 Score = 55.5 bits (132),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 89/151 (59%), Gaps = 13/151 (9%)
 Frame = +1

Query  820   LHITRTSIPDANIEELKAEARMWELNARRLMV---KMETLRKEFANQSQRIADMEMELST  990
             L +    + D  + +LK+E  ++   AR++ V   +++TLRK+   +S+R  D+  E+++
Sbjct  288   LRLASQEVSDIVVVKLKSELAVF---ARQVEVSDLELQTLRKQIVKESKRGQDLSKEVAS  344

Query  991   AHTESNRLMHDIKRLEV---LLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESN  1161
                E + L  +  +L+     L E+ +K    + L  +  + + ++ E+  EL +Q E N
Sbjct  345   LKNERDALKEECDKLKASQRRLNEAKSK----DKLLYEQGDLQTLVSELRQELAYQKELN  400

Query  1162  SNLSLQLRKSQESNAELVSVLQEMEETVQKK  1254
             +NL +QL+K+QESN+EL+  +++++E +++K
Sbjct  401   ANLEIQLQKTQESNSELILAVRDLDEMLEQK  431



>gb|KFK33030.1| hypothetical protein AALP_AA6G321500 [Arabis alpina]
Length=984

 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/145 (28%), Positives = 72/145 (50%), Gaps = 15/145 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QV +   + L++S++  + GK+ +KL KA 
Sbjct  1    MFKSARWRSE-----KNKIKIVFKLQFHATQVHQLKSEGLTISIVPGDVGKSTAKLEKAL  55

Query  235  VNNGTCQWTESLWSPENYASN--------GLDHFKFLVSMGSSRAGILGEATVNVGHYRN  390
            V +G C+W   ++    +  +         + H     + GS+++GI+GE  ++ G Y +
Sbjct  56   VLDGHCRWESPVYETVKFVQDLKTGKVNQRIYHLIVSTTTGSTKSGIVGETKIDFGDYVD  115

Query  391  SEASIPVSLPLQKCNKGTVLNFEIK  465
            +  +  VSLPLQ  N   +L+  I+
Sbjct  116  AIKTCNVSLPLQNSNSKAMLHVSIQ  140


 Score = 55.1 bits (131),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 86/155 (55%), Gaps = 23/155 (15%)
 Frame = +1

Query  817   SLHITRTSIP--------DANIEELKAE----ARMWELNARRLMVKMETLRKEFANQSQR  960
             S+H +  +IP        D  +E+LK E    AR  +L+     +++++LRK+   +++R
Sbjct  272   SMHSSNDTIPRDTTRTSSDDEVEKLKTELVAVARRADLSE----LELQSLRKQIVKETKR  327

Query  961   IADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAE---NLNLQAKNTENILKEME  1131
               D+  E+++   E + L  D +  +     S+ ++  A+    L  + ++ E +L+E  
Sbjct  328   SQDLLREVTSLKQERDSLKADCESFKA----SDKRKEDAKVRNKLQTEGRDPEVLLEETR  383

Query  1132  DELKFQTESNSNLSLQLRKSQESNAELVSVLQEME  1236
             +EL ++ + NSNL LQL K+QESN EL+  +Q++E
Sbjct  384   EELDYEKDMNSNLRLQLEKTQESNTELILAVQDLE  418



>gb|KGN53347.1| hypothetical protein Csa_4G049060 [Cucumis sativus]
Length=1063

 Score = 67.0 bits (162),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 124/228 (54%), Gaps = 7/228 (3%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              D  IEELK E  +    A  L ++++TLRK+   +++R  D+  E+S    E +    +
Sbjct  274   ADIEIEELKTELSVSTRRADMLDMELQTLRKQIVKENKRSQDLMGEISIFKAERDEWRAE  333

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
              ++L+   +  +  ++  + L     +   +L+EM  EL ++ + N+NL LQL+K+QESN
Sbjct  334   CEKLKGFQKHVDDAKVKNK-LQFDGGDLRALLEEMRQELNYEKDLNANLRLQLQKTQESN  392

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNS-RSDVMGVINS-CGDEDNVQPKSTEQVSVEK  1377
              EL+  +Q++EE +++K  EI +L    S +++ M +  S C  E++ + K+ E + V  
Sbjct  393   TELILAVQDLEEMLEQKNCEISDLYTEESKKAEEMKITCSKCQIEEDEELKALENL-VND  451

Query  1378  QCQEFKLQHLQESHMSLENSIICQEKAQEE---KIHEIELEQDLRAQG  1512
             Q  + K   L++  M L N I    + ++E   ++ ++ L+ ++  QG
Sbjct  452   QKNDRKAYVLEQKVMELYNEIELHMRDKDELAMQMEQLALDYEILKQG  499


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 81/185 (44%), Gaps = 29/185 (16%)
 Frame = +1

Query  142  ALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENY--------AS  294
            A QV + G D L +S+I  + GK+  KL KA+V  G C+W    +    +         +
Sbjct  24   ATQVSEFGGDSLMISVIPGDVGKSTVKLEKATVRGGKCRWENPAYVTVKFDVDQKTGKFT  83

Query  295  NGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIK---  465
              + HF+  VS G  +AG++GE +++   Y  +      SLPLQ  N   VL+  I+   
Sbjct  84   EKIYHFR--VSTGLIKAGLVGEVSIDFAKYAEATKPFSASLPLQNSN-SAVLHIWIQRIQ  140

Query  466  -----------CLTPRTSFRGDEVNSTAAYNE--EENSVCNGIDNKSEERNNSLPSMEDS  606
                       C   RT F    +N+    ++  E N   NG    S   + +L S E S
Sbjct  141  EHADQRTLALICSVWRT-FSEMWMNTRGGLSDEAERNGEINGEHRTSSGSDITLSSYESS  199

Query  607  LGRDS  621
             G DS
Sbjct  200  SGLDS  204



>ref|XP_009616000.1| PREDICTED: centromere-associated protein E isoform X1 [Nicotiana 
tomentosiformis]
Length=1074

 Score = 67.0 bits (162),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 67/141 (48%), Gaps = 9/141 (6%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFK  R +S  +      F   F   Q  QV    D L VS++  + GK   K  KA+V 
Sbjct  1    MFKSARWRSEKNKIKA-VFKLQFHATQVSQVV--GDALMVSVVPADVGKPTVKSEKATVR  57

Query  241  NGTCQWTESLWSPENYA---SNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEAS  402
            +G+C W   +     +     +G  H   + F+V  GSS++G++GEA+ +   Y ++   
Sbjct  58   DGSCYWENGVLESVKFVREPKSGKIHERIYNFVVGTGSSKSGVVGEASFDFSSYADATKV  117

Query  403  IPVSLPLQKCNKGTVLNFEIK  465
              VSLPL+      VL+  I+
Sbjct  118  SLVSLPLKNSKSEAVLHVSIQ  138


 Score = 60.5 bits (145),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 95/163 (58%), Gaps = 17/163 (10%)
 Frame = +1

Query  913   VKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEV----LLEESNAKQIAAE  1080
             ++++TLRK+   +S+R  D+  E+++   E + L  +  +L+     + E  +  ++  +
Sbjct  304   LELQTLRKQIVKESKRGQDLSKEVASLKEERDALKEECDKLKASQKRIDETKSNDKLLYD  363

Query  1081  NLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKI  1260
             N ++QA     ++ E+  EL +Q + N+NL +QL+K+QESN+EL+  +Q+++E +++K  
Sbjct  364   NGDIQA-----LVDELRQELNYQKDMNANLQIQLQKTQESNSELILAVQDLDEMLEQKNQ  418

Query  1261  EIENLLALNSRSD----VMGVINSC----GDEDNVQPKSTEQV  1365
             EI NL   ++  D       VI++      DED+ + K+ EQ+
Sbjct  419   EIANLSNKSTSCDEAEKFPDVISNSKHEMSDEDDEEQKALEQL  461



>ref|XP_004146567.1| PREDICTED: uncharacterized protein LOC101221081 [Cucumis sativus]
Length=1076

 Score = 67.0 bits (162),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 124/228 (54%), Gaps = 7/228 (3%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              D  IEELK E  +    A  L ++++TLRK+   +++R  D+  E+S    E +    +
Sbjct  287   ADIEIEELKTELSVSTRRADMLDMELQTLRKQIVKENKRSQDLMGEISIFKAERDEWRAE  346

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
              ++L+   +  +  ++  + L     +   +L+EM  EL ++ + N+NL LQL+K+QESN
Sbjct  347   CEKLKGFQKHVDDAKVKNK-LQFDGGDLRALLEEMRQELNYEKDLNANLRLQLQKTQESN  405

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNS-RSDVMGVINS-CGDEDNVQPKSTEQVSVEK  1377
              EL+  +Q++EE +++K  EI +L    S +++ M +  S C  E++ + K+ E + V  
Sbjct  406   TELILAVQDLEEMLEQKNCEISDLYTEESKKAEEMKITCSKCQIEEDEELKALENL-VND  464

Query  1378  QCQEFKLQHLQESHMSLENSIICQEKAQEE---KIHEIELEQDLRAQG  1512
             Q  + K   L++  M L N I    + ++E   ++ ++ L+ ++  QG
Sbjct  465   QKNDRKAYVLEQKVMELYNEIELHMRDKDELAMQMEQLALDYEILKQG  512


 Score = 61.2 bits (147),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 13/112 (12%)
 Frame = +1

Query  142  ALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYASNGLDH---  309
            A QV + G D L +S+I  + GK+  KL KA+V  G C+W    +    +    +D    
Sbjct  24   ATQVSEFGGDSLMISVIPGDVGKSTVKLEKATVRGGKCRWENPAYVTVKF---DVDQKTG  80

Query  310  ------FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTV  447
                  + F VS G  +AG++GE +++   Y  +      SLPLQ  N   +
Sbjct  81   KFTEKIYHFRVSTGLIKAGLVGEVSIDFAKYAEATKPFSASLPLQNSNSAVL  132



>ref|XP_004160979.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221081 
[Cucumis sativus]
Length=1086

 Score = 66.6 bits (161),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 124/228 (54%), Gaps = 7/228 (3%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              D  IEELK E  +    A  L ++++TLRK+   +++R  D+  E+S    E +    +
Sbjct  297   ADIEIEELKTELSVSTRRADMLDMELQTLRKQIVKENKRSQDLMGEISIFKAERDEWRAE  356

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
              ++L+   +  +  ++  + L     +   +L+EM  EL ++ + N+NL LQL+K+QESN
Sbjct  357   CEKLKGFQKHVDDAKVKNK-LQFDGGDLRALLEEMRQELNYEKDLNANLRLQLQKTQESN  415

Query  1204  AELVSVLQEMEETVQKKKIEIENLLALNS-RSDVMGVINS-CGDEDNVQPKSTEQVSVEK  1377
              EL+  +Q++EE +++K  EI +L    S +++ M +  S C  E++ + K+ E + V  
Sbjct  416   TELILAVQDLEEMLEQKNCEISDLYTEESKKAEEMKITCSKCQIEEDEELKALENL-VND  474

Query  1378  QCQEFKLQHLQESHMSLENSIICQEKAQEE---KIHEIELEQDLRAQG  1512
             Q  + K   L++  M L N I    + ++E   ++ ++ L+ ++  QG
Sbjct  475   QKNDRKAYVLEQKVMELYNEIELHMRDKDELAMQMEQLALDYEILKQG  522


 Score = 61.6 bits (148),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 75/157 (48%), Gaps = 16/157 (10%)
 Frame = +1

Query  142  ALQVPK-GWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYASNGLDH---  309
            A QV + G D L +S+I  + GK+  KL KA+V  G C+W    +    +    +D    
Sbjct  24   ATQVSEFGGDSLMISVIPGDVGKSTVKLEKATVRGGKCRWENPAYVTVKF---DVDQKTG  80

Query  310  ------FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNFEIKCL  471
                  + F VS G  +AG++GE +++   Y  +      SLPLQ  N   VL+  I+ +
Sbjct  81   KFTEKIYHFRVSTGLIKAGLVGEVSIDFAKYAEATKPFSASLPLQNSN-SAVLHIWIQMI  139

Query  472  TPRTSFRG-DEVNSTAAYNEEENSVCNGIDNKSEERN  579
                  R  DE     + +++E S+ + ++N+   +N
Sbjct  140  QEHADQRDVDEYEGLKSRSQDE-SLSSYLNNEDANKN  175



>ref|XP_009616001.1| PREDICTED: centromere-associated protein E isoform X2 [Nicotiana 
tomentosiformis]
Length=1071

 Score = 66.2 bits (160),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (48%), Gaps = 14/142 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPKGWDKLSVSLISVEAGKTISKLGKASV  237
            MFK  R +S       +K   +F     A QV    D L VS++  + GK   K  KA+V
Sbjct  1    MFKSARWRSEK-----NKIKAVFKLQFHATQVV--GDALMVSVVPADVGKPTVKSEKATV  53

Query  238  NNGTCQWTESLWSPENYA---SNGLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEA  399
             +G+C W   +     +     +G  H   + F+V  GSS++G++GEA+ +   Y ++  
Sbjct  54   RDGSCYWENGVLESVKFVREPKSGKIHERIYNFVVGTGSSKSGVVGEASFDFSSYADATK  113

Query  400  SIPVSLPLQKCNKGTVLNFEIK  465
               VSLPL+      VL+  I+
Sbjct  114  VSLVSLPLKNSKSEAVLHVSIQ  135


 Score = 60.5 bits (145),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 95/163 (58%), Gaps = 17/163 (10%)
 Frame = +1

Query  913   VKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDIKRLEV----LLEESNAKQIAAE  1080
             ++++TLRK+   +S+R  D+  E+++   E + L  +  +L+     + E  +  ++  +
Sbjct  301   LELQTLRKQIVKESKRGQDLSKEVASLKEERDALKEECDKLKASQKRIDETKSNDKLLYD  360

Query  1081  NLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKI  1260
             N ++QA     ++ E+  EL +Q + N+NL +QL+K+QESN+EL+  +Q+++E +++K  
Sbjct  361   NGDIQA-----LVDELRQELNYQKDMNANLQIQLQKTQESNSELILAVQDLDEMLEQKNQ  415

Query  1261  EIENLLALNSRSD----VMGVINSC----GDEDNVQPKSTEQV  1365
             EI NL   ++  D       VI++      DED+ + K+ EQ+
Sbjct  416   EIANLSNKSTSCDEAEKFPDVISNSKHEMSDEDDEEQKALEQL  458



>ref|XP_006405390.1| hypothetical protein EUTSA_v10027632mg [Eutrema salsugineum]
 gb|ESQ46843.1| hypothetical protein EUTSA_v10027632mg [Eutrema salsugineum]
Length=987

 Score = 65.1 bits (157),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 73/144 (51%), Gaps = 14/144 (10%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFS-NIQALQVPK-GWDKLSVSLISVEAGKTISKLGKAS  234
            MFK  R +S       +K   +F     A QV +   + L +SL+  + GK+  K  KA 
Sbjct  1    MFKSARWRSEK-----NKIKIVFKLQFHATQVTQLKAEGLMISLVPGDVGKSTGKTEKAM  55

Query  235  VNNGTCQWTESLWSPENY---ASNGLDH---FKFLVSM-GSSRAGILGEATVNVGHYRNS  393
            V +G C+W   ++    +     NG  +   + F+VS  GSS++G++GE +++   Y ++
Sbjct  56   VLDGHCRWESPVYETVKFLQDMKNGKVNQRIYHFIVSTTGSSKSGLVGETSIDFADYVDA  115

Query  394  EASIPVSLPLQKCNKGTVLNFEIK  465
              +  VSLPLQ  N   +L+  I+
Sbjct  116  IKTCNVSLPLQNSNSKAMLHVSIQ  139



>ref|XP_010660910.1| PREDICTED: myosin-9 isoform X2 [Vitis vinifera]
Length=916

 Score = 64.3 bits (155),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 82/144 (57%), Gaps = 1/144 (1%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
             PD  IE+LK +  +    A    ++++TLRK+   + +R  D+  E+     E + L  +
Sbjct  108   PDVAIEKLKTDFLVLARQAEMAELELQTLRKQIVKERKRGQDLSKEVGGLKEERDALKAE  167

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
              + L    + ++  +I    L  +  +   +L+E+  EL ++ + N+NL LQL+K+QESN
Sbjct  168   CENLRSFQKRTDQAKIK-NKLQFEGGDPRALLEELRQELSYEKDLNANLRLQLQKTQESN  226

Query  1204  AELVSVLQEMEETVQKKKIEIENL  1275
              EL+  +++++E +++K +EI NL
Sbjct  227   TELILAVRDLDEMLEQKNLEISNL  250



>ref|XP_008452020.1| PREDICTED: intracellular protein transport protein USO1-like 
isoform X1 [Cucumis melo]
Length=1088

 Score = 63.9 bits (154),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 84/146 (58%), Gaps = 1/146 (1%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
              D  IEELK E  +    A    ++++TLRK+   +++R  D+  E+S    E +    +
Sbjct  297   ADIEIEELKTELSVLTRRADMSDMELQTLRKQIVKENKRSQDLMGEISILKAERDEWRAE  356

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
              ++L+   +  + +++  ++      +   +L+EM  EL ++ + N+NL LQL+K+QESN
Sbjct  357   CEKLKGFQKHMDVEKVKNKS-QFDGGDLRALLEEMRQELNYEKDLNANLRLQLQKTQESN  415

Query  1204  AELVSVLQEMEETVQKKKIEIENLLA  1281
              EL+  +Q++EE +++K  EI +L A
Sbjct  416   TELILAVQDLEEMLEQKNCEISDLYA  441


 Score = 57.8 bits (138),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/138 (27%), Positives = 59/138 (43%), Gaps = 15/138 (11%)
 Frame = +1

Query  61   MFKLRRHKSSTSDNSGDKFGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVN  240
            MFK  R +S  +    + F   F   Q  +   G D L +S+I  + GK   +L KA+V 
Sbjct  1    MFKSARWRSEKNRIKAE-FKLQFCATQVSEF--GGDSLIISVIPGDVGKPTVRLEKATVR  57

Query  241  NGTCQWTESLWSPENYASNGLDH---------FKFLVSMGSSRAGILGEATVNVGHYRNS  393
             G C+W    +    +    +D          + F VS    +AG++GE +++   Y  +
Sbjct  58   GGKCRWENPAYVTVKF---DVDQKTGKFTEKIYHFRVSTALIKAGLVGEVSIDFAKYAEA  114

Query  394  EASIPVSLPLQKCNKGTV  447
                  SLPLQ  N   +
Sbjct  115  TKPFSASLPLQNSNSAVL  132



>gb|KHN25716.1| hypothetical protein glysoja_018290 [Glycine soja]
Length=1090

 Score = 61.2 bits (147),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 76/170 (45%), Gaps = 10/170 (6%)
 Frame = +1

Query  115  FGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWS------  276
            F   F   Q  Q   G D L +S++  + GK  +KL KA+V + TC+W   ++       
Sbjct  18   FKLHFHATQVFQ--SGMDALVLSIVPGDIGKPTTKLEKATVRDRTCRWENPVYETVKFIQ  75

Query  277  -PENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLN  453
             P+    N    + FLVS G  +A  +GE ++N   Y  +     V+LP++  +   VL+
Sbjct  76   EPKTGKIND-KIYHFLVSTGLPKASSIGEVSMNFADYVEATKPSSVALPIRISHCDAVLH  134

Query  454  FEIKCLTPRTSFRGDEVNSTAAYNEEENSVCNGIDNKSEERNNSLPSMED  603
              I+ L      R +E         ++ S  N + N +++  +   S ED
Sbjct  135  VSIQRLQENGDRREEEECEDVKLKSDDRSSRNQLSNGNKDETSRSCSSED  184



>ref|XP_006573769.1| PREDICTED: myosin-3-like [Glycine max]
Length=1090

 Score = 61.2 bits (147),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 60/126 (48%), Gaps = 10/126 (8%)
 Frame = +1

Query  115  FGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWS------  276
            F   F   Q  Q   G D L +S++  + GK  +KL KA+V + TC+W   ++       
Sbjct  18   FKLHFHATQVFQ--SGMDALVLSIVPGDIGKPTTKLEKATVRDRTCRWENPVYETVKFIQ  75

Query  277  -PENYASNGLDHFKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLN  453
             P+    N    + FLVS G  +A  +GE ++N   Y  +     V+LP++  +   VL+
Sbjct  76   EPKTGKIND-KIYHFLVSTGLPKASSIGEVSMNFADYVEATKPSSVALPIRISHCDAVLH  134

Query  454  FEIKCL  471
              I+ L
Sbjct  135  VSIQRL  140



>ref|XP_010430415.1| PREDICTED: golgin subfamily A member 6-like protein 22 [Camelina 
sativa]
Length=1032

 Score = 59.7 bits (143),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 83/146 (57%), Gaps = 0/146 (0%)
 Frame = +1

Query  829   TRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESN  1008
             TR S  +   E+LK+E       A    +++++LRK+   +++R  D+  E+++   E +
Sbjct  285   TRNSSDEDETEKLKSEVAGLTRQADLSEMELQSLRKQIVKETKRSQDLLREVNSLKQERD  344

Query  1009  RLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRK  1188
              L  D +R +V  +      +    L  + ++   +L+E  +EL ++ + N NL LQL+K
Sbjct  345   TLKQDCERHKVSDKHQGETNMRRNRLQFEGRDPWILLEETREELDYEKDRNFNLRLQLQK  404

Query  1189  SQESNAELVSVLQEMEETVQKKKIEI  1266
             +QESN+EL+  +Q++EE +++K  E+
Sbjct  405   TQESNSELILAVQDLEEMLEEKSKEV  430



>ref|XP_011072419.1| PREDICTED: LOW QUALITY PROTEIN: intracellular protein transport 
protein USO1-like [Sesamum indicum]
Length=1064

 Score = 58.9 bits (141),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 68/145 (47%), Gaps = 16/145 (11%)
 Frame = +1

Query  115  FGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYAS  294
            F   F   Q  Q+  G D L   +ISV       K  KA+V NG+C W   ++       
Sbjct  18   FKLQFHASQVTQI--GGDGL---MISVXV-----KSDKAAVRNGSCLWENPVYETVRLNQ  67

Query  295  N---GLDH---FKFLVSMGSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLNF  456
            +   G  H   + F+V  G S+AG++GEA++++ +Y  +     VSLPL+K     +L+ 
Sbjct  68   DPKSGKIHERIYYFVVGTGLSKAGVVGEASIDLSNYAEANKVSLVSLPLKKSKTDAILHV  127

Query  457  EIKCLTPRTSFRGDEVNSTAAYNEE  531
             I+ +      R +E  +   Y ++
Sbjct  128  SIQRIQESMDQRVEESENAKFYTDD  152


 Score = 57.8 bits (138),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 79/143 (55%), Gaps = 12/143 (8%)
 Frame = +1

Query  844   PDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
             PD  IE+LK++       A    ++++TLRK+   +S+R  D+  E+     E + L  +
Sbjct  275   PDIVIEKLKSDLAALSRQAELSELELQTLRKQIVKESKRGQDLGKEIVCLKEERDALKGE  334

Query  1024  IKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESN  1203
              +RL+         Q   E +  +A     I++E+  EL    E N+NL +QL+K+QESN
Sbjct  335   CERLKAF-------QRRTEGVESRA-----IVEELRQELNHAKEMNANLRIQLQKTQESN  382

Query  1204  AELVSVLQEMEETVQKKKIEIEN  1272
             +EL+  +QE++E +++K  E+ N
Sbjct  383   SELILAVQELDEMLEQKNQEMSN  405



>ref|XP_007160043.1| hypothetical protein PHAVU_002G287700g [Phaseolus vulgaris]
 gb|ESW32037.1| hypothetical protein PHAVU_002G287700g [Phaseolus vulgaris]
Length=1083

 Score = 58.9 bits (141),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 92/164 (56%), Gaps = 21/164 (13%)
 Frame = +1

Query  817   SLHITRTSIP--------DANIEELKAEARMWELNARRLMV---KMETLRKEFANQSQRI  963
             S ++++ ++P        D  IE LKAE       AR++ V   +++TLRK+   +S+R 
Sbjct  275   STNVSQDALPRERSHQASDVEIERLKAELAAL---ARQVDVSDLELQTLRKQIVKESKRG  331

Query  964   ADMEMELSTAHTESNRLM---HDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMED  1134
              ++  E+     E + L     +++     +EE+     A     L + +   +++E++ 
Sbjct  332   QELFKEIICVKEERDALKIECDNLRSFRKRMEEAKVSNRAP----LDSGDLCTLVEEIKQ  387

Query  1135  ELKFQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEI  1266
             ELK++ E N+NL LQL+K+QESNAELV  +Q+M+E +++K  EI
Sbjct  388   ELKYEKELNANLQLQLKKTQESNAELVLAVQDMDEMLEQKNREI  431



>ref|XP_002509773.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51160.1| ATP binding protein, putative [Ricinus communis]
Length=1134

 Score = 58.2 bits (139),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 112/206 (54%), Gaps = 19/206 (9%)
 Frame = +1

Query  856   IEELKAE----ARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHD  1023
             IE+LKAE    AR  +L+     ++++TLRK+   + +R  D+  E++    E + L  +
Sbjct  303   IEKLKAEIVALARQVDLSE----LELQTLRKQIVKECKRGQDLTREVTGLKEERDALKAE  358

Query  1024  IKRLEVL---LEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQ  1194
              ++L+     +E++ +K      L  +  +   +L E++ EL ++ + N+NL LQL+K+Q
Sbjct  359   CEKLKTFQKRIEDAKSKN----KLQFEGGDPRVLLDEIKQELNYEKDLNANLRLQLQKTQ  414

Query  1195  ESNAELVSVLQEMEETVQKKKIEIENLLALNSRSDVMGVINSCGDEDNVQPKSTEQVSVE  1374
             ESNAEL+  + ++EE +++K  EI N    +  S+   ++ S  D+D  Q    + V   
Sbjct  415   ESNAELILAVTDLEEMLEQKNWEISNPSNKSKSSE-NAMLRSLSDDDEEQKALEDLVKEH  473

Query  1375  KQCQEFKLQHLQESHMSLENSI-ICQ  1449
             K  +E  L  L++  M L + I IC+
Sbjct  474   KDAKEAYL--LEQKIMDLSSEIEICR  497



>ref|XP_006391751.1| hypothetical protein EUTSA_v10023231mg [Eutrema salsugineum]
 gb|ESQ29037.1| hypothetical protein EUTSA_v10023231mg [Eutrema salsugineum]
Length=1031

 Score = 57.4 bits (137),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 61/124 (49%), Gaps = 9/124 (7%)
 Frame = +1

Query  115  FGFIFSNIQALQVPKGWDKLSVSLISVEAGKTISKLGKASVNNGTCQWTESLWSPENYAS  294
            F   F   QA +     + L++SL+  + GK  ++  KA V++G C+W   ++    +  
Sbjct  18   FRLKFHATQASEF--NTEGLTLSLVPGDVGKPTARSEKAVVSDGQCRWEIPVYETVKFLK  75

Query  295  NGLDH------FKFLVSM-GSSRAGILGEATVNVGHYRNSEASIPVSLPLQKCNKGTVLN  453
            +          +  +VS  G +RAG++GE +++   Y ++  +  V LPLQ  N   +L+
Sbjct  76   DAKTDKVNQRIYHLIVSTTGPTRAGLVGETSIDFADYADAIKTCNVCLPLQNSNSKALLH  135

Query  454  FEIK  465
              I+
Sbjct  136  VSIQ  139



>ref|XP_010545827.1| PREDICTED: myosin-11 [Tarenaya hassleriana]
Length=1026

 Score = 56.2 bits (134),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 87/147 (59%), Gaps = 3/147 (2%)
 Frame = +1

Query  838   SIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLM  1017
             ++ D   E+LK++       A    +++++LRK+   +S+R  D+  E++T   E + L 
Sbjct  278   NLSDVETEKLKSDLVALTRQADLSELELQSLRKQIVKESKRSQDLLREVTTLKQERDCLK  337

Query  1018  HDIKRLEVLLEESNAKQIAAEN-LNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQ  1194
              +  RL+V   E+   ++  +N L  + ++   +L+E+  EL ++ + NSNL LQL+K+Q
Sbjct  338   AECGRLKV--SENRKDEMKVKNKLQYEGRDPWILLEEIRQELDYEKDLNSNLRLQLQKTQ  395

Query  1195  ESNAELVSVLQEMEETVQKKKIEIENL  1275
             ESN EL+  +Q++E  ++++  E E++
Sbjct  396   ESNTELILAVQDLEAMLEQRNNEAEDI  422



>gb|KHN23660.1| hypothetical protein glysoja_039111 [Glycine soja]
Length=1069

 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 112/212 (53%), Gaps = 32/212 (15%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLM---  1017
             D  +E LKAE       A    ++++TLRK+   +S+R  ++  E+ +   E + L    
Sbjct  299   DMEVERLKAELAALARQADVSDLELQTLRKQIVKESKRGQELSKEIISLKEERDALKLEC  358

Query  1018  HDIKRLEVLLEE---SNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRK  1188
              +++     +EE   SN  Q+ + +L         +++E+  ELK++ E N+NL LQL+K
Sbjct  359   DNLRSFRKRMEEAKVSNRPQLDSGDLC-------TLVEEIRQELKYEKELNANLQLQLKK  411

Query  1189  SQESNAELVSVLQEMEETVQKKKIEIENLL-----ALNSRSDVMGVINSCGDEDNVQPKS  1353
             +Q++N+ELV  +Q+++E +++K  EI +L        NS  ++ G +++C  +D  Q   
Sbjct  412   TQDANSELVLAVQDLDEMLEQKNSEIYSLSNKHEEGKNSH-ELAGKLSNCETDDEEQ---  467

Query  1354  TEQVSVEKQCQEFKLQH--LQESHMSLENSII  1443
                    K+ +E   +H   +ESH+ LE  II
Sbjct  468   -------KELEELVKEHSNAKESHL-LEQKII  491



>ref|XP_006580596.1| PREDICTED: myosin-6-like [Glycine max]
Length=1086

 Score = 55.1 bits (131),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 112/212 (53%), Gaps = 32/212 (15%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLM---  1017
             D  +E LKAE       A    ++++TLRK+   +S+R  ++  E+ +   E + L    
Sbjct  299   DMEVERLKAELAALARQADVSDLELQTLRKQIVKESKRGQELSKEIISLKEERDALKLEC  358

Query  1018  HDIKRLEVLLEE---SNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRK  1188
              +++     +EE   SN  Q+ + +L         +++E+  ELK++ E N+NL LQL+K
Sbjct  359   DNLRSFRKRMEEAKVSNRPQLDSGDLC-------TLVEEIRQELKYEKELNANLQLQLKK  411

Query  1189  SQESNAELVSVLQEMEETVQKKKIEIENLL-----ALNSRSDVMGVINSCGDEDNVQPKS  1353
             +Q++N+ELV  +Q+++E +++K  EI +L        NS  ++ G +++C  +D  Q   
Sbjct  412   TQDANSELVLAVQDLDEMLEQKNSEIYSLSNKHEEGKNSH-ELAGKLSNCETDDEEQ---  467

Query  1354  TEQVSVEKQCQEFKLQH--LQESHMSLENSII  1443
                    K+ +E   +H   +ESH+ LE  II
Sbjct  468   -------KELEELVKEHSNAKESHL-LEQKII  491



>gb|KEH21046.1| myosin heavy chain-like protein [Medicago truncatula]
Length=1032

 Score = 55.1 bits (131),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 93/164 (57%), Gaps = 15/164 (9%)
 Frame = +1

Query  817   SLHITRTSIP--------DANIEELKAEARMWELNARRLMV---KMETLRKEFANQSQRI  963
             S+H ++ ++P        D   E+LKAE       AR++ V   +++TLRK+   +S+R 
Sbjct  285   SIHGSQDALPRERSHQAVDIENEKLKAEVAAL---ARQVDVSDMELQTLRKQIVKESKRG  341

Query  964   ADMEMELSTAHTESNRLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELK  1143
              ++  E+ +   E + L  + + L+   +  +  ++++ +  L+  +   +++E+  EL 
Sbjct  342   QELAKEVISLKEERDTLKIECENLKSFRKRRDEAKVSSRS-QLEGGDLHTLIEEIRQELN  400

Query  1144  FQTESNSNLSLQLRKSQESNAELVSVLQEMEETVQKKKIEIENL  1275
              + + N+NL LQL K+QESNAELV  +Q+++  +++K  EI +L
Sbjct  401   HEKDMNANLRLQLNKTQESNAELVLAVQDLDAMLEQKNKEIHSL  444



>ref|XP_010418352.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X2 [Camelina sativa]
 ref|XP_010418353.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X3 [Camelina sativa]
 ref|XP_010418354.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X4 [Camelina sativa]
Length=1034

 Score = 54.7 bits (130),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 93/170 (55%), Gaps = 2/170 (1%)
 Frame = +1

Query  829   TRTSIPDANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESN  1008
             TR S  +  +E+LK E       A    +++++LRK+   +++R  D+  E+++   E +
Sbjct  284   TRNSSDEDEVEKLKTEVAGLTRQADLSEMELQSLRKQIVKETKRSQDLLREVNSLKQERD  343

Query  1009  RLMHDIKRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRK  1188
              L  D +R +V  ++   +      L  + ++   +L+E  +EL ++ +   NL LQL+K
Sbjct  344   TLKQDCERHKVS-DKHQGESKMRNRLQFEGRDPWILLEETREELDYEKDRIFNLRLQLQK  402

Query  1189  SQESNAELVSVLQEMEETVQKKKIEIENLLALNSRSD-VMGVINSCGDED  1335
             +QESN+EL+  +Q++EE +++K  E   L + +  SD +   + S  DED
Sbjct  403   TQESNSELILAVQDLEEMLEEKSKEGAELPSKSRTSDEIQESMRSETDED  452



>gb|KHN16837.1| hypothetical protein glysoja_002934 [Glycine soja]
Length=1086

 Score = 54.7 bits (130),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 79/136 (58%), Gaps = 1/136 (1%)
 Frame = +1

Query  847   DANIEELKAEARMWELNARRLMVKMETLRKEFANQSQRIADMEMELSTAHTESNRLMHDI  1026
             D  IE LKAE       A    ++++TLRK+   +S+R  ++  E+ +   E + L  + 
Sbjct  299   DMEIERLKAELAALARQADMSDLELQTLRKQIVKESKRGQELSKEIISLKEERDALKIEC  358

Query  1027  KRLEVLLEESNAKQIAAENLNLQAKNTENILKEMEDELKFQTESNSNLSLQLRKSQESNA  1206
               L    ++    ++++    L + +   +++E+  ELK++ E N+NL LQL+K+Q++N+
Sbjct  359   DNLRSFRKQMEEAKVSSRP-PLDSGDLCTLVEEIRQELKYEKELNANLQLQLKKTQDANS  417

Query  1207  ELVSVLQEMEETVQKK  1254
             ELV  +Q+++E +++K
Sbjct  418   ELVLAVQDLDEMLEQK  433



Lambda      K        H        a         alpha
   0.312    0.128    0.350    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 15834400867600