BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c26475_g1_i1 len=2587 path=[2565:0-2586]

Length=2587
                                                                      Score     E

ref|XP_011038011.1|  PREDICTED: subtilisin-like protease SBT3.5         659   0.0      
ref|XP_006358675.1|  PREDICTED: xylem serine proteinase 1-like          660   0.0      
ref|XP_002518937.1|  Cucumisin precursor, putative                      645   0.0      Ricinus communis
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease                643   0.0      
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg             642   0.0      
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg             639   0.0      
ref|XP_002317663.1|  subtilase family protein                           638   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011079238.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    638   0.0      
ref|XP_009348696.1|  PREDICTED: subtilisin-like protease SBT5.4         637   0.0      
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3         635   0.0      
ref|XP_006351094.1|  PREDICTED: cucumisin-like                          635   0.0      
ref|XP_004309572.1|  PREDICTED: subtilisin-like protease-like           636   0.0      
ref|XP_011038008.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    630   0.0      
ref|XP_007039203.1|  Subtilase family protein, putative                 629   0.0      
ref|XP_004309570.1|  PREDICTED: subtilisin-like protease-like           625   0.0      
ref|XP_010529677.1|  PREDICTED: subtilisin-like protease SBT3.3         622   0.0      
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    645   0.0      
ref|XP_002298973.2|  subtilase family protein                           623   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3         619   0.0      
ref|XP_010529408.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    615   0.0      
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    611   0.0      
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg             612   0.0      
ref|XP_006306822.1|  hypothetical protein CARUB_v10008364mg             611   0.0      
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5         612   0.0      
ref|XP_009128710.1|  PREDICTED: subtilisin-like protease SBT5.3         611   0.0      
ref|XP_006306820.1|  hypothetical protein CARUB_v10008362mg             610   0.0      
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5         610   0.0      Vitis vinifera
ref|XP_010529409.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    609   0.0      
ref|XP_010478712.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    609   0.0      
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3         608   0.0      
ref|XP_010461118.1|  PREDICTED: subtilisin-like protease SBT3.5         608   0.0      
ref|XP_010499844.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    608   0.0      
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3         603   0.0      
ref|NP_567359.1|  Subtilase family protein                              602   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007039330.1|  Subtilase family protein, putative                 611   0.0      
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5         602   0.0      
ref|XP_009132975.1|  PREDICTED: subtilisin-like protease SBT5.3         601   0.0      
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3         601   0.0      
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    600   0.0      
ref|XP_002891021.1|  predicted protein                                  600   0.0      
ref|XP_011081356.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    600   0.0      
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3         599   0.0      
emb|CDY25259.1|  BnaA02g21970D                                          598   0.0      
emb|CBI23086.3|  unnamed protein product                                602   0.0      
ref|XP_011081355.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    600   0.0      
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3         598   0.0      
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    598   0.0      
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3         598   0.0      
emb|CDX84657.1|  BnaA03g15730D                                          597   0.0      
ref|XP_006286454.1|  hypothetical protein CARUB_v10000290mg             597   0.0      
ref|NP_567362.1|  subtilisin-like protease                              597   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190697.1|  subtilisin-like protease                           597   0.0      
ref|XP_010529679.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    594   0.0      
ref|XP_002888489.1|  subtilase family protein                           595   0.0      
ref|XP_010551747.1|  PREDICTED: subtilisin-like protease SBT3.5         595   0.0      
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3         593   0.0      
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3         594   0.0      
ref|XP_006415135.1|  hypothetical protein EUTSA_v10006863mg             594   0.0      
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg             594   0.0      
ref|XP_010104913.1|  Subtilisin-like protease                           594   0.0      
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg                593   0.0      
ref|XP_002891022.1|  subtilase family protein                           592   0.0      
ref|NP_193895.2|  Subtilase family protein                              590   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    591   0.0      
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3         590   0.0      
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3         590   0.0      
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg             590   0.0      
ref|XP_011038010.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    588   0.0      
ref|XP_010436973.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    589   0.0      
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    590   0.0      
ref|NP_567633.2|  Subtilase family protein                              589   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX94043.1|  BnaC07g36770D                                          589   0.0      
ref|XP_002874634.1|  subtilase family protein                           589   0.0      
ref|XP_010554964.1|  PREDICTED: subtilisin-like protease SBT3.3         588   0.0      
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       588   0.0      
emb|CDX93811.1|  BnaA09g24110D                                          587   0.0      
gb|KFK31853.1|  hypothetical protein AALP_AA6G166900                    588   0.0      
ref|NP_564869.1|  Subtilase-like protein                                587   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529680.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    585   0.0      
ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    587   0.0      
emb|CDY67954.1|  BnaAnng25710D                                          587   0.0      
ref|NP_567361.1|  Subtilase family protein                              587   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             587   0.0      Populus trichocarpa [western balsam poplar]
emb|CBI23066.3|  unnamed protein product                                584   0.0      
ref|NP_567360.1|  Subtilase family protein                              585   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK28745.1|  hypothetical protein AALP_AA7G041500                    586   0.0      
gb|KFK41045.1|  hypothetical protein AALP_AA2G078300                    585   0.0      
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         585   0.0      
ref|XP_002278450.2|  PREDICTED: subtilisin-like protease SBT3.3         585   0.0      Vitis vinifera
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       586   0.0      
emb|CAB40021.1|  subtilisin-like protease-like protein                  584   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         583   0.0      
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3         582   0.0      
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    580   0.0      
ref|XP_002874635.1|  subtilase family protein                           582   0.0      
ref|XP_010528996.1|  PREDICTED: subtilisin-like protease SBT3.5         581   0.0      
ref|XP_006829610.1|  hypothetical protein AMTR_s00122p00026080          580   0.0      
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3         580   0.0      
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         580   0.0      
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    578   0.0      
ref|NP_564412.1|  Subtilase 3.5                                         579   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg             578   0.0      
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             579   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_567358.1|  Subtilase family protein                              577   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529681.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    575   0.0      
ref|XP_002872521.1|  predicted protein                                  577   0.0      
emb|CBI34615.3|  unnamed protein product                                575   0.0      
ref|NP_567632.1|  Subtilase family protein                              576   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAD03438.1|  similar to the subtilase family of serine proteas...    576   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891020.1|  subtilase family protein                           575   0.0      
emb|CAN80173.1|  hypothetical protein VITISV_018392                     580   0.0      Vitis vinifera
gb|KFK41050.1|  hypothetical protein AALP_AA2G078900                    575   0.0      
ref|XP_009344068.1|  PREDICTED: subtilisin-like protease SBT5.3         574   0.0      
emb|CDY07491.1|  BnaA07g25700D                                          574   0.0      
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg             575   0.0      
emb|CDX98693.1|  BnaA03g44780D                                          573   0.0      
gb|KCW72614.1|  hypothetical protein EUGRSUZ_E01074                     573   0.0      
ref|XP_010470495.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    573   0.0      
ref|NP_564413.2|  subtilase family protein                              573   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    571   0.0      
ref|XP_010511549.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    572   0.0      
ref|XP_009105192.1|  PREDICTED: subtilisin-like protease SBT5.3         572   0.0      
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         573   0.0      
ref|XP_010056036.1|  PREDICTED: subtilisin-like protease SBT5.3         572   0.0      
gb|KFK31852.1|  hypothetical protein AALP_AA6G166800                    592   0.0      
emb|CDX94251.1|  BnaC02g29110D                                          570   0.0      
emb|CBI34614.3|  unnamed protein product                                603   0.0      
ref|XP_010538683.1|  PREDICTED: subtilisin-like protease SBT3.5         566   0.0      
ref|XP_010437025.1|  PREDICTED: subtilisin-like protease SBT3.5         569   0.0      
ref|NP_001078370.1|  subtilisin-like protease                           567   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98849.1|  subtilisin-like protease -like protein                 566   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5         590   0.0      
ref|XP_006286616.1|  hypothetical protein CARUB_v10002407mg             566   0.0      
ref|XP_010436935.1|  PREDICTED: subtilisin-like protease SBT3.3         567   0.0      
ref|XP_002867836.1|  subtilase family protein                           566   0.0      
ref|XP_006301525.1|  hypothetical protein CARUB_v10021953mg             566   0.0      
ref|XP_006391365.1|  hypothetical protein EUTSA_v10018142mg             566   0.0      
ref|NP_564868.2|  Subtilisin-like serine endopeptidase family pro...    565   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAF31277.1|AC006424_6  Second of four adjacent putative subtil...    565   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3         565   0.0      
ref|XP_008775642.1|  PREDICTED: subtilisin-like protease SBT5.3         563   0.0      
ref|XP_010463200.1|  PREDICTED: subtilisin-like protease SBT3.5         563   0.0      
gb|AAG51763.1|AC066691_3  hypothetical protein; 8963-6048               563   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CBI23085.3|  unnamed protein product                                592   0.0      
gb|AAL24366.1|  subtilisin proteinase-like                              560   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX79081.1|  BnaA01g11480D                                          561   0.0      
ref|XP_002887016.1|  subtilase family protein                           560   0.0      
ref|XP_002893749.1|  hypothetical protein ARALYDRAFT_473479             559   0.0      
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    561   0.0      
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg             561   0.0      
ref|XP_006304869.1|  hypothetical protein CARUB_v10012621mg             560   0.0      
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like           560   0.0      
ref|XP_009105193.1|  PREDICTED: subtilisin-like protease SBT5.3         558   0.0      
ref|XP_010474133.1|  PREDICTED: subtilisin-like protease SBT3.3         558   0.0      
ref|XP_002872522.1|  subtilase family protein                           557   0.0      
emb|CDY49641.1|  BnaCnng17930D                                          557   0.0      
ref|XP_002518939.1|  Cucumisin precursor, putative                      557   0.0      Ricinus communis
ref|XP_002871506.1|  subtilase family protein                           556   0.0      
gb|AET04097.2|  subtilisin-like serine protease                         557   0.0      
ref|XP_006399712.1|  hypothetical protein EUTSA_v10012766mg             556   0.0      
ref|NP_568255.1|  Subtilase family protein                              556   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480961.1|  PREDICTED: subtilisin-like protease SBT3.5         555   0.0      
ref|XP_006397047.1|  hypothetical protein EUTSA_v10028468mg             555   0.0      
emb|CDY07492.1|  BnaA07g25710D                                          555   0.0      
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...    556   0.0      
emb|CDX82843.1|  BnaC01g12930D                                          555   0.0      
emb|CDX98690.1|  BnaA03g44750D                                          552   0.0      
emb|CDY49640.1|  BnaCnng17920D                                          554   0.0      
ref|XP_010538146.1|  PREDICTED: subtilisin-like protease SBT3.5         555   0.0      
ref|XP_006286458.1|  hypothetical protein CARUB_v10000288mg             553   0.0      
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g             553   0.0      
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...    553   0.0      
emb|CDX91186.1|  BnaC02g04110D                                          551   0.0      
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5         552   1e-180   
ref|XP_010499843.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    563   2e-180   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                551   2e-180   
ref|XP_003629621.1|  Subtilisin-like protease                           551   3e-180   
ref|XP_010419003.1|  PREDICTED: subtilisin-like protease SBT3.3         548   4e-180   
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g             549   1e-179   Populus trichocarpa [western balsam poplar]
emb|CAB36808.1|  subtilisin-like protease                               548   4e-179   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125836.1|  PREDICTED: subtilisin-like protease SBT5.4         547   4e-179   
emb|CDY54842.1|  BnaC05g51310D                                          566   7e-179   
ref|XP_006391366.1|  hypothetical protein EUTSA_v10018188mg             545   8e-179   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      547   9e-179   
ref|XP_010449086.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    546   1e-178   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             545   1e-178   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                546   1e-178   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3         546   1e-178   
gb|KFK45042.1|  hypothetical protein AALP_AA1G336600                    545   2e-178   
gb|EAZ09847.1|  hypothetical protein OsI_32138                          546   2e-178   Oryza sativa Indica Group [Indian rice]
emb|CAB87667.1|  subtilisin-like protease-like protein                  546   2e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5         546   2e-178   
ref|XP_002512984.1|  Xylem serine proteinase 1 precursor, putative      546   3e-178   Ricinus communis
dbj|BAK05842.1|  predicted protein                                      545   3e-178   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg             545   5e-178   
ref|XP_006289915.1|  hypothetical protein CARUB_v10003531mg             544   7e-178   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          544   8e-178   Sorghum bicolor [broomcorn]
emb|CDX93808.1|  BnaA09g24080D                                          543   1e-177   
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    543   2e-177   
ref|XP_010437012.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    539   3e-177   
ref|XP_006283179.1|  hypothetical protein CARUB_v10004209mg             542   4e-177   
ref|XP_010104911.1|  Subtilisin-like protease SDD1                      543   4e-177   
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like      543   5e-177   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1           543   6e-177   
gb|KDP41723.1|  hypothetical protein JCGZ_26741                         542   8e-177   
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                     540   3e-176   
emb|CAB36809.1|  subtilisin proteinase-like                             538   3e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3         541   4e-176   
gb|AGN12874.1|  putative transcription factor DYSFUNCTIONAL TAPET...    539   9e-176   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    538   3e-175   
ref|XP_004309569.1|  PREDICTED: subtilisin-like protease SDD1-like      539   7e-175   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg             537   8e-175   
ref|NP_001063751.1|  Os09g0530800                                       536   8e-175   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    536   1e-174   
ref|XP_006413795.1|  hypothetical protein EUTSA_v10024459mg             537   1e-174   
ref|XP_010513580.1|  PREDICTED: subtilisin-like protease SBT3.3         535   1e-174   
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like           535   3e-174   
ref|NP_567624.1|  Subtilase family protein                              536   4e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413752.1|  hypothetical protein EUTSA_v10027359mg             533   4e-174   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease                534   6e-174   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     534   1e-173   Zea mays [maize]
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             533   3e-173   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       533   4e-173   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    532   5e-173   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          532   7e-173   
emb|CDX93810.1|  BnaA09g24100D                                          531   8e-173   
gb|AID21582.1|  AT4G21323p                                              533   8e-173   
gb|AID21654.1|  At4g21323p-like protein                                 533   9e-173   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1           531   1e-172   
ref|XP_010436981.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    527   1e-172   
gb|AID21627.1|  At4g21323p-like protein                                 532   2e-172   
gb|KCW72613.1|  hypothetical protein EUGRSUZ_E01073                     548   7e-172   
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like           528   1e-171   
ref|XP_006301478.1|  hypothetical protein CARUB_v10021900mg             527   1e-171   
ref|XP_010478713.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    524   1e-171   
ref|XP_006287131.1|  hypothetical protein CARUB_v10000302mg             527   1e-171   
emb|CCI61493.1|  unnamed protein product                                529   2e-171   
gb|AID21602.1|  At4g21323p-like protein                                 529   2e-171   
gb|KHN39834.1|  Cucumisin                                               526   6e-171   
ref|NP_001169390.1|  putative subtilase family protein precursor        526   6e-171   Zea mays [maize]
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...    526   7e-171   
gb|AID21686.1|  At4g21323p-like protein                                 528   7e-171   
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             526   8e-171   
gb|AID21679.1|  At4g21323p-like protein                                 528   8e-171   
ref|XP_003537841.1|  PREDICTED: cucumisin-like                          526   1e-170   
ref|XP_002298974.2|  hypothetical protein POPTR_0001s45470g             525   1e-170   Populus trichocarpa [western balsam poplar]
gb|AID21581.1|  AT4G21326p                                              525   2e-170   
gb|AID21619.1|  At4g21323p-like protein                                 526   2e-170   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5         525   2e-170   
emb|CCI61494.1|  unnamed protein product                                524   3e-170   
emb|CDY61569.1|  BnaCnng38020D                                          536   5e-170   
ref|XP_010449088.1|  PREDICTED: subtilisin-like protease SBT3.5         525   5e-170   
gb|AID21678.1|  At4g21326p-like protein                                 523   6e-170   
gb|KFK45041.1|  hypothetical protein AALP_AA1G336500                    521   6e-170   
ref|XP_006413792.1|  hypothetical protein EUTSA_v10024501mg             523   7e-170   
ref|XP_010109770.1|  hypothetical protein L484_008446                   522   1e-169   
gb|AID21685.1|  At4g21326p-like protein                                 523   1e-169   
gb|AID21628.1|  At4g21326p-like protein                                 522   2e-169   
emb|CAH66111.1|  OSIGBa0115D20.4                                        522   2e-169   Oryza sativa [red rice]
ref|XP_004292430.1|  PREDICTED: subtilisin-like protease-like           523   2e-169   
emb|CAE01678.2|  OSJNBb0089K24.3                                        522   2e-169   Oryza sativa Japonica Group [Japonica rice]
gb|AID21603.1|  At4g21326p-like protein                                 522   3e-169   
ref|XP_006283139.1|  hypothetical protein CARUB_v10004165mg             523   4e-169   
gb|AID21653.1|  At4g21326p-like protein                                 521   8e-169   
gb|EEC67681.1|  hypothetical protein OsI_35120                          519   3e-168   Oryza sativa Indica Group [Indian rice]
emb|CDX99526.1|  BnaC09g24660D                                          519   3e-168   
ref|NP_567625.4|  subtilase 3.12                                        519   4e-168   Arabidopsis thaliana [mouse-ear cress]
gb|KHG28029.1|  Subtilisin-like protease SDD1                           519   5e-168   
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       519   1e-167   
gb|ADQ37388.1|  unknown                                                 515   2e-167   
emb|CDX94044.1|  BnaC07g36780D                                          515   6e-167   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5         516   6e-167   
ref|XP_003581342.1|  PREDICTED: subtilisin-like protease SBT3.3         514   2e-166   
emb|CAE01679.2|  OSJNBb0089K24.4                                        514   2e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010456502.1|  PREDICTED: subtilisin-like protease SBT3.3         515   2e-166   
gb|EMS53237.1|  Subtilisin-like protease                                514   2e-166   
ref|NP_174573.1|  Subtilisin-like serine endopeptidase family pro...    513   3e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006580142.1|  PREDICTED: subtilisin-like protease SDD1-lik...    511   4e-166   
ref|XP_010470496.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    511   4e-166   
emb|CBI38006.3|  unnamed protein product                                514   7e-166   
ref|XP_010511550.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    510   1e-165   
ref|NP_001130788.1|  putative subtilase family protein precursor        513   2e-165   
ref|XP_002447443.1|  hypothetical protein SORBIDRAFT_06g001140          512   2e-165   
dbj|BAJ93156.1|  predicted protein                                      510   4e-165   
emb|CDX86874.1|  BnaA09g22640D                                          511   4e-165   
emb|CDY70485.1|  BnaA03g58450D                                          509   7e-165   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                      511   8e-165   
ref|XP_009137186.1|  PREDICTED: subtilisin-like protease SBT5.3         509   1e-164   
ref|XP_003581117.1|  PREDICTED: subtilisin-like protease SBT3.3         509   2e-164   
ref|XP_008663777.1|  PREDICTED: subtilisin-like protease SBT5.3         510   2e-164   
ref|XP_009128706.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    504   6e-164   
gb|EMS61069.1|  Subtilisin-like protease                                507   1e-163   
ref|XP_004951230.1|  PREDICTED: subtilisin-like protease-like           505   4e-163   
emb|CDX94033.1|  BnaC07g36670D                                          506   9e-163   
ref|XP_010434192.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    505   2e-162   
ref|XP_003572346.1|  PREDICTED: subtilisin-like protease SBT3.5         503   2e-162   
emb|CDX94032.1|  BnaC07g36660D                                          503   9e-162   
emb|CDY58475.1|  BnaA03g58460D                                          503   1e-161   
emb|CDM82077.1|  unnamed protein product                                501   1e-161   
ref|XP_009391853.1|  PREDICTED: subtilisin-like protease SBT5.3         501   2e-161   
gb|EMS63596.1|  Cucumisin                                               502   3e-161   
ref|XP_003572336.1|  PREDICTED: subtilisin-like protease SBT3.5         500   3e-161   
ref|XP_010920365.1|  PREDICTED: subtilisin-like protease SBT3.5         499   4e-161   
gb|ADQ37345.1|  unknown                                                 498   9e-161   
emb|CAE01301.2|  OSJNBa0020P07.18                                       499   2e-160   
ref|XP_009137185.1|  PREDICTED: subtilisin-like protease SBT5.4         499   3e-160   
emb|CDY65868.1|  BnaAnng21170D                                          495   4e-160   
gb|ABV21208.1|  At4g21326                                               496   6e-160   
ref|XP_006580143.1|  PREDICTED: subtilisin-like protease SDD1-lik...    494   8e-160   
ref|XP_010439493.1|  PREDICTED: subtilisin-like protease SBT3.5         498   1e-159   
emb|CAH66108.1|  OSIGBa0115D20.1                                        494   2e-159   
ref|XP_006662913.1|  PREDICTED: cucumisin-like                          496   2e-159   
ref|XP_010434193.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    495   3e-159   
gb|ADQ37368.1|  unknown                                                 493   4e-159   
gb|EMT21268.1|  Subtilisin-like protease                                495   5e-159   
ref|XP_003572330.1|  PREDICTED: subtilisin-like protease SBT3.5         494   8e-159   
gb|ADQ37356.1|  unknown                                                 493   1e-158   
ref|NP_001046522.1|  Os02g0271000                                       492   6e-158   
gb|KDO76781.1|  hypothetical protein CISIN_1g042478mg                   498   2e-157   
ref|XP_006653122.1|  PREDICTED: xylem serine proteinase 1-like          490   4e-157   
ref|XP_006644839.1|  PREDICTED: subtilisin-like protease SDD1-like      488   1e-156   
ref|XP_009420612.1|  PREDICTED: subtilisin-like protease SBT5.4         486   1e-155   
gb|EAZ29545.1|  hypothetical protein OsJ_13620                          485   2e-155   
gb|EEC68285.1|  hypothetical protein OsI_36335                          486   4e-155   
ref|XP_008804316.1|  PREDICTED: subtilisin-like protease SBT5.4         485   6e-155   
dbj|BAJ96374.1|  predicted protein                                      483   1e-154   
ref|XP_009391860.1|  PREDICTED: subtilisin-like protease SBT5.3         482   3e-154   
dbj|BAJ90143.1|  predicted protein                                      482   4e-154   
dbj|BAJ94815.1|  predicted protein                                      482   4e-154   
gb|AHJ61058.1|  Hwi2                                                    481   8e-154   
dbj|BAJ97332.1|  predicted protein                                      481   2e-153   
ref|XP_010931731.1|  PREDICTED: subtilisin-like protease SBT3.5         479   2e-153   
ref|XP_006647148.1|  PREDICTED: subtilisin-like protease-like           482   2e-153   
dbj|BAJ94791.1|  predicted protein                                      480   2e-153   
gb|EMS68678.1|  Subtilisin-like protease                                479   3e-153   
ref|XP_010538433.1|  PREDICTED: subtilisin-like protease SBT5.4         480   5e-153   
ref|XP_009387964.1|  PREDICTED: subtilisin-like protease SBT5.3         479   5e-153   
ref|XP_010931718.1|  PREDICTED: subtilisin-like protease SBT3.5         479   6e-153   
gb|AIC80773.1|  subtilase                                               478   6e-153   
gb|EMT05073.1|  Subtilisin-like protease                                478   1e-152   
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...    476   3e-152   
gb|EMS50761.1|  Subtilisin-like protease                                478   3e-152   
gb|EEC72887.1|  hypothetical protein OsI_06697                          478   7e-152   
ref|XP_008783547.1|  PREDICTED: subtilisin-like protease SBT5.3         474   8e-152   
ref|XP_009391852.1|  PREDICTED: subtilisin-like protease SBT5.3         476   1e-151   
emb|CAA20197.1|  putative protein                                       498   2e-151   
ref|XP_002456475.1|  hypothetical protein SORBIDRAFT_03g037010          474   4e-151   
ref|XP_009391854.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    474   6e-151   
ref|NP_001046517.1|  Os02g0269600                                       473   8e-151   
emb|CDM80018.1|  unnamed protein product                                473   1e-150   
ref|NP_001044505.1|  Os01g0794800                                       473   1e-150   
ref|XP_002869894.1|  hypothetical protein ARALYDRAFT_329472             494   9e-150   
ref|XP_006398487.1|  hypothetical protein EUTSA_v10001201mg             471   2e-149   
gb|EAZ13817.1|  hypothetical protein OsJ_03742                          470   2e-149   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             470   2e-149   
gb|EMT17675.1|  Subtilisin-like protease                                470   2e-149   
gb|EMT19033.1|  Subtilisin-like protease                                471   3e-149   
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative      469   5e-149   
emb|CDM80022.1|  unnamed protein product                                469   7e-149   
gb|EMS63058.1|  Subtilisin-like protease                                468   1e-148   
ref|XP_008674940.1|  PREDICTED: subtilisin-like protease SBT5.3         467   2e-148   
gb|EEE56708.1|  hypothetical protein OsJ_06199                          467   3e-148   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4         466   9e-148   
emb|CDM84531.1|  unnamed protein product                                465   1e-147   
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                465   3e-147   
ref|XP_010256205.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    466   5e-147   
ref|XP_010934029.1|  PREDICTED: subtilisin-like protease SBT3.5         462   5e-147   
ref|XP_007042043.1|  Subtilase family protein, putative isoform 2       459   1e-146   
ref|XP_002451012.1|  hypothetical protein SORBIDRAFT_05g022600          462   1e-146   
gb|EMT13355.1|  Subtilisin-like protease                                462   1e-146   
ref|XP_010934028.1|  PREDICTED: subtilisin-like protease SBT3.5         460   2e-146   
emb|CDP06146.1|  unnamed protein product                                463   2e-146   
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                463   2e-146   
ref|XP_004499342.1|  PREDICTED: subtilisin-like protease-like           462   3e-146   
ref|XP_010107369.1|  Subtilisin-like protease                           462   3e-146   
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         462   5e-146   
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         462   5e-146   
dbj|BAJ96317.1|  predicted protein                                      460   1e-145   
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3         461   1e-145   
gb|EMS55531.1|  Subtilisin-like protease                                458   2e-145   
ref|XP_010942695.1|  PREDICTED: subtilisin-like protease SBT5.3         459   3e-145   
gb|AIC80771.1|  subtilase                                               459   4e-145   
ref|XP_010647020.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    459   4e-145   
emb|CBI38460.3|  unnamed protein product                                460   4e-145   
ref|XP_008810184.1|  PREDICTED: subtilisin-like protease SBT5.3         459   5e-145   
gb|EMS50759.1|  Subtilisin-like protease                                459   6e-145   
ref|XP_004970241.1|  PREDICTED: subtilisin-like protease SDD1-lik...    458   9e-145   
emb|CDM80019.1|  unnamed protein product                                457   1e-144   
ref|XP_003625338.1|  Subtilisin-like serine protease                    458   1e-144   
emb|CDY40408.1|  BnaA02g27220D                                          458   2e-144   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         457   2e-144   
ref|XP_004970240.1|  PREDICTED: subtilisin-like protease SDD1-lik...    457   2e-144   
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         456   1e-143   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             455   1e-143   
ref|XP_008804320.1|  PREDICTED: subtilisin-like protease SBT5.3         456   2e-143   
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         455   2e-143   
ref|XP_003600434.1|  Subtilisin-like protease                           454   2e-143   
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                455   2e-143   
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         455   3e-143   
ref|XP_011048159.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    456   3e-143   
gb|EEC76686.1|  hypothetical protein OsI_14683                          454   4e-143   
ref|XP_006400913.1|  hypothetical protein EUTSA_v10015943mg             454   4e-143   
ref|XP_009107091.1|  PREDICTED: subtilisin-like protease SBT5.4         454   5e-143   
emb|CDY37334.1|  BnaC02g33520D                                          454   7e-143   
ref|XP_004500162.1|  PREDICTED: subtilisin-like protease-like           453   1e-142   
gb|EMS67122.1|  Subtilisin-like protease                                451   2e-142   
ref|XP_007207186.1|  hypothetical protein PRUPE_ppa017229mg             452   2e-142   
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                   448   2e-142   
ref|XP_007213363.1|  hypothetical protein PRUPE_ppa026835mg             451   2e-142   
ref|XP_009391857.1|  PREDICTED: subtilisin-like protease SBT5.4         451   3e-142   
ref|XP_010103095.1|  Subtilisin-like protease                           453   3e-142   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative      451   4e-142   
ref|XP_011048158.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    453   4e-142   
gb|AES91026.2|  subtilisin-like serine protease                         452   5e-142   
gb|KCW89054.1|  hypothetical protein EUGRSUZ_A01380                     451   5e-142   
gb|KEH32715.1|  subtilisin-like serine protease                         451   5e-142   
ref|XP_008224681.1|  PREDICTED: subtilisin-like protease                451   5e-142   
ref|XP_010048355.1|  PREDICTED: subtilisin-like protease SBT5.3         451   9e-142   
ref|XP_010257694.1|  PREDICTED: subtilisin-like protease SBT3.5         451   9e-142   
ref|NP_001046523.1|  Os02g0271600                                       447   1e-141   
ref|XP_003571633.1|  PREDICTED: subtilisin-like protease SBT5.3         451   1e-141   
ref|XP_004492916.1|  PREDICTED: subtilisin-like protease-like           451   1e-141   
ref|XP_008667736.1|  PREDICTED: uncharacterized protein LOC100278...    449   2e-141   
ref|XP_006350127.1|  PREDICTED: subtilisin-like protease-like           449   2e-141   
gb|ACP18876.1|  subtilisin-like serine protease                         449   3e-141   
ref|XP_006857645.1|  hypothetical protein AMTR_s00061p00140690          449   3e-141   
gb|AES91025.2|  subtilisin-like serine protease                         449   3e-141   
gb|AES70685.2|  subtilisin-like serine protease                         449   4e-141   
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g             448   4e-141   
ref|XP_007207992.1|  hypothetical protein PRUPE_ppa015005mg             448   5e-141   
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like           449   5e-141   
ref|XP_008342263.1|  PREDICTED: subtilisin-like protease                449   5e-141   
ref|XP_008667735.1|  PREDICTED: uncharacterized protein LOC100278...    448   6e-141   
gb|EYU34388.1|  hypothetical protein MIMGU_mgv1a001745mg                448   6e-141   
ref|XP_004970244.1|  PREDICTED: cucumisin-like                          447   6e-141   
gb|EAY76130.1|  hypothetical protein OsI_04059                          449   7e-141   
ref|XP_008667730.1|  PREDICTED: uncharacterized protein LOC100278...    448   7e-141   
ref|XP_010647021.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    447   7e-141   
ref|XP_004243217.1|  PREDICTED: subtilisin-like protease SBT5.3         448   8e-141   
gb|KDO54486.1|  hypothetical protein CISIN_1g003970mg                   448   1e-140   
gb|EMT05074.1|  Subtilisin-like protease                                457   1e-140   
ref|NP_001044507.1|  Os01g0795000                                       446   1e-140   
ref|XP_006826300.1|  hypothetical protein AMTR_s00004p00071240          448   2e-140   
ref|XP_004294696.1|  PREDICTED: subtilisin-like protease-like           447   3e-140   
ref|XP_009587856.1|  PREDICTED: subtilisin-like protease SBT5.4         447   3e-140   
ref|XP_011022895.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    446   3e-140   
ref|XP_003608829.1|  Subtilisin-like serine protease                    447   3e-140   
ref|XP_004159123.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    446   4e-140   
ref|XP_004251819.1|  PREDICTED: subtilisin-like protease SBT5.3         446   4e-140   
ref|XP_002269375.1|  PREDICTED: subtilisin-like protease SBT5.3         447   4e-140   
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3         446   4e-140   
emb|CDP06171.1|  unnamed protein product                                446   4e-140   
ref|XP_002530614.1|  Cucumisin precursor, putative                      446   5e-140   
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3         446   5e-140   
ref|XP_007214967.1|  hypothetical protein PRUPE_ppa001732mg             446   6e-140   
ref|XP_004139597.1|  PREDICTED: subtilisin-like protease-like           445   6e-140   
ref|XP_004970239.1|  PREDICTED: subtilisin-like protease-like           445   6e-140   
ref|XP_002522297.1|  Xylem serine proteinase 1 precursor, putative      446   7e-140   
ref|XP_002266728.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    446   8e-140   
ref|XP_006282063.1|  hypothetical protein CARUB_v10028308mg             446   9e-140   
ref|XP_003608828.1|  Subtilisin-like serine protease                    446   1e-139   
ref|NP_200789.2|  Subtilase 5.4                                         446   1e-139   
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3         445   2e-139   
ref|XP_009361505.1|  PREDICTED: subtilisin-like protease SBT5.3         445   2e-139   
gb|AES91027.2|  subtilisin-like serine protease                         445   2e-139   
ref|XP_004148289.1|  PREDICTED: subtilisin-like protease-like           444   2e-139   
ref|XP_004162792.1|  PREDICTED: subtilisin-like protease-like           444   2e-139   
ref|XP_009803454.1|  PREDICTED: subtilisin-like protease SBT5.3         444   3e-139   
ref|XP_007020377.1|  Xylem serine proteinase 1, putative                444   3e-139   
ref|XP_009759335.1|  PREDICTED: subtilisin-like protease SBT5.4         444   3e-139   
ref|XP_008464322.1|  PREDICTED: subtilisin-like protease                444   3e-139   
ref|XP_006469402.1|  PREDICTED: subtilisin-like protease-like           444   3e-139   
gb|KGN55998.1|  hypothetical protein Csa_3G045120                       444   3e-139   
ref|XP_004492921.1|  PREDICTED: subtilisin-like protease-like           444   4e-139   
gb|KDO74051.1|  hypothetical protein CISIN_1g044682mg                   443   4e-139   
gb|KGN64982.1|  hypothetical protein Csa_1G171040                       444   4e-139   
gb|KHN11556.1|  Subtilisin-like protease                                444   4e-139   
ref|XP_003533568.1|  PREDICTED: subtilisin-like protease-like           444   4e-139   
gb|KDP29034.1|  hypothetical protein JCGZ_16423                         444   6e-139   
ref|XP_002269259.3|  PREDICTED: subtilisin-like protease SBT5.4         442   7e-139   
dbj|BAC22315.1|  putative subtilisin-like serine protease AIR3          443   7e-139   
gb|KDP21172.1|  hypothetical protein JCGZ_21643                         444   7e-139   
ref|XP_006365013.1|  PREDICTED: subtilisin-like protease-like           443   8e-139   
ref|XP_010647022.1|  PREDICTED: subtilisin-like protease SBT5.3         442   8e-139   
ref|XP_009606152.1|  PREDICTED: subtilisin-like protease SBT5.4         442   8e-139   
gb|AIC80772.1|  subtilase                                               442   8e-139   
ref|XP_009782970.1|  PREDICTED: subtilisin-like protease SBT5.4         442   9e-139   
ref|XP_007217687.1|  hypothetical protein PRUPE_ppa001727mg             443   9e-139   
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg             438   9e-139   
ref|XP_009604273.1|  PREDICTED: subtilisin-like protease SBT5.3         443   9e-139   
ref|XP_006447860.1|  hypothetical protein CICLE_v10014355mg             443   1e-138   
ref|XP_011022894.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    442   1e-138   
dbj|BAB08348.1|  serine protease-like protein                           442   1e-138   
ref|XP_004970242.1|  PREDICTED: subtilisin-like protease SDD1-like      442   1e-138   
emb|CBI38458.3|  unnamed protein product                                442   1e-138   
ref|NP_001052072.2|  Os04g0121300                                       440   1e-138   
ref|XP_002309930.2|  hypothetical protein POPTR_0007s04500g             441   2e-138   
ref|XP_008384293.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    442   2e-138   
ref|XP_006449587.1|  hypothetical protein CICLE_v10014347mg             442   2e-138   
ref|XP_008229767.1|  PREDICTED: subtilisin-like protease                442   2e-138   



>ref|XP_011038011.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=781

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/776 (48%), Positives = 487/776 (63%), Gaps = 53/776 (7%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             V  +N +K++IVY+G K H + + I +SH D+LA VVGS E A K+M+YSY++GFSGFAA
Sbjct  33    VSADNTRKVHIVYMGEKQHSNLKLITDSHIDMLASVVGSKEAAVKSMIYSYQHGFSGFAA  92

Query  2234  VLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIV  2055
             +L+  QAK +A + GVV V  ++ H +QT+RSWD+LGLS   + P  L  K  KGDG+I+
Sbjct  93    MLSKDQAKMIAELPGVVHVTRNQLHSLQTTRSWDYLGLS--THYPSNLSHKAKKGDGIII  150

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             G  DSG+  E   F D G GPVP RWKG C +  G  FN +  CN+K+IGA+WF  G L 
Sbjct  151   GFFDSGVWPESEVFDDEGYGPVPTRWKGHCDS--GQLFNATADCNKKLIGAKWFIDGFLA  208

Query  1874  SQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVAS  1695
                   N     D  S  DV GHG+ V++I AGSFV N +  G+ +G+ RG AT AR+A 
Sbjct  209   ENKEPFNTTEKPDYLSPRDVVGHGTHVSAIAAGSFVSNTSFKGLGLGLARGAATRARIAM  268

Query  1694  YKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFH  1515
             YK  WN+ P   +C+ ADLL A D AIHD VD++S+S+GS VPL SD++  +GI IG+FH
Sbjct  269   YKVFWNVGP--VICSSADLLRAFDEAIHDGVDLLSLSIGSFVPLFSDVDERDGIAIGAFH  326

Query  1514  AITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLP  1335
             A+ +GIPVI AAGN GP A TI N  PW++TVAAST+DR F   +TLGN           
Sbjct  327   AVAKGIPVIAAAGNTGPHAQTIQNTAPWILTVAASTVDRSFPTLLTLGN-----------  375

Query  1334  NGTALSHPLHFAGKYMGEADLM--------------PRKLDPAEVKGKIVFMFGDDLDRN  1197
             N T +   L FAGK +G   L+                  +   V GK+V  F   +   
Sbjct  376   NITIMGQAL-FAGKEIGFTGLVYPETSELVYPSFCESLSFNNTSVDGKVVLCF-TTVGSR  433

Query  1196  LVLVDKAT---DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMT  1029
              VL   A+   +AG VGVI + NPS  D L       P V VDY+ GT+I  YI +S  +
Sbjct  434   AVLTTAASAVREAGGVGVIVARNPS--DMLGSCGNDFPCVVVDYELGTQILFYI-RSARS  490

Query  1028  PTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCAD----PTSDG  861
             PT ++S  K  VG  +  KV DFSSRGPSS AP I+KPDIAAPG  I+ A     P   G
Sbjct  491   PTVKISPSKTLVGNPVATKVADFSSRGPSSIAPAILKPDIAAPGVSILAASSPAYPFEAG  550

Query  860   GFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLR  681
             GF I SGTS + PHVS IVALLK   P WSPAAI+SA+VTTAW SD Y  PIF++GS+ +
Sbjct  551   GFSILSGTSFSTPHVSGIVALLKAIQPNWSPAAIRSAIVTTAWKSDPYGEPIFSEGSTWK  610

Query  680   AADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEE  501
              AD FD+GGG+VNPN A +PGLVYDM   DY  YLCA+GYN+S I   +          +
Sbjct  611   LADPFDFGGGLVNPNKAAEPGLVYDMGTNDYIHYLCAVGYNDSSISLVVG---------K  661

Query  500   HTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKP  321
              T CP T+PS+LD+NLPS+ +P+L K V L RTV NVG VNS+YK+++  P+G  V+V+P
Sbjct  662   VTTCPGTKPSILDVNLPSITIPNLSKSVVLTRTVKNVGSVNSMYKSLIVPPIGISVSVRP  721

Query  320   KVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             + L F+    + SF +  +    VN+ F FGSLTW+DG H V +PI+VR  I+  Y
Sbjct  722   QTLIFNSTTNRVSFKVTFTTTHKVNTRFYFGSLTWTDGFHAVTSPISVRTQIIQSY  777



>ref|XP_006358675.1| PREDICTED: xylem serine proteinase 1-like [Solanum tuberosum]
Length=1174

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/754 (48%), Positives = 483/754 (64%), Gaps = 23/754 (3%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YI+YLG KPHDDH  I +SH+D+L+ V GS EEA+K M+YSYR+GFSGFAA LT SQA
Sbjct  431   KVYIIYLGHKPHDDHELITDSHHDILSQVAGSKEEAKKMMMYSYRHGFSGFAAKLTNSQA  490

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K++  +  VV V+++  +   TSRSWDFLGLS   N P  LL KTN+GDGMI+GV+DSGI
Sbjct  491   KQIGELPDVVRVIKNPLYTTHTSRSWDFLGLSR--NSPNNLLNKTNQGDGMIIGVLDSGI  548

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
             S E  +F D GMGP+P RWKG C++     FN +  CN+K+IGARW+ KG +  ++  L+
Sbjct  549   SGESEAFNDNGMGPIPSRWKGICKS--EANFNATIHCNKKIIGARWYIKGFM--EEKGLS  604

Query  1853  KFLVSDSY--SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
             + ++  +Y  S  D +GHGS  AS  AGS+V N    G+++G +RGGA  AR+A YK CW
Sbjct  605   QSIIDKTYNLSAVDASGHGSHCASTAAGSYVNNLQYYGLNMGTIRGGAPLARLAIYKICW  664

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
               +     C+GAD+LA +D AI D VD+IS S+G      +++  E+ +GIGS+HA++ G
Sbjct  665   K-EMMAVYCSGADILAGVDDAIKDGVDIISASIGDIFINIAEVNEESVLGIGSYHAVSHG  723

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I VI A GN+GP + TI+N  PWVITVAAS  DR     +TLGN      D  L      
Sbjct  724   ISVIAAGGNSGPDSNTISNTAPWVITVAASNSDRHIVTPLTLGNNNTILGD-GLFREQIF  782

Query  1319  SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSN  1140
                + F     GE      K    EVKGK++ +F    D  L  +     +G + +I S 
Sbjct  783   GPLITFHNITKGEQ----VKFIANEVKGKVLLVFFQQEDDILASLINLKTSGVLAIIVSI  838

Query  1139  P---SNVDSLPILNARIPYVQVDYDAGTRIKDYIFQS---TMTPTAQLSSPKIQVGRALT  978
             P      D   +    IP V VD + G +I DY  +S      P  +L   +I  G+ + 
Sbjct  839   PPFDEITDYNQLFGIPIPNVYVDLEQGNQIYDYFQRSKSNNQDPMIKLGRSEILEGQEVV  898

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--DPTSDGGFRISSGTSHAAPHVSAIV  804
              KVP FSSRGP++FAP I+KPDIAAPG  I+ A      D GF++ SGTS AAPHVS IV
Sbjct  899   LKVPKFSSRGPNAFAPEILKPDIAAPGVNILAAVRPQKGDHGFQLMSGTSMAAPHVSGIV  958

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADD  624
             ALLK++HP+WSPAAIKSALVTTAWN DTY S I+++G+  + AD FD+GGGI NPN A D
Sbjct  959   ALLKVAHPDWSPAAIKSALVTTAWNEDTYKSEIYSEGAGDKIADPFDFGGGICNPNGATD  1018

Query  623   PGLVYDMRGIDYAQYLCALGY-NNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPS  447
             PGLVYDM   DY  YLC+LGY N+ +   T   ++ ++ T    ICP   PS L+LNLPS
Sbjct  1019  PGLVYDMDKNDYLNYLCSLGYSNDKMQNATTLFSKTKNSTSSGIICPNKVPSRLNLNLPS  1078

Query  446   MVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRV  267
             + +P+L   VT++RTVTNVG VN++YK ++K P   VV V P +++F+   KK SF +++
Sbjct  1079  ISIPNLKNSVTIKRTVTNVGNVNAIYKVVIKPPRNTVVKVSPHIVKFNSKTKKISFEVKI  1138

Query  266   SADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             ++     S FTFGSL W+DG H VR PIAVRK +
Sbjct  1139  TSTHQRMSKFTFGSLAWNDGKHFVRIPIAVRKQV  1172



>ref|XP_002518937.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43470.1| Cucumisin precursor, putative [Ricinus communis]
Length=778

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/764 (48%), Positives = 487/764 (64%), Gaps = 39/764 (5%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    ++IVYLG K HDD + I +SH+D+LA +VGS E A + MVYSY++GFSGFAA LT
Sbjct  31    EATSNVHIVYLGEKQHDDLKLITDSHHDMLANIVGSKELASELMVYSYKHGFSGFAAKLT  90

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+K++ + GVV V+ +  HK+QT+RSW+FLGLS  ++ P   L  ++ GDG+I+GV 
Sbjct  91    ESQAQKLSELPGVVRVIPNSLHKLQTTRSWNFLGLS--SHSPTNALHNSSMGDGVIIGVF  148

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  +F D G+GP+P  WKG C  I G RFN +  CN+K+IGARW+  G L    
Sbjct  149   DTGIWPESKAFSDEGLGPIPSHWKGVC--ISGGRFNPTLHCNKKIIGARWYIDGFLAEYG  206

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               +N     +  S  D  GHG+  AS  AG+FV N +  G+  G++RGGA  AR+A YK 
Sbjct  207   KPINTSGDLEFLSARDANGHGTHTASTAAGAFVSNVSYKGLAPGIIRGGAPRARLAIYKV  266

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CW++   +  C+ AD+L AID AIHD VDV+S+S+GS +PL SD++  +GI  GSFHA+ 
Sbjct  267   CWDVLGGQ--CSSADILKAIDEAIHDGVDVMSLSIGSSIPLFSDIDERDGIATGSFHAVA  324

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             RGI V+ AA N GPSA T+ N  PW++TVAAST+DR F   I LGN   +     L   T
Sbjct  325   RGITVVCAAANDGPSAQTVQNTAPWILTVAASTMDRAFPTPIILGNNRTF-----LGQAT  379

Query  1325  ALSHPLHFAGKYMGEAD-LMPR--------KLDPAEVKGKIVFMFGDDLDRNLVL--VDK  1179
                  + F G +  +A  L P          L+   V GK+V  F     R+ V    + 
Sbjct  380   FTGKEIGFRGLFYPQASGLDPNAAGACQSLSLNATLVAGKVVLCFTSTARRSSVTSAAEV  439

Query  1178  ATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
               +AG VG+I + NPS  D+L   N   P ++VD++ GTRI  YI +ST  P  +L   K
Sbjct  440   VKEAGGVGLIVAKNPS--DALYPCNDNFPCIEVDFEIGTRILFYI-RSTRFPQVKLRPSK  496

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTS  834
               VGR L  KV  FSSRGP+S AP I+KPDI APG  I+ A    DP  D G+ + SGTS
Sbjct  497   TIVGRPLLAKVAYFSSRGPNSIAPAILKPDITAPGVNILAATSPLDPFEDNGYTMHSGTS  556

Query  833   HAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGG  654
              +APH+S IVALLK  HP+WSPAAIKSALVTTAW +     PIFA+GSS + A+ FD GG
Sbjct  557   MSAPHISGIVALLKALHPDWSPAAIKSALVTTAWRNHPSGYPIFAEGSSQKLANPFDIGG  616

Query  653   GIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRP  474
             GI NPN A +PGLVYDM   DY  YLCA+GYN++ I          S T +  +CPK   
Sbjct  617   GIANPNGAANPGLVYDMGTPDYVHYLCAMGYNHTAI---------SSLTGQPVVCPKNET  667

Query  473   SMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNR  294
             S+LD+NLPS+ +P+L K VTL RTVTNVG +NS+Y+ +++ P G  ++VKP  L F    
Sbjct  668   SILDINLPSITIPNLRKSVTLTRTVTNVGALNSIYRVVIEPPFGTYISVKPDSLVFSRKT  727

Query  293   KKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             KK +FT+ V+A   VN+ + FGSL+W++GVH V +P++VR  I+
Sbjct  728   KKITFTVTVTAANQVNTGYYFGSLSWTNGVHTVASPMSVRTDIL  771



>ref|XP_008239249.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239250.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239251.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/770 (47%), Positives = 490/770 (64%), Gaps = 55/770 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +++IVYLG K HD+ + + +SH+DLLA + GS E A + MVYSYR+GFSGFAA LT SQA
Sbjct  31    QVHIVYLGEKQHDNPKLLTDSHHDLLATIAGSKELASELMVYSYRHGFSGFAAKLTESQA  90

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +K++ + GVV V+ +  HK+QT+RSWDFLGLS  +  P  +L K++ GDG+I+GV+D+GI
Sbjct  91    QKLSELPGVVRVIPNSLHKLQTTRSWDFLGLS--SQSPSNILHKSSMGDGVIIGVLDTGI  148

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF + G+GPVP  WKG C +  G RFN +  CNRK+IGARWF  G L      LN
Sbjct  149   WPESESFNEKGLGPVPSHWKGVCES--GDRFNATIHCNRKIIGARWFIDGLLAEYGKPLN  206

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +   ++  S  D  GHG+  +S  AGSFV N +  G+  G ++GGA  AR+A YK CW +
Sbjct  207   R--STEFLSPRDAHGHGTHTSSTAAGSFVTNVSYKGLGHGTIKGGAPNARLAIYKVCWKV  264

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                +  C+ AD+L A D AIHD VDV+S+S+GS +PL S+++  +GI  GSFHA+ RGI 
Sbjct  265   LGGQ--CSSADILKAFDEAIHDGVDVLSLSIGSSIPLFSEVDERDGIATGSFHAVARGIT  322

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+  A N GPSA  + N  PW+ITVAAST+DR F  +ITLGN + +        G A+  
Sbjct  323   VVCGAANDGPSAEMVQNTAPWIITVAASTMDRSFPTSITLGNNKTFL-------GQAM--  373

Query  1313  PLHFAGKYMGEADLM---PRKLDPAE-------------VKGKIVFMFGDDLDRNLVLVD  1182
                F G  +G A L+    + LDP               V GK+V  F     R  +   
Sbjct  374   ---FTGPEIGFASLIYPESKGLDPTAAGVCQSLSFNKTMVAGKVVLCFTTVSRRTAITSA  430

Query  1181  KAT--DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
              A   +AG VG+I + NPS  D+L   N   P ++VDY+ GTRI  YI +ST +P  +L+
Sbjct  431   SAAVKEAGGVGLIVAKNPS--DALYPCNEDFPCIEVDYEIGTRILFYI-RSTRSPLVKLT  487

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISS  843
              PK  +G+ L+ KV  FSSRGP+S  P I+KPDIAAPG  I+ A    D   +GG  + S
Sbjct  488   PPKTFIGKPLSAKVAYFSSRGPNSITPAILKPDIAAPGVNILAATSPLDALGEGGHVMHS  547

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFD  663
             GTS + PHV+ IVALLK  HP WSPAAIKSALVTTAW +     PIFA+GS  + A+ FD
Sbjct  548   GTSMSTPHVAGIVALLKAMHPNWSPAAIKSALVTTAWRNGPSGLPIFAEGSPQKLANPFD  607

Query  662   YGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPK  483
             +GGGI+NPN A DPGLVYD+    Y QYLC+ GYNNS I + +  N         T CP 
Sbjct  608   FGGGIMNPNGAADPGLVYDIGKAGYMQYLCSRGYNNSAISRLVGQN---------TKCPI  658

Query  482   TRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFD  303
              +PS+LD+NLPS+ +P L  P+T++R+VTNVG   S+Y+A +++P G +V+V P  L F+
Sbjct  659   KKPSILDMNLPSITIPSLKNPITIKRSVTNVGAPESIYRATIETPFGTIVSVNPNALVFN  718

Query  302   GNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
                +K  FT+ +SA   +N+ + FGSL+W+DGVH VR P++VR   +  Y
Sbjct  719   STVRKLDFTITISAIHRMNTGYYFGSLSWADGVHVVRIPLSVRTEFLQPY  768



>ref|XP_007210025.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
 gb|EMJ11224.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
Length=773

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/782 (47%), Positives = 496/782 (63%), Gaps = 57/782 (7%)
 Frame = -3

Query  2429  GTNAKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGF  2250
             G  AKV + +  +++IVYLG + HD+ + + +SH+DLLA + GS E A + MVYSYR+GF
Sbjct  21    GMIAKVAENS--QVHIVYLGERQHDNPKLLTDSHHDLLATIAGSKELASELMVYSYRHGF  78

Query  2249  SGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKG  2070
             SGFAA LT SQA+K++ + GVV V+ +  HK+QT+RSWDFLGLS  +  P  +L K++ G
Sbjct  79    SGFAAKLTESQAQKLSELPGVVRVIPNSLHKLQTTRSWDFLGLS--SQSPSNILHKSSMG  136

Query  2069  DGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFF  1890
             DG+I+GV+D+GI  E  SF + G+GPVP  WKG C +  G RFN ++ CNRK+IGARWF 
Sbjct  137   DGVIIGVLDTGIWPESESFNEKGLGPVPSHWKGVCES--GDRFNATKHCNRKIIGARWFI  194

Query  1889  KGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATA  1710
              G L      LN+   ++  S  D  GHG+  +S  AGSFV N +  G+  G ++GGA  
Sbjct  195   DGLLTEYGKPLNR--STEFLSPRDAHGHGTHTSSTAAGSFVTNVSYKGLGHGTIKGGAPN  252

Query  1709  ARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIG  1530
             AR+A YK CW +   +  C+ AD+L A D AIHD VDV+S+S+GS +PL S+++  +GI 
Sbjct  253   ARLAIYKVCWKVLGGQ--CSSADILKAFDEAIHDGVDVLSLSIGSSIPLFSEVDERDGIA  310

Query  1529  IGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAV  1350
              GSFHA+ RGI V+  A N GPSA T+ N  PW+ITVAAST+DR F  +ITLGN + +  
Sbjct  311   TGSFHAVARGITVVCGAANDGPSAETVQNTAPWIITVAASTMDRSFPTSITLGNNKTFL-  369

Query  1349  DWQLPNGTALSHPLHFAGKYMGEADLM---PRKLDPAE-------------VKGKIVFMF  1218
                   G A+     F G  +G A L+    + LDP               V GK+V  F
Sbjct  370   ------GQAM-----FTGPEIGFASLIYPESKGLDPTAAGVCQSLSLNKTMVAGKVVLCF  418

Query  1217  GDDLDRNLVLVDKAT--DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYI  1047
                  R  +    A   +AG VG+I + NPS  D+L   N   P  +VDY+ GTRI  YI
Sbjct  419   TTVSRRTAITSASAAVKEAGGVGLIVAKNPS--DALYPCNEDFPCTEVDYEIGTRILFYI  476

Query  1046  FQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----  879
              +ST +P  +L  PK  +G+ L+ KV  FSSRGP+S  P I+KPDIAAPG  I+ A    
Sbjct  477   -RSTRSPLVKLRPPKTFIGKPLSAKVAYFSSRGPNSITPAILKPDIAAPGVNILAATSPL  535

Query  878   DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFA  699
             D   +GG+ + SGTS + PHV+ IVALLK  HP WSPAAIKSALVTTAW +     PIFA
Sbjct  536   DALGEGGYVMHSGTSMSTPHVAGIVALLKAMHPNWSPAAIKSALVTTAWRNGPSGLPIFA  595

Query  698   KGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRN  519
             +GS  + A+ FD+GGGI+NPN A DPGLVYD+    Y QYLC+ GYNNS I + +  N  
Sbjct  596   EGSPQKLANPFDFGGGIMNPNGAADPGLVYDIGKAGYMQYLCSRGYNNSAISRLVGQN--  653

Query  518   RSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGA  339
                    T CP  +PS+LD+NLPS+ +P L  P+T++R+VTNVG   S+Y+A +++P G 
Sbjct  654   -------TKCPIKKPSILDMNLPSITIPSLKNPITIKRSVTNVGAPESIYRATIETPFGT  706

Query  338   VVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVP  159
             +V+V P  L F+   +K  FT+ +S    +N+ + FGSL+W+DGVH V+ P++VR   + 
Sbjct  707   IVSVNPNALVFNSTVRKLDFTITISTIHRMNTGYYFGSLSWADGVHVVKIPLSVRTEFLQ  766

Query  158   LY  153
              Y
Sbjct  767   PY  768



>ref|XP_007210725.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
 gb|EMJ11924.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
Length=783

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/769 (48%), Positives = 481/769 (63%), Gaps = 51/769 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVY+G K H D   +   H+D+LA V+GS E A  +MVYSY++GFSGFAA +T SQA
Sbjct  40    KVHIVYMGEKHHHDPEVVTSLHHDMLASVLGSKEAAYDSMVYSYKHGFSGFAAKVTESQA  99

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +K+A + GV+ V+    + +QT+RSWD+LGLS  +  P  LL  TN GDG+++G++D+GI
Sbjct  100   QKIAELPGVIRVMPSHFYSLQTTRSWDYLGLSPSS--PTNLLHDTNLGDGIVIGLLDTGI  157

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+GP+P +WKG C  + G  FN S  CN+K+IGA+W+  G L       N
Sbjct  158   WPESKVFNDEGLGPIPNQWKGQC--VSGESFNASADCNKKLIGAKWYIDGFLAENKQPFN  215

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  DV GHG+  ++I  GSFV NA+  G+ +G VRGGA  AR+A YK CWN+
Sbjct  216   TTDSPDFLSPRDVFGHGTHTSTIAGGSFVYNASYRGLGLGSVRGGAPRARLAMYKVCWNV  275

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                R  C+ AD+L A D AIHD VDVISVS+G+ +PL S+++  + I IGSFHA+ +GIP
Sbjct  276   --PRGQCSSADILKAFDDAIHDGVDVISVSLGTQLPLFSEVDDRDTISIGSFHAVAKGIP  333

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+  A N GPSA+T+ N  PW++TVAA+TIDR F   ITLGN           N T L  
Sbjct  334   VVCGAANEGPSAYTVENTAPWILTVAATTIDRSFPTPITLGN-----------NLTILGQ  382

Query  1313  PLHFAGKYMGEADLM-PRK---------------LDPAEVKGKIVFMFGDDLDRNLVL--  1188
              + FAGK +G   L+ P                 L+   V G +V  F     R  V   
Sbjct  383   AI-FAGKEVGFTGLVYPENPGLIPSLAGVCESLLLNNTPVAGNVVLCFTTVASRTPVATA  441

Query  1187  VDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSS  1008
             V     AG VGVI +  S  D L   +   P ++VDY+ GT+I  YI +ST +PT +LS 
Sbjct  442   VSSVRAAGGVGVIVAK-SPGDVLGPCSNEFPCIEVDYELGTQILFYI-RSTRSPTVKLSP  499

Query  1007  PKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSG  840
                 VG+ ++ KV  FSSRGP+S AP I+KPDIAAPG  I+      D   DGGF + SG
Sbjct  500   SATLVGKPISTKVATFSSRGPNSIAPAILKPDIAAPGVSILAGSSPYDSFMDGGFALHSG  559

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS A PHVS IVALLK  H  WSPAAI+SALVTTAW +D +  PIFA+GS  + A+ FDY
Sbjct  560   TSMATPHVSGIVALLKALHSNWSPAAIRSALVTTAWKTDPFGEPIFAEGSPQKVANPFDY  619

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGG+VNPN A DPGL+YDM   DY +YLCA+GYN S I + +          + T C   
Sbjct  620   GGGLVNPNKAADPGLIYDMGTEDYIKYLCAVGYNTSAISQLVG---------QTTACSMV  670

Query  479   RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDG  300
             +PS+LD+NLPS+ +P+L + +TL R+VTNVGPVNSVYKA +  P G  V V+P+ L F+ 
Sbjct  671   KPSVLDVNLPSITIPNLRENITLTRSVTNVGPVNSVYKANIDPPPGISVAVRPETLVFNS  730

Query  299   NRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
               K  SFT+ VS    VN+ + FGSLTW+DG H V +PI+VR  I+  Y
Sbjct  731   TIKTISFTVAVSTTHQVNTGYYFGSLTWTDGEHLVTSPISVRTQIIQYY  779



>ref|XP_002317663.1| subtilase family protein [Populus trichocarpa]
 gb|EEE98275.1| subtilase family protein [Populus trichocarpa]
Length=770

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/776 (47%), Positives = 491/776 (63%), Gaps = 56/776 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    ++IVYLGGK HDDH     SH+D+LA VVGS E A + MVYSY++GFSGFAA LT
Sbjct  27    EATSSVHIVYLGGKQHDDHILTTNSHHDMLASVVGSKEMATELMVYSYKHGFSGFAAKLT  86

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+KV+ + GV+ V+ +  H++QT+RSWDFLGLS  ++ P   L K+N GDG+I+GV+
Sbjct  87    ESQAQKVSELPGVIRVIPNSLHRLQTTRSWDFLGLS--SHSPVNTLHKSNMGDGVIIGVL  144

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  +F D G+GP+P  WKG C +  G  F     CNRK+IGARWF  G L    
Sbjct  145   DTGIWPESKAFSDKGLGPIPSHWKGVCES--GTGFEAKNHCNRKIIGARWFVDGFLAEYG  202

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               LN     + +S  D  GHG+  AS  AG+FV N +  G+ +G +RGGA  A++A YK 
Sbjct  203   QPLNTSENREFFSPRDANGHGTHTASTAAGNFVDNVSYRGLGLGTIRGGAPRAQLAIYKV  262

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN+   +  CA AD+L A D AIHD VDV+S+S+GS +PL SD++  + I  GSFHA+ 
Sbjct  263   CWNVLGGQ--CASADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDSIATGSFHAVA  320

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GI V+  A N GPSA T+ N  PW++TVAAS++DR F   ITLGN + +        G 
Sbjct  321   KGITVVCGASNDGPSAQTVQNTAPWILTVAASSMDRAFPTPITLGNNKTF-------RGK  373

Query  1325  ALSHPLHFAGKYMGEADL---MPRKLDP-------------AEVKGKIVFMFGDDLD---  1203
              L     ++G   G  +L   + + LDP             + V GK+V  F        
Sbjct  374   GL-----YSGNDTGFRNLFYPVAKGLDPNSAGVCQSLLVDASTVAGKVVLCFASMTPGAV  428

Query  1202  RNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTP  1026
             R+   V K  +AG  G+I + NPS  D+L       P  +VDY+ GT+I  YI +ST +P
Sbjct  429   RSAAEVVK--EAGGAGLIVAKNPS--DALYPCTDGFPCTEVDYEIGTQILFYI-RSTRSP  483

Query  1025  TAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGG  858
               +LS  K  VG+ +  KV  FSSRGP+S AP I+KPDIAAPG  I+ A      + +GG
Sbjct  484   VVKLSPSKTIVGKPVLAKVAYFSSRGPNSIAPAILKPDIAAPGVNILAATSPLRRSQEGG  543

Query  857   FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRA  678
             + + SGTS A PHVS IVALLK  HP+WSPAAIKS++VTTAW ++    PIFA+GS  + 
Sbjct  544   YTMLSGTSMATPHVSGIVALLKAVHPDWSPAAIKSSIVTTAWRNNPSGFPIFAEGSPQKL  603

Query  677   ADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEH  498
             AD FDYGGGIVNPN A  PGLVYDM   DY  YLCA+ YNN+ I + ++GN         
Sbjct  604   ADTFDYGGGIVNPNGAAYPGLVYDMGTEDYINYLCAMNYNNTAISR-LTGNL--------  654

Query  497   TICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPK  318
             T+CP   PS+L++NLPS+ +P+L   +TL RTVTNVG  NS+Y+ +++ P G  V+VKP 
Sbjct  655   TVCPIEEPSILNINLPSITIPNLRNSITLTRTVTNVGASNSIYRVMIEPPFGTSVSVKPN  714

Query  317   VLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             VL F+   KK +FT+ V+    VN+ ++FGSLTW+DGVH VR+P++VR   +  Y+
Sbjct  715   VLVFNHKTKKITFTVTVTTAHQVNTEYSFGSLTWTDGVHIVRSPLSVRTEFLQPYI  770



>ref|XP_011079238.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Sesamum indicum]
Length=780

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/772 (47%), Positives = 488/772 (63%), Gaps = 45/772 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IYIVYLG KP  +H  I ESH D+LA  VGS EEA++ MVY+Y++ FSGFAA LT +QA
Sbjct  29    QIYIVYLGDKPQHNHECIAESHDDILASAVGSKEEAKRLMVYNYKHSFSGFAAKLTKAQA  88

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A   GV+ V+ D  H+VQ +RSW  LGLS    +P  LL + + GDG+IVGVVDSGI
Sbjct  89    KKLAEKPGVLRVLPDGRHRVQNTRSWISLGLSH-IGLPNNLLHQAHMGDGVIVGVVDSGI  147

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               +  +F D G+GPVP RWKG C++  GL FN S+ CNRK+IGARW+ KG L    V++ 
Sbjct  148   WPDSEAFNDEGLGPVPDRWKGVCKS-DGL-FNASKHCNRKIIGARWYIKGYLHETGVNVA  205

Query  1853  KF--LVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
             +F      + S  D+ GHG+ VAS VAGSFV N    G+D+G  RGGA  AR+A YKACW
Sbjct  206   QFNETPEGTPSPIDIGGHGTHVASTVAGSFVSNVNYYGLDMGTFRGGAPRARLAIYKACW  265

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
               D  + +C+ +D+LAAID A+ D VDVISVS+G   P   ++  +N + IGSFHAI   
Sbjct  266   --DAPKELCSSSDILAAIDDAVRDGVDVISVSLGGSFPHLPEVSPDNALAIGSFHAIAX-  322

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
               V+ + GN GP+  +I  V PW+I+VAAST+DR F   ITLGN +       +  G  +
Sbjct  323   --VVSSFGNGGPTTSSIEEVAPWMISVAASTVDRAFPTPITLGNNKTI-----MGRGLVI  375

Query  1319  SHPLHFAGKYMGEADLMPRKLDPAE--------VKGKIVFMFGDDL----DRNLVLVDKA  1176
                + FAG    E   +P+++   E        ++GK++  F  D      R  V V   
Sbjct  376   GTRVGFAGLVQEE---LPKRVHEGELNQAPVPGIEGKVILSFFKDYVAHYPRAAVQV---  429

Query  1175  TDAGAVGVIYSNPSN-------VDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQ  1017
              ++G + +I   P +        DS+     RIP V+VD++AG  I +Y+ +S+   T  
Sbjct  430   AESGGLALIVVRPLDDTDLYAYCDSMQHPATRIPIVEVDFEAGNEILEYMEKSSQA-TIM  488

Query  1016  LSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRI  849
             +    + VG+ LTPK+  FSSRGP++ AP I+KPDIAAPG  I+ A     P +D GF  
Sbjct  489   IGPSSVLVGKPLTPKIAGFSSRGPNALAPAILKPDIAAPGASILAAVPPGYPANDNGFAF  548

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS AAPH+S IVALL+  HP WSPAAIKSALVTTAWN D++ +PIFA+GS  + AD 
Sbjct  549   MSGTSMAAPHLSGIVALLRALHPHWSPAAIKSALVTTAWNEDSHKTPIFAEGSPAKIADP  608

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FD+GGGIVNPN A  PGLVYDM   DY  YLC+  Y  + IY         + T E  IC
Sbjct  609   FDFGGGIVNPNGAAYPGLVYDMDREDYMNYLCSQDYYTADIYNATKETSAYNATAEQLIC  668

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
                  S+L+LNLPS+V+P L   +T++R VTNVGP NSVY+A +K P+G  V+VKP VL 
Sbjct  669   QNRYLSILNLNLPSIVIPALKTSITVKRRVTNVGPSNSVYRATIKFPIGTTVSVKPDVLV  728

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             FD N +   F + V+ ++ +N+ + FGSLTW+DG H+VR+PI+VR  +  L+
Sbjct  729   FDSNTRMIDFEVTVNDEQNMNTGYVFGSLTWTDGKHSVRSPISVRTTLYSLH  780



>ref|XP_009348696.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=759

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/772 (47%), Positives = 486/772 (63%), Gaps = 51/772 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
              ++IVYLG K ++D  R+ + H+D+LA VVGS E A ++MVYSY++GF GFAA LT SQA
Sbjct  10    NVHIVYLGAKHNEDPERLTDLHHDMLASVVGSKEAAIESMVYSYKHGFFGFAAKLTGSQA  69

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++  +GVV V  +  +   T+RSWD+LGLS  ++ P  L+ +TN GDG+I+G++D+GI
Sbjct  70    KKISECSGVVHVRPNSFYTPHTTRSWDYLGLS--SHSPTNLMHETNMGDGVIIGIIDTGI  127

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E     D G+GP+P RWKG C +     FN +  CNRK+IGA+ F KG +  Q  +  
Sbjct  128   WPESKMLKDDGVGPIPTRWKGRCVSRSEGDFNATTACNRKLIGAKMFIKGFIHEQPFNKT  187

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +FL  D YS  D  GHG+  A+  AGSFV NA+  G+ +G+VRGGA  A +A YKACW L
Sbjct  188   EFLAVDYYSARDAYGHGTHTATTAAGSFVANASYKGLALGVVRGGAPRAHLAVYKACWRL  247

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVP--LASDMEAENGIGIGSFHAITRG  1500
                   C  ADLL A D AIHD VDV+S+S+GS  P     ++   NGI IGSF+A+ +G
Sbjct  248   SEPEPSCTDADLLKAFDEAIHDGVDVLSISIGSDDPNFKFEEVGMHNGIAIGSFYAVAKG  307

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ +AGNAGP+  T++NV PW+ITVAA+T+DR F   ITLGN           N T L
Sbjct  308   ITVVCSAGNAGPAPQTVSNVAPWIITVAATTMDRSFPTPITLGN-----------NKTLL  356

Query  1319  SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLV--------------LVD  1182
                L F GK +G   L+  +   A+         G+ L  N+V              ++ 
Sbjct  357   GQAL-FVGKEVGFTGLVHLECPTADGACD-SLTLGNTLAGNVVIYLTTMPGGAQVNSIIY  414

Query  1181  KATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
                +AGAVG+I + P +    P ++   PY+ VDY+ GT I  Y+  ST  P  +LS  K
Sbjct  415   AVKNAGAVGLIIAMPPSNLFFPSID-DFPYIVVDYEHGTEIMFYM-SSTSFPIVKLSPSK  472

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA---DPTS------DGGFRI  849
                G+ ++ KV  FSSRGP+S  P I+KPDIAAPG  I+ A   DPTS      DG F +
Sbjct  473   TLTGKPVSTKVASFSSRGPNSIGPTILKPDIAAPGVNILAAKPYDPTSSNQPPLDGVFAL  532

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS AAPH++ IVALLK  HP+WSPAA+KSALVTTAW +D +  PIFA+G+ L+ AD 
Sbjct  533   DSGTSMAAPHIAGIVALLKSLHPDWSPAAMKSALVTTAWKTDPFGEPIFAEGAGLKLADP  592

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FDYGGG+VNPN A  PGL+YDM   DY  YLCA GY+   + + +         E  T C
Sbjct  593   FDYGGGLVNPNKAAHPGLIYDMATNDYINYLCAFGYDTLTVTQLV---------EHATSC  643

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
             P  +PS+LD+NLPS+ +P++  P+TL RTVTN+GPV+S YKA ++ P G  V V+P+ L 
Sbjct  644   PVQKPSILDVNLPSITIPNIRNPITLTRTVTNIGPVSSTYKAQIEPPPGINVVVRPETLV  703

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F+   KK SFT+ VS    VN+A+ FGSLTW+DGVH V +P++VR  I+  Y
Sbjct  704   FNSTVKKISFTVEVSTTYRVNTAYFFGSLTWTDGVHAVTSPMSVRTQILRSY  755



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/776 (47%), Positives = 488/776 (63%), Gaps = 56/776 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    ++IVYLGGK HDDH     SH+D+LA VVGS + A + MVYSY++GFSGFAA LT
Sbjct  27    EATSSVHIVYLGGKQHDDHILTTNSHHDMLASVVGSKDMAAELMVYSYKHGFSGFAAKLT  86

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+KV+ + GV+ V+ +  H++QT+RSWDFLGLS  ++ P   L K+N GDG+I+GV+
Sbjct  87    VSQAQKVSELPGVIRVIPNSLHRLQTTRSWDFLGLS--SHSPVNTLHKSNMGDGVIIGVL  144

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  +F D G+GP+P  WKG C +  G  F     CNRK+IGARWF  G L    
Sbjct  145   DTGIWPESKAFSDKGLGPIPSHWKGVCES--GTGFEAKSHCNRKIIGARWFVDGFLAEYG  202

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               LN     + +S  D  GHG+  AS  AG+FV N +  G+ +G VRGGA  A++A YK 
Sbjct  203   QPLNTSENREFFSPRDANGHGTHTASTAAGNFVDNVSYRGLGLGTVRGGAPHAQLAIYKV  262

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN+     +CA AD+L A D AIHD VDV+S+S+GS +PL SD++  +GI  GSFHA+ 
Sbjct  263   CWNV--LGGLCAAADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDGIATGSFHAVA  320

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GI V+  A N GPSA T+ N  PWV+TVAAS++DR F   ITLGN + +        G 
Sbjct  321   KGITVVCGASNDGPSAQTVQNTAPWVLTVAASSMDRAFPTPITLGNNKTF-------RGK  373

Query  1325  ALSHPLHFAGKYMGEADL---MPRKLDP-------------AEVKGKIVFMFGDDLD---  1203
              L     ++G   G   L   + + LDP             + V GK+V  F        
Sbjct  374   GL-----YSGNDTGFRSLFYPVAKGLDPNSAGVCQSLLVDASTVAGKVVLCFASMTPGAV  428

Query  1202  RNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTP  1026
             R+   V K  +AG  G+I + NPS  ++L       P  +VDY+ GTRI  YI +S  +P
Sbjct  429   RSAAEVVK--EAGGAGLIVAKNPS--EALYPCTDGFPCTEVDYEIGTRILFYI-RSARSP  483

Query  1025  TAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT----SDGG  858
                LS  K  VG+ +  KV  FSSRGP+S AP I+KPDIAAPG  I+ A        +GG
Sbjct  484   VVNLSPSKTIVGKPVLAKVAHFSSRGPNSMAPAILKPDIAAPGVNILAATSPLRRFQEGG  543

Query  857   FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRA  678
             + + SGTS A PHVS IVALLK  HP+WSPAAIKS++VTTAW ++    PIFA+GS  + 
Sbjct  544   YTMLSGTSMATPHVSGIVALLKAVHPDWSPAAIKSSIVTTAWRNNPSGFPIFAEGSPQKL  603

Query  677   ADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEH  498
             AD FDYGGGIVNPN+A  PGLVYDM   DY  YLCA+ YNN+ I + ++GN         
Sbjct  604   ADTFDYGGGIVNPNSAAYPGLVYDMGTEDYINYLCAMNYNNTAISR-LTGNL--------  654

Query  497   TICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPK  318
             T+CP   PS+L++NLPS+ +P+L   +TL RTVTNVG  NS+Y+ +++ P G  V+VKP 
Sbjct  655   TVCPIEEPSILNINLPSITIPNLRNSITLTRTVTNVGASNSIYRVMIEPPFGTSVSVKPN  714

Query  317   VLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             VL F+   KK +FT+ V+    VN+ ++FGSLTW+DG H VR+P++VR   +  Y+
Sbjct  715   VLVFNHKTKKITFTVTVTTAHQVNTEYSFGSLTWTDGEHKVRSPLSVRTEFLQPYI  770



>ref|XP_006351094.1| PREDICTED: cucumisin-like [Solanum tuberosum]
Length=803

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/756 (48%), Positives = 478/756 (63%), Gaps = 26/756 (3%)
 Frame = -3

Query  2408  KENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVL  2229
             +E   K+YI+YLG KPHDDH  I +SH+D+L  V+GS EE +K MVYSYR+GFSGFAA L
Sbjct  28    EEADTKLYIIYLGHKPHDDHELITDSHHDILGQVIGSKEEGKKNMVYSYRHGFSGFAAKL  87

Query  2228  TasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGV  2049
             T SQAK++  + GV+ V++++ +K  T+RSWDFLGLS+    P  LL KTN+GDG+I+GV
Sbjct  88    TDSQAKQIRELPGVIRVIQNQIYKTHTTRSWDFLGLSKSD--PNNLLNKTNQGDGIIIGV  145

Query  2048  VDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQ  1869
             VD+GI  +L  F D  +GP+P RWKGSC++     FN ++ CN+K+IGARW+ KG  L +
Sbjct  146   VDTGIWGDLEGFNDKELGPIPSRWKGSCKS--EANFNATKHCNKKIIGARWYIKG--LME  201

Query  1868  DVDLNKFLVSDSY--SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVAS  1695
             +  LN+ +   SY  S  D  GHG+ VA   AGS+V N    G+++G  RGGA  AR+A 
Sbjct  202   EYKLNQTMAEKSYNLSPLDEDGHGTHVAYTAAGSYVNNIQYYGLNMGTSRGGAPLARLAI  261

Query  1694  YKACW--NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGS  1521
             YK CW   +D E ++  GAD LAAID AI D VD+IS S+G    + S+++ E+  GIGS
Sbjct  262   YKVCWINKVDGETYL-GGADALAAIDDAIKDGVDIISASIGFNGRVFSEVDFESLFGIGS  320

Query  1520  FHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQ  1341
             FHA++ GIP + A GN GP   +I NV PW+ITVAAS  DR     +TLGN         
Sbjct  321   FHAVSHGIPFVAAGGNTGPEPNSIGNVSPWIITVAASNEDRDIVTPLTLGNNNTILAQEI  380

Query  1340  LPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGA  1161
                      PL  A     + +L   K    EVKGK+V +F +D    L  +    + G 
Sbjct  381   FQGKNQAFAPLLVARDVTNKEEL---KSIVKEVKGKVVMIFLEDKKDVLFYLATLNNTGV  437

Query  1160  VGVIYSNP---SNVDSLPILNARIPYVQVDYDAGTRIKDYIFQ---STMTPTAQLSSPKI  999
             + +I   P    N D   ++   IP+  VD + GT+I DY  Q   +   P  +L   ++
Sbjct  438   LALICVTPPLEQNTDFNQLIGVPIPFFTVDVEQGTQILDYFQQCKSNNQDPMIKLGQTRV  497

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDG--GFRISSGTSHAA  825
               G  +  KV  FSSRGP+SFAP I+KPD+AAPG  I+ A P + G  GF++ SGTS AA
Sbjct  498   VEGNEVFQKVAKFSSRGPNSFAPDILKPDVAAPGVGILAAAPPNKGNNGFQLMSGTSMAA  557

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             PHVS IVALLK++HP+WSPAAIKSALVTTAWN DT    I+++G++   A+ FD+GGGI 
Sbjct  558   PHVSGIVALLKVAHPDWSPAAIKSALVTTAWNEDTCTYEIYSEGTN-NLANPFDFGGGIS  616

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NPN A DPGL+YDM   DY  YLC LGY N ++    S      DT+  TICPK  PS L
Sbjct  617   NPNGAMDPGLIYDMDKNDYLNYLCTLGYKNDMVQNATS---YFFDTKTSTICPKEVPSRL  673

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             DLNLPS+ +P+L   + +RRTVTN+G VNS+YK +VK P    + V P VL+F+ N KK 
Sbjct  674   DLNLPSISIPNLKNSIIVRRTVTNIGDVNSIYKLVVKPPKNTAIKVNPNVLKFNSNTKKI  733

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAV  177
             SF + + +     S F FGSL WSDG H VR PIA+
Sbjct  734   SFEVEIISTYQRKSNFNFGSLAWSDGKHFVRIPIAI  769



>ref|XP_004309572.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=837

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/762 (48%), Positives = 487/762 (64%), Gaps = 36/762 (5%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             V  +    ++IVYLG + HD+ + I +SH+DLLA +VGS   A K MVYSYR+GFSGFAA
Sbjct  86    VAAKTNSHVHIVYLGERQHDNPKLITDSHHDLLATIVGSKSLASKLMVYSYRHGFSGFAA  145

Query  2234  VLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIV  2055
              LTA+QA+K A +  VV V+ +  HK+QTSRSWDFLGLS   +    +L  +N GDG+I+
Sbjct  146   KLTAAQAQKFAELPDVVRVIPNTLHKLQTSRSWDFLGLSP-LSPSSNILHSSNMGDGVII  204

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             GV+D+GI  E  SF + G+G VP RWKG C++  G +FN +  CNRK+IGARWF  G L 
Sbjct  205   GVLDTGIWPESKSFNEEGLGSVPSRWKGVCKS--GEKFNATLHCNRKIIGARWFNDGILA  262

Query  1874  SQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVAS  1695
                  LN    ++  S  D  GHG+  AS  AGSFV N +  G+  G +RGGA  AR+A 
Sbjct  263   EYGKPLNTSKRTEFMSPRDAHGHGTHTASTAAGSFVTNVSYKGLGHGTIRGGAPNARLAI  322

Query  1694  YKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFH  1515
             YK CWN+   +  C+ AD+L   D AIHD VDV+S+S+G  VPL SD++  +GI  GSFH
Sbjct  323   YKVCWNVLGGQ--CSAADMLKGFDEAIHDGVDVLSLSIGGSVPLFSDVDERDGISTGSFH  380

Query  1514  AITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---AVDW  1344
             A+ RGI V+ AA N GPSA T+ N+ PW+ITVAAST+DR F  +ITLGN + +   A+  
Sbjct  381   AVARGITVVCAASNDGPSAQTVQNISPWIITVAASTMDRAFPTSITLGNNKTFLGQAMFT  440

Query  1343  QLPNG-TALSHPLHFAGKY---MGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLV---  1185
              L  G T+L +P    G Y    G  D +   L+   V G +V  F   L R + +    
Sbjct  441   GLEIGFTSLIYP-ESKGLYPTATGVCDSL--SLNNTMVSGMVVLCF-TSLGRRIDVTTAS  496

Query  1184  DKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSS  1008
             D    AG VG+I + NP+  D L   +   P ++VDY+ GTRI  YI +ST  P  +L+ 
Sbjct  497   DAVKQAGGVGLIIAKNPT--DGLYPCSDDFPCIEVDYEIGTRIVFYI-RSTRYPLVKLTP  553

Query  1007  PKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSG  840
             P   VG+ ++ KV  FSSRGP+S AP I+KPD+ APG  I+ A    D  +D G+ + SG
Sbjct  554   PTTIVGKPISAKVAYFSSRGPNSAAPAILKPDVTAPGVNILAATSPLDSFADAGYVMHSG  613

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS + PHV+ IVAL+K  HP WSPAAI+SALVTTAW++     PIFA+GS  + A+ FD+
Sbjct  614   TSMSTPHVAGIVALIKAVHPNWSPAAIRSALVTTAWSNGPSRLPIFAEGSPQKLANPFDF  673

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGGIVNPNAA +PGLVYDM   DY  YLCA+ YNNS I +          T + T CP  
Sbjct  674   GGGIVNPNAASNPGLVYDMGAADYMHYLCAMDYNNSDITRL---------TGQATTCPMK  724

Query  479   RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDG  300
             RPS+LD+NLPS+ +P L   +T+ RTVTNVG   SVY+A +  P+G VV+VKP +L F+ 
Sbjct  725   RPSLLDINLPSITIPSLGNSITVTRTVTNVGAPKSVYEATIDPPLGTVVSVKPNLLVFNS  784

Query  299   NRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
               KK +F + +S    +N+ + FGSLTW+D VH VR P++VR
Sbjct  785   TVKKLTFEIVISTTHQMNTGYYFGSLTWTDRVHAVRIPLSVR  826



>ref|XP_011038008.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
 ref|XP_011038009.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
Length=775

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/774 (47%), Positives = 486/774 (63%), Gaps = 52/774 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    ++IVYLGGK HDD     +SH+D+LA VVGS E A + MVYSY++GF GFAA LT
Sbjct  29    EATSNVHIVYLGGKQHDDPILKTDSHHDMLANVVGSKEIASELMVYSYKHGFYGFAAKLT  88

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+KVA + GVV V+ +  H++QTSRSWDFLGLS  A+ P   L  ++ GDG+I+GV+
Sbjct  89    ESQAQKVAELPGVVRVIPNSLHRLQTSRSWDFLGLS--AHSPANTLHNSSMGDGVIIGVL  146

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  +F D G+GP+P  WKG C +  G RF     CN+K+IGARWF +G L    
Sbjct  147   DTGIWPEAKAFSDKGLGPIPSHWKGVCES--GKRFKAKRHCNKKIIGARWFVEGFLAEYG  204

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               LN     + +S  D  GHG+  AS  AG+F+ N +  G+  G +RGGA  AR+A YK 
Sbjct  205   QPLNTSGNREFFSPRDANGHGTHTASTAAGTFIDNVSYRGLAHGTIRGGAPRARLAIYKV  264

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN+   +  C+ AD+L A D AIHD VDV+S+S+GS +PL SD++  +GI  GSFHA+ 
Sbjct  265   CWNVLGGQ--CSSADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDGIATGSFHAVA  322

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GI V+  A N GP A T+ N  PW++TVAAS++DR F   ITLGN + +        G 
Sbjct  323   KGITVVCGAANDGPFAQTVQNTAPWILTVAASSMDRAFPTPITLGNNKTFL-------GQ  375

Query  1325  ALSHPLHFAGKYMGEADLM---PRKLDP-------------AEVKGKIVFMFGD-DLDRN  1197
             A+     ++GK +G   L+    + L+P             + V GK+V  F   +L   
Sbjct  376   AI-----YSGKEIGFRSLIYPEAKGLNPNSAGVCQFLSVDNSMVAGKVVLCFTSMNLGAV  430

Query  1196  LVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTA  1020
             +   +   +AG VG+I + NPS  ++L       P V+VDY+ GTRI  YI +ST +P  
Sbjct  431   ISASEVVKEAGGVGLIVAKNPS--EALYPFTDGFPCVEVDYEIGTRILFYI-RSTRSPVV  487

Query  1019  QLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFR  852
             +LS  K  VG+ +  KV  FSSRGP+S AP I+KPDIAAPG  I+ A    D   D G+ 
Sbjct  488   KLSPSKTIVGKPVLAKVARFSSRGPNSNAPAILKPDIAAPGVNILAATSPLDRFQDSGYV  547

Query  851   ISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAAD  672
             + SGTS A PH+S I ALLK  HP+WSPAAIKSA VTTAW ++    PIFA+GS L+ AD
Sbjct  548   MHSGTSMATPHISGITALLKAMHPDWSPAAIKSAFVTTAWINNPSGFPIFAEGSPLKLAD  607

Query  671   AFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTI  492
              FDYGGGI NPN A  PGLVYDM   DY  YLCA+ YNN+ I +          T + T+
Sbjct  608   PFDYGGGIANPNGAAHPGLVYDMGSDDYVNYLCAMDYNNTAISRL---------TGKPTV  658

Query  491   CPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVL  312
             CP   PS+L++NLPS+ +P+L   VTL RTVTN G  NS+Y+ ++++P    V+V+P VL
Sbjct  659   CPTEGPSILNINLPSITIPNLRNSVTLTRTVTNAGASNSIYRVVIEAPFCCSVSVEPHVL  718

Query  311   RFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
              F+   KK +F++ V+    VN+ + FGS+TW DGVH VR+P++VR  I   Y+
Sbjct  719   VFNHTTKKNTFSVTVNTTYQVNTGYFFGSITWIDGVHTVRSPLSVRTEISQPYI  772



>ref|XP_007039203.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23704.1| Subtilase family protein, putative [Theobroma cacao]
Length=776

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/771 (47%), Positives = 486/771 (63%), Gaps = 54/771 (7%)
 Frame = -3

Query  2411  LKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAV  2232
             L ++   +YIVY+G + H D  R+  +H+++L+ V+ S E ++++MVYSY++GFSGFAA 
Sbjct  33    LADSNSNVYIVYMGKRQHPDVERLTRTHHEMLSTVLVSEETSKESMVYSYKHGFSGFAAK  92

Query  2231  LTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVG  2052
             +T +QA+K++ + GVV V  +  +K+QT+RSWD+LGLS   N P  LL K+  G+G+I+G
Sbjct  93    MTEAQAQKLSKLPGVVHVTRNGFYKLQTTRSWDYLGLS--TNSPSNLLNKSKMGNGVIIG  150

Query  2051  VVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLS  1872
             ++D+GI  E   F D G+GP+P RWKG C +  G  F+ ++ CNRK+IGAR+F +G    
Sbjct  151   LLDTGIWPESEVFSDEGLGPIPSRWKGVCES--GELFDGAKACNRKLIGARYFIRGLQAE  208

Query  1871  QDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASY  1692
                  N    +D  S  D +GHG+  +SI  GSFV N +  G+  G VRGGA  AR+A Y
Sbjct  209   YGQPYNTSANNDYLSPRDPSGHGTHTSSIAGGSFVANVSYYGLGFGTVRGGAPGARLAMY  268

Query  1691  KACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHA  1512
             K CW L     VC+ AD+L   D AIHD VDV+SVS+ + +PL SD++    I IGSFHA
Sbjct  269   KVCWQL--YGGVCSDADVLKGFDEAIHDGVDVLSVSLVADIPLYSDVDQRGSIPIGSFHA  326

Query  1511  ITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPN  1332
             + +GI V+ AAGNAGP A T+ N  PW++TVAAST+DR F   I LGN           N
Sbjct  327   VAKGITVVCAAGNAGPRAETVQNTAPWILTVAASTVDRSFPTPIMLGN-----------N  375

Query  1331  GTALSHPLHFAGK--------YMGEADLM-PRKLDPAE-----VKGKIVFMFGDDLDRNL  1194
              T +   + F G+        Y   +DLM PR  +        + GK+V  F  +   N+
Sbjct  376   QTIMGQAM-FTGEDTVFATLVYPEVSDLMVPRNCESLSSNDDWMAGKVVLCFVSEY--NM  432

Query  1193  VLVD----KATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMT  1029
              L+D       +AG +GVI +  PS  D L     R P VQV Y+ GT+I  YI +ST  
Sbjct  433   SLLDDGIWSVKEAGGLGVIVARTPS--DYLYSYATRFPCVQVTYETGTQILYYI-RSTSN  489

Query  1028  PTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT---SDGG  858
             P  +LS  +  VG+ L+  V  FSSRGPSS AP I+KPDIAAPG KI+ A P    ++G 
Sbjct  490   PQVRLSPSRTHVGKPLSTSVAYFSSRGPSSNAPAILKPDIAAPGVKILAASPPDRPTNGA  549

Query  857   FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRA  678
             F   SGTS A PHVS IVALLK  +P+WSPAAIKSA+VTTA ++D    PIFA+G   + 
Sbjct  550   FAFRSGTSMATPHVSGIVALLKSLYPDWSPAAIKSAIVTTALSADQSGGPIFAEGEPSKL  609

Query  677   ADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEH  498
             AD FD+GGGIVNPN A DPGLVYDM   DY QYLCA+GYN+S I++          T+  
Sbjct  610   ADPFDFGGGIVNPNGAADPGLVYDMNTEDYGQYLCAMGYNDSAIFQL---------TQHP  660

Query  497   TICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPK  318
              +CP  +PS+LD+NLPS+ +P L KP  L RTVTNVGPVNS YKA V+   G  + V+P+
Sbjct  661   IVCPSKQPSVLDVNLPSITIPSLRKPTILTRTVTNVGPVNSKYKANVEFASGINIAVRPE  720

Query  317   VLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             +L F    K  +FT+ +S+   VN+ + FGSLTW+DG H VR+PI+VR  +
Sbjct  721   ILIFSSKTKTITFTVMISSAHNVNAGYYFGSLTWTDGGHVVRSPISVRTEV  771



>ref|XP_004309570.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=739

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/764 (48%), Positives = 473/764 (62%), Gaps = 52/764 (7%)
 Frame = -3

Query  2375  LGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagv  2196
             +G K H D   +   H+D+LA VVGS E A  AMVYSY++GFSGFAA  T SQ KK+A  
Sbjct  1     MGEKHHHDPEVVTCLHHDMLASVVGSKEAATDAMVYSYKHGFSGFAAKFTESQVKKIADF  60

Query  2195  agvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPS  2016
              GV+ V+ ++ H +QT+RSWD+LGLS   N P  LL  TN GDG+I+G++D+GI  E   
Sbjct  61    PGVIRVIPNQFHSLQTTRSWDYLGLSP--NSPKNLLNDTNLGDGIIIGLLDTGIRPESEV  118

Query  2015  FGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSD  1836
             F D  +GP+P +WKG C  + G +FN S  CN K+IGA+++  G L       N     D
Sbjct  119   FNDEDLGPIPSQWKGQC--VSGQQFNASTACNNKLIGAKYYIDGFLAENQQPFNTTDSPD  176

Query  1835  SYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFV  1656
               S  DV GHG+  ++I  GSFV NA+  GI +G+VRGGA  AR+A YK CWN+   R  
Sbjct  177   YMSPRDVVGHGTHTSTIAGGSFVYNASYKGIGLGIVRGGAPRARLAMYKVCWNV--PRGQ  234

Query  1655  CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAG  1476
             C+ ADLL A D AIHD VDVISVS+G+ +PL S+++  + I IGSFHA+T+GIPV+ AA 
Sbjct  235   CSNADLLKAFDDAIHDGVDVISVSLGTQLPLFSEVDDRDAISIGSFHAVTKGIPVVCAAA  294

Query  1475  NAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAG  1296
             N GPSA+T+ N  PW++TVAASTIDR F   ITLGN           N T L   L FAG
Sbjct  295   NEGPSAYTVENTAPWILTVAASTIDRSFPTNITLGN-----------NLTILGQAL-FAG  342

Query  1295  K--------YMGEADLMPRK--------LDPAEVKGKIVFMFGDDLDRNLVL--VDKATD  1170
                      Y     L+P          L+   V G +V  F     R  V   V     
Sbjct  343   TEVDFTGLVYPENPGLIPSLAGVCEALLLNNTPVAGNVVLCFTSVARRTPVALAVSSVKA  402

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             AG VGVI +  S  D L   ++  P ++VDY+ GT+I  YI +ST +P  +L+     VG
Sbjct  403   AGGVGVIVAK-SPGDVLGPCSSDFPCIEVDYELGTQILLYI-RSTSSPVVKLNPSVTLVG  460

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAP  822
             + ++ KV  FSSRGP+S +P I+KPDIAAPG  I+ A    DP  +GGF + SGTS A P
Sbjct  461   KPVSTKVAAFSSRGPNSISPAILKPDIAAPGVSILAASAPFDPYMNGGFALHSGTSMATP  520

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
             HVS IVALLK  H  WSPAAI+SA+VTTAW +D +  PIFA+GS  + AD FDYGGGIVN
Sbjct  521   HVSGIVALLKALHSNWSPAAIRSAIVTTAWRTDPFGEPIFAEGSPQKLADPFDYGGGIVN  580

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             PN A DPGLVYD+   DY  YLCA+GYNNS I + + GN         T C  T+PS+LD
Sbjct  581   PNKAADPGLVYDLGVYDYILYLCAVGYNNSEISQLV-GNS--------TTCSSTKPSVLD  631

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             +NLPS+ VP+L + +TL R+VTNVGPVNS YKA +  P G  V V P+ L F+ N +   
Sbjct  632   VNLPSITVPNLRENITLTRSVTNVGPVNSTYKARISPPWGISVAVSPETLVFNSNIETIY  691

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGV-HNVRTPIAVRKMIVPLY  153
             FT+ VS    VN+ + FGSL W+D   H V  P++VR  I+  Y
Sbjct  692   FTVEVSTTHEVNTGYYFGSLAWTDEWGHVVTIPMSVRTQIILYY  735



>ref|XP_010529677.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=767

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/757 (47%), Positives = 480/757 (63%), Gaps = 30/757 (4%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             KK++IVYLG + HDD   + ESH+ +L  ++GS E+A  +MVYSYR+GFSGFAA LT  Q
Sbjct  28    KKVHIVYLGERRHDDPEFVTESHHQMLWSILGSKEDAHDSMVYSYRHGFSGFAAKLTDFQ  87

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A++++G+  V+ V+ D+ +++ T+RSWD+LGLS   +    LLR T+ G  +I+G+VD+G
Sbjct  88    AEQISGLPEVIHVMADRSYELATTRSWDYLGLSSVNS--SNLLRNTHLGHQVIIGIVDTG  145

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   F D G+GP+P RWKG+C +  G +FN S  CNRK+IGA++F  G LL+   DL
Sbjct  146   VWPESEMFSDEGIGPIPSRWKGNCES--GQQFNGSAHCNRKLIGAKYFIDG-LLAAIGDL  202

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     +  S  D  GHG+ V++I AGSFV N +  G   G  RGGA  AR+A YKACW 
Sbjct  203   NTTQNPEYVSPRDFNGHGTHVSTIAAGSFVANVSYGGFGKGTARGGAPLARIAMYKACW-  261

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                +   C G+DLL AID AIHD VDVIS+SV  P+PL S++E  +GI +GSFHA+++GI
Sbjct  262   --LQVGTCMGSDLLKAIDEAIHDGVDVISISVAFPIPLFSEIEIRDGISVGSFHAVSKGI  319

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQLPN  1332
              V+ AAGN GP+A T+ N  PWV+TVAA+T+DR F  +ITLGN     G+   V  +L  
Sbjct  320   LVVCAAGNKGPAAQTVVNTAPWVLTVAATTLDRSFPTSITLGNNITMQGQAMYVGPEL-G  378

Query  1331  GTALSHPLH-FAGKYMGEADLMPRKLDP-AEVKGKIVFMFGDDLDRNLVL--VDKATDAG  1164
              T L +P +   G      D     ++P + + GK+V  F    D + V   V    +A 
Sbjct  379   FTGLVYPENPGTGDEEFSGDCERLSVNPNSTMAGKVVLCFTAKTDNSPVASAVSAVRNAR  438

Query  1163  AVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRA  984
              +GVI +   N   L +     P + VDY+ GT I  YI +S   P  ++   +  VG+ 
Sbjct  439   GLGVIIAR--NPGHLLVPCGGFPCIAVDYELGTDILFYI-RSNKIPVVKIMPSQTLVGQP  495

Query  983   LTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIV  804
             ++ KV  FSSRGP+S +P I+KPDI+APG  I+ A    DGGF + SGTS A P VS IV
Sbjct  496   VSTKVATFSSRGPNSISPAILKPDISAPGVNILAATSPDDGGFAMKSGTSMATPVVSGIV  555

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADD  624
             ALL+  HP+WSPAAI+SALVTTAW +D    PIFA GS+ + AD FDYGGG+VNP  A D
Sbjct  556   ALLRGLHPDWSPAAIRSALVTTAWKTDPSGEPIFADGSNRKLADPFDYGGGLVNPEKATD  615

Query  623   PGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSM  444
             PGLVYDM   DY  Y+C+ GY +S I + I          + T CP  +PS+LDLNLPS+
Sbjct  616   PGLVYDMGTSDYILYMCSAGYADSSISQLIG---------KPTSCPNPKPSILDLNLPSI  666

Query  443   VVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS  264
              +P+L   VTL RTVTNVGP +SVYK +++ P G  V V PK L F+   K+ SFT+RV+
Sbjct  667   TIPNLRDEVTLTRTVTNVGPRDSVYKVVMEPPSGVRVDVNPKTLVFNSETKRVSFTVRVT  726

Query  263   ADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
                 VNS F FG LTW+D V  V  P++VR  I+  Y
Sbjct  727   TAHKVNSGFYFGRLTWTDSVREVTIPVSVRTQILQRY  763



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/776 (47%), Positives = 485/776 (63%), Gaps = 55/776 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    ++IVYLG + H+D   +++SH+D+LA +VGS E A + MVYSY++GFSGFAA LT
Sbjct  37    ETRTNVHIVYLGERQHNDPELVRDSHHDMLASIVGSKEVASELMVYSYKHGFSGFAAKLT  96

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+++A + GV+ V+ +  H++QT+RSWD+LGLS  +  P  +L  +N GDG+I+GV+
Sbjct  97    ESQAQRIAELPGVLRVIPNSLHQLQTTRSWDYLGLSFQS--PKNILHSSNMGDGVIIGVL  154

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  SF D G GP+P +WKG C +  G +FN +  CNRKVIGARWF  G L    
Sbjct  155   DTGIWPESKSFNDEGFGPIPSQWKGVCES--GQQFNSTMHCNRKVIGARWFVNGFLAEYG  212

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               LN     +  S  D  GHG+  +S   GSFV N +  G+ +G VRGGA  AR+A YK 
Sbjct  213   QPLNTSGNQEFLSPRDANGHGTHTSSTAGGSFVGNVSYKGLALGTVRGGAPHARLAIYKV  272

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN+   +  C+ AD+L A D AI+D V V+S+S+GS +PL SD++  +GI  GSFHA+ 
Sbjct  273   CWNVLGGQ--CSSADILKAFDEAINDGVHVLSLSIGSSIPLFSDIDERDGIATGSFHAVA  330

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GI V+  A N GP A T+ N  PW++TVAAST+DR F   ITLGN           N T
Sbjct  331   KGITVVCGASNDGPQAQTVQNTAPWILTVAASTMDRAFPTPITLGN-----------NKT  379

Query  1325  ALSHPLHFAGKYMGEADLM----------------PRKLDPAEVKGKIVFMFGDDLDRNL  1194
              L   L F GK  G + L+                   LD   V GK+V  F   + R  
Sbjct  380   LLGQAL-FTGKETGFSGLVYPEVSGLALNSAGQCEALSLDQTSVAGKVVLCFTSTV-RRA  437

Query  1193  VLVDKATD---AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTP  1026
              L+  ++D   AG VGVI + NP   D+L   +   P V+VDY+ GTRI  YI +ST  P
Sbjct  438   TLISASSDVQAAGGVGVIIAKNPG--DNLAACSNDFPCVEVDYEIGTRILYYI-RSTRLP  494

Query  1025  TAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGG  858
                LS  K  VG A+  KV  FSSRGP+S AP I+KPDI APG  I+ A    +   DGG
Sbjct  495   VVNLSPSKTFVGEAVLAKVAYFSSRGPNSIAPAILKPDITAPGVNILAATGPLNRVMDGG  554

Query  857   FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRA  678
             + + SGTS A PHVS +VALLK  HP+WSPAAIKSALVTTAW +     PIFA+G   + 
Sbjct  555   YAMLSGTSMATPHVSGVVALLKALHPDWSPAAIKSALVTTAWRNGPSGLPIFAEGFPKKL  614

Query  677   ADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEH  498
             AD FD+GGGIVNPN A DPGLVYD+   D+  YLCA+GYNNS I +          T + 
Sbjct  615   ADPFDFGGGIVNPNGATDPGLVYDVGATDHIYYLCAVGYNNSAISQL---------TGQS  665

Query  497   TICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPK  318
              +CP  RPS+LD+NLPS+ +P+L    TL RTVTNVG   S+Y+ +++ P+G V+TV P 
Sbjct  666   IVCPSERPSILDVNLPSITIPNLRNSTTLTRTVTNVGAPESIYRVVIQPPIGVVITVNPD  725

Query  317   VLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             VL F+   K  +F + VS+   VN+ + FGSLTW+DGVH VR+P++VR  I+  Y+
Sbjct  726   VLVFNSMTKSITFKVTVSSTHHVNTGYYFGSLTWTDGVHEVRSPLSVRTEIIQSYV  781


 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/737 (47%), Positives = 456/737 (62%), Gaps = 58/737 (8%)
 Frame = -3

Query  2294  EEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSE  2115
             + A  +MVYSY++GFSGFAA LT SQA+KVA + GVV V+ ++ HK+QT+RSWD+LGLS 
Sbjct  783   DTAFDSMVYSYKHGFSGFAAKLTDSQAQKVADLPGVVHVIPNRLHKLQTTRSWDYLGLSS  842

Query  2114  GANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNE  1935
              +  P  LL +TN G G+I+G++D+G+  E   F D G GP+P  WKG C  + G  FN 
Sbjct  843   QS--PSNLLHETNMGGGIIIGLLDTGVCPESEVFNDEGFGPIPSHWKGGC--VSGELFNA  898

Query  1934  SELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNAT  1755
             +  CNRK+IGARW+  G L   +   N     D  S  D  GHG+  ++I +GSF+ NA+
Sbjct  899   TTDCNRKLIGARWYIDGFLADNEQPSNTTENPDYLSPRDSIGHGTHTSTIASGSFLVNAS  958

Query  1754  TLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGS  1575
               G+ +G+VRGGA  AR+A YK CWN+   +  CA AD+L A D AIHD VDV+SVS+GS
Sbjct  959   YQGLGLGIVRGGAPRARIAMYKVCWNVAAGQ--CASADILKAFDEAIHDGVDVLSVSLGS  1016

Query  1574  PVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRI  1395
              +PL S+++  +GI IGSFHA+ +G+ V+  A   GPSA ++ N  PW++TVAASTIDR 
Sbjct  1017  DIPLFSEVDERDGIAIGSFHAVAKGMTVVCGASTDGPSAQSVQNTAPWILTVAASTIDRS  1076

Query  1394  FAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLM----------------PR  1263
             F   ITLGN           N T L   + F GK +G + L+                  
Sbjct  1077  FPTPITLGN-----------NVTILGQAM-FPGKEIGFSGLVHPETPGLLPTAAGVCESL  1124

Query  1262  KLDPAEVKGKIVFMFGD--DLDRNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPY  1092
              L+   V G +V  F                  AG VGVI + NP N  +L   +   P 
Sbjct  1125  SLNNTTVAGNVVLCFTTVGSRSAMASASSAVRAAGGVGVIVARNPRN--ALAPCSNGFPC  1182

Query  1091  VQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPD  912
             + VD + GT+I  YI +ST +PT +LSS K  VG+ ++ K+  FSSRGPSS AP  +KPD
Sbjct  1183  IIVDXELGTKILFYI-RSTSSPTVKLSSSKTLVGKPVSTKIAYFSSRGPSSIAPANLKPD  1241

Query  911   IAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALV  744
             IAAP   I+ A    DP  DGGF + SGTS A PH+S IVALLK  HP WSP AIKSALV
Sbjct  1242  IAAPSVSILAASSPLDPFMDGGFALHSGTSMATPHISGIVALLKALHPSWSPVAIKSALV  1301

Query  743   TTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALG  564
             TTAW +D    PIF +GS  + AD FDYGGGIVNPN A +PGLVYDM   DY  YLC++G
Sbjct  1302  TTAWRTDPLGEPIFVEGSPRKLADPFDYGGGIVNPNKAAEPGLVYDMGTSDYIHYLCSVG  1361

Query  563   YNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGP  384
             YNNS I + +         E+ TICP T+ S+LD+NLPS+ + +L K  TL R VTNVGP
Sbjct  1362  YNNSAISQLV---------EQPTICPNTKASILDVNLPSITISNLRKSTTLTRKVTNVGP  1412

Query  383   VNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGV  204
              NS+YKA+++ P+G  VTV+P +L F+   +     + VS    VN+ + FGSLTW DGV
Sbjct  1413  QNSMYKAMIEPPLGIPVTVRPDILVFNSTXQ-----VEVSTAHQVNTGYYFGSLTWMDGV  1467

Query  203   HNVRTPIAVRKMIVPLY  153
             H V +PI+VR  ++  Y
Sbjct  1468  HTVSSPISVRTQLIQSY  1484



>ref|XP_002298973.2| subtilase family protein [Populus trichocarpa]
 gb|EEE83778.2| subtilase family protein [Populus trichocarpa]
Length=786

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/789 (46%), Positives = 484/789 (61%), Gaps = 71/789 (9%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    ++IVYLGGK HDD     +SH+D+LA VVGS E A + MVYSY++GFSGFAA LT
Sbjct  29    EATSNVHIVYLGGKQHDDPMLKTDSHHDMLASVVGSKEIASELMVYSYKHGFSGFAAKLT  88

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+KVA +        +  H++QT+RSWDFLGLS  A+ P   L  ++ GDG+I+GV+
Sbjct  89    ESQAQKVAVI-------PNSLHRLQTTRSWDFLGLS--AHSPANTLHNSSMGDGVIIGVL  139

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  +F D G+GP+P  WKG C +  G RF     CN+K+IGARWF +G L    
Sbjct  140   DTGIWPEAKAFSDKGLGPIPSHWKGVCES--GKRFKAKSHCNKKIIGARWFVEGFLAEYG  197

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               LN     + +S  D  GHG+  AS  AG+F+ + +  G+ +G +RGGA  AR+A YK 
Sbjct  198   QPLNTSGNREFFSPRDANGHGTHTASTAAGTFIDDVSYRGLALGTIRGGAPRARLAIYKV  257

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN+   +  C+ AD+L A D AIHD VDV+S+S+GS +PL SD++  +GI  GSFHA+ 
Sbjct  258   CWNVLGGQ--CSSADILKAFDEAIHDGVDVLSLSIGSSIPLFSDIDERDGIATGSFHAVA  315

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GI V+  A N GP A T+ N  PW++TVAAS++DR     ITLGN + +     L +G+
Sbjct  316   KGITVVCGAANDGPFAQTVQNTAPWILTVAASSMDRALPTPITLGNNKTF-----LQHGS  370

Query  1325  ALSHPLH------------------------FAGK----YMGEADLMPRKLDPAEVKGKI  1230
             +L  PLH                         AG     + G        +D + V GK+
Sbjct  371   SLK-PLHSKLNCLTVEPMISAQATTLNFHTNLAGPSHIFWKGNCVCQFLSVDNSMVAGKV  429

Query  1229  VFMFGDDLDRNLVLVDKATD----AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGT  1065
             V  F      NL  V  A++    AG VG+I + NPS  ++L       P V+VDY+ GT
Sbjct  430   VLCF---TSMNLGAVRSASEVVKEAGGVGLIVAKNPS--EALYPCTDGFPCVEVDYEIGT  484

Query  1064  RIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIM  885
             RI  YI +ST +P  +LS  K  VG+ +  KV  FSSRGP+S AP I+KPDIAAPG  I+
Sbjct  485   RILFYI-RSTRSPVVKLSPSKTIVGKPVLAKVAHFSSRGPNSIAPAILKPDIAAPGVNIL  543

Query  884   CA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTY  717
              A    D   DGG+ + SGTS A PHVS I ALLK  HP+WSPA+IKSA+VTTAW ++  
Sbjct  544   AATSPLDRFQDGGYVMHSGTSMATPHVSGIAALLKAIHPDWSPASIKSAIVTTAWINNPS  603

Query  716   FSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKT  537
               PIFA+GS  + AD FDYGGGI NPN A  PGLVYDM   DY  YLCA+ YNN+ I + 
Sbjct  604   GFPIFAEGSPQKLADPFDYGGGIANPNGAAHPGLVYDMGTDDYVNYLCAMDYNNTAISRL  663

Query  536   ISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIV  357
                      T + T+CP   PS+L++NLPS+ +P+L   VTL RTVTNVG  NS+Y+ ++
Sbjct  664   ---------TGKPTVCPTEGPSILNINLPSITIPNLRNSVTLTRTVTNVGASNSIYRVVI  714

Query  356   KSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAV  177
             ++P    V V+P VL F+   KK +F++ V+    VN+ + FGS+TW DGVH VR+P++V
Sbjct  715   EAPFCCSVLVEPYVLVFNYTTKKITFSVTVNTTYQVNTGYFFGSITWIDGVHTVRSPLSV  774

Query  176   RKMIVPLYL  150
             R  I   Y+
Sbjct  775   RTEISQPYI  783



>ref|XP_009350314.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=718

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/745 (48%), Positives = 468/745 (63%), Gaps = 53/745 (7%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +LA VVGS E A  +MVYSYR+GFSGFAA LT SQAKK++  +GVV V  +  +  QT+R
Sbjct  1     MLASVVGSKEAAIDSMVYSYRHGFSGFAAKLTESQAKKISEFSGVVHVTPNSFYSPQTTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             SWD+LGLS  ++ P  L+ +TN GDG+++G++D GI  E     D G+GP+P RWKG C 
Sbjct  61    SWDYLGLS--SDSPTNLMHETNMGDGIVIGIMDFGIWPESKMLNDHGVGPIPTRWKGRCE  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
             +  G  FN +  CNRK+IGA+WF  G L   +   N  +  + YS  D AGHG+  A+  
Sbjct  119   S--GESFNATTHCNRKLIGAKWFIDGFLADNEQPFNT-VFREFYSPRDGAGHGTHTATTA  175

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRV  1602
             AGSFV NA+  G+ +G+VRGGA  A +A YK CWN+    FVCA ADLL A D AI+D V
Sbjct  176   AGSFVANASYQGLALGVVRGGAPRAHLAVYKTCWNV--LNFVCAAADLLKAFDEAIYDGV  233

Query  1601  DVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVIT  1422
             DV+S+S+G+  P  ++++  + I  GSFHA+ +GI V+ AA N GP+  T++NV PW+IT
Sbjct  234   DVLSLSIGNYNPKFAEVDKRDAIATGSFHAVAKGITVVCAADNTGPAPQTVSNVAPWIIT  293

Query  1421  VAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLM----PRK--  1260
             VAA+TIDR F   ITLGN           N T L   + F GK +G   L+    P +  
Sbjct  294   VAATTIDRSFPTPITLGN-----------NKTLLGQAM-FVGKEVGFTGLVYPEGPEQFP  341

Query  1259  ----------LDPAEVKGKIVFMFGDDLDRNLVL--VDKATDAGAVGVIYS-NPSNVDSL  1119
                       L+   V G +V  F        V   V     AG VGVI + NPSN+   
Sbjct  342   TAYGVCESLTLNTTHVAGNVVICFTTMPGPAQVTSAVSAVRSAGGVGVIIARNPSNL--F  399

Query  1118  PILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSS  939
                +   P + VDY+ GT I  YI +ST +PT +LS  K   G+ +  KV  FSSRGP++
Sbjct  400   GPCSDDFPCIVVDYELGTEIMLYI-RSTRSPTVKLSPSKTLTGKPIATKVAYFSSRGPNA  458

Query  938   FAPGIMKPDIAAPGDKIMCA---DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSP  768
              AP I+KPDIAAPG  I+ A   DPT DGGF + SGTS A PH++ IVALLK  HP WSP
Sbjct  459   IAPAILKPDIAAPGVNILAASSYDPTMDGGFALLSGTSMATPHIAGIVALLKSLHPGWSP  518

Query  767   AAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDY  588
             AA+KSALVTTAW +D +  PIFA+G+  + AD FDYGGG+VNPN A +PGL+YDM   DY
Sbjct  519   AAMKSALVTTAWKTDPFGEPIFAEGTGQKLADPFDYGGGLVNPNKAANPGLIYDMGTNDY  578

Query  587   AQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLR  408
               YLCA GYN S I   +         ++ T CP  +PS+LD+NLPS+ +P+L  PVTL 
Sbjct  579   INYLCAFGYNTSAISLLV---------KQATSCPVIKPSILDVNLPSITIPNLRNPVTLT  629

Query  407   RTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFG  228
             RTVTNVGPV S YK  ++ P+G  V VKP+ L F+   K  SFT+ VS    VN+A+ FG
Sbjct  630   RTVTNVGPVISTYKTQIEPPLGINVVVKPEALVFNSTVKALSFTVAVSTTYQVNTAYFFG  689

Query  227   SLTWSDGVHNVRTPIAVRKMIVPLY  153
             SLTW+DGVH V +PI+VR  I+  Y
Sbjct  690   SLTWTDGVHAVSSPISVRTQIIQSY  714



>ref|XP_010529408.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Tarenaya 
hassleriana]
Length=765

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/756 (46%), Positives = 469/756 (62%), Gaps = 36/756 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YI+Y+G +  DD   +  SH+ +L   +GS EEA K++VYS+R+GFSGFAA LT SQA
Sbjct  36    KVYIIYMGERRRDDPEFVTTSHHQMLESFLGSKEEALKSIVYSFRHGFSGFAAELTPSQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
              +++    VV V+  + HK++T+R+WD LGLS     P  LL  TN G   I+GV+D+G+
Sbjct  96    MEISEHEEVVHVIPSRIHKIKTTRTWDLLGLSPSPTSPKALLHDTNFGSEAIIGVIDTGV  155

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E P + D G+GP+P+RW+G C  + G  FN    CN+K+IGA+++    +       N
Sbjct  156   WPESPVYNDKGLGPIPKRWRGHC--VSGESFNGGVHCNKKLIGAKYYIDALIRQIGGHYN  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +  V D  S  D  GHG+ V++I  GSFVP  +  G+  G +RGGA  AR+A YKACWN+
Sbjct  214   RTEVPDFLSPRDTNGHGTHVSAIAGGSFVPKVSYFGLARGTLRGGAPRARIAMYKACWNV  273

Query  1673  --DPERFV--CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
               D    V  C  AD+  A D AIHD VDV+SVS+G  VPL  D E +    + +FHA+ 
Sbjct  274   MGDSGDAVGKCTTADIWKAFDDAIHDGVDVLSVSLGGSVPL--DGEVDQLDNVAAFHAVK  331

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GIPV+ AAGN GP+A T+ NV PWV+TVAA+T+DR F   I LGN        Q   G 
Sbjct  332   KGIPVVCAAGNDGPNAQTVVNVAPWVLTVAATTLDRSFPTAIALGNN-------QTIFGE  384

Query  1325  ALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIY  1146
             AL     F+   +  AD   RK+D   VKGK+  +F  +  +NL+ + +    GA G+I 
Sbjct  385   ALHTGREFSAGLIHIADAEDRKVD---VKGKMALIFDTEDTKNLIPLARL--GGASGLIL  439

Query  1145  SNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVP  966
             +  +N D L    A  P + VDY+ GT I  YI +S  +PT ++S  K  VGR  T KV 
Sbjct  440   AQMAN-DVLTQCPADFPCIFVDYELGTDILFYI-RSARSPTVRISPSKTLVGRPATTKVA  497

Query  965   DFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVAL  798
              FS RGP+S +P I+KPDIAAPG  I+ A    +  +D GF + +GTS + P +S I AL
Sbjct  498   AFSCRGPNSISPAILKPDIAAPGVGILSALSPDNDKADNGFGMETGTSMSTPVISGIAAL  557

Query  797   LKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPG  618
             LK  HP WSPAAI+SA+VTTAW +     PIFA+GSS + AD FDYGGG+VNP  A  PG
Sbjct  558   LKALHPRWSPAAIRSAMVTTAWRTSPSGEPIFAEGSSKKLADPFDYGGGLVNPEKAAKPG  617

Query  617   LVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTR-PSMLDLNLPSMV  441
             LVYDM   DY  YLC+ GYN+S I   +          E   CP  R PS+LD+NLPS+ 
Sbjct  618   LVYDMFMSDYVHYLCSTGYNDSSISNVVG---------ETVTCPTDRKPSILDVNLPSIT  668

Query  440   VPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA  261
             +PD+   V +RRTVTNVGPVNSVY+A+++ P+G  V   PK L FD   K+ +F +++S 
Sbjct  669   IPDIKDEVLVRRTVTNVGPVNSVYEAVIEPPLGINVEATPKKLVFDSRNKRVTFVVKIST  728

Query  260   DKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
                VN+ + FGSLTW+DGVH+VR P++VR  I+  Y
Sbjct  729   RHEVNTGYLFGSLTWTDGVHDVRIPLSVRTRILKHY  764



>ref|XP_010542106.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=712

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/732 (48%), Positives = 469/732 (64%), Gaps = 33/732 (5%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++GS E A  +MVYSYR+GFSGFAA LT  QA+++A +  V+ V+ D+ ++++T+R
Sbjct  1     MLWSLLGSKEAAHGSMVYSYRHGFSGFAAKLTDLQAEQIAELPEVIHVIPDRFYELETTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             +WD+LGLS     P  LL  TN GD +I+GVVDSG+  E  SF D GMGP+P RWKG C+
Sbjct  61    TWDYLGLSPVH--PKNLLNDTNMGDQVIIGVVDSGVWPESESFNDRGMGPIPSRWKGGCQ  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
             +  G RFN S  CNRK+IGA++F  G L+++  + N     +  S  D  GHG+ VAS  
Sbjct  119   S--GQRFNASTHCNRKLIGAKYFIDG-LVAETGNFNTTENPEYISPRDYVGHGTHVASTA  175

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRV  1602
              GSF+ N + +G+  G +RGGA  AR+A YK CWN  P    C  +D+L AID A+HD V
Sbjct  176   GGSFLSNVSYVGLGRGRMRGGAPRARIAVYKPCWNHQPS---CTASDILGAIDEAVHDGV  232

Query  1601  DVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVIT  1422
             DV+S+S+GS +P+  +++  +GI +G+FHA+ +GIPVI AAGN GP+A T+ NV PW++T
Sbjct  233   DVLSISLGSTIPILPEIDTHDGIAVGAFHAVAKGIPVICAAGNIGPAAQTVVNVAPWILT  292

Query  1421  VAASTIDRIFAYTITLGN-----GEKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKL  1257
             VAA+T DR F   ITLGN     G+   V  +L   T+L +P + +G     + +  R +
Sbjct  293   VAATTQDRSFPTPITLGNNITILGQALYVGQEL-GFTSLLYPQNVSGDCEKLSAIPNRTM  351

Query  1256  DPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDY  1077
                   GK+V  F    D   VL   A    A G+ +    N     I    IP V VDY
Sbjct  352   -----VGKVVLCFTSKTDFTAVLSAAAAVNEAGGLDFIVARNPGHTLIPCGSIPCVAVDY  406

Query  1076  DAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPG  897
             + GT I  YI +ST +P  ++   K  VG+ +  KV  FSSRGPSS +P ++KPDIAAPG
Sbjct  407   ELGTDILFYI-RSTRSPVVKIQPSKTLVGQPVATKVATFSSRGPSSISPAVLKPDIAAPG  465

Query  896   DKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWN  729
               I+ A    D   DG F + SGTS A P VSAIVALL+ SHP+WSPAAI+SA+VTTAW 
Sbjct  466   VNILAATSPNDVLGDGRFNMMSGTSMATPVVSAIVALLRPSHPDWSPAAIRSAIVTTAWK  525

Query  728   SDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSL  549
             +D    PIFA GS+ + AD FDYGGG+VNP  A DPGL+YDM   DY  Y+C++GYN+S 
Sbjct  526   TDPSGEPIFADGSNRKLADPFDYGGGLVNPEKAADPGLIYDMGTSDYVHYMCSVGYNDSS  585

Query  548   IYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVY  369
             I + +         +  T+CP  RPS+LDLNLPS+ +PDL   VTL RTVTNVGPV+SVY
Sbjct  586   ISQIV---------KNATVCPNPRPSILDLNLPSITIPDLRNEVTLTRTVTNVGPVDSVY  636

Query  368   KAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRT  189
             K +V+ P+G  VTV P ++ F+   K+ SFT+RVS    VNS F FGSLTW++  HNV  
Sbjct  637   KVVVEPPLGVSVTVTPDMIVFNSTTKRVSFTVRVSTGHKVNSGFYFGSLTWTESAHNVTI  696

Query  188   PIAVRKMIVPLY  153
             P++VR  I+  Y
Sbjct  697   PLSVRTQILERY  708



>ref|XP_006397048.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
 gb|ESQ38501.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
Length=764

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/763 (46%), Positives = 479/763 (63%), Gaps = 49/763 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K HDD   + ESH+ +L  ++GS E    ++VYSYR+GFSGFAA LT SQA
Sbjct  31    KVYVVYLGEKEHDDPTSVTESHHQMLWSLLGSKESVHDSIVYSYRHGFSGFAAKLTESQA  90

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ +  +++ T+R+WD+LGLS G +    L  K   G  +IVGV+D+G+
Sbjct  91    QQLSELPEVVHVIPNTLYELTTTRTWDYLGLSPGTS--KSLQHKAKMGSQVIVGVIDTGV  148

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C +  G  FN S  CNRK+IGA++F  G L++   D+N
Sbjct  149   WPESQMFNDKGYGPIPSRWKGGCES--GELFNASVHCNRKLIGAKYFVDG-LVADVGDVN  205

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +    +  S  D +GHG+ V+S + GSF+PN + LG+  G VRGGA   R+A YKACW  
Sbjct  206   RTENPEYLSPRDFSGHGTHVSSTIGGSFLPNVSYLGLGRGSVRGGAPGVRLAIYKACW--  263

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               +  VC+GAD+L AID AIHD VDV+S+S+GS VPL S+ +      +G+FHA+ +GIP
Sbjct  264   -LQSGVCSGADVLKAIDEAIHDGVDVLSLSLGSKVPLYSETDVRELTSVGAFHAVAKGIP  322

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ AAGNAGP A TI+NV PW++TVAA+T+DR F   ITLGN           N T L  
Sbjct  323   VVAAAGNAGPMAQTISNVAPWILTVAATTLDRSFPTAITLGN-----------NMTILGQ  371

Query  1313  PLHFAGKYMG--------EADLMPRKLDPAE-VKGKIVFMFGDDLDRNLVL--VDKATDA  1167
              + FAG  +G          D      +P + ++GK+V  F  +     V+  +    DA
Sbjct  372   AI-FAGPELGFVGLAYPLSGDCEKLSANPNKTMEGKVVLCFTTETTVPPVINAITAVRDA  430

Query  1166  GAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             G +GVI + NP++   L I  +  P V VD++ GT I  YI +ST +   ++ + +  V 
Sbjct  431   GGLGVIIARNPTH---LLIPTSNFPCVTVDFELGTDILFYI-RSTRSSIVKIQASRTLVA  486

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAP  822
               +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A    D +S  GF + SGTS A P
Sbjct  487   NYVATKVATFSSRGPNSISPAILKPDIAAPGVNILAATSLNDSSSVRGFSMKSGTSMATP  546

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              VS +V LLK  HP WSP+AIKSA+VTTAW +D    PIFA GSS + AD FDYGGG+VN
Sbjct  547   VVSGVVVLLKSLHPHWSPSAIKSAIVTTAWKTDPSGEPIFADGSSRKLADPFDYGGGLVN  606

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A  PGLVYDM   DY  YLCA  Y++  I + ++G        + T+CP  +PS+LD
Sbjct  607   PEKAAKPGLVYDMTTHDYILYLCAADYSDISISR-VAG--------KATVCPNPKPSVLD  657

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             LNLPS+ +P+L   VTL RTVTNVGPVNSVYK ++  P+G  V V P  L F+    K S
Sbjct  658   LNLPSITIPNLRDEVTLTRTVTNVGPVNSVYKVVIDPPMGVNVIVTPTKLVFNSTATKLS  717

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             FT++VS    VN+ + FGSLTW+D +HNV  P++VR  ++  Y
Sbjct  718   FTVKVSTTHKVNTGYFFGSLTWTDNLHNVAIPVSVRTQMLQRY  760



>ref|XP_006306822.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
 gb|EOA39720.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
Length=770

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/762 (46%), Positives = 484/762 (64%), Gaps = 38/762 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L+ ++GS ++A  +MVYSYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPEFVTESHHQMLSTLLGSKKDAHDSMVYSYRHGFSGFAAKLTKSQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             + +A +  VV V+ D  +++ T+R+WD+LGLS GAN P  LL  TN GD +I+GV+D+G+
Sbjct  88    RTIAELPEVVHVIPDGVYELATTRTWDYLGLS-GAN-PNNLLTDTNMGDQVIIGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P++WKG C +  G  F  ++ CNRK+IGA++F KG  L+Q+   N
Sbjct  146   WPESESFNDKGVGPIPRKWKGGCES--GENFRSTD-CNRKLIGAKYFIKG-FLAQNKGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VAS   GSFVPN +  G+  G +RGGA  AR+A YKACW L
Sbjct  202   STKSPDYISARDFDGHGTHVASTAGGSFVPNVSYKGLAGGTLRGGAPRARIAMYKACWYL  261

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +  +   C  +D++ AID A+HD VDV+S+S+   VPL  + +  N    G FHA+ +GI
Sbjct  262   EEVDGVTCLNSDIMKAIDEAMHDGVDVLSISLTGEVPLLPETDLSNEFATGLFHAVAKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG----  1329
              V+ A GN GP A T+TN  PW++TVAA+T+DR F   ITLGN  K  +     +G    
Sbjct  322   VVVCAGGNNGPEAQTVTNTAPWILTVAATTLDRSFPTPITLGN-NKVILGQATYSGPELG  380

Query  1328  -TALSHPLHFAGKYMGEADLMPRKLDP-AEVKGKIVFMFGDDLDRNLVLVDKAT---DAG  1164
              T+L +P   A    G  + +   L+P + + GK+V  F      N  +   A+    AG
Sbjct  381   LTSLVYPAD-AENSSGVCESL--NLNPNSTMAGKVVLCFTTS-RTNTAIASAASFVKTAG  436

Query  1163  AVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
              +G+I S NP  V +L       P V +DY+ GT I  YI +ST +P  ++   K   G+
Sbjct  437   GLGLIISRNP--VYTLAPCGDDFPCVAIDYELGTNILSYI-RSTKSPVVKIQPSKTLSGQ  493

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHAAPH  819
              +  KV  FSSRGP+S +P I+KPDIAAPG +I+ A  P S    GGF I SGTS + P 
Sbjct  494   PVGTKVVHFSSRGPNSMSPAILKPDIAAPGVRILAATSPNSTMSVGGFGILSGTSMSTPA  553

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             +S ++ALLK  HP+WSPAA +SA+VTTAW +D +   IFAKGSS + AD FDYGGG+VNP
Sbjct  554   ISGVIALLKSLHPDWSPAAFRSAIVTTAWRTDPFGEQIFAKGSSGKVADPFDYGGGLVNP  613

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               A +PGL+YDM   DY  YLC+ GYN+S I + +          + T+C   +PS+LD+
Sbjct  614   EKAAEPGLIYDMGSEDYILYLCSAGYNDSSISQLVG---------KVTVCSNPKPSVLDV  664

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +P+L   V L RTVTNVGPV+S+YK +V+ P+G +V VKP+ L F+   K+ SF
Sbjct  665   NLPSITIPNLKDEVNLTRTVTNVGPVDSIYKVVVEPPLGVIVVVKPETLVFNSKFKRVSF  724

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             T+RVS     N+ F FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  725   TVRVSTTHKTNTGFYFGSLTWTDSVHNVIIPVSVRTQILQNY  766



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/768 (46%), Positives = 468/768 (61%), Gaps = 52/768 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + H D   I  +H+++L  V+GS E +  +M+YSYR+GFSGFAA LT +QA
Sbjct  36    KVHIVYLGKRQHHDPEFITNTHHEMLTTVLGSKEASVDSMLYSYRHGFSGFAAKLTEAQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             + V+ +  VV V+  + HK++T+RSWD+LGLS  ++    LL +TN GDG+I+G++DSGI
Sbjct  96    QAVSELPDVVQVMPSRLHKLKTTRSWDYLGLSS-SHSSTNLLHETNMGDGIIIGLLDSGI  154

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG--ALLSQDVD  1860
               E   F D G+GP+P RWKG C +  G  FN ++ CNRK+IGAR+F KG  A + + ++
Sbjct  155   WPESKVFSDKGLGPIPSRWKGGCSS--GQSFNATKHCNRKLIGARYFLKGLEAEIGEPLN  212

Query  1859  LNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
               K+L  +  S  D  GHG+  +SI  GS V NA+  G+  G VRGGA  AR+A YKACW
Sbjct  213   TTKYL--EYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKACW  270

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             NL      C+ AD+L A D AIHD VDV+SVS+GS   L +++   + I IGSFHA+ +G
Sbjct  271   NLGGG--FCSDADILKAFDKAIHDGVDVLSVSLGSDDILFTEIIKPDSILIGSFHAVAQG  328

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ AAGN GPSA T+ N  PW++TVAAS+IDR F   ITLGN           N T +
Sbjct  329   ISVVCAAGNGGPSAQTVENTAPWILTVAASSIDRSFPTPITLGN-----------NRTVM  377

Query  1319  SHPLHFAGKYMGEADLM----PRKLDPAE----------VKGKIVFMFGDDLDRNLVLVD  1182
                +   G + G A L+    P    P+           V GK+   F            
Sbjct  378   GQAM-LIGNHTGFASLVYPDDPHLQSPSNCLSISPNDTSVAGKVALCFTSGTVETEFSAS  436

Query  1181  KATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
                 A  +GVI + N  N  +  I  +  P ++V Y+ G++I  YI  ST  P  +LS  
Sbjct  437   FVKAALGLGVIIAENSGNTQASCI--SDFPCIKVSYETGSQILHYI-SSTRHPHVRLSPS  493

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD----GGFRISSGT  837
             K  VG+ +   V  FSSRGPS  +P ++KPDIA PG +I+ A P SD      F   SGT
Sbjct  494   KTHVGKPVPTNVAYFSSRGPSFPSPAVLKPDIAGPGAQILGAVPPSDLKKNTEFAFHSGT  553

Query  836   SHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYG  657
             S A PH++ IVALLK  HP WSPAAIKSA+VTT W +D    PIFA+G   + AD FD+G
Sbjct  554   SMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFG  613

Query  656   GGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTR  477
             GGIVNPN A DPGLVYDM   DY  YLC LGYNNS I++          TE+   CP   
Sbjct  614   GGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNNSAIFQF---------TEQSIRCPTRE  664

Query  476   PSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGN  297
              S+LDLNLPS+ +P L    +L R VTNVG VNS YKA + SP G  +TVKP  L FD  
Sbjct  665   HSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISPAGTTITVKPDTLIFDST  724

Query  296   RKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              K  +F++ VS+ + VN+ ++FGSLTW DGVH VR+PI+VR MI   Y
Sbjct  725   IKTVTFSVTVSSIQQVNTGYSFGSLTWIDGVHAVRSPISVRTMIKESY  772



>ref|XP_009128710.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=764

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/764 (46%), Positives = 481/764 (63%), Gaps = 49/764 (6%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K+Y+VYLG K HDD   + E H+ +L  ++GS E    ++VYSYR+GFSGFAA LT SQ
Sbjct  30    RKVYVVYLGEKEHDDPASVTEYHHQMLWSLLGSKESVHDSIVYSYRHGFSGFAAKLTESQ  89

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A++++ +  VV V+ +  +++ T+R+WD+LGLS G +    L+ K + G  +IVGV+D+G
Sbjct  90    AQQLSELPEVVHVIPNTLYELTTTRTWDYLGLSPGTS--KSLVHKADMGRKIIVGVIDTG  147

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   + D G GP+P RWKGSC +  G  FN S  CN+K+IGA++F  G L+++  D 
Sbjct  148   VWPESEMYNDKGYGPIPSRWKGSCES--GELFNGSIHCNKKLIGAKYFVDG-LVAEIGDF  204

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             ++   ++  S  D  GHG+ V+S + GSF+P  + LG+  G V+GGA   R+A YKACW 
Sbjct  205   DRAENAEYASPRDFNGHGTHVSSTIGGSFLPGVSYLGLGRGTVKGGAPGVRLAIYKACW-  263

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                +   C+GAD+L AID AIHD VDV+S+S+GS VPL S+ +      +G+FHA+ +GI
Sbjct  264   --LQSGSCSGADVLKAIDEAIHDGVDVLSLSLGSKVPLYSETDVRELTSVGAFHAVAKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ AAGN GPSA TI+NV PW++TVAA+T+DR F   ITLGN           N T L 
Sbjct  322   PVVAAAGNDGPSAQTISNVAPWILTVAATTLDRSFPTAITLGN-----------NITILG  370

Query  1316  HPLHFAGKYMGEADLM-PRKLDPAEV--------KGKIVFMFGDDLDRNLVL--VDKATD  1170
               + FAG  +G +DL  P+  D  ++        +GK+V  F  +      +  +    +
Sbjct  371   QAI-FAGPELGYSDLTYPQSGDCQKLSANPNNTMEGKVVLCFTRETSVTPAVDAIIAVRN  429

Query  1169  AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
             AG +GVI + NP+++  LP  N   P V VD++ GT I  YI +ST +P  ++ + +  V
Sbjct  430   AGGLGVIIARNPTHL-LLPSRN--FPSVAVDFELGTDILFYI-RSTRSPIVKIGASRTLV  485

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAA  825
              R +  KV  FSSRGPSS +P I+KPDIAAPG  I+ A    D  S  GF + SGTS A 
Sbjct  486   ARPVATKVATFSSRGPSSISPAILKPDIAAPGVNILAATSLNDSFSVNGFSMKSGTSMAT  545

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P VS IV LLK  HP WSP+AIKSA+VTTAW +D    PIFA GSS + AD FDYGGG+V
Sbjct  546   PVVSGIVVLLKSLHPHWSPSAIKSAIVTTAWKTDPSGEPIFADGSSRKLADPFDYGGGLV  605

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A  PGLVYDM   DY  YLCA  Y++  I + +          + T+CP  +PS+L
Sbjct  606   NPERAAKPGLVYDMATHDYVLYLCAADYSDMSISRVLG---------KATVCPTPKPSVL  656

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             DLNLPS+ +P+L   VTL RTVTNVGP+NSVYK ++  P G  V V P    F+    K 
Sbjct  657   DLNLPSITIPNLRDEVTLTRTVTNVGPLNSVYKVVINPPTGVNVGVTPTTFVFNSTATKL  716

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             SFT+RV+    VN+ + FGSLTWSD +HNV  P++VR  I+P Y
Sbjct  717   SFTVRVTTTHRVNTGYFFGSLTWSDNMHNVAIPLSVRTQILPRY  760



>ref|XP_006306820.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
 gb|EOA39718.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
Length=771

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/777 (45%), Positives = 478/777 (62%), Gaps = 62/777 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + HD+   + ESH+ +L  ++GS E A  +MVYSYR+GFS FAA LT SQ 
Sbjct  23    KVHIVYLGERQHDNPDSVTESHHQMLWSILGSKEAAHDSMVYSYRHGFSAFAAKLTDSQV  82

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
              +++ +  VV V+ D+ +++QT+R+WD+L     +  P  LL +TN GD +I+GVVDSGI
Sbjct  83    IQLSELPEVVHVIRDRFYELQTTRTWDYL--KHTSRHPKNLLNQTNMGDKVIIGVVDSGI  140

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD-VDL  1857
               E  SF D G+GP+P+RWKGSC       FN S +CNRK+IGA++F  G +   D  + 
Sbjct  141   WPESESFSDNGLGPIPKRWKGSCET--KQSFNGSTVCNRKLIGAKYFISGLINGADESNW  198

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     +  S  D  GHG+ VA+  AGSFVP+A+ L +  G+ RGGA  AR+A YKACW+
Sbjct  199   NTTENPEYISPRDFNGHGTHVAATAAGSFVPDASYLALGRGIARGGAPRARIAMYKACWH  258

Query  1676  LDP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             L       C+ AD+L AID AIHD VDV+S+S   P+PL  +++A + + +G+FHA+ +G
Sbjct  259   LASIGTATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDARDAMAVGAFHAVAKG  318

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYA-----------  1353
             IPV+ + GNAGP++ T+TN  PW+ITVAA+T DR F   ITLGN                
Sbjct  319   IPVVCSGGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMD  378

Query  1352  -VDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEV-KGKIVFMFGDDLDRNLVLVDK  1179
              +    P G   S+       + G  + + +  +PA + K KIV  F            K
Sbjct  379   FIGLVYPEGPGASNE-----TFSGVCEDLAK--NPARIIKEKIVLCF-----------TK  420

Query  1178  ATDAGAVGVIYSNPSNVDSLPILNAR-----------IPYVQVDYDAGTRIKDYIFQSTM  1032
             +TD G V    S+  N+D   ++ AR            P + VDY+ GT I  YI +ST 
Sbjct  421   STDYGTVIQAASDVFNLDGYGVIVARNPGYQLNPCDGFPCLAVDYELGTDILFYI-RSTR  479

Query  1031  TPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSD  864
             +P A++   +  VG  +  KV  FSSRGPSS +P I+KPDIAAPG  I+ A    D   D
Sbjct  480   SPVAKIQPTRTLVGLPVATKVATFSSRGPSSISPAILKPDIAAPGVNILAATSPNDTFYD  539

Query  863   GGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSL  684
              GF + SGTS + P V+ IVALLK  HP WSPAAI+SA+VTTAW +D    PIFA GS+ 
Sbjct  540   RGFSMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWRTDPSGEPIFADGSNR  599

Query  683   RAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTE  504
             + AD FDYGGG+VN   A  PGLVYDM   DY  YLC++GY++S I + +S         
Sbjct  600   KLADPFDYGGGVVNSEKAAKPGLVYDMGVKDYVLYLCSVGYSDSSITRLVS---------  650

Query  503   EHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVK  324
             + T+C   +PS+LDLNLPS+ +P+L K VT+ RTVTNVG V SVYKA++++P+G  VTV 
Sbjct  651   KKTVCGNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGTVGSVYKAVIEAPMGVNVTVT  710

Query  323   PKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             P  L F+   +K SF +RV  +  VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  711   PSTLVFNAKTRKLSFKIRVLTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQILQHY  767



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/764 (47%), Positives = 466/764 (61%), Gaps = 52/764 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IVYLG + H D   I  +H+++L  V+GS E +  +M+YSYR+GFSGFAA LT +QA
Sbjct  36    KIHIVYLGMRQHHDPELITNTHHEMLTTVLGSKEASVDSMLYSYRHGFSGFAAKLTEAQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             + V+ +  VV V+  + HK++T+RSWD+LGLS  ++    LL +TN GDG+I+G++DSGI
Sbjct  96    QAVSELPDVVQVMPSRLHKLKTTRSWDYLGLSS-SHSSTNLLHETNMGDGIIIGLLDSGI  154

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG--ALLSQDVD  1860
               E   F D G+GP+P RWKG C +  G  FN ++ CNRK+IGAR+F KG  A + + ++
Sbjct  155   WPESKVFSDKGLGPIPSRWKGGCSS--GQSFNATKHCNRKLIGARYFLKGLEAEIGEPLN  212

Query  1859  LNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
               ++L  +  S  D  GHG+  +SI  GS V NA+  G+  G VRGGA  AR+A YKACW
Sbjct  213   TTEYL--EYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKACW  270

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             NL      C+ AD+L A D AIHD VDV+SVS+GS   L +++   + I IGSFHA+ +G
Sbjct  271   NLGGG--FCSDADILKAFDKAIHDGVDVLSVSLGSDDILFTEIIKPDSILIGSFHAVAQG  328

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ AAGN GPSA T+ N  PW++TVAAS+IDR F   ITLGN           N T +
Sbjct  329   ISVVCAAGNGGPSAQTVDNTAPWILTVAASSIDRSFPTPITLGN-----------NRTVM  377

Query  1319  SHPLHFAGKYMGEADLM----PRKLDPAE----------VKGKIVFMFGDDLDRNLVLVD  1182
                +   G + G A L+    P    P+           V GK+   F            
Sbjct  378   GQAM-LIGNHTGFASLVYPDDPHVESPSNCLSISPNDTSVAGKVALCFTSGTFETQFAAS  436

Query  1181  KATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
                +A  +GVI + N  N  +  I  +  P ++V Y+ G++I  YI  ST  P   LS  
Sbjct  437   FVKEARGLGVIIAENSGNTQASCI--SDFPCIKVSYETGSQILHYI-SSTRHPHVSLSPS  493

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD----GGFRISSGT  837
             K  VG+ +   V  FSSRGPS  +P ++KPDIA PG +I+ A P SD      F   SGT
Sbjct  494   KTHVGKPVPTNVAYFSSRGPSFPSPAVLKPDIAGPGAQILGAVPPSDLKKNTEFAFHSGT  553

Query  836   SHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYG  657
             S A PH++ IVALLK  HP WSPAAIKSA+VTT W +D    PIFA+G   + AD FD+G
Sbjct  554   SMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFG  613

Query  656   GGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTR  477
             GGIVNPN A DPGLVYDM   DY  YLC LGYNNS I++          TE+   CP   
Sbjct  614   GGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNNSAIFQF---------TEQSIRCPTGE  664

Query  476   PSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGN  297
              S+LDLNLPS+ +P L    +L R VTNVG VNS YKA + SP G  +TVKP  L FD  
Sbjct  665   HSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFDST  724

Query  296   RKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
              K  +F++ VS+   VN+ ++FGSLTW DGVH VR+PI+VR MI
Sbjct  725   IKTVTFSVTVSSIHQVNTGYSFGSLTWIDGVHAVRSPISVRTMI  768



>ref|XP_010529409.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Tarenaya 
hassleriana]
Length=761

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/756 (46%), Positives = 467/756 (62%), Gaps = 40/756 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YI+Y+G +  DD   +  SH+ +L   +GS EEA K++VYS+R+GFSGFAA LT SQA
Sbjct  36    KVYIIYMGERRRDDPEFVTTSHHQMLESFLGSKEEALKSIVYSFRHGFSGFAAELTPSQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
              +++    VV V+  + HK++T+R+WD LGLS     P  LL  TN G   I+GV+D   
Sbjct  96    MEISEHEEVVHVIPSRIHKIKTTRTWDLLGLSPSPTSPKALLHDTNFGSEAIIGVID---  152

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
              TE P + D G+GP+P+RW+G C  + G  FN    CN+K+IGA+++    +       N
Sbjct  153   -TESPVYNDKGLGPIPKRWRGHC--VSGESFNGGVHCNKKLIGAKYYIDALIRQIGGHYN  209

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +  V D  S  D  GHG+ V++I  GSFVP  +  G+  G +RGGA  AR+A YKACWN+
Sbjct  210   RTEVPDFLSPRDTNGHGTHVSAIAGGSFVPKVSYFGLARGTLRGGAPRARIAMYKACWNV  269

Query  1673  --DPERFV--CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
               D    V  C  AD+  A D AIHD VDV+SVS+G  VPL  D E +    + +FHA+ 
Sbjct  270   MGDSGDAVGKCTTADIWKAFDDAIHDGVDVLSVSLGGSVPL--DGEVDQLDNVAAFHAVK  327

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GIPV+ AAGN GP+A T+ NV PWV+TVAA+T+DR F   I LGN        Q   G 
Sbjct  328   KGIPVVCAAGNDGPNAQTVVNVAPWVLTVAATTLDRSFPTAIALGNN-------QTIFGE  380

Query  1325  ALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIY  1146
             AL     F+   +  AD   RK+D   VKGK+  +F  +  +NL+ + +    GA G+I 
Sbjct  381   ALHTGREFSAGLIHIADAEDRKVD---VKGKMALIFDTEDTKNLIPLARL--GGASGLIL  435

Query  1145  SNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVP  966
             +  +N D L    A  P + VDY+ GT I  YI +S  +PT ++S  K  VGR  T KV 
Sbjct  436   AQMAN-DVLTQCPADFPCIFVDYELGTDILFYI-RSARSPTVRISPSKTLVGRPATTKVA  493

Query  965   DFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVAL  798
              FS RGP+S +P I+KPDIAAPG  I+ A    +  +D GF + +GTS + P +S I AL
Sbjct  494   AFSCRGPNSISPAILKPDIAAPGVGILSALSPDNDKADNGFGMETGTSMSTPVISGIAAL  553

Query  797   LKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPG  618
             LK  HP WSPAAI+SA+VTTAW +     PIFA+GSS + AD FDYGGG+VNP  A  PG
Sbjct  554   LKALHPRWSPAAIRSAMVTTAWRTSPSGEPIFAEGSSKKLADPFDYGGGLVNPEKAAKPG  613

Query  617   LVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTR-PSMLDLNLPSMV  441
             LVYDM   DY  YLC+ GYN+S I   +          E   CP  R PS+LD+NLPS+ 
Sbjct  614   LVYDMFMSDYVHYLCSTGYNDSSISNVVG---------ETVTCPTDRKPSILDVNLPSIT  664

Query  440   VPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA  261
             +PD+   V +RRTVTNVGPVNSVY+A+++ P+G  V   PK L FD   K+ +F +++S 
Sbjct  665   IPDIKDEVLVRRTVTNVGPVNSVYEAVIEPPLGINVEATPKKLVFDSRNKRVTFVVKIST  724

Query  260   DKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
                VN+ + FGSLTW+DGVH+VR P++VR  I+  Y
Sbjct  725   RHEVNTGYLFGSLTWTDGVHDVRIPLSVRTRILKHY  760



>ref|XP_010478712.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=771

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/772 (45%), Positives = 479/772 (62%), Gaps = 52/772 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + HD    + ESH+ +L  ++GS E A ++MVYSYR+GFS FAA LT SQ 
Sbjct  23    KVHIVYLGERQHDHPDSVTESHHQMLWSILGSKEAAHESMVYSYRHGFSAFAAKLTDSQV  82

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
              +++ +  VV V+ D+ +++QT+R+WD+L     +  P  LL +TN GD +I+GVVDSGI
Sbjct  83    IQLSELPEVVHVIRDRFYELQTTRTWDYL--KHTSRHPKNLLNQTNMGDKVIIGVVDSGI  140

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD-VDL  1857
               E  SF D G+GP+P+RWKG+C +     FN S +CNRK+IGA++F  G +   D  + 
Sbjct  141   WPESESFSDKGLGPIPKRWKGTCES--KQSFNGSTVCNRKLIGAKYFISGLINGADESNW  198

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     +  S  D  GHG+ VA+  AGSFVP+A+ L +  G  RGGA  AR+A YKACW+
Sbjct  199   NTTENPEYISPRDFNGHGTHVAATAAGSFVPDASYLALGRGTARGGAPRARIAMYKACWH  258

Query  1676  LDP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             L       C+ AD+L AID AIHD VDV+S+S   P+PL  +++A++ + +G+FHA+ +G
Sbjct  259   LASIGTATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDAQDAMAVGAFHAVAKG  318

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD--WQLPNG-  1329
             IPV+ + GNAGP++ T+TN  PW+ITVAA+T DR F   ITLGN         +Q P+  
Sbjct  319   IPVVCSGGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMD  378

Query  1328  -TALSHPLHFAGK---YMGEADLMPRKLDPAEV-KGKIVFMFGDDLDRNLVLVDKATDAG  1164
              T L +P         + G  + + +  +PA + K KIV  F            K+TD G
Sbjct  379   FTGLVYPEGPGASNETFSGVCEDLAK--NPARIIKEKIVLCF-----------TKSTDYG  425

Query  1163  AVGVIYSNPSNVDSLPILNAR-----------IPYVQVDYDAGTRIKDYIFQSTMTPTAQ  1017
              +    S+  N+D   ++ AR            P + VDY+ GT I  YI +ST +P A+
Sbjct  426   TLIQAASDVFNLDGYGVIVARNPGYQLNPCDGFPCLAVDYELGTDILFYI-RSTRSPVAK  484

Query  1016  LSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRI  849
             +   +  VG  +  KV  FSSRGPSS  P I+KPDIAAPG  I+ A    D   D GF +
Sbjct  485   IQPTRTLVGLPVATKVATFSSRGPSSITPAILKPDIAAPGVNILAATSPNDTFYDRGFSM  544

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS + P V+ IVALLK  HP WSPAAI+SA+VTTAW +D    PIFA GS+ + AD 
Sbjct  545   KSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWRTDPSGEPIFADGSNRKLADP  604

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FDYGGG+VN   A  PGLVYDM   DY  YLC++GY +S I + +          + T+C
Sbjct  605   FDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTDSSITRLV---------RKKTVC  655

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
                +PS+LDLNLPS+ +P+L K VT+ RTVTNVG V SVYKA++++P+G  VTV P  L 
Sbjct  656   GNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGTVGSVYKAVIEAPMGVNVTVTPSTLV  715

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F+   +K SF +RV  +  VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  716   FNAKTRKLSFKVRVLTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQILQRY  767



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/763 (46%), Positives = 479/763 (63%), Gaps = 36/763 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD + + ESH+ +L+ ++GS  EA  +MV+SYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPKHVTESHHQMLSSLLGSEVEAHDSMVHSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    VV V+ D  +++ T+R+WD+LGLS   + P  LL  TN GD +I+G +DSG+
Sbjct  88    KKIADSPDVVHVIPDSFYELATTRTWDYLGLS--VSNPKNLLNDTNMGDQVIIGFIDSGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GPVP  WKG C++  G  F  +  CNRK+IGA++F  G  L+++   N
Sbjct  146   WPESESFNDNGVGPVPSHWKGECQS--GENFMSTN-CNRKLIGAKYFING-FLAENEGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VASI  GSFVPN +  G+  G +RGGA  AR+A YKACW +
Sbjct  202   STGSRDYISARDFIGHGTHVASIAGGSFVPNVSYKGLAGGNLRGGAPRARIAIYKACWYV  261

Query  1673  DPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D    V C+ +D+L A+D A+HD VDV+S+S+G+ VPL  + +  + I  G+FHA+ +GI
Sbjct  262   DQLGAVACSSSDILKAMDEAMHDGVDVLSLSLGAQVPLFPETDLRDRIATGAFHAVAKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG----  1329
              V+ A GN+GP+A T+ N  PWVITVAA+T+DR F   ITLGN     +   L  G    
Sbjct  322   IVVCAGGNSGPAAQTVLNTAPWVITVAATTLDRSFLTPITLGN-NNVILGQALYTGPEVG  380

Query  1328  -TALSHPLHFAGKYMGEADLMPR-KLDP-AEVKGKIVFMFGDDLDRNLVLVDKATD----  1170
              T+L +P +     +  + +  R  L+P   ++GK+V  F          V +A      
Sbjct  381   FTSLVYPENSGHSNVTFSGVCERLNLNPNGTMRGKVVLCF--TTATLFTAVSRAASYVKA  438

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             AG VGVI +     +  P  +   P V +DY+ GT I  YI +ST +P  ++   +  VG
Sbjct  439   AGGVGVIIARNPGYNLTPCRD-DFPCVAIDYELGTDILLYI-RSTGSPVVKIQPSRTMVG  496

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISSGTSHAAP  822
             + +  KV  FSSRGP+S +P I+KPDI APG  I+ A      +S GGF I +GTS AAP
Sbjct  497   QPVGTKVATFSSRGPNSISPAILKPDIGAPGVSILAATSPDSNSSAGGFDILAGTSMAAP  556

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S +VALLK  HP+WSPAAIKSA+VTTAW +D +   IFA+GSS + AD FDYGGG+VN
Sbjct  557   VISGVVALLKAMHPDWSPAAIKSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDYGGGLVN  616

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A DPGL+YDM   DY  YLC+ GYN+S I + +          + T+C   +PS+LD
Sbjct  617   PEKAADPGLIYDMGPKDYILYLCSAGYNDSSISQLVG---------QVTVCSNPKPSVLD  667

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             +NLPS+ +P+L + V L RTVTNVGPVNSVYK +V+ P+G  V V PK L F+   K  S
Sbjct  668   VNLPSLTIPNLKEEVNLTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKSLS  727

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F +RVS    +N+ F FGSL W D VHNV  P++VR  I+  Y
Sbjct  728   FMVRVSTIHKINTGFYFGSLIWRDSVHNVTIPVSVRTQILQNY  770



>ref|XP_010461118.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=771

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/772 (45%), Positives = 478/772 (62%), Gaps = 52/772 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + HD    + ESH+ +L  ++GS E A  +MVYSYR+GFS FAA LT SQ 
Sbjct  23    KVHIVYLGERQHDHPDSVTESHHQMLWSILGSKEAAHDSMVYSYRHGFSAFAAKLTDSQV  82

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
              +++ +  VV V+ D+ +++QT+R+WD+L        P  LL +TN GD +I+GVVDSGI
Sbjct  83    IQLSELPEVVHVIRDRFYELQTTRTWDYL--KHTTRHPKNLLNQTNMGDKVIIGVVDSGI  140

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD-VDL  1857
               E  SF D G+GP+P+RWKGSC +     FN S +CNRK+IGA++F  G +   D  + 
Sbjct  141   WPESESFSDKGLGPIPKRWKGSCDS--KQSFNGSTVCNRKLIGAKYFISGLINGADESNW  198

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     +  S  D  GHG+ VA+  AGSFV +A+ L +  G  RGGA  ARVA YKACW+
Sbjct  199   NTTENPEYISPRDFNGHGTHVAATAAGSFVSDASYLALGRGTARGGAPRARVAMYKACWH  258

Query  1676  LDP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             L       C+ AD+L AID AIHD VDV+S+S   P+PL  +++A++ + +G+FHA+ +G
Sbjct  259   LASIGTATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDAQDAMAVGAFHAVAKG  318

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD--WQLPNG-  1329
             IPV+ + GNAGP++ T+TN  PW+ITVAA+T DR F   ITLGN         +Q P+  
Sbjct  319   IPVVCSGGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMD  378

Query  1328  -TALSHPLHFAGK---YMGEADLMPRKLDPAEV-KGKIVFMFGDDLDRNLVLVDKATDAG  1164
              T L +P         + G  + + +  +PA + K KIV  F            K+TD G
Sbjct  379   FTGLVYPEGPGASNETFSGVCEDLAK--NPARIIKEKIVLCF-----------TKSTDYG  425

Query  1163  AVGVIYSNPSNVDSLPILNAR-----------IPYVQVDYDAGTRIKDYIFQSTMTPTAQ  1017
              +    S+  N+D   ++ AR            P + VDY+ GT I  YI +ST +P A+
Sbjct  426   TLIQAASDVFNLDGYGVIVARNPGYQLNPCDGFPCLAVDYELGTDILFYI-RSTRSPVAK  484

Query  1016  LSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRI  849
             +   +  VG  +  KV  FSSRGPSS +P I+KPDIAAPG  I+ A    D   D GF +
Sbjct  485   IQPTRTLVGLPVATKVATFSSRGPSSISPAILKPDIAAPGVNILAATSPNDTFYDRGFSM  544

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS + P V+ IVALLK  HP WSPAAI+SA+VTTAW +D    PIFA GS+ + AD 
Sbjct  545   KSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWRTDPSGEPIFADGSNRKLADP  604

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FDYGGG+VN   A  PGLVYDM   DY  YLC++GY +S I + +          + T+C
Sbjct  605   FDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTDSSITRLV---------RKKTVC  655

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
                +PS+LDLNLPS+ +P+L K VT+ RTVTNVGPV SVYKA++++P+G  VTV P  L 
Sbjct  656   GNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGPVGSVYKAVIEAPMGVNVTVTPSTLV  715

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F+   +K SF +RV  +  VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  716   FNAKTRKLSFKVRVVTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQILQRY  767



>ref|XP_010499844.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010499845.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=771

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/772 (45%), Positives = 479/772 (62%), Gaps = 52/772 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + HD    + ESH+ +L  ++GS E A  +MVYSYR+GFS FAA LT SQ 
Sbjct  23    KVHIVYLGERQHDHPDSVTESHHQMLWSILGSKEAAHDSMVYSYRHGFSAFAAKLTDSQV  82

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
              +++ +  V+ V+ ++ +++QT+R+WD+L     +  P  LL +TN GD +I+GVVDSGI
Sbjct  83    IQLSELPEVIHVIRERFYELQTTRTWDYL--KHTSRHPKNLLNQTNMGDKVIIGVVDSGI  140

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD-VDL  1857
               E  SF D G+GP+P+RWKGSC +     FN S +CNRK+IGA++F  G +   D  + 
Sbjct  141   WPESESFSDKGLGPIPKRWKGSCDS--KQSFNGSTVCNRKLIGAKYFISGLINGADESNW  198

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     +  S  D  GHG+ VA+  AGSFVP+A+ L +  G  RGGA  AR+A YKACW+
Sbjct  199   NTTENPEYISPRDFNGHGTHVAATAAGSFVPDASYLALGRGTARGGAPRARIAMYKACWH  258

Query  1676  LDP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             L       C+ AD+L AID AIHD VDV+S+S   P+PL  +++A++ + +G+FHA+ +G
Sbjct  259   LASIGTATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDAQDAMAVGAFHAVAKG  318

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD--WQLPNG-  1329
             IPV+ + GNAGP++ T+TN  PW+ITVAA+T DR F   ITLGN         +Q P+  
Sbjct  319   IPVVCSGGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMD  378

Query  1328  -TALSHPLHFAGK---YMGEADLMPRKLDPAEV-KGKIVFMFGDDLDRNLVLVDKATDAG  1164
              T L +P         + G  + + +  +PA + K KIV  F            K+TD G
Sbjct  379   FTGLVYPEGPGASNETFSGVCEDLAK--NPARIIKEKIVLCF-----------TKSTDYG  425

Query  1163  AVGVIYSNPSNVDSLPILNAR-----------IPYVQVDYDAGTRIKDYIFQSTMTPTAQ  1017
              +    S+  N+D   ++ AR            P + VDY+ GT I  YI +ST +P A+
Sbjct  426   TLIQAASDVFNLDGYGVIVARNPGYQLNPCDGFPCLAVDYELGTDILFYI-RSTRSPVAK  484

Query  1016  LSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRI  849
             +   +  VG  +  KV  FSSRGPSS +P I+KPDIAAPG  I+ A    D   D GF +
Sbjct  485   IQPTRTLVGLPVATKVATFSSRGPSSISPAILKPDIAAPGVNILAATSPNDTFYDRGFSM  544

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS + P V+ IVALLK  HP WSPAAI+SA+VTTAW +D    PIFA GS+ + AD 
Sbjct  545   KSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWRTDPSGEPIFADGSNRKLADP  604

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FDYGGG+VN   A  PGLVYDM   DY  YLC++GY +S I + +          + T+C
Sbjct  605   FDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTDSSITRLV---------RKKTVC  655

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
                +PS+LDLNLPS+ +P+L K VT+ RTVTNVGPV SVYKA++++P+G  V V P  L 
Sbjct  656   GNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGPVGSVYKAVIEAPMGVNVNVTPSALV  715

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F+   +K SF +RV  +  VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  716   FNAKTRKLSFKVRVVTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQILQRY  767



>ref|XP_010421968.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=759

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/764 (46%), Positives = 474/764 (62%), Gaps = 54/764 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K HD    + ESH+ LL  ++GS +E   ++VYSYR+GFSGFAA LT SQA
Sbjct  29    KVYVVYLGKKTHDHPESVTESHHQLLRPLLGSKKEVHDSVVYSYRHGFSGFAAKLTESQA  88

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ +  +++ T+R+WD+LGLS G +    LL K N G  +IVGV+D+G+
Sbjct  89    QQISQLPEVVHVIPNTLYELTTTRTWDYLGLSPGTS--KSLLHKANMGSQVIVGVIDTGV  146

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C  + G  FN S  CN+K+IGA++F  G L+++   LN
Sbjct  147   WPESEMFNDKGYGPIPSRWKGGC--VSGELFNASIHCNKKLIGAKYFVDG-LVAEIGVLN  203

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+ VAS V GSF+PN + LG+  G  RGGA    +A YKACW+ 
Sbjct  204   TTENPEYLSPRDFNGHGTHVASTVGGSFLPNVSYLGLGRGTARGGAPGVYLAIYKACWS-  262

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSP-VPLASDMEAENGIGIGSFHAITRGI  1497
                +  C+GADLL AID AIHD VDV+S+S+GSP +PL  + +  N   +G FHA+ +GI
Sbjct  263   ---QIGCSGADLLKAIDQAIHDGVDVLSLSLGSPNIPLNLETDV-NLFAMGLFHAVAKGI  318

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ +AGN GP+A TI NV PW++TVAA+T+DR F   ITLGN           N T L 
Sbjct  319   HVVASAGNNGPAAQTIANVSPWILTVAATTLDRSFPTAITLGN-----------NITTLG  367

Query  1316  HPLHFAGKYMGEADLM----PRKLDPAEVK--------GKIVFMFGDDLD-RNLVLVDKA  1176
               + FAG  +G  DL     P   D AE++        GK+V  F  DL+  ++ +V+  
Sbjct  368   QAI-FAGPELGFVDLTDPERPLSGDCAELRANPNKTMQGKVVLCFTADLNPTSMAVVNAV  426

Query  1175  T---DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
             T   +AG +GVI +       +P  N   P V VD++ GT I  YI +ST +P  ++ + 
Sbjct  427   TAVSNAGGLGVIIARNPTYSLIPTPN--FPCVMVDFELGTDILFYI-RSTRSPIVKIHAS  483

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAA  825
             +  V   +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A+ T   G  + SGTS A 
Sbjct  484   RTLVSHHVATKVATFSSRGPNSISPAILKPDIAAPGVNIVAANRT---GVVMRSGTSMAT  540

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P V+ +V LLK  +P WSPAA++SA+VTTAW +D    PIFA GSS + AD FDYGGG+V
Sbjct  541   PVVTGVVVLLKSLYPHWSPAAVRSAIVTTAWKTDPSGEPIFADGSSRKLADPFDYGGGLV  600

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A  PGL+YDM   DY  YLC+  YNN  I + +         E+ T+CP  +PS+L
Sbjct  601   NPEKAARPGLIYDMTIADYVSYLCSTYYNNVSISQVL---------EKKTVCPNPKPSVL  651

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             DLNLPS+ +P+L   VTL RTVTNVGP+NS+YK ++  P+G  +TV P  L F    K  
Sbjct  652   DLNLPSITIPNLKDEVTLTRTVTNVGPLNSIYKVMIDPPIGVSMTVTPDTLEFSSTTKIV  711

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             SF +RVS    VN+ + FGSLTW+D VHNV  P++VR  I   Y
Sbjct  712   SFKVRVSTRHKVNTGYYFGSLTWTDSVHNVVIPVSVRTQIFQRY  755



>ref|NP_567359.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03440.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=48.3, E=2.3e-12, n=4) [Arabidopsis thaliana]
 emb|CAB40045.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78175.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82893.1| Subtilase family protein [Arabidopsis thaliana]
Length=756

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/762 (45%), Positives = 478/762 (63%), Gaps = 52/762 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K HD+   + ESH+ +L  ++GS E    ++VYSYR+GFSGFAA LT SQA
Sbjct  28    KVYVVYLGEKEHDNPESVTESHHQMLWSLLGSKEAVLDSIVYSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ +  +++ T+R+WD+LG+S G +    LL+K N G  +IVGV+DSG+
Sbjct  88    QQISELPEVVQVIPNTLYEMTTTRTWDYLGVSPGNS--DSLLQKANMGYNVIVGVIDSGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C +  G  FN S  CNRK+IGA++F  G L+++   +N
Sbjct  146   WPESEMFNDKGFGPIPSRWKGGCES--GELFNASIHCNRKLIGAKYFVDG-LVAEFGVVN  202

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +    +  S  D AGHG+ VAS + GSF+PN + +G+  G  RGGA    +A YKACW+ 
Sbjct  203   RTQNPEYLSPRDFAGHGTHVASTIGGSFLPNVSYVGLGRGTARGGAPGVHIAVYKACWS-  261

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   C+GAD+L A+D AIHD VD++S+S+G  VPL  + E  +   +G+FHA+ +GIP
Sbjct  262   ----GYCSGADVLKAMDEAIHDGVDILSLSLGPSVPLFPETEHTS---VGAFHAVAKGIP  314

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V++AAGNAGP+A TI+NV PWV+TVAA+T DR F   ITLGN           N T L  
Sbjct  315   VVIAAGNAGPTAQTISNVAPWVLTVAATTQDRSFPTAITLGN-----------NITILGQ  363

Query  1313  PLH------FAGKYMGEA----DLMPRKLDP-AEVKGKIVFMFGDDLDRNLVLVDKATDA  1167
              ++      F G    E+    D      +P + ++GK+V  F      N  +       
Sbjct  364   AIYGGPELGFVGLTYPESPLSGDCEKLSANPNSTMEGKVVLCFAASTPSNAAIAAVINAG  423

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
             G   ++  NP++  SL     + P+V +D++ GT I  YI +ST +P  ++ + K   G+
Sbjct  424   GLGLIMAKNPTH--SL-TPTRKFPWVSIDFELGTDILFYI-RSTRSPIVKIQASKTLFGQ  479

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTS---DGGFRISSGTSHAAPH  819
             +++ KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P S   DGGF + SGTS A P 
Sbjct  480   SVSTKVATFSSRGPNSVSPAILKPDIAAPGVNILAAISPNSSINDGGFAMMSGTSMATPV  539

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             VS +V LLK  HP+WSP+AIKSA+VTTAW +D    PIFA GSS + AD FDYGGG++NP
Sbjct  540   VSGVVVLLKSLHPDWSPSAIKSAIVTTAWRTDPSGEPIFADGSSRKLADPFDYGGGLINP  599

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               A  PGL+YDM   DY  Y+C++ Y++  I + +          + T+CP  +PS+LDL
Sbjct  600   EKAVKPGLIYDMTTDDYVMYMCSVDYSDISISRVLG---------KITVCPNPKPSVLDL  650

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +P+L   VTL RTVTNVGPVNSVYK ++  P G  V V P  L FD    KRSF
Sbjct  651   NLPSITIPNLRGEVTLTRTVTNVGPVNSVYKVVIDPPTGINVAVTPAELVFDYTTTKRSF  710

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             T+RVS    VN+ + FGSLTW+D +HNV  P++VR  I+  Y
Sbjct  711   TVRVSTTHKVNTGYYFGSLTWTDNMHNVAIPVSVRTQILQRY  752



>ref|XP_007039330.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23831.1| Subtilase family protein, putative [Theobroma cacao]
Length=1029

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/765 (47%), Positives = 477/765 (62%), Gaps = 34/765 (4%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    ++IVYLG +  DD + + +SH+DLLA VVGS E A   MVYSYR+GFSGFAA LT
Sbjct  28    EAKSNVHIVYLGERQLDDPKLVTDSHHDLLATVVGSKEVASDLMVYSYRHGFSGFAAKLT  87

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+K++ + GVV V+ +  H++QT+RSWDFLGLS  ++ P  +L+ +  GDG+I+GV 
Sbjct  88    ESQAQKLSELPGVVRVIPNSLHRLQTTRSWDFLGLS--SHYPTNILQNSKMGDGVIIGVF  145

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  +F D G+GP+P RWKG C++  G  FN +  CNRK+IGARWF  G L    
Sbjct  146   DTGIWPESKAFSDEGLGPIPSRWKGVCKS--GDHFNAATHCNRKIIGARWFIDGFLAEYG  203

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
                N     + +S  D  GHG+  +S   GS+V N +  G+  G VRGGA  AR+A YK 
Sbjct  204   QPFNTSEDPEYFSPRDANGHGTHTSSTAGGSYVRNVSYRGLGPGTVRGGAPHARLAIYKV  263

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN+   +  CA AD+L A D AIHD VDV+S+S+G  +PL SD++  +GI  GSFHA+ 
Sbjct  264   CWNVLGGQ--CASADILKAFDEAIHDGVDVLSLSIGYSLPLFSDVDERDGIATGSFHAVA  321

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---AVDWQLP  1335
             RGI V+  A N GPSA T+ N  PW++TVAAST+DR F   ITLGN + +   A+     
Sbjct  322   RGITVVCGAANDGPSAQTVQNTAPWIVTVAASTMDRAFPTPITLGNNKTFLGQAIFTGKE  381

Query  1334  NG-TALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT--DAG  1164
             NG T L++P                 L+   V GK+V  F     R  +    AT  +AG
Sbjct  382   NGFTGLTYPEGTGLDPTSAGACQDLLLNSTLVAGKVVLCFASVARRVAIRSAAATLQEAG  441

Query  1163  AVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
               G+I + NPS  D+L   +   P ++VDY+ GTRI  YI +S  +PT +LS  K  VG+
Sbjct  442   GTGLIIAKNPS--DALTECSNDFPCIEVDYEIGTRILYYI-RSAKSPTVKLSPSKTLVGK  498

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPH  819
              ++ KV  FSSRGPSS AP I+KPDI APG  I+ A    +   D G+ I SGTS A PH
Sbjct  499   PVSAKVAFFSSRGPSSIAPEILKPDITAPGVNILAAISQLNQLRDDGYAIRSGTSMATPH  558

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             VS IVALLK  HP+WSPAAIKSALVTTAW  D    P+FA+GS  + A+ FD+GGGIVNP
Sbjct  559   VSGIVALLKAIHPDWSPAAIKSALVTTAWTKDASGLPLFAEGSPQKLANPFDFGGGIVNP  618

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
             N A DPGLVYDM   DY QYLCA+GYN+S I +          T + T+CP  +PS+LD+
Sbjct  619   NGAADPGLVYDMGTSDYIQYLCAMGYNDSAISRL---------TGQSTVCPIKKPSILDV  669

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             N+PS+ +  L    TL RTVTNVG   SVY+A+++ P G  VTV+P VL F+   KK SF
Sbjct  670   NVPSITISSLRNSATLTRTVTNVGAPISVYRAVIEPPTGITVTVRPNVLVFNSTTKKISF  729

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL*L  144
             ++ VSA     +  T G L  +  + + RT +    ++V L+L L
Sbjct  730   SVTVSAAHQKYATNTMGRLLIA--ISSYRTSLI---LLVNLFLIL  769


 Score =   191 bits (484),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 153/235 (65%), Gaps = 4/235 (2%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +++IVY+G +  +D + I E H+DLLA +VGS E A  +MVY+Y++GFSGFAA LT SQA
Sbjct  784   RVHIVYMGERQQNDPKLITEFHHDLLATIVGSKEAAVDSMVYTYKHGFSGFAAKLTESQA  843

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ ++ H +QT+R+WD+L +S  +  P  LL  T+ GDG+I+G++D+G+
Sbjct  844   QQISELPEVVHVIPNRFHSLQTTRTWDYLDISSYS--PFNLLHDTDMGDGIIIGLLDTGV  901

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+ P+P RWKG C +  G  FN +  CNRK+IGA++F  G L   +   N
Sbjct  902   WPESVVFNDEGLEPIPARWKGLCES--GQLFNGTTDCNRKLIGAKYFIDGFLAGNNQPFN  959

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYK  1689
                  D  S  D  GHG+  ++I  GSFV NA+  G+ +G  RGGA  AR+A YK
Sbjct  960   TTDNPDYMSPRDSFGHGTHTSTIAGGSFVANASYKGLALGTSRGGAPRARIAMYK  1014



>ref|XP_003634153.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/768 (46%), Positives = 466/768 (61%), Gaps = 52/768 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + H D   I   H+++L  V+GS E +  +M+YSYR+GFSGFAA LT +QA
Sbjct  36    KVHIVYLGKRQHHDPELITNIHHEMLTTVLGSKEASVDSMIYSYRHGFSGFAAKLTEAQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             + V+ + GVV V+  + HK++T+RSWD+LGLS  ++    LL +TN GDG+I+G++D+GI
Sbjct  96    QAVSELPGVVQVMSSRLHKLKTTRSWDYLGLSS-SHSSTNLLYETNNGDGIIIGLLDTGI  154

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG--ALLSQDVD  1860
               E   F D G+GP+P RWKG C +  G  FN ++ CNRK+IGAR+FFKG  A + + ++
Sbjct  155   WPESEVFSDKGLGPIPSRWKGGCSS--GQSFNATKHCNRKLIGARYFFKGLEAEIGEPLN  212

Query  1859  LNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
               ++L  +  S  D  GHG+  +SI  GS V NA+  G+  G VRGGA  AR+A YK CW
Sbjct  213   TTEYL--EYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKVCW  270

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             NL  E   C+ AD+L A D AIHD VDV+SVS+GS     +++   + I IGSFHA+ +G
Sbjct  271   NL--EGGFCSDADILKAFDKAIHDGVDVLSVSLGSDDIPFTEIIKPDSILIGSFHAVAQG  328

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ AAGN GPSA T+ N  PW++TVAAS+IDR F   ITLGN           N T +
Sbjct  329   ISVVCAAGNGGPSAQTVENTAPWILTVAASSIDRSFPTPITLGN-----------NRTVM  377

Query  1319  SHPLHFAGKYMGEADLM----PRKLDPAE----------VKGKIVFMFGDDLDRNLVLVD  1182
                +   G   G A L+    P    P+           V GK+   F            
Sbjct  378   GQAM-LIGNLTGFASLVYPDDPHLQSPSSCLYMSPNDTSVAGKVALCFTSGTFETQFAAS  436

Query  1181  KATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
                +A  +GVI + N  N  +  I  +  P ++V Y+ G++I  YI  ST  P  +LS  
Sbjct  437   FVKEARGLGVIIAENSGNTQASCI--SDFPCIKVSYETGSQILYYI-SSTRHPHVRLSPS  493

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGT  837
             K  VG+ +   V  FSSRGPS  +P ++KPDIA PG +I+ A    D   +  F   SGT
Sbjct  494   KTHVGKPVPTNVAYFSSRGPSFPSPAVLKPDIAGPGAQILGAVLPSDLKKNTEFAFHSGT  553

Query  836   SHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYG  657
             S A PH++ IVALLK  HP WSPAAIKSA+VTT W +D    PIFA+G   + AD FD+G
Sbjct  554   SMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFG  613

Query  656   GGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTR  477
             GGIVNPN A DPGLVYDM   DY  YLC LGYNNS I++          TE+   CP   
Sbjct  614   GGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNNSAIFQF---------TEQSIRCPTRE  664

Query  476   PSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGN  297
              S+LDLNLPS+ +P L    +L R VTNVG VNS YKA + SP G  +TVKP  L F+  
Sbjct  665   HSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFNST  724

Query  296   RKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              K  +F++ VS+   VN+ ++FGSLTW DGVH V++PI+VR MI   Y
Sbjct  725   IKTVTFSVTVSSIHQVNTEYSFGSLTWVDGVHAVKSPISVRTMIEESY  772



>ref|XP_009132975.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/748 (47%), Positives = 472/748 (63%), Gaps = 43/748 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD + + +SH+D+L  ++GS + +R++M+YSYR+GFSGFAA LT SQA
Sbjct  39    QIYTVHLGERQHDDPKLVTDSHHDILRSLLGSKKASRESMIYSYRHGFSGFAAKLTPSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV V   K+ K+ T+R  D+LGL+  A  P  L+ +T+ G G I+G++D+GI
Sbjct  99    RELSEHPDVVHVTRSKYMKLATTRVSDYLGLTPTA--PTGLVHETDMGSGAIIGILDTGI  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               +  SF D G+GP+P RWKG C  + G  FN S  CNRK+IGAR++ KG L S +   +
Sbjct  157   WPDSKSFSDNGLGPIPTRWKGKC--VSGEWFNASSSCNRKLIGARYYAKGLLESYNGTYD  214

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  DV GHG+  ASI AGSFV +A+ LG+  G  RG A  AR+ASYK CW+ 
Sbjct  215   AMEKDEVMSPLDVTGHGTHCASIAAGSFVQDASFLGLGSGTARGSAPRARIASYKVCWSK  274

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             +    VC   D+L A+D+AI D VDVIS+S+GS +PL  +++  +   IG+FHA+ +GIP
Sbjct  275   E----VCYSPDILKAMDHAIRDGVDVISMSLGSTIPLEFEVDRSD-FAIGAFHAVMKGIP  329

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP   T++NV PW+ITV A+T+DR F   ITLGN           N T L  
Sbjct  330   VVCAGGNDGPHTQTVSNVAPWIITVGATTMDREFFTPITLGN-----------NVTVLGQ  378

Query  1313  PLHFAGKYMGEAD------LMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGV  1152
                + GK +G AD      L    +   + KGKIVF F   +  +L + + A   G VGV
Sbjct  379   ESLYTGKEVGFADIVYLEDLTKDDILAGKAKGKIVFAF--QIQSSLDIEEYAKSNGVVGV  436

Query  1151  IY-SNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             I  SNP   D +      IPYV VD++ G  I  Y F++T  P A++S  K  VGR  + 
Sbjct  437   IIASNP--YDHIAPGTTDIPYVYVDFEIGMDIMLY-FKTTKFPKAKISPTKSFVGRPFST  493

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALL  795
             KV  FSSRGP+S +P I+KPDIAAPG  I+ A P S+ G+   SGTS A P VS IVALL
Sbjct  494   KVARFSSRGPNSISPAILKPDIAAPGSGILAAVP-SEEGYAFMSGTSMATPVVSGIVALL  552

Query  794   KISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGL  615
             +   P+WSPAAI+SALVTTA  +D +  PI A+GS  + A+ FD+GGG+VNP    DPGL
Sbjct  553   RQKRPDWSPAAIRSALVTTALQTDPFGEPISAEGSPRKLANPFDFGGGLVNPGKVADPGL  612

Query  614   VYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVP  435
             VYDM   +Y  YLC+ GY N    K+IS    R  T     CP   PSMLD+N+PS+ +P
Sbjct  613   VYDMGSDEYVHYLCSAGYEN----KSISRLLGRIYT-----CPSPTPSMLDVNVPSITIP  663

Query  434   DLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADK  255
              L + + L RTVTNVGPV SVYKA+++ P+G  + V PK L F  N KK +FT++VS   
Sbjct  664   YLNEEIILTRTVTNVGPVGSVYKAVIEPPLGIKLQVSPKTLEFGPNTKKITFTVKVSTTH  723

Query  254   LVNSAFTFGSLTWSD-GVHNVRTPIAVR  174
               N+ + FGSLTW+D G HNVR P++VR
Sbjct  724   RWNTDYLFGSLTWTDNGAHNVRIPLSVR  751



>ref|XP_009114844.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/763 (46%), Positives = 480/763 (63%), Gaps = 34/763 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IVYLG K HDD + + ESH+ +L+ ++GS E+A  +MVYSYR+GFSGFAA LT SQA
Sbjct  28    KIHIVYLGEKQHDDPKLVTESHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++    VV V+ D ++++ T+R+WD+LGL  G   P  LL  TN GD +I+GVVD+G+
Sbjct  88    KKISYSPEVVHVMPDSYYELATTRTWDYLGL--GTANPKNLLNNTNMGDQVIIGVVDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P  WKG C  IPG  F  +  CN+K+IGA+++  G     ++D  
Sbjct  146   WPESESFNDDGVGPIPSHWKGGC--IPGENFKLTN-CNKKLIGAKYYING--FQSEIDGF  200

Query  1853  KFLVSDSYS-GYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
              F  S  YS   D  GHG+ VAS   GS++P+ +  G+  G +RGGA  AR+A YKACW 
Sbjct  201   NFTESPDYSSARDFVGHGTHVASTAGGSYIPDVSYKGLARGTMRGGAPRARIAMYKACWY  260

Query  1676  LDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             L+    V C+ +D+L AID AIHD VDV+S+S+GS +PL S+ +  + I IGSFHA+ +G
Sbjct  261   LEELGGVTCSSSDILKAIDDAIHDGVDVLSLSLGSRIPLNSETDLPDAIAIGSFHAVAKG  320

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY--AVDWQLPN--  1332
             I V+ A GNAGPSA TI N  PW++TVAA+T+DR FA  I LGN +       +  PN  
Sbjct  321   ITVVCAGGNAGPSAQTIANTAPWILTVAATTLDRSFATPIILGNKKVILGQAMYTAPNLG  380

Query  1331  GTALSHPL---HFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKA--TDA  1167
              T+L +P    +    + G+ + +   +    + GK+V  F        +  D +    A
Sbjct  381   FTSLVYPEDPGNSNETFNGDCESL-NFIPIRAMAGKVVLCFTISRRYTTLSGDASFVKRA  439

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
             G +G+I +        P  +   P V VDY+ GT I  YI +ST +P  ++   +  VG+
Sbjct  440   GGLGLIIARTPGYTVSPCKD-DFPCVAVDYELGTDILFYI-RSTRSPVVKIQRSRTIVGQ  497

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISSGTSHAAPH  819
              +  KV  FSSRGP++ +P I+KPDIAAPG  I+ A       + GGF + SGTS AAP 
Sbjct  498   PVGIKVATFSSRGPNTISPAILKPDIAAPGVNILAATSPNVTNNAGGFAMYSGTSMAAPV  557

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             +S +VALLK  HP WSPAA++SA+VTTAW +D     + A+GSS +AAD FDYGGG+VNP
Sbjct  558   ISGVVALLKALHPNWSPAALRSAIVTTAWRTDPSGEQLPAEGSSRKAADPFDYGGGLVNP  617

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               A +PGL+YDM   DY  YLC+ GYN+S I + +          + T+C   +PS+LD+
Sbjct  618   EKAAEPGLIYDMGPKDYILYLCSAGYNDSSISQLVG---------KVTVCSNPKPSVLDM  668

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +P+L + VTL RTVTNVGPVNSVYK +V+ P+G  V V PK L F+   K+ SF
Sbjct  669   NLPSITIPNLKEKVTLTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKRVSF  728

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
              +R S    +N+ + FGSL W+D VHNV  P++VR  I+  Y 
Sbjct  729   KVRASTTHKINTGYYFGSLIWTDNVHNVTIPVSVRTQILQNYF  771



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/762 (47%), Positives = 477/762 (63%), Gaps = 34/762 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQA
Sbjct  33    KVHIVYLGQKQHDDPEFVTESHHQMLCSLLGSKEDAHGSMVYSYRHGFSGFAAKLTKSQA  92

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V+ D  +K++T+R+WD+LGLS  A+ P  LL +TN G+ +I+G++D+G+
Sbjct  93    KKIANLPEVVHVIPDSFYKLKTTRTWDYLGLS--ASSPKNLLNETNMGEQIIIGIIDTGV  150

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+G VP  WKG C++  G  FN S  CN+K+IGA++F  G  L ++   N
Sbjct  151   WPESEVFNDDGIGSVPSHWKGGCQS--GEMFNSSH-CNKKLIGAKYFING-FLEENKSFN  206

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D+ GHG+ VA+I AGS+V + +  G+  G VRGGA  AR+A YK CW L
Sbjct  207   SKESLDFISPRDLNGHGTHVATIAAGSYVQDISYKGLAGGTVRGGAPRARIAMYKGCWYL  266

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D  +   C+ AD+L A+D AIHD VDV+S+S+GS VPL  + +  +GI  G+FHA+ +GI
Sbjct  267   DDLDITTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGETDIRDGISTGAFHAVLKGI  326

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ A GN+GP A T+TN  PW++TVAA+T+DR F   ITLGN  K  +   +  G  L 
Sbjct  327   TVVCAGGNSGPEAQTVTNTAPWIVTVAATTLDRSFPTPITLGN-NKVILGQAMYTGPELG  385

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT--DA  1167
                      P +    + G  + +    +   V GK+V  F        V     +   A
Sbjct  386   FTSLVYPEDPGNSNETFSGTCEDLSLNSNDTMV-GKVVLCFTASSSSGSVSSAAGSVKKA  444

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
             G + VI +     D  P L+   P V VDY+ GT I  YI +ST +P  ++      VG+
Sbjct  445   GGLAVIIARHPGSDLEPCLD-DFPCVSVDYELGTNILLYI-RSTGSPVLKIQPSTTLVGQ  502

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTS----DGGFRISSGTSHAAPH  819
              +  KV  FSSRGP+S AP I+KPDIAAPG  I+ A  T+    DGGF + SGTS AAP 
Sbjct  503   PVGTKVASFSSRGPNSIAPAILKPDIAAPGASILAATTTNTTLNDGGFIMLSGTSMAAPV  562

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             +S +VALLK  HP+WSPAAI+SA+VTTAW +D +   I A+GSS + AD FDYGGG+VNP
Sbjct  563   ISGVVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIDAEGSSRKLADPFDYGGGLVNP  622

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               A  PGLVYD+   DY  Y+C++GYN+S I + +          E T C   RPS+LDL
Sbjct  623   EKAVKPGLVYDLDLEDYVLYMCSVGYNDSSISQLVG---------ERTTCSNPRPSVLDL  673

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +PDL + VTL RTVTNVGP +SVYK  V+ P+G  VTV P  L F+   KK S+
Sbjct  674   NLPSITIPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSY  733

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              +RVS    +N+ F FGSLTWSD VH+V  P++VR  I+  Y
Sbjct  734   HVRVSTRHKINTGFYFGSLTWSDSVHDVIIPLSVRTQILQNY  775



>ref|XP_002891021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/763 (45%), Positives = 477/763 (63%), Gaps = 36/763 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L+ ++GS ++A K+MVYSYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPEFVTESHHQMLSSLLGSKDDAHKSMVYSYRHGFSGFAAKLTKSQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    V+ V+ D ++++ T+R+WD+LGLS  A+    LL   N GD  I+GV+D+G+
Sbjct  88    KKIADSPEVIHVIPDGYYELATTRTWDYLGLS--ADNSKNLLNDKNMGDQTIIGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P  WKG C   PG  F  +  CNRK+IGA++F  G  L+++   N
Sbjct  146   WPESESFNDNGVGPIPSHWKGGCE--PGENFISTN-CNRKLIGAKYFING-FLAENQGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VAS V GS VPN +  G+  G +RGGA  AR+A YKACW L
Sbjct  202   TTESPDYISARDFDGHGTHVASTVGGSLVPNVSYKGLAKGTLRGGAPRARIAMYKACWYL  261

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +  +   C+ +D++ AID AIHD VDV+S+S+G  +PL S+ +  +GI  G+FHA+++GI
Sbjct  262   NELDGVTCSFSDIMKAIDEAIHDGVDVLSLSLGGRIPLNSETDLRDGIATGAFHAVSKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQLPN  1332
              V+ A GNAGP++ T+ N  PW++TVAA+T+DR FA  I LGN     G+      +L  
Sbjct  322   VVVCAGGNAGPASQTVVNTAPWIVTVAATTLDRSFATPIILGNNQVILGQAMYTGPEL-G  380

Query  1331  GTALSHPLHFAGKYMGEADLMPR-KLDPAE-VKGKIVFMFGDDLDRNLVLVDKATD----  1170
              T+L +P      Y   + +     L+P   + GK+V  F     R+  +V +A      
Sbjct  381   FTSLVYPEDPGNSYDTFSGVCESLNLNPNHTMAGKVVLCF--TTARDYAVVSRAASLVKA  438

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             AG +G+I +     +  P  +   P V +DY+ GT I  YI + T +P  ++   +  VG
Sbjct  439   AGGLGLIIARNPGYNLAPCSD-DFPCVAIDYELGTDILFYI-RYTGSPVVKIQPSRTLVG  496

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHAAP  822
               +  KV  FSSRGP+S +P I+KPDI APG  I+ A  P  +   GGF + SGTS AAP
Sbjct  497   EPVGTKVATFSSRGPNSISPAILKPDITAPGVSILAATSPNKNLNAGGFVMLSGTSMAAP  556

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S ++ALLK  HP+WSPAA +SA+VTTAW +D +   IFA+GSS + AD FDYGGG+VN
Sbjct  557   VISGVIALLKSLHPDWSPAAFRSAIVTTAWRTDPFGEQIFAEGSSQKVADPFDYGGGLVN  616

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A +PGL+YDM   DY  YLC+ GYN S I   +          + T+C   +PS+LD
Sbjct  617   PEKAAEPGLIYDMGPQDYILYLCSAGYNESSISLLVG---------KVTVCSNPKPSVLD  667

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             +NLPS+ +P+L   VTL RTVTNVGPVNSVYK +V+ P+G  V V P  L F+   K  S
Sbjct  668   INLPSITIPNLKDEVTLTRTVTNVGPVNSVYKVVVEPPLGVRVAVTPATLVFNSKTKSVS  727

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F +RVS    +N+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  728   FRVRVSTKHKINTGYLFGSLTWTDSVHNVVIPVSVRTQILQNY  770



>ref|XP_011081356.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Sesamum 
indicum]
Length=782

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/757 (45%), Positives = 472/757 (62%), Gaps = 31/757 (4%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIVYLG + H+D + + +SH+D+L  ++GS E A+++MVYSYR+GFSGFAA LTASQA+
Sbjct  42    VYIVYLGERQHNDPKLVTDSHHDMLTNLMGSKELAKESMVYSYRHGFSGFAAKLTASQAQ  101

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             +++    VV V+ +  +K+QT+RSWD+LGLS     P  LL K+N GDG+I+GV+D+GI 
Sbjct  102   QLSEHPDVVGVMPNSFYKLQTTRSWDYLGLSP--QTPNNLLNKSNMGDGVIIGVLDTGIW  159

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
              E  +F D G+G +P  WKG C++  G +F+ ++ CN+K+IGARWF  G L      LN 
Sbjct  160   PESKAFRDEGLGEIPSGWKGFCQS--GDQFSAAKHCNKKLIGARWFVDGLLAEIGRTLNL  217

Query  1850  FLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLD  1671
               + +  S  D  GHG+ V+S  AG++V N +  G+ +G  RGGA  AR+A YK CW L 
Sbjct  218   TRLGEILSARDAEGHGTHVSSTAAGAYVANVSYDGVGLGTARGGAPRARLAIYKVCWKLS  277

Query  1670  PERFVCAGADLLAAIDYAIHDRVDVISVSVGSP-VPLASDMEAENGIGIGSFHAITRGIP  1494
               +  CA AD+L A D AI D V V+++S+ +  +PL S+++  + I IGSFHAI RGI 
Sbjct  278   GGQ--CASADILKAFDEAIKDGVHVLTLSIAAASLPLYSEVDGRDAIAIGSFHAIARGIT  335

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYA----VDWQLPNGT  1326
             V+  AGN GP   T+ N  PW+ITVAAST+DR +   ITLGN + +        +    T
Sbjct  336   VVCGAGNDGPLPQTVKNTAPWIITVAASTMDRAYPTQITLGNNKTFQGQSIYTGKEEGFT  395

Query  1325  ALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD--AGAVGV  1152
              L +P    G            L P  V GK+V  F     R +  +   +   AG VGV
Sbjct  396   GLFYPAD-GGPDATAGVCEDLNLKPNLVAGKVVLCFTTVSSRIVTQIAARSVRVAGGVGV  454

Query  1151  IYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPK  972
             I S P N   +       P  +VDY+ GT+I  YI +S   P  +LS P   VG+A+  K
Sbjct  455   IVSKPPN--DITAQCRSFPCAEVDYEVGTQILFYI-RSAGHPVVKLSPPPTLVGKAVPAK  511

Query  971   VPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIV  804
             + +FSSRGP++ A  ++KPDIAAPG +I+ A    D +++ GF + SGTS A PH++ IV
Sbjct  512   IAEFSSRGPNTVAASVLKPDIAAPGVQIIAATSALDTSAEQGFTMLSGTSMATPHIAGIV  571

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADD  624
             ALL+  H +WSPAAI+SAL TTAW SD Y  PIFA+G   + AD FD+GGGI NPN A  
Sbjct  572   ALLRALHADWSPAAIRSALTTTAWMSDPYGVPIFAEGDPHKLADPFDFGGGIANPNGAAC  631

Query  623   PGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSM  444
             PGLVYDM   DY  YLC++ YNNS I +          T +   CPKT  S+LD+NLPS+
Sbjct  632   PGLVYDMDESDYINYLCSMEYNNSAISRL---------TGKPVTCPKTV-SLLDVNLPSI  681

Query  443   VVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS  264
              +P L    TL RTVTNVG  NS+Y  IV+ P G +V V P +L F+   KK SFT+ VS
Sbjct  682   TIPYLGNSTTLTRTVTNVGATNSIYHVIVEPPTGTIVLVNPPILIFNSMTKKISFTVTVS  741

Query  263   ADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             +   +++ + FGSL W+DGVH+VR+PI+VR  +  L+
Sbjct  742   SMHQLSAGYYFGSLIWTDGVHDVRSPISVRTAMPRLH  778



>ref|XP_010421966.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=762

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/765 (45%), Positives = 475/765 (62%), Gaps = 52/765 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K + + + + +SH+ +L  ++GS E A  ++VYSYR+GFSGFAA LT SQA
Sbjct  28    KVYVVYLGEKENANIKSVTDSHHQMLWSLLGSIEAAHDSIVYSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ D  +++ T+R+WD+LGLS G   P  LL KTN G  +IVGV+D+G+
Sbjct  88    QEISELPEVVQVIPDTIYELTTTRTWDYLGLSPGT--PQSLLHKTNMGSSVIVGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG+C    G  F+ S  CNRK+IGA++F  G   S+   LN
Sbjct  146   WPESEMFNDNGYGPIPSRWKGACEY--GDLFSPSN-CNRKLIGAKFFIDG-FSSEFEVLN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+ V+S V GS+V N + LG+  G VRGGA    +A YKACW  
Sbjct  202   TTQKPEYISPRDFNGHGTHVSSTVGGSYVANVSYLGLGRGTVRGGAPRVHIAIYKACW--  259

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                  VC+GAD+L AID AI+D VDV+S+S+G  VPL  + +    + +G+FHA+ +GIP
Sbjct  260   --LHGVCSGADVLKAIDEAINDGVDVLSLSLGLNVPLYQETDMRELLSVGAFHAVAKGIP  317

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP A TI+NV PW++TVAA+T DR F   ITLGN           N T L  
Sbjct  318   VVASAGNNGPGAQTISNVAPWILTVAATTQDRSFPTIITLGN-----------NITILGQ  366

Query  1313  PLHFAGKYMGEADLM----PRKLDPAEV--------KGKIVFMFGDDLDRNLVL--VDKA  1176
              + FAG  +G  +L     P   D AE+        +GK+V  F  D +   ++  +   
Sbjct  367   AI-FAGPALGFVELTIPDKPFSSDCAELPGNPKHTMEGKVVLCFTADSNAGAIVNGILAV  425

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
              +AG +GVI +       +P  +   P V VD++ GT I  YI +ST +P  ++ + K  
Sbjct  426   KNAGGLGVIVARNPTYSLIP--SRDFPCVMVDFELGTYILFYI-RSTRSPIVKIDASKTL  482

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHA  828
             V   +  KVP FSSRGP+S +P I+KPDIAAPG  I+ A       SDGGF ++SGTS A
Sbjct  483   VSYPVATKVPTFSSRGPNSISPAILKPDIAAPGVNILAATSLNSSISDGGFAMTSGTSMA  542

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P ++ +V LLK  HP+WSPAAIKSA+VTTAW +D    PIFA GS  + AD FDYGGG+
Sbjct  543   TPIIAGVVVLLKALHPDWSPAAIKSAIVTTAWKTDPSGEPIFADGSGRKLADPFDYGGGL  602

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VNP+ A  PGL+YD+   DY  YLC+  YN++ I + +          + T CP  +PS+
Sbjct  603   VNPDKAARPGLIYDINTNDYVLYLCSTDYNDTSISQVVG---------KKTECPNPKPSV  653

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LDLNLPS+ +P+L   VTL RTVTNVGP NS+YK ++  P G  +TVKP +LRF+   KK
Sbjct  654   LDLNLPSITIPNLKDKVTLTRTVTNVGPPNSIYKVLINPPSGVRMTVKPNMLRFNPRTKK  713

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SFT+ VS    VN+ + FGSLTW+D VH V  P++VR  I+  Y
Sbjct  714   VSFTVTVSTTHKVNTGYYFGSLTWTDNVHRVVIPVSVRTQILERY  758



>emb|CDY25259.1| BnaA02g21970D [Brassica napus]
Length=742

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/764 (46%), Positives = 468/764 (61%), Gaps = 71/764 (9%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K+Y+VYLG K HDD   + E H+ +L  ++GS E    ++VYSYR+GFSGFAA LT SQ
Sbjct  30    RKVYVVYLGEKEHDDPASVTEYHHQMLWSLLGSKESVHDSIVYSYRHGFSGFAAKLTESQ  89

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A++++ +  VV V+ +  +++ T+R+WD+LGLS G +    L+ K + G  +IVGV+D+G
Sbjct  90    AQQLSELPEVVHVIPNTLYELTTTRTWDYLGLSPGTS--KSLVHKADMGRKIIVGVIDTG  147

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   + D G GP+P RWKGSC +  G  FN S  CN+K+IGA++F  G         
Sbjct  148   VWPESEMYNDKGYGPIPSRWKGSCES--GELFNGSIHCNKKLIGAKYFVDG---------  196

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
                L ++  S  D  GHG+ V+S + GSF+P  + LG+  G V+GGA   R+A YKACW 
Sbjct  197   ---LNAEYASPRDFNGHGTHVSSTIGGSFLPGVSYLGLGRGTVKGGAPGVRLAIYKACWL  253

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                +   C+GAD+L AID AIHD VDV+S+S+GS VPL S+ +      +G+FHA+ +GI
Sbjct  254   ---QSGSCSGADVLKAIDEAIHDGVDVLSLSLGSKVPLYSETDVRELTSVGAFHAVAKGI  310

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ AAGN GPSA TI+NV PW++TVAA+T+DR F   ITLGN           N T L 
Sbjct  311   PVVAAAGNDGPSAQTISNVAPWILTVAATTLDRSFPTAITLGN-----------NITILG  359

Query  1316  HPLHFAGKYMGEADLM-PRKLDPAEV--------KGKIVFMFGDDLDRNLVL--VDKATD  1170
               + FAG  +G +DL  P+  D  ++        +GK+V  F  +      +  +    +
Sbjct  360   QAI-FAGPELGYSDLTYPQSGDCQKLSANPNNTMEGKVVLCFTRETSVTPAVDAIIAVRN  418

Query  1169  AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
             AG +GVI + NP+++  LP  N   P V VD++ GT I  YI +ST +P  ++ + +  V
Sbjct  419   AGGLGVIIARNPTHL-LLPSRN--FPSVAVDFELGTDILFYI-RSTRSPIVKIGASRTLV  474

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD----GGFRISSGTSHAA  825
              R +  KV  FSSRGPSS +P I+KPDIAAPG  I+ A   +D     GF + SGTS A 
Sbjct  475   ARPVATKVATFSSRGPSSISPAILKPDIAAPGVNILAATSLNDSFSVNGFSMKSGTSMAT  534

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P VS IV LLK  HP WSP+AIKSA+VTTAW +D    PIFA GSS + AD FDYGGG+V
Sbjct  535   PVVSGIVVLLKSLHPHWSPSAIKSAIVTTAWKTDPSGEPIFADGSSRKLADPFDYGGGLV  594

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A  PGLVYDM   DY  YLCA  Y                     T+CP  +P +L
Sbjct  595   NPERAAKPGLVYDMATHDYVLYLCAADYT--------------------TVCPTPKPWVL  634

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             DLNLPS+ +P+L   VTL RTVTNVGP+NSVYK ++  P G  V V P    F+    K 
Sbjct  635   DLNLPSITIPNLRDEVTLTRTVTNVGPLNSVYKVVINPPTGVNVGVTPTTFVFNSTATKL  694

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             SFT+RV+    VN+ + FGSLTWSD +HNV  P++VR  I+P Y
Sbjct  695   SFTVRVTTTHRVNTGYFFGSLTWSDNMHNVAIPLSVRTQILPRY  738



>emb|CBI23086.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/766 (46%), Positives = 460/766 (60%), Gaps = 48/766 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + H D   I   H+++L  V+GS E +  +M+YSYR+GFSGFAA LT +QA
Sbjct  102   KVHIVYLGKRQHHDPELITNIHHEMLTTVLGSKEASVDSMIYSYRHGFSGFAAKLTEAQA  161

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             + V+ + GVV V+  + HK++T+RSWD+LGLS  ++    LL +TN GDG+I+G++D+GI
Sbjct  162   QAVSELPGVVQVMSSRLHKLKTTRSWDYLGLSS-SHSSTNLLYETNNGDGIIIGLLDTGI  220

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+GP+P RWKG C +  G  FN ++ CNRK+IGAR+FFKG        LN
Sbjct  221   WPESEVFSDKGLGPIPSRWKGGCSS--GQSFNATKHCNRKLIGARYFFKGLEAEIGEPLN  278

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+  +SI  GS V NA+  G+  G VRGGA  AR+A YK CWNL
Sbjct  279   TTEYLEYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKVCWNL  338

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               E   C+ AD+L A D AIHD VDV+SVS+GS     +++   + I IGSFHA+ +GI 
Sbjct  339   --EGGFCSDADILKAFDKAIHDGVDVLSVSLGSDDIPFTEIIKPDSILIGSFHAVAQGIS  396

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ AAGN GPSA T+ N  PW++TVAAS+IDR F   ITLGN           N T +  
Sbjct  397   VVCAAGNGGPSAQTVENTAPWILTVAASSIDRSFPTPITLGN-----------NRTVMGQ  445

Query  1313  PLHFAGKYMGEADLM----PRKLDPAE----------VKGKIVFMFGDDLDRNLVLVDKA  1176
              +   G   G A L+    P    P+           V GK+   F              
Sbjct  446   AM-LIGNLTGFASLVYPDDPHLQSPSSCLYMSPNDTSVAGKVALCFTSGTFETQFAASFV  504

Query  1175  TDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
              +A  +GVI + N  N  +  I  +  P ++V Y+ G++I  YI  ST  P  +LS  K 
Sbjct  505   KEARGLGVIIAENSGNTQASCI--SDFPCIKVSYETGSQILYYI-SSTRHPHVRLSPSKT  561

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSH  831
              VG+ +   V  FSSRGPS  +P ++KPDIA PG +I+ A    D   +  F   SGTS 
Sbjct  562   HVGKPVPTNVAYFSSRGPSFPSPAVLKPDIAGPGAQILGAVLPSDLKKNTEFAFHSGTSM  621

Query  830   AAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGG  651
             A PH++ IVALLK  HP WSPAAIKSA+VTT W +D    PIFA+G   + AD FD+GGG
Sbjct  622   ATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFGGG  681

Query  650   IVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
             IVNPN A DPGLVYDM   DY  YLC LGYNNS I++          TE+   CP    S
Sbjct  682   IVNPNRAADPGLVYDMGTADYIHYLCTLGYNNSAIFQF---------TEQSIRCPTREHS  732

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
             +LDLNLPS+ +P L    +L R VTNVG VNS YKA + SP G  +TVKP  L F+   K
Sbjct  733   ILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISPAGITITVKPDTLIFNSTIK  792

Query  290   KRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
               +F++ VS+   VN+ ++FGSLTW DGVH V++PI+VR MI   Y
Sbjct  793   TVTFSVTVSSIHQVNTEYSFGSLTWVDGVHAVKSPISVRTMIEESY  838



>ref|XP_011081355.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Sesamum 
indicum]
Length=805

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/779 (45%), Positives = 476/779 (61%), Gaps = 52/779 (7%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIVYLG + H+D + + +SH+D+L  ++GS E A+++MVYSYR+GFSGFAA LTASQA+
Sbjct  42    VYIVYLGERQHNDPKLVTDSHHDMLTNLMGSKELAKESMVYSYRHGFSGFAAKLTASQAQ  101

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             +++    VV V+ +  +K+QT+RSWD+LGLS     P  LL K+N GDG+I+GV+D+GI 
Sbjct  102   QLSEHPDVVGVMPNSFYKLQTTRSWDYLGLSP--QTPNNLLNKSNMGDGVIIGVLDTGIW  159

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
              E  +F D G+G +P  WKG C++  G +F+ ++ CN+K+IGARWF  G L      LN 
Sbjct  160   PESKAFRDEGLGEIPSGWKGFCQS--GDQFSAAKHCNKKLIGARWFVDGLLAEIGRTLNL  217

Query  1850  FLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLD  1671
               + +  S  D  GHG+ V+S  AG++V N +  G+ +G  RGGA  AR+A YK CW L 
Sbjct  218   TRLGEILSARDAEGHGTHVSSTAAGAYVANVSYDGVGLGTARGGAPRARLAIYKVCWKLS  277

Query  1670  PERFVCAGADLLAAIDYAIHDRVDVISVSVGSP-VPLASDMEAENGIGIGSFHAITRGIP  1494
               +  CA AD+L A D AI D V V+++S+ +  +PL S+++  + I IGSFHAI RGI 
Sbjct  278   GGQ--CASADILKAFDEAIKDGVHVLTLSIAAASLPLYSEVDGRDAIAIGSFHAIARGIT  335

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD--WQLPNGTAL  1320
             V+  AGN GP   T+ N  PW+ITVAAST+DR +   ITLGN + + V   W      AL
Sbjct  336   VVCGAGNDGPLPQTVKNTAPWIITVAASTMDRAYPTQITLGNNKTFQVSNLWFARCIKAL  395

Query  1319  -----SHPLHFAGKYMGE----------ADLMP---------RKLDPAEVKGKIVFMFGD  1212
                    PL     Y G+          AD  P           L P  V GK+V  F  
Sbjct  396   ILIFQGKPLQGQSIYTGKEEGFTGLFYPADGGPDATAGVCEDLNLKPNLVAGKVVLCFTT  455

Query  1211  DLDR--NLVLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQS  1038
                R    +       AG VGVI S P N   +       P  +VDY+ GT+I  YI +S
Sbjct  456   VSSRIVTQIAARSVRVAGGVGVIVSKPPN--DITAQCRSFPCAEVDYEVGTQILFYI-RS  512

Query  1037  TMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPT  870
                P  +LS P   VG+A+  K+ +FSSRGP++ A  ++KPDIAAPG +I+ A    D +
Sbjct  513   AGHPVVKLSPPPTLVGKAVPAKIAEFSSRGPNTVAASVLKPDIAAPGVQIIAATSALDTS  572

Query  869   SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGS  690
             ++ GF + SGTS A PH++ IVALL+  H +WSPAAI+SAL TTAW SD Y  PIFA+G 
Sbjct  573   AEQGFTMLSGTSMATPHIAGIVALLRALHADWSPAAIRSALTTTAWMSDPYGVPIFAEGD  632

Query  689   SLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSD  510
               + AD FD+GGGI NPN A  PGLVYDM   DY  YLC++ YNNS I +          
Sbjct  633   PHKLADPFDFGGGIANPNGAACPGLVYDMDESDYINYLCSMEYNNSAISRL---------  683

Query  509   TEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVT  330
             T +   CPKT  S+LD+NLPS+ +P L    TL RTVTNVG  NS+Y  IV+ P G +V 
Sbjct  684   TGKPVTCPKTV-SLLDVNLPSITIPYLGNSTTLTRTVTNVGATNSIYHVIVEPPTGTIVL  742

Query  329   VKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             V P +L F+   KK SFT+ VS+   +++ + FGSL W+DGVH+VR+PI+VR  +  L+
Sbjct  743   VNPPILIFNSMTKKISFTVTVSSMHQLSAGYYFGSLIWTDGVHDVRSPISVRTAMPRLH  801



>ref|XP_010470055.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=750

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/766 (46%), Positives = 477/766 (62%), Gaps = 58/766 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K HD    + ESH+ LL  ++GS +E   ++VYSYR+GFSGFAA LT SQA
Sbjct  20    KVYVVYLGKKTHDHPESVTESHHQLLRPLLGSKKEVHDSIVYSYRHGFSGFAAKLTESQA  79

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ +  +++ T+R+WD+LGLS G +    LL K N G  +IVGV+D+G+
Sbjct  80    QQISQLPEVVHVIPNTLYELTTTRTWDYLGLSPGTS--KSLLHKANMGSQVIVGVIDTGV  137

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C  + G  FN S  CN+K+IGA++F  G L+++   LN
Sbjct  138   WPESEMFNDKGYGPIPSRWKGGC--VSGELFNASIHCNKKLIGAKYFVDG-LVAEVGVLN  194

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+ VAS + GSF+PN + LG+  G  RGGA    +A+YKACW+ 
Sbjct  195   TTENPEYLSPRDFNGHGTHVASTIGGSFLPNVSYLGLGRGTARGGAPGVYLATYKACWS-  253

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAE-NGIGIGSFHAITRGI  1497
                +  C+ ADLL AID AIHD VDV+S+S+G P  +  ++E + N   +G FHA+ +GI
Sbjct  254   ---QIGCSDADLLKAIDQAIHDGVDVLSLSLG-PTEIPLNLETDVNLFAMGLFHAVAKGI  309

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ +AGN GP+A TI NV PW++TVAA+T+DR F   ITLGN           N T L 
Sbjct  310   HVVASAGNNGPAAQTIANVSPWILTVAATTLDRSFPTAITLGN-----------NITTLG  358

Query  1316  HPLHFAGKYMGEADLM----PRKLDPAE--------VKGKIVFMFGDDLDRNLVLVDKA-  1176
               + FAG  +G  DL     P   D AE        ++GK+V  F  DL+   + V  A 
Sbjct  359   QAI-FAGPELGSVDLTYPERPLSGDCAELRANPNKTIQGKVVLCFTADLNPTSMAVVNAI  417

Query  1175  ---TDAGAVGVIYS-NPSNVDSLPILNARI-PYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
                ++AG +GVI + NP++     ++  RI P V VD++ GT I  YI +ST +P  ++ 
Sbjct  418   TAVSNAGGLGVIIARNPTH----SLIPTRIFPCVTVDFELGTDILFYI-RSTRSPIVKIH  472

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSH  831
             + +  V   +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A+ T   G  + SGTS 
Sbjct  473   ASRTLVSHHVATKVATFSSRGPNSISPAILKPDIAAPGVNILAANRT---GVVMRSGTSM  529

Query  830   AAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGG  651
             A P VS +V LLK  +P WSPAAI+SA+VTTAW +D    PIFA GSS + AD FDYGGG
Sbjct  530   ATPVVSGVVVLLKSLYPHWSPAAIRSAIVTTAWKTDPSGEPIFADGSSHKLADPFDYGGG  589

Query  650   IVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
             +VNP  A  PGL+YDM   DY  YLC+  YNN  + + +         E+ T+CPK   S
Sbjct  590   LVNPEKAARPGLIYDMTIDDYVLYLCSTYYNNVSVSQIL---------EKKTVCPKPTRS  640

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
             +LDLNLPS+ +P+L   VTL RTVTNVGP+NS+YK ++  P+G  +TV P  L F+   K
Sbjct  641   VLDLNLPSITIPNLKDEVTLTRTVTNVGPLNSIYKVMIDPPIGVSMTVTPYTLEFNSTTK  700

Query  290   KRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
               SF +RVS    VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  701   NVSFKVRVSTTHKVNTGYYFGSLTWTDSVHNVVIPVSVRTQILQRY  746



>ref|XP_010437005.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=762

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/767 (45%), Positives = 476/767 (62%), Gaps = 56/767 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K H D + + +SH+ +L  ++GS E A  ++VYSYR+GFSGFAA LT SQA
Sbjct  28    KVYVVYLGEKEHADIKSVTDSHHRMLWALLGSIEAAHDSIVYSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  V+ V+ D  +++ T+R+WD+LGLS G   P  LL KT+ G  +IVGV+D+G+
Sbjct  88    QEISELPEVMQVIPDTIYELTTTRTWDYLGLSPGT--PQSLLHKTDLGSSVIVGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG+C    G  F+ S  CNRK+IGA++F  G     +V LN
Sbjct  146   WPESEMFNDNGYGPIPSRWKGACET--GDLFSPSN-CNRKLIGAKFFIDGFSAEFEV-LN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+ V+S V GS+V N + LG+  G VRGGA    +A YKACW  
Sbjct  202   TTQRPEYISPRDFNGHGTHVSSTVGGSYVANVSYLGLGSGTVRGGAPRVHIAIYKACW--  259

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                  VC+GAD+L A+D AI+D VDV+S+S+G  VPL  + +    + +G+FHA+ +GIP
Sbjct  260   --LHGVCSGADVLKAMDEAINDGVDVLSLSLGLKVPLYQETDMRELLSVGAFHAVEKGIP  317

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP A TI+NV PW++TVAA+T DR F  TITLGN           N T L  
Sbjct  318   VVASAGNNGPGAQTISNVAPWILTVAATTQDRSFPTTITLGN-----------NITILGQ  366

Query  1313  PLHFAGKYMGEADLM----PRKLDPAEV--------KGKIVFMFGDDLDR----NLVLVD  1182
              + F G  +G  +L     P   D A++        +GK+V  F  D +     N +L  
Sbjct  367   AI-FGGPAVGFVELTIPDKPFSTDCADLPGNPKSTMEGKVVLCFTADSNAGAMGNGILAV  425

Query  1181  KATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
             K  +AG +GVI +       +P  +   P V VD++ GT I  YI +ST +P  ++ + K
Sbjct  426   K--NAGGLGVIVAKNPTYSLIP--SRDFPCVMVDFELGTDILFYI-RSTSSPIVKIDASK  480

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTS  834
               V   +  KVP FSSRGP+S +P I+KPDIAAPG  I+ A       SDGG+ ++SGTS
Sbjct  481   TLVSYPVATKVPTFSSRGPNSISPAILKPDIAAPGVNILAATSLNSSVSDGGYAMTSGTS  540

Query  833   HAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGG  654
              A P ++ +V LLK  HP+WSPAAIKSA+VTTAW +D    PIFA GSS + AD FDYGG
Sbjct  541   MATPVIAGVVVLLKALHPDWSPAAIKSAIVTTAWRTDPSGEPIFADGSSRKLADPFDYGG  600

Query  653   GIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRP  474
             G+VNP+ A  PGL+YD+   DY  YLC+  YN++ I + +          + T CP  +P
Sbjct  601   GLVNPDKAARPGLIYDINTNDYVLYLCSTDYNDTSISQVVG---------KKTECPNPKP  651

Query  473   SMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNR  294
             S+LDLNLPS+ +P+L   VTL RTVTNVGP NS+YK ++  P G  +TVKP +LRF+   
Sbjct  652   SVLDLNLPSITIPNLKDKVTLTRTVTNVGPPNSIYKVVINPPTGVRMTVKPNILRFNPRT  711

Query  293   KKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             KK SFT+ VS    VN+ + FGSLTW+D V  V  P++VR  I+  Y
Sbjct  712   KKVSFTVTVSTTHKVNTGYYFGSLTWTDNVRRVVIPVSVRTQILERY  758



>ref|XP_009114845.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=772

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/765 (46%), Positives = 477/765 (62%), Gaps = 40/765 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD + + E H+ +L+ ++GS E+A  +MVYSYR+GFSGFAA LT SQA
Sbjct  26    KVHIVYLGEKQHDDPKHVTEYHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQA  85

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K++A    VV V+ D ++++ T+R+WD+LGLS  A  P  LL  TN G+ +I+GV+D+G+
Sbjct  86    KELADSPEVVHVMPDGYYELATTRTWDYLGLS--AAHPKNLLNDTNMGEHVIIGVIDTGV  143

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+G +P+RWKG C   PG  F +S  CNRK+IGA+++  G L   D   N
Sbjct  144   WPESESFSDNGVGAIPKRWKGGCE--PGEDF-KSTNCNRKLIGAKYYINGFLAEND-GFN  199

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VASI  GSFVPN +  G+  G +RGGA  AR+A YKACW L
Sbjct  200   STKSPDYISPRDFNGHGTHVASIAGGSFVPNVSYKGLAGGTLRGGAPRARIAMYKACWYL  259

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +  E   C+ +D++ A+D AIHD VDV+S+S+GS VPL S+ +  +GI  G+FHA+  GI
Sbjct  260   EELEGVTCSFSDIMKAMDDAIHDGVDVLSLSLGSRVPLFSETDMRDGIATGAFHAVANGI  319

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ A GNAGPSA T+ N  PW++TVAA+T+DR FA  ITLGN  K  +   +  G  L 
Sbjct  320   TVVCAGGNAGPSAQTVVNTAPWILTVAATTLDRSFATPITLGN-NKVILGQAMYTGPELG  378

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD---  1170
                      P +    + GE + +    +   + GKIV  F     R    V +A     
Sbjct  379   FTSLVYPEDPGNSNDTFTGECESLNLNSN-RTMAGKIVLCF--TTTRGYTTVSRAASFVK  435

Query  1169  -AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
              AG +G+I + NP +  +L       P V VDY+ GT I  YI +S  +P  ++   +  
Sbjct  436   RAGGLGLIIARNPGH--TLNPCKDDFPCVAVDYELGTDILFYI-RSNGSPVVKIQPSRTM  492

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHA  828
             VG+ +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P +    GGF + SGTS A
Sbjct  493   VGQPVGSKVATFSSRGPNSISPAILKPDIAAPGVSILAATSPNATFNAGGFVMLSGTSMA  552

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P +S +VALLK  HP+WSPAA +SA+VTTAW +D +   + A+GSS + AD FDYGGG+
Sbjct  553   TPAISGVVALLKSLHPDWSPAAFRSAIVTTAWRTDPFGEQLPAEGSSRKVADPFDYGGGL  612

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VNP  A +PGL+YDM   DY  YLC++GYN+S I + +          + T+C   +PS+
Sbjct  613   VNPEKAAEPGLIYDMGPKDYILYLCSVGYNDSSISQLVG---------KGTVCTDPKPSV  663

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD+NLPS+ +P+L   V L RTVTNVGPV+SVYK  V+ P+G  V V PK L F+   K 
Sbjct  664   LDMNLPSITIPNLKDEVILTRTVTNVGPVHSVYKVGVEPPLGVRVVVTPKKLVFNSKTKS  723

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SFT+RVS    +N+ + FGSL WSD V  V  P++VR  I+  Y
Sbjct  724   VSFTVRVSTTHKINTGYYFGSLVWSDSVRKVTIPVSVRTQILQNY  768



>emb|CDX84657.1| BnaA03g15730D [Brassica napus]
Length=759

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/747 (46%), Positives = 470/747 (63%), Gaps = 41/747 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD + + +SH+D+L  ++GS + +R++M+YSYR+GFSGFAA LT SQA
Sbjct  39    QIYTVHLGERQHDDPKLVTDSHHDILGSLLGSKKASRESMIYSYRHGFSGFAAKLTPSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV V   K+ K+ T+R  D+LGL+  A  P  L+ +T+ G G I+G++D+GI
Sbjct  99    RELSEHPDVVHVTRSKYMKLATTRVSDYLGLTPTA--PTGLVHETDMGSGAIIGILDTGI  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               +  SF D G+GP+P RWKG C  + G  FN S  CNRK+IGAR++ KG L S +   +
Sbjct  157   WPDSKSFSDNGLGPIPTRWKGKC--VSGEWFNASSSCNRKLIGARYYAKGLLESYNGTYD  214

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  DV GHG+  ASI AGSFV +A+ LG+  G  RG A  AR+ASYK CW+ 
Sbjct  215   AMEKDEVMSPLDVTGHGTHCASIAAGSFVQDASFLGLGSGTARGSAPRARIASYKVCWSK  274

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             +    VC   D+L A+D+AI D VDVIS+S+GS +PL  +++  +   IG+FHA+ +GIP
Sbjct  275   E----VCYSPDILKAMDHAIRDGVDVISMSLGSTIPLEFEVDRSD-FAIGAFHAVMKGIP  329

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP   T++NV PW+ITVAA+T+DR F   ITLGN           N T L  
Sbjct  330   VVCAGGNDGPVTQTVSNVAPWIITVAATTMDREFFTPITLGN-----------NVTVLGQ  378

Query  1313  PLHFAGKYMGEAD------LMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGV  1152
                + GK +G AD      L        + KGKIV  F   +  +L + + A   G VGV
Sbjct  379   ESLYTGKEVGFADIVYLEDLTKDDFLAGKAKGKIVLAF--QIQSSLDIEEYAKSNGVVGV  436

Query  1151  IYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPK  972
             I ++    D +      IPYV VD++ G  I  Y F++T  P A++S  K  VGR  + K
Sbjct  437   IIAS-KPYDHIAPGTTDIPYVYVDFEIGMDIMLY-FKTTKFPKAKISRTKSFVGRPFSTK  494

Query  971   VPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLK  792
             V  FSSRGP+S +P I+KPDIAAPG  I+ A P S+ G+   SGTS A P VS IVALL+
Sbjct  495   VARFSSRGPNSISPAILKPDIAAPGSGILAAVP-SEEGYAFMSGTSMATPVVSGIVALLR  553

Query  791   ISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLV  612
                P+WSPAAI+SALVTTA  +D +  PI A+GS  + A  FD+GGG+VNP    DPGLV
Sbjct  554   QKRPDWSPAAIRSALVTTALQTDPFGEPISAEGSPRKLASPFDFGGGLVNPGKVADPGLV  613

Query  611   YDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPD  432
             YDM   +Y  YLC+ GY N    K+IS    R  T     CP   PSMLD+N+PS+ +P 
Sbjct  614   YDMGSDEYVHYLCSAGYEN----KSISRLLGRIYT-----CPSPTPSMLDVNVPSITIPY  664

Query  431   LFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKL  252
             L + + L RTVTNVGPV SVYKA+++ P+G  + V P+ L+F  N KK +FT++VS    
Sbjct  665   LNEEIILTRTVTNVGPVGSVYKAVIEPPLGIKLQVSPETLKFGPNTKKITFTVKVSTTHR  724

Query  251   VNSAFTFGSLTWSD-GVHNVRTPIAVR  174
              N+ + FGSLTW+D G HNVR P++VR
Sbjct  725   WNTDYLFGSLTWTDNGAHNVRIPLSVR  751



>ref|XP_006286454.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19352.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=754

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/761 (46%), Positives = 479/761 (63%), Gaps = 52/761 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YIVY+G K H+D   + ESH+ LL   +GS E    ++VYSYR+GFSGFAA LT +QA
Sbjct  28    KVYIVYMGKKTHEDPESVTESHHQLLWPFLGSKEAVHDSIVYSYRHGFSGFAAKLTETQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V  +  +++ T+R+WD+LGLS G +    LL+K N G  +IVGV+DSG+
Sbjct  88    QQISELPEVVQVAPNTLYELTTTRTWDYLGLSPGNS--QSLLQKANMGSSVIVGVIDSGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C +  G  FN S  CNRK+IGA++F  G +  + + LN
Sbjct  146   WPESDMFNDKGYGPIPSRWKGGCES--GDSFNASINCNRKLIGAKFFVDGLVADKRI-LN  202

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             + L++D  S  D+ GHG+ VAS + GSF+PN + LG+  G  RGGA    +A YKACW L
Sbjct  203   RTLIADYLSPRDLNGHGTHVASTIGGSFLPNVSYLGLGEGTARGGAPGVHIAIYKACWLL  262

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             +     C  AD+L AID AI D VDV+S+S+GS VPL  + +  N + +G FHA+ +GI 
Sbjct  263   EG---TCTDADVLKAIDVAIDDGVDVLSLSLGSGVPLTIETDV-NLMAMGLFHAVEKGIH  318

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A+GN GP A +++NV PW++TVAA+T+DR F   ITLGN           N T +  
Sbjct  319   VVAASGNNGPVAQSVSNVAPWILTVAATTLDRSFPTAITLGN-----------NITIMGQ  367

Query  1313  PLHFAGKYMGE---------ADLMPRKLDPAEVKGKIVFMFGDDLD--RNLVLVDKA--T  1173
               +FAG  +G          A+L+ +  +P  +KGK+V  F  DL+     V + +A  +
Sbjct  368   A-NFAGPELGSVGLTYSGDCANLLDKPNNP--MKGKVVLCFTADLNPRSRAVTIARAVVS  424

Query  1172  DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
             +AG +GVI + NP +V+  P  N   P V VD++ GT I  YI +ST +P+ ++ +P   
Sbjct  425   NAGGLGVIIARNPRSVN--PTHN--FPCVTVDFELGTDILFYI-RSTSSPSVKIHAPTTL  479

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHV  816
             V   +  KV  FSSRGP+S +P I+KPDIAAPG  I+ AD   +G     SGTS A P V
Sbjct  480   VSHPVATKVAYFSSRGPNSISPAILKPDIAAPGVNILAADKDKEG-VVFKSGTSMATPVV  538

Query  815   SAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPN  636
             S +V LLK  +P+WSPAAI+SA+VTTAW +D +  PIFA+GS+ + AD FDYGGG+VNP 
Sbjct  539   SGVVVLLKSLYPQWSPAAIRSAIVTTAWKTDPFGEPIFAEGSNRKLADPFDYGGGLVNPE  598

Query  635   AADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLN  456
              A  PGLVYDM   DY  YLC+  YN + +  +  GN         T CP  + S+LDLN
Sbjct  599   KAVSPGLVYDMTINDYVSYLCS-AYNFNDVSISQVGNI--------TACPNPKQSLLDLN  649

Query  455   LPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFT  276
             LPS+ +PDL   VTL RTVTNVG VNS+YK ++ +P+G  + V P  L F+   +K SF 
Sbjct  650   LPSITIPDLRDEVTLTRTVTNVGSVNSIYKVMIDAPIGVNMIVTPATLEFNSMTRKVSFK  709

Query  275   MRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             +RV     VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  710   VRVLTTHKVNTGYYFGSLTWTDNVHNVVIPVSVRTQILQRY  750



>ref|NP_567362.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AAM91616.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE82896.1| subtilisin-like protease [Arabidopsis thaliana]
Length=778

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/762 (45%), Positives = 474/762 (62%), Gaps = 33/762 (4%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQ
Sbjct  32    RKVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQ  91

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AKK+A +  VV V+ D  +K+ T+R+WD+LGLS  A  P  LL +TN G+ +I+GV+D+G
Sbjct  92    AKKIADLPDVVHVIPDSFYKLATTRTWDYLGLS--AANPKSLLHETNMGEQIIIGVIDTG  149

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   F D+G GPVP  WKG C    G  FN S  CN+K+IGA++F  G  L+++   
Sbjct  150   VWPESEVFNDSGFGPVPSHWKGGCET--GENFNSSN-CNKKLIGAKYFING-FLAENESF  205

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     D  S  D+ GHG+ V++I  GSFVPN +  G+  G VRGGA  A +A YKACW 
Sbjct  206   NSTNSLDFISPRDLDGHGTHVSTIAGGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWY  265

Query  1676  LDPE-RFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             LD +    C+ AD+L A+D A+HD VDV+S+S+GS VPL  + +  +GI  G+FHA+ +G
Sbjct  266   LDDDDTTTCSSADILKAMDEAMHDGVDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKG  325

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ + GN+GP + T+TN  PW+ITVAA+T+DR FA  +TLGN  K  +   +  G  L
Sbjct  326   ITVVCSGGNSGPDSLTVTNTAPWIITVAATTLDRSFATPLTLGN-NKVILGQAMYTGPGL  384

Query  1319  --------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVL--VDKATD  1170
                      +P +    + G  + +    +   ++GK+V  F        VL        
Sbjct  385   GFTSLVYPENPGNSNESFSGTCEELLFNSN-RTMEGKVVLCFTTSPYGGAVLSAARYVKR  443

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             AG +GVI +        P L+   P V VD++ GT I  Y  +S+ +P  ++   K  VG
Sbjct  444   AGGLGVIIARHPGYAIQPCLD-DFPCVAVDWELGTDILLYT-RSSGSPVVKIQPSKTLVG  501

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT---SDGGFRISSGTSHAAPH  819
             + +  KV  FSSRGP+S AP I+KPDIAAPG  I+ A      SD GF + SGTS AAP 
Sbjct  502   QPVGTKVATFSSRGPNSIAPAILKPDIAAPGVSILAATTNTTFSDQGFIMLSGTSMAAPA  561

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             +S + ALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+VNP
Sbjct  562   ISGVAALLKALHRDWSPAAIRSAIVTTAWKTDPFGEQIFAEGSPPKLADPFDYGGGLVNP  621

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               + +PGLVYDM   DY  Y+C++GYN + I + I          + T+C   +PS+LD 
Sbjct  622   EKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLIG---------KTTVCSNPKPSVLDF  672

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +P+L   VT+ RTVTNVGP+NSVY+  V+ P+G  VTV P+ L F+   KK  F
Sbjct  673   NLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYF  732

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              ++VS     N+ + FGSLTWSD +HNV  P++VR  I+  Y
Sbjct  733   KVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVRTQILQNY  774



>ref|NP_001190697.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82898.1| subtilisin-like protease [Arabidopsis thaliana]
Length=794

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/762 (45%), Positives = 474/762 (62%), Gaps = 33/762 (4%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQ
Sbjct  48    RKVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQ  107

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AKK+A +  VV V+ D  +K+ T+R+WD+LGLS  A  P  LL +TN G+ +I+GV+D+G
Sbjct  108   AKKIADLPDVVHVIPDSFYKLATTRTWDYLGLS--AANPKSLLHETNMGEQIIIGVIDTG  165

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   F D+G GPVP  WKG C    G  FN S  CN+K+IGA++F  G  L+++   
Sbjct  166   VWPESEVFNDSGFGPVPSHWKGGCET--GENFNSSN-CNKKLIGAKYFING-FLAENESF  221

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     D  S  D+ GHG+ V++I  GSFVPN +  G+  G VRGGA  A +A YKACW 
Sbjct  222   NSTNSLDFISPRDLDGHGTHVSTIAGGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWY  281

Query  1676  LDPE-RFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             LD +    C+ AD+L A+D A+HD VDV+S+S+GS VPL  + +  +GI  G+FHA+ +G
Sbjct  282   LDDDDTTTCSSADILKAMDEAMHDGVDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKG  341

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ + GN+GP + T+TN  PW+ITVAA+T+DR FA  +TLGN  K  +   +  G  L
Sbjct  342   ITVVCSGGNSGPDSLTVTNTAPWIITVAATTLDRSFATPLTLGN-NKVILGQAMYTGPGL  400

Query  1319  --------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVL--VDKATD  1170
                      +P +    + G  + +    +   ++GK+V  F        VL        
Sbjct  401   GFTSLVYPENPGNSNESFSGTCEELLFNSN-RTMEGKVVLCFTTSPYGGAVLSAARYVKR  459

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             AG +GVI +        P L+   P V VD++ GT I  Y  +S+ +P  ++   K  VG
Sbjct  460   AGGLGVIIARHPGYAIQPCLD-DFPCVAVDWELGTDILLYT-RSSGSPVVKIQPSKTLVG  517

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT---SDGGFRISSGTSHAAPH  819
             + +  KV  FSSRGP+S AP I+KPDIAAPG  I+ A      SD GF + SGTS AAP 
Sbjct  518   QPVGTKVATFSSRGPNSIAPAILKPDIAAPGVSILAATTNTTFSDQGFIMLSGTSMAAPA  577

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             +S + ALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+VNP
Sbjct  578   ISGVAALLKALHRDWSPAAIRSAIVTTAWKTDPFGEQIFAEGSPPKLADPFDYGGGLVNP  637

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               + +PGLVYDM   DY  Y+C++GYN + I + I          + T+C   +PS+LD 
Sbjct  638   EKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLIG---------KTTVCSNPKPSVLDF  688

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +P+L   VT+ RTVTNVGP+NSVY+  V+ P+G  VTV P+ L F+   KK  F
Sbjct  689   NLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYF  748

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              ++VS     N+ + FGSLTWSD +HNV  P++VR  I+  Y
Sbjct  749   KVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVRTQILQNY  790



>ref|XP_010529679.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Tarenaya 
hassleriana]
Length=717

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/731 (46%), Positives = 455/731 (62%), Gaps = 26/731 (4%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++GS E A  +MVYSYR+GFSGFAA LT  +A++++ +  VV VV D+ +++ T+R
Sbjct  1     MLCSLLGSEEAAHDSMVYSYRHGFSGFAAKLTEYEAEQISELPEVVHVVLDQFYQLTTTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             +WD+LGLS     P  LL +TN G+ +I GV+DSGI  E  S  D GMG +P RWKG C 
Sbjct  61    TWDYLGLSP--KHPKNLLYETNMGNQVIAGVIDSGIWPESESLNDKGMGSIPSRWKGGCE  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
             +  G  FN S  CNRK+IGA++F  G  ++ + DLN     +  S  D  GHG+ VA+ +
Sbjct  119   S--GQMFNPSTHCNRKLIGAKFFIDG-FIASNGDLNTTENPEYVSPKDFDGHGTHVATTI  175

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDP-ERFVCAGADLLAAIDYAIHDR  1605
             AGSFVPN T LG   G++RGGA  A +A YKACW++       C+ AD+L AID AI D 
Sbjct  176   AGSFVPNVTYLGFAGGIIRGGAPLAHIAMYKACWHVTAIGTATCSSADMLKAIDEAIKDG  235

Query  1604  VDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVI  1425
             VDVIS+S+   VPL  +++  +GI +G+FHA+ RGIPV+ A GNAGP+A TI N  PW++
Sbjct  236   VDVISISIAFSVPLFPEIDIRDGIAVGAFHAVARGIPVVCAGGNAGPAAQTIVNTAPWIL  295

Query  1424  TVAASTIDRIFAYTITLGNG-EKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPA  1248
             TVAA+T+DR F   ITLGN       +  + +G   +  ++    + G+ + +    +  
Sbjct  296   TVAATTLDRSFPTPITLGNNITILGQELYVGSGLGFTPLVYPESPFSGDCEKLSANPN-R  354

Query  1247  EVKGKIVFMFGDDLDRNLVLV--DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYD  1074
              + GK+V  F    D + V+      ++AG +GVI +   N   L +         +DY+
Sbjct  355   TMAGKVVLCFTTKTDPSAVISAGKAVSEAGGLGVIVAR--NPGHLLVPCVDFACAAIDYE  412

Query  1073  AGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGD  894
              GT I  YI +ST +P  ++   +  VG  +  KV  FSSRGP+S  P I+KPDI+APG 
Sbjct  413   LGTDILFYI-RSTKSPVVKIQPSRTLVGPPVATKVATFSSRGPNSITPAILKPDISAPGV  471

Query  893   KIMCADPTSD----GGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNS  726
              I+ A   +D    GGF + SGTS A P VS IVALL+  HP WSPAAI+SA+VTTAW +
Sbjct  472   NILAATSLNDSLGAGGFVLKSGTSMATPVVSGIVALLRALHPNWSPAAIRSAIVTTAWKT  531

Query  725   DTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLI  546
             D    PIFA GS+ + AD FDYGGG+VNP  A DPGLVYDM   DY  Y+C++GY +  I
Sbjct  532   DPSGEPIFADGSNRKLADPFDYGGGLVNPEKATDPGLVYDMGTSDYIHYMCSVGYKDPSI  591

Query  545   YKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYK  366
                +          + TICP   PS+LDLNLPS+ +PDL   VT+ RTVTNVGP NSVYK
Sbjct  592   SLVVG---------KATICPHPNPSVLDLNLPSITIPDLSGEVTITRTVTNVGPRNSVYK  642

Query  365   AIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTP  186
              ++  P G  + V PK L F+   ++ SFT+RVS    VN+ F FGSLTW+D VHNV  P
Sbjct  643   VVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAIP  702

Query  185   IAVRKMIVPLY  153
             ++VR  I+P Y
Sbjct  703   VSVRTQILPRY  713



>ref|XP_002888489.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64748.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=760

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/757 (46%), Positives = 469/757 (62%), Gaps = 52/757 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD   + ESH+D+L  ++GS E +R++M+YSYR+GFSGFAA LT+SQA
Sbjct  39    QIYTVHLGERQHDDPNLVTESHHDILGPLLGSKEASRESMIYSYRHGFSGFAAKLTSSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++G   VV V + K+ K++T+R  D+LGL+  A  P  LL +T  G   IVG++DSGI
Sbjct  99    RELSGHPDVVHVTKSKNMKLKTTRVNDYLGLTPTA--PTGLLHETAMGSEAIVGILDSGI  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               +  SF D G+GP+P RWKG C  + G  FN S  CNRK+IGA ++ KG +   +   N
Sbjct  157   WPDSKSFNDNGLGPIPARWKGQC--VSGEAFNASS-CNRKLIGATYYSKGLMSKYNGTFN  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+  AS   GSFVP+A   G+  G  RG A  AR+ASYK CWN 
Sbjct  214   AVEKGEVMSPLDKMGHGTHCASTAVGSFVPDANVFGLAQGTARGSAPRARIASYKVCWNN  273

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             D     C   D++ AID+AI D VDVIS+S+GS VP+  ++++ +   I +FHA+ +GIP
Sbjct  274   DE----CFTPDIVKAIDHAIRDGVDVISLSLGSEVPVDFEVDSRSDFAIAAFHAVMKGIP  329

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP   TI+NV PW+ITVAA+T+DR F   ITLGN           N T L  
Sbjct  330   VVCAGGNDGPDKQTISNVAPWLITVAATTMDREFFTPITLGN-----------NITLLGQ  378

Query  1313  PLHFAGKYMGEADLM------PRKLDPAEVKGKIVFMFG-----DDLDRNLVLVDKATDA  1167
                + GK +G  DL+         +   +  GKI+F F      DD       V+ A   
Sbjct  379   EGVYTGKEVGFTDLLYFEDLTKEDMQAGKANGKILFFFQTAKYQDDF------VEYAQSN  432

Query  1166  GAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             GA GVI +  P+  DS+   +A I Y  VDY+ G  I  YI Q+T +P A++S  K  VG
Sbjct  433   GAAGVILAMQPT--DSIDPGSADIAYAYVDYEIGMDILLYI-QTTKSPVAKISPTKTFVG  489

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSA  810
             R L  KV  FSSRGP+S +P I+KPDIAAPG  I+ A P S  G+ + SGTS AAP VS 
Sbjct  490   RPLATKVARFSSRGPNSLSPAILKPDIAAPGSGILAAVP-SRAGYELMSGTSMAAPVVSG  548

Query  809   IVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAA  630
             IV+LL+   P+WSPAAI+SALVTTA  +D    PI A+GS  + AD+FDYGGG+VNP   
Sbjct  549   IVSLLRQKRPDWSPAAIRSALVTTALQTDPSGEPIAAEGSPRKLADSFDYGGGLVNPGKV  608

Query  629   DDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLP  450
              DPGLVYDM   +Y  YLC+ GY+N+ I K +          +   CP   PSMLD+NLP
Sbjct  609   ADPGLVYDMGHDEYVHYLCSAGYDNTSISKLLG---------KIYTCPSPIPSMLDVNLP  659

Query  449   SMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMR  270
             S+ +P L + +T+ RTVTNVGPV SVYKA++++P G  + V P+ L F  N  K +FT++
Sbjct  660   SITIPYLSEEITITRTVTNVGPVGSVYKAVIQAPQGINLQVSPETLEFGSNTNKITFTVK  719

Query  269   VSADKLVNSAFTFGSLTWSDGV-HNVRTPIAVRKMIV  162
             VS     N+ + FGSLTW+D   HNVR P++VR  ++
Sbjct  720   VSTTHRANTDYLFGSLTWTDNEGHNVRIPLSVRTRVL  756



>ref|XP_010551747.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=761

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/754 (49%), Positives = 479/754 (64%), Gaps = 49/754 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IVYLG + H+D   +  SH+ +L  V GS + ARK+M+YSYR+GFSGFAA L +SQ 
Sbjct  41    KIHIVYLGARQHEDPELVTASHHTILESVFGSKDAARKSMIYSYRHGFSGFAAKLNSSQV  100

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++    VV V  ++  +++T+RS+D+LGLS   N P  LL  TN G   I+GV+DSGI
Sbjct  101   KALSAHPDVVHVAPNRILQLKTTRSFDYLGLSP--NAPKGLLHDTNMGSDAIIGVIDSGI  158

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+ P+P RWKG C  + G  F+ ++ CN+K+IGA+++F+G L   D   N
Sbjct  159   WPEAESFNDKGLSPIPTRWKGGC--VSGESFDATKSCNKKLIGAKFYFQGVLKEVDGAFN  216

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  ++ S  DV GHG+ V SI AGSFVP A+  G+  G  RGGA  ARVA+YK CW  
Sbjct  217   FTEAGETKSPRDVTGHGTHVTSIAAGSFVPGASVEGLAGGTARGGAPGARVATYKVCW--  274

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAE-NGIGIGSFHAITRGI  1497
               +   C G+DL+ AID AIHDRVDVIS+S+G+ +P  +D E +   IGI SFHA+  GI
Sbjct  275   --KSAGCPGSDLVKAIDDAIHDRVDVISISIGNRIP--NDFEVDPRDIGIASFHAVMEGI  330

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ AAGN GP   T+ NV PW+ITVAAST+DR F   +TLGN           N T ++
Sbjct  331   PVVCAAGNEGPGPQTVDNVAPWIITVAASTMDRSFPIYLTLGN-----------NLTMMA  379

Query  1316  HPLHFAGKYMGEADLM-PRKLDPAEVK-----GKIV--FMFGDDLDRNLVLVDKATDAGA  1161
               L + G   G  DL+   +L  A++K     GKIV  FM  D     L L+      G+
Sbjct  380   QGL-YTGNQTGFVDLVYGGELPDADIKNGSVMGKIVLIFMASDVEKEKLKLI---VQGGS  435

Query  1160  VGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRAL  981
              GVI +  S +D++P      P V VDY+ GT I  YI QST +P  ++S  K  VGR +
Sbjct  436   AGVIMAQ-SIIDAVPCF--MFPCVSVDYELGTDILYYI-QSTASPKIKISPTKTVVGRPI  491

Query  980   TPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD-GGFRISSGTSHAAPHVSAIV  804
               K+P FS+RGP+S +P I+KPDIAAPG  I+ A P SD   F + SGTS AAP VS +V
Sbjct  492   ATKIPTFSNRGPNSISPAILKPDIAAPGADILGAVPGSDPRQFDLLSGTSMAAPAVSGVV  551

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADD  624
             ALL+  +P+WSPAAI+SALVTTAW +D +  PI ++G+S + AD FDYGGGI+NP  A +
Sbjct  552   ALLRAKYPQWSPAAIRSALVTTAWRTDPFGFPIMSEGASPKPADPFDYGGGIMNPERAAN  611

Query  623   PGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSM  444
             PGLVYDM   DY  YLC+ GY +    K IS    +  T     CP  RPS+LD+NLPS+
Sbjct  612   PGLVYDMGYEDYVHYLCSAGYQD----KAISSLLGKVYT-----CPNPRPSILDVNLPSI  662

Query  443   VVPDLFKPVTLRRTVTNVGPVNS-VYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRV  267
              VPDL + VT+ RTVTNVG V+S VYK +V+SP G  V V PK L F+   KK +F + V
Sbjct  663   TVPDLKEHVTVTRTVTNVGTVDSVVYKPVVESPYGVKVVVNPKALVFNSTTKKATFKVHV  722

Query  266   SADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             S    VNSAF FGSLTW+DG +NV  P++VR  I
Sbjct  723   STTNEVNSAFFFGSLTWTDGTNNVTIPLSVRTKI  756



>ref|XP_009344070.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=699

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/722 (47%), Positives = 460/722 (64%), Gaps = 56/722 (8%)
 Frame = -3

Query  2276  MVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPG  2097
             MVYSY++GFSGFAA LT SQ +++  + GVV ++ +  HK++T+RSWDFLGLS  ++   
Sbjct  1     MVYSYKHGFSGFAAKLTESQTQQLLELPGVVRIIPNSLHKLETTRSWDFLGLSPHSS--S  58

Query  2096  ELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNR  1917
              +L K+N GDG+I+GV+D+GI  E  SF + G+GPVP  W G C +  G  FN +  CNR
Sbjct  59    NILPKSNMGDGVIIGVLDTGIWPESESFNEKGLGPVPSHWNGVCES--GDNFNTTIHCNR  116

Query  1916  KVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDV  1737
             K+IGARWF  G L      L+K    + +S  D  GHG+  +S  AGSFV N +  G+ +
Sbjct  117   KIIGARWFINGLLAEYAKPLDK----EFHSPRDAHGHGTHTSSTAAGSFVANISYKGLGL  172

Query  1736  GMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLAS  1557
             G +RGGA  AR+A YK CWN+   +  C+ AD+L A D AIHD VDV+S+S+   VPL S
Sbjct  173   GTIRGGAPNARLAIYKVCWNVLGGQ--CSTADILKAFDEAIHDGVDVLSLSIVYSVPLFS  230

Query  1556  DMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTIT  1377
             D++  +GI  GSFHA+ +GI V+ AAGN+GPSA T+ N  PW+ITVAAST+DR F  +IT
Sbjct  231   DVDERDGIATGSFHAVAKGITVVCAAGNSGPSAQTVGNTAPWIITVAASTMDREFPTSIT  290

Query  1376  LGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLM-PRKLDPAE-------------VK  1239
             LGN + +        G A+     F G  +G  +L+ P    P +             V 
Sbjct  291   LGNNKTFL-------GQAM-----FTGTEIGFTNLVYPESEGPTDGGVCESLSLNKTIVV  338

Query  1238  GKIVFMFGDDLDRNLVLVDKAT--DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAG  1068
             GK+V  F   + R  +    A   +AG VG+I + NPS   S  I +   P ++V+Y+ G
Sbjct  339   GKVVLCF-TTMGRQAITNASAVVKEAGGVGLIIAKNPSGALSPCIED--FPCIEVEYEIG  395

Query  1067  TRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKI  888
             TRI  YI +ST  P  +LS PK  VG+ L+ KV  FSSRGP+S AP  +KPDIAAPG  I
Sbjct  396   TRILFYI-RSTRYPLVKLSLPKSTVGKQLSAKVAYFSSRGPNSIAPASLKPDIAAPGVNI  454

Query  887   MCADPT----SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDT  720
             + A       ++GG+ + SGTS + PHV+ IVAL+K  HP WSPAAIKSALVTTAW +  
Sbjct  455   LAATSPLYSFAEGGYAMMSGTSMSTPHVTGIVALIKRMHPNWSPAAIKSALVTTAWRNGP  514

Query  719   YFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYK  540
                PIFA+GS  + A++FD+GGG+VNPN A DPGLVYDM   DY +YLCA GYNNS I +
Sbjct  515   SGLPIFAEGSPQKLANSFDFGGGLVNPNGAADPGLVYDMGAADYMEYLCARGYNNSAISR  574

Query  539   TISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAI  360
                       T ++T CP  +PS+LD+NLPS+ +P L  P+T++RTVTNVG   S+YKA 
Sbjct  575   L---------TGKNTTCPVKKPSILDVNLPSVTIPSLRNPITVKRTVTNVGAPESIYKAT  625

Query  359   VKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIA  180
             ++ P G +V V P  L F+   +K +FT+ +SA   +N+ + FGSLTW DGVH VR P++
Sbjct  626   IEPPFGTIVYVNPTALVFNSTVEKLTFTITISAIHEMNTGYYFGSLTWVDGVHAVRIPLS  685

Query  179   VR  174
             V+
Sbjct  686   VK  687



>ref|XP_010421967.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/765 (45%), Positives = 479/765 (63%), Gaps = 51/765 (7%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K+Y+VYLG K HD+   + ESH+ +L  ++GS E    ++VYSYR+GFSGFAA LT SQ
Sbjct  27    RKVYVVYLGEKEHDNPESVTESHHQILWSLLGSKESVHDSIVYSYRHGFSGFAAKLTESQ  86

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A++++ +  VV V+ +  +++ T+R+WD+LGLS G   P  LL K N G+ +IVGV+DSG
Sbjct  87    AQQISELPEVVQVIPNTLYEMTTTRTWDYLGLSPGT--PKSLLHKANMGNSVIVGVIDSG  144

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   F D G GP+P RWKG C +  G  FN S  CN+K+IGA++F  G + +  V +
Sbjct  145   VWPESEMFNDKGYGPIPSRWKGGCES--GESFNASIHCNKKLIGAKYFVDGLVAAAGV-V  201

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N+    +  S  D  GHG+ VAS + GSF+PN + LG+  G  RGGA    +A YKACW 
Sbjct  202   NRTENPEYLSPRDFNGHGTHVASTIGGSFLPNVSYLGLGQGTARGGAPGVHIAIYKACW-  260

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                +   C GAD+L AID AIHD VD++S+S+ S VPL  + +      +G+FHA+++GI
Sbjct  261   --LQTGTCTGADVLKAIDEAIHDGVDILSLSLQSSVPLFPETDMRELTSVGAFHAVSKGI  318

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ AAGNAGP+A TI+NV PW++TVAA+T DR F   ITLGN           N T L 
Sbjct  319   AVVAAAGNAGPTAQTISNVAPWILTVAATTQDRSFPTAITLGN-----------NITILG  367

Query  1316  HPLHFAGKYMG-----------EADLMPRKLDP-AEVKGKIVFMFGDDLDRNLVLVDKAT  1173
               + F G  +G             D      +P + ++GK+V  F  +   N   +    
Sbjct  368   QAI-FGGPELGFVGLTYPERPLSGDCENLSANPDSAMEGKVVLCFAANKPTNAA-ITAVR  425

Query  1172  DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
             +AG +G+I + NP+++ S P  N   PYV VD++ GT I  YI +ST +P  ++ + +  
Sbjct  426   NAGGLGLIIARNPTHLLS-PTRN--FPYVSVDFELGTDILFYI-RSTRSPIVKIDASRTL  481

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTS---DGGFRISSGTSHA  828
             V R+++ KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P S   DGGF + SGTS +
Sbjct  482   VARSVSTKVATFSSRGPNSVSPAILKPDIAAPGVNILAAISPNSSINDGGFAMMSGTSMS  541

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P VS +V LLK  HP+WSPAAIKSA+VTTAW +D    PIFA GSS + AD FDYGGG+
Sbjct  542   TPVVSGVVVLLKSLHPDWSPAAIKSAIVTTAWKTDPSGEPIFADGSSRKLADPFDYGGGL  601

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             +NP  A  PGL+YDM   DY  YLC+  Y++  I + +          + T+CP  +PS+
Sbjct  602   INPEKAVKPGLIYDMTTDDYILYLCSAEYSDVSISRVLG---------KATVCPNPKPSV  652

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LDLNLPS+ +P+L + VT +RTVTNVGP+ S+YK ++  P G  VTV P  L FD    K
Sbjct  653   LDLNLPSITIPNLREEVTFKRTVTNVGPLKSIYKVVIDPPTGVNVTVTPTELVFDSTNTK  712

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SFT+RVS    VN+ + FGSLTW++ +HNV  P++VR  I+  Y
Sbjct  713   LSFTVRVSTTHKVNTGYYFGSLTWTNDLHNVVIPVSVRTQILQRY  757



>ref|XP_006415135.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
 gb|ESQ33488.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
Length=776

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/772 (46%), Positives = 481/772 (62%), Gaps = 52/772 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + HDD   + ESH+ +L  ++GS E A  +MVYSY +GFS FAA LT SQ 
Sbjct  28    KVHIVYLGERQHDDPASVTESHHQMLWSILGSKEAAHDSMVYSYHHGFSAFAAKLTDSQV  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
              +++ +  VV V+ D+ +++QT+R+WD+L     +  P  LL +TN GD +I+GVVDSGI
Sbjct  88    NQLSELPEVVHVIRDRFYELQTTRTWDYL--KHTSKHPKNLLNQTNMGDKVIIGVVDSGI  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD-VDL  1857
               E  SF D G+GP+P+RWKGSC +     FN S +CNRK+IGA++F  G L   D  + 
Sbjct  146   WPESESFSDNGLGPIPKRWKGSCES--KQSFNGSTVCNRKLIGAKYFVSGLLGGADESNW  203

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     +  S  D  GHG+ VA+  AGSFVP+A+ L +  G+ RGGA  ARVA YKACW+
Sbjct  204   NTTENPEYVSPRDFNGHGTHVAATAAGSFVPDASYLALGRGIARGGAPRARVAMYKACWH  263

Query  1676  LDP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             L       C+ AD+L AID AIHD VDV+S+S    +PL  +++A + + +G+FHA+ +G
Sbjct  264   LTSLGTATCSAADMLKAIDEAIHDGVDVLSISTSFSIPLFPEVDARDAMAVGAFHAVAKG  323

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD--WQLPNG-  1329
             IPV+ + GNAGP++ T+TN  PW+ITVAA+T DR F   ITLGN         +Q P+  
Sbjct  324   IPVVCSGGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNVTIVGQALYQGPDMD  383

Query  1328  -TALSHPLHFAGK---YMGEADLMPRKLDPAEV-KGKIVFMFGDDLDRNLVLVDKATDAG  1164
              T L +P         + G  + + +  +PA + K KIV  F            K+TD G
Sbjct  384   FTGLVYPEGPEASNETFSGVCEDLSK--NPARIIKEKIVLCF-----------TKSTDYG  430

Query  1163  AVGVIYSNPSNVDSLPILNAR-----------IPYVQVDYDAGTRIKDYIFQSTMTPTAQ  1017
              V    S+  N+D   ++ AR            P + VDY+ GT I  YI +ST +P A+
Sbjct  431   TVIQAASDVFNLDGYGVIVARNPGYQLNPCDGFPCLAVDYELGTDILFYI-RSTRSPVAK  489

Query  1016  LSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRI  849
             +   +  VG  +  KV  FSSRGPSS +P I+KPDIAAPG  I+ A    D  +D GF +
Sbjct  490   IQPTRTLVGLPVATKVATFSSRGPSSISPAILKPDIAAPGVNILAATSPNDTFNDRGFSM  549

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS + P V+ IVALLK  HP WSPAAI+SA+VTTAW +D    PIFA GS+ + AD 
Sbjct  550   KSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWRTDPSGEPIFADGSNRKLADP  609

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FDYGGG+VN   A  PGLVYDM   DY  YLC++GY +S I + +          + T+C
Sbjct  610   FDYGGGVVNSEKAAKPGLVYDMGVKDYVLYLCSVGYTDSSISRLV---------RKKTVC  660

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
                +PS+LDLNLPS+ +P+L K VT+ RTVTNVGPV SVYKA++++P+G  VTV P+ L 
Sbjct  661   ANPKPSVLDLNLPSITIPNLGKEVTVTRTVTNVGPVGSVYKAVIEAPMGVNVTVTPRTLV  720

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F+   KK SF +RV  +  VN+ + FGSLTW+D +HNV  P++VR  I+  Y
Sbjct  721   FNAKTKKLSFKVRVLTNHRVNTGYYFGSLTWTDSLHNVVIPLSVRTQILQRY  772



>ref|XP_006287119.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
 gb|EOA20017.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
Length=758

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/765 (45%), Positives = 472/765 (62%), Gaps = 52/765 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K HDD   + ESH+ +L  ++GS E  + ++VYSYR+GFSGFAA LT SQA
Sbjct  28    KVYVVYLGEKKHDDIESVTESHHQILWSLLGSKEAVQDSIVYSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ + GVV V+ +  +++ T+R+WD+LGLS G +    LL+KTN G  +IVGV+D+G+
Sbjct  88    QQISEIPGVVQVIPNALYELTTTRTWDYLGLSPGNS--QSLLQKTNMGSSVIVGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C    G  F+ S  CN+K+IGA++F  G      V + 
Sbjct  146   WPESEMFNDKGYGPIPSRWKGVCEY--GELFSPSN-CNKKLIGAKFFIDGYFAEFGV-VK  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+ VAS V GSFV N + LG+  G VRGGA   ++A YKACW  
Sbjct  202   TTEKPEYISPRDFHGHGTHVASTVGGSFVHNVSYLGLGRGSVRGGAPGVQLAIYKACW--  259

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               +   C+G D+L AID AIHD VDV+S+S+G  VPL  + +      +G+FHA+ +GI 
Sbjct  260   --QDGTCSGVDVLKAIDEAIHDGVDVLSLSLGLKVPLYQETDVRELTSVGTFHAVAKGIT  317

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP+A TI+NV PW++TVAA+T+DR F  TITLGN           N T L  
Sbjct  318   VVASAGNDGPAAQTISNVAPWILTVAATTLDRSFPTTITLGN-----------NITTLGQ  366

Query  1313  PLHFAGKYMGEADLM-PRK----------LDPAE-VKGKIVFMFGDDLDRNLVL--VDKA  1176
              + F G  +G  DL  P K           +P   ++GK+V  F  DL    ++  +   
Sbjct  367   AI-FGGPELGFVDLTYPEKPLIGDCAGLAANPKNTMEGKVVLCFTADLSSAGLVNGIIAV  425

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
              +AG +GVI +       +P  +   P V VD++ GT I  YI +ST +P  ++ + +  
Sbjct  426   KNAGGLGVIIARNPTHQLIP--SRDFPCVMVDFELGTDILFYI-RSTSSPIVKIHASRTL  482

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHA  828
             V   +  KV  FSSRGP+S +P ++KPDIAAPG  I+ A       SDGGF +++GTS A
Sbjct  483   VSYPVATKVATFSSRGPNSVSPAVLKPDIAAPGVNILAAVSPNSSISDGGFAMTTGTSMA  542

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P VS +V LLK  HP WSPAAIKSA+VTTAW +D    PIFA GSS + AD FDYGGG+
Sbjct  543   TPVVSGVVVLLKSLHPNWSPAAIKSAIVTTAWRTDPSGEPIFADGSSRKLADPFDYGGGL  602

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             +NP  A  PGL+YDM   DY  YLC+  YN++ I + +          + TICP  +PS+
Sbjct  603   INPEKAARPGLIYDMTIDDYVLYLCSTDYNDTSISQVLG---------KTTICPNPKPSV  653

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LDLNLPS+ +P+L   VTL RTVTNVGP NS+YK ++  P+G  + V PK L F+   KK
Sbjct  654   LDLNLPSITIPNLKDEVTLTRTVTNVGPPNSIYKVVIDPPMGVNMIVTPKWLVFNSMTKK  713

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SF +RVS    VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  714   VSFKVRVSTTHKVNNGYYFGSLTWTDKVHNVVIPVSVRTQILQRY  758



>ref|XP_010104913.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC02149.1| Subtilisin-like protease [Morus notabilis]
Length=803

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/807 (45%), Positives = 486/807 (60%), Gaps = 75/807 (9%)
 Frame = -3

Query  2408  KENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVL  2229
              E    ++IVY+G K H+D   I +SH+ LLA +VGS ++A + MVYSY++GFSGFAA L
Sbjct  13    NEPEANVHIVYMGEKQHNDPGMITDSHHHLLAKIVGSKQKASELMVYSYKHGFSGFAAKL  72

Query  2228  TasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGV  2049
             T S+AKK+A + GVV V+ +  H++QT+RSWD LGLS  +N    LL  ++ GDG+I+GV
Sbjct  73    TESEAKKIAELPGVVRVIPNTLHRLQTTRSWDSLGLSYESN--SNLLHNSSNGDGVIIGV  130

Query  2048  VDSGI---------------------STELPS--------------------FGDAGMGP  1992
              D+G+                     S+E P                     F + G+GP
Sbjct  131   FDTGLFTFPSLYRPWLLSFTGTGNGTSSERPFCHPSLFNPKNETGIWPESKFFDERGLGP  190

Query  1991  VPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVA  1812
             VP RWKG C++  G +FN ++ CNRK+IGARWF  G L    + LN    ++  S  D  
Sbjct  191   VPSRWKGVCKS--GEKFNATQHCNRKIIGARWFIDGFLAEYGLPLNSSGQTEFLSPRDAN  248

Query  1811  GHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLA  1632
             GHG+  AS  AGSFV N +  G+  G  RGGA  ARVA YK CWNL   +  C+ AD+L 
Sbjct  249   GHGTHTASTAAGSFVGNVSYKGLAGGNARGGAPKARVAVYKVCWNLLGGQ--CSSADILK  306

Query  1631  AIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFT  1452
             A D AIHD VDV+S+S+G  +PL +D++  +GI  GSFHA+  GI V+  AGN GPSA T
Sbjct  307   AFDEAIHDGVDVLSLSIGFGIPLYADVDERDGIATGSFHAVANGISVVCGAGNDGPSAQT  366

Query  1451  ITNVEPWVITVAASTIDRIFAYTITLGNGEKY---AVDWQLPNG-TALSHPLHFAGKYMG  1284
             + N  PW++TVAA++IDR F  +ITLGN +     A+  +  N  T L +P         
Sbjct  367   VQNTAPWILTVAANSIDRAFLASITLGNNKTLVGQALITRKENAFTGLLYPESHGLDPTA  426

Query  1283  EADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT----DAGAVGVIYS-NPSNVDSL  1119
              A      L+  +  GK+V  F     R  + +  AT    +AG VG+I + +PS   +L
Sbjct  427   SAICQALTLNGTDAAGKVVLCFTSMSGR--IAITSATSAVREAGGVGLIVAKHPSG--AL  482

Query  1118  PILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSS  939
                    P V+VDY+ GT+I  YI +ST  P  +LS PK  VG+ ++ KV  FSSRGP+S
Sbjct  483   YPCPGDFPCVEVDYEVGTKILFYI-RSTRFPVVRLSPPKTVVGKPVSAKVAFFSSRGPNS  541

Query  938   FAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWS  771
              AP I+KPDI APG  I+ A    D  +D G+ + SGTS A PH+S IVALLK  HP WS
Sbjct  542   VAPAILKPDITAPGVNILAAASPLDEFADNGYVMHSGTSMATPHISGIVALLKALHPTWS  601

Query  770   PAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGID  591
             PAAIKSA++TTA  +      IF++GS  + AD FD+GGGIVNPNAA DPGLVYDM   D
Sbjct  602   PAAIKSAIITTARTAAPSGLTIFSEGSPQKLADPFDFGGGIVNPNAAADPGLVYDMGTSD  661

Query  590   YAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL-FKPVT  414
             YA YLCA+ YNNS I   I GN  +        CP  +PS+LD+NLPS+ +P +   P+ 
Sbjct  662   YAHYLCAMHYNNSAISHLI-GNLTK--------CPLQKPSVLDVNLPSITIPSIRTTPIV  712

Query  413   LRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFT  234
             + RTVTNVG  NS+Y+A ++ P G +V+VKP+ L F+   +K SF + +S    +N+ + 
Sbjct  713   VTRTVTNVGSPNSIYEATIEPPSGVLVSVKPEFLVFNSTIEKISFQVTISTTHQMNTDYL  772

Query  233   FGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             FGSLTW+D VH VR P++VR  +   Y
Sbjct  773   FGSLTWTDKVHIVRIPLSVRTEMFQPY  799



>gb|EYU19440.1| hypothetical protein MIMGU_mgv1a001654mg [Erythranthe guttata]
Length=778

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/765 (44%), Positives = 475/765 (62%), Gaps = 36/765 (5%)
 Frame = -3

Query  2411  LKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAV  2232
               ++   +YIVYLG + HDD + + +SH+D+L  ++GS + A +AMVYSYR+GFSGFAA 
Sbjct  29    FADDTSNVYIVYLGERQHDDPKLVTDSHHDMLTTLMGSKQLALEAMVYSYRHGFSGFAAK  88

Query  2231  LTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVG  2052
             +TASQA++++    VVSV+ +  + +QT+RSWD+L LS  A +P  L  K+N GDG+I+G
Sbjct  89    ITASQAQQLSEHPDVVSVMPNSFYNLQTTRSWDYLRLS--AQIPNNLASKSNMGDGIIIG  146

Query  2051  VVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGAL--  1878
             V+D+GI  E  +F D G+GP+P  WKG C++  G +FN ++ C++K+IGARWF  G L  
Sbjct  147   VLDTGIWPESEAFRDEGLGPIPSGWKGFCQS--GEQFNAAKHCSKKIIGARWFVDGFLAE  204

Query  1877  LSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVA  1698
             + Q V+L +    +  S  D +GHG+ V+S  AG+ V N +  G+ VG  RGGA  AR+A
Sbjct  205   IGQAVNLTRL--GEFLSARDASGHGTHVSSTAAGADVANVSYNGVGVGTARGGAPRARLA  262

Query  1697  SYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVG-SPVPLASDMEAENGIGIGS  1521
              YK CW +     +CA AD+L A D AI D V V+++S+G S +PL S+++  + I +GS
Sbjct  263   VYKVCWKV--RSGLCAAADILKAFDEAIKDGVHVLTLSIGASSLPLYSEVDGRDAIAVGS  320

Query  1520  FHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEK------  1359
             FHA+ +GIPV+  AGN GPS  T+ N  PW+ITVAAST+DR F+  ITLGN +       
Sbjct  321   FHAVAKGIPVVCGAGNDGPSPQTVKNTAPWIITVAASTMDRAFSTQITLGNNKTLQGQSI  380

Query  1358  YAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDK  1179
             Y         T L +P                 L P+ V GK+V  F       + L+  
Sbjct  381   YTGSGTGGGFTGLYYPADGGANTSSTGVCEGLTLKPSLVAGKVVLCFTTVSSPVVTLIAS  440

Query  1178  --ATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
                  AG VGVI S   N  +    N   P  +VDY+ GT+I  YI +S   P  +LS P
Sbjct  441   LLVRAAGGVGVIVSKLQNDITGQCRN--FPCAEVDYEIGTQILFYI-RSNRNPVVKLSPP  497

Query  1004  KIQVGR-ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSG  840
                +G+ +++ K+ +FSSRGP++ +  I+KPDIAAPG +I+ A    D +++ GF + SG
Sbjct  498   TTLIGKESVSAKIAEFSSRGPNTISASILKPDIAAPGLQIIAATSGVDTSAERGFTMMSG  557

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS A PH++ IVALL+  HP+WSPA ++SAL TTAW SD Y +P+FA+G   + AD FDY
Sbjct  558   TSMATPHIAGIVALLRALHPDWSPAGLRSALTTTAWTSDPYGTPMFAEGDPHKLADPFDY  617

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGGI NPN A  PGL+YDM   DY  YLCA+ YN+S I +          T +  +CP  
Sbjct  618   GGGIANPNGASCPGLIYDMDTTDYINYLCAMEYNSSAISRL---------TGQPIMCPNK  668

Query  479   RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDG  300
                +LD+NLPS+ +P L     L RTVTNVGP NS+Y+ +V+ P G +V V P +L F+ 
Sbjct  669   TFPILDVNLPSITIPYLRNSTVLSRTVTNVGPTNSIYRVVVEPPTGTLVFVTPPILIFNS  728

Query  299   NRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             + KK ++ + V +   +   + FGSL W+DGVH+VR+PIAVR  +
Sbjct  729   HIKKITYQVTVISVHPLIGGYYFGSLIWTDGVHDVRSPIAVRSAM  773



>ref|XP_002891022.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67281.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/769 (45%), Positives = 476/769 (62%), Gaps = 48/769 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H D   + +SH+ +L  ++GS ++A  +MVYSYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHHDPEFVTKSHHQMLVSLLGSKKDADDSMVYSYRHGFSGFAAKLTKSQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V+ D  H++ T+R+WD+LGLS  A  P  LL  TN GD +I+GV+D+G+
Sbjct  88    KKIADLPEVVHVIPDGFHELATTRTWDYLGLS--AANPKNLLNDTNMGDQVIIGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P++WKG C +    R   S  CNRK+IGA++F  G  L+++   N
Sbjct  146   WPESESFNDNGVGPIPRKWKGGCESGENFR---STNCNRKLIGAKYFING-FLAKNKGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW-N  1677
                  D  S  D  GHG+ VASI  GSFVPN +  G+  G +RGGA  ARVA YKACW  
Sbjct  202   STKSPDYISARDFDGHGTHVASIAGGSFVPNVSYKGLAGGTLRGGAPRARVAMYKACWFQ  261

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
              + E   C+ +D++ AID A+HD VDV+S+S+   VPL S+ +  +    G FHA+ +GI
Sbjct  262   EELEGVTCSNSDIMKAIDEAMHDGVDVLSISLVGRVPLNSETDLRDEFATGLFHAVAKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQLPN  1332
              V+ A GNAGP+A T+ N+ PW+ITVAA+T+DR F   ITLGN     G+      +L  
Sbjct  322   VVVCAGGNAGPAAQTVVNIAPWIITVAATTLDRSFPTPITLGNNKVILGQATYTGPEL-G  380

Query  1331  GTALSHPLH-------FAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT  1173
              T+L +P         F+G      +L P +     + GK+V  F     R    + +A+
Sbjct  381   LTSLFYPEDERNSNETFSG-VCESLNLNPNR----TMAGKVVLCF--TTSRTNAAIYRAS  433

Query  1172  D----AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSS  1008
                  AG +G+I S NP+   +L   N   P V +DY+ GT I  YI +ST +P  ++  
Sbjct  434   SFVKAAGGLGLIISRNPAF--TLASCNDDFPCVAIDYELGTDILSYI-RSTRSPVVKIQP  490

Query  1007  PKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD----GGFRISSG  840
                  G+ +  KV +FSSRGP+S +P I+KPDIAAPG +I+ A   +D    GGF + SG
Sbjct  491   STTLSGQPVGTKVVNFSSRGPNSMSPAILKPDIAAPGVRILAATSPNDTLNVGGFAMLSG  550

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS A P +S ++ALLK  HP+WSPAA +SA+VTTAW +D +   IFA+GSS + AD FDY
Sbjct  551   TSMATPVISGVIALLKALHPDWSPAAFRSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDY  610

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGG+VNP  A +PGL+YDM   DY  YLC+  YN S I + +          + T+C   
Sbjct  611   GGGLVNPEKAAEPGLIYDMGPQDYILYLCSADYNESSISQLVG---------QVTVCSNP  661

Query  479   RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDG  300
             +PS+LD+NLPS+ +P+L   VT  RTVTNVGP NSVYK  V+ P+G  V V P+ L F+ 
Sbjct  662   KPSVLDVNLPSITIPNLKDEVTDARTVTNVGPSNSVYKVAVEPPLGVRVVVTPETLVFNS  721

Query  299   NRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
               K  SFT+ VS    +N+ F FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  722   KTKSVSFTVLVSTTHKINTGFYFGSLTWTDSVHNVVIPLSVRTQILQNY  770



>ref|NP_193895.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AEE84484.1| Subtilase family protein [Arabidopsis thaliana]
Length=733

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/761 (44%), Positives = 465/761 (61%), Gaps = 79/761 (10%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             ++  K+YIVYLG + HDD   +  SH+ +L  ++ S E+A  +M+YSY++GFSGFAA+LT
Sbjct  36    DSNSKVYIVYLGQREHDDPELLTASHHQMLESLLQSKEDAHNSMIYSYQHGFSGFAALLT  95

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLS---------EGANVPGELLRKTNK  2073
             +SQAKK++    V+ V+ ++  K++T+R WD LGLS           A   G LL  T+ 
Sbjct  96    SSQAKKISEHPEVIHVIPNRILKLKTTRIWDHLGLSPIPTSFSSSSSAKAKG-LLHNTSM  154

Query  2072  GDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWF  1893
             G   I+GVVDSGI  E   F D G+GP+P+RW+G CR+  G +FN +  CN+K+IGA+++
Sbjct  155   GSEAIIGVVDSGIWPESKVFNDQGLGPIPKRWRGKCRS--GEKFNATMHCNKKLIGAKYY  212

Query  1892  FKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGAT  1713
               G L       N+ ++ D  S  D  GHG+  A+I  GSFVPNA+  G+  G VRGGA 
Sbjct  213   QSGLLAMNGGKFNRIIIRDFKSNRDATGHGTHTATIAGGSFVPNASFYGLARGTVRGGAP  272

Query  1712  AARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGI  1533
              AR+ASYKACWN+     +C+ AD+  A D AIHD+VDV+SVS+G+ +P     ++E   
Sbjct  273   RARIASYKACWNVVGWGGICSSADMWKAYDDAIHDQVDVLSVSIGASIP----EDSERVD  328

Query  1532  GIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYA  1353
              I +FHA+ +GI V+ AAGN G  A TI NV PW++TVAA+T+DR F   ITLGN +   
Sbjct  329   FIAAFHAVAKGITVVAAAGNDGSGAQTICNVAPWLLTVAATTLDRSFPTKITLGNNQT--  386

Query  1352  VDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT  1173
                             F GK + E D       P+ + G+ V          ++L  K  
Sbjct  387   ----------------FFGKTILEFD----STHPSSIAGRGVVA--------VILAKKPD  418

Query  1172  DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
             D  A       P N            Y+  DY+ GT I  YI ++T +PT ++S+     
Sbjct  419   DRPA-------PDN-----------SYIFTDYEIGTHILQYI-RTTRSPTVRISAATTLT  459

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAA  825
             G+  TPKV  FSSRGP+S +P I+KPDIAAPG  I+ A    DP +  GF++ SGTS + 
Sbjct  460   GQPATPKVAAFSSRGPNSVSPAILKPDIAAPGVSILAAVSPLDPGAFNGFKLHSGTSMST  519

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P VS I+ LLK  HP+WSPAA++SALVTTAW +     PIFA+GS+ + AD FDYGGG+V
Sbjct  520   PVVSGIIVLLKSLHPKWSPAAMRSALVTTAWRTSPSGEPIFAQGSNKKLADPFDYGGGLV  579

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A  PGLVYDM   DY  Y+C+ GYN+S I + +          + T CP  +PSML
Sbjct  580   NPEKAAKPGLVYDMGIKDYINYMCSAGYNDSSISRVLG---------KKTKCPIPKPSML  630

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK-  288
             D+NLPS+ +P+L K VTL RTVTNVGP+ SVY+A+++SP+G  +TV P +L F    K+ 
Sbjct  631   DINLPSITIPNLEKEVTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTILVFKSAAKRV  690

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
              +F+++      VNS + FGSLTW+DGVH+V  P++V+  I
Sbjct  691   LTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVTIPVSVKTTI  731



>ref|XP_010318060.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Solanum 
lycopersicum]
Length=772

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/764 (44%), Positives = 474/764 (62%), Gaps = 58/764 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVY+G + HDD      +H+ LL  V+GS + AR +++YSY++GFSGFAA LT SQA
Sbjct  35    KVHIVYMGRRQHDDVELATSAHHQLLTSVMGSQKAARDSIIYSYKHGFSGFAARLTKSQA  94

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV VV +   K+ T RSWD+LGLSE ++ P  LL + N GDG+I+GV+D+GI
Sbjct  95    KKIAELPDVVHVVPNHFFKLHTRRSWDYLGLSE-SSPPTNLLHEANMGDGIIIGVLDTGI  153

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG---ALLSQDV  1863
               E  +F D G+GP+P RWKG C++  G +F+ +  CNRK+IG++++ KG   A     +
Sbjct  154   WPESEAFNDKGLGPIPSRWKGHCQS--GDKFDPATACNRKLIGSKYYLKGFEAAAGRPAI  211

Query  1862  DLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
                 FL  D  S  D  GH +  +S   GSF PNA+   +  G V+GGA  AR+A YK C
Sbjct  212   KDPDFLRFDIASPRDRDGHDTHTSSTAGGSFTPNASYHRLGYGTVKGGAPKARIAMYKVC  271

Query  1682  WNLDPERFV--CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
             WN      +  C  AD + AID AIHD VD++S+S+G  +PL +D++  NGI   SFHA+
Sbjct  272   WNW----LIGGCTFADTMMAIDEAIHDGVDILSISLGLEIPLYADIDMRNGIAFASFHAV  327

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
             ++GI VI + GN GP   T+ N+ PW++TVAAS+IDR F   ITLGN + ++       G
Sbjct  328   SKGITVICSGGNEGPYPQTVVNISPWILTVAASSIDRSFPTLITLGNNQTFS-------G  380

Query  1328  TALSHPLHFAGKYMGEADLMPRKLDPAE--------------VKGKIVFMF---GDDLDR  1200
              ++     + GK  G   +  +++   E                GK+V  F   GD+L  
Sbjct  381   QSM-----YTGKETGFIGIAHQEISELEDTRFCNNLNTNDTWAAGKVVLCFIVKGDELYL  435

Query  1199  NLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPT  1023
                      + G +G+I + NP+    L  L    P ++V++D G+++ +YI + +  P 
Sbjct  436   PFTQ-QVVQEVGGLGLIVAKNPTR--DLNYLTFDFPCIEVNFDVGSQLLNYI-RYSRKPQ  491

Query  1022  AQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISS  843
              +L+  +  VG+ ++  +  FSSRGP+S AP I+KPDIAAPG  I+ A   +D  +R  S
Sbjct  492   VKLNPTRTHVGQPVSTHLASFSSRGPNSVAPAILKPDIAAPGVNILAAVLPADTPYRFES  551

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYF-SPIFAKGSSLRAADAF  666
             GTS AAPHVS IVALLK  HP WSPAAIKSALVTTAW +D +   P+ ++G+  + AD F
Sbjct  552   GTSMAAPHVSGIVALLKSLHPHWSPAAIKSALVTTAWVTDPHSGEPVISEGNPNKLADPF  611

Query  665   DYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICP  486
             D+GGG+VN N A DPGLVYDM   DY  YLC++GYNNS I   I         ++   CP
Sbjct  612   DFGGGLVNTNGAKDPGLVYDMGTFDYILYLCSMGYNNSAISMLI---------DQAASCP  662

Query  485   KTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRF  306
               RPS+LD+NLPS+ +P L K V  RRTVTNVGPVNS Y+AI++ P+G  + VKP+ L F
Sbjct  663   IKRPSILDVNLPSLTIPSLRKKV--RRTVTNVGPVNSKYEAIIEPPLGITIKVKPETLIF  720

Query  305   DGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             + + KK SFT+ +S      + + FGSLTW+DG+H VR+P +VR
Sbjct  721   NSSTKKISFTITISTSHKYTTYYYFGSLTWTDGMHRVRSPTSVR  764



>ref|XP_009137202.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=771

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/766 (44%), Positives = 469/766 (61%), Gaps = 51/766 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             +N  K+YIVYLG + +DD   +  SH+ +L   + S E+A K+M+YSY +GFSGFAA+LT
Sbjct  36    DNNTKVYIVYLGERENDDPELVTASHHQMLESFLDSKEDAHKSMIYSYPHGFSGFAALLT  95

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSE--------GANVPGELLRKTNKG  2070
             +SQA K++    V+ V+ ++  K+QT+R+WD L LS+          +V G LL  TN G
Sbjct  96    SSQANKISDHPEVIHVIPNRILKLQTTRTWDLLELSQIPTSFSSSTTSVKG-LLHDTNMG  154

Query  2069  DGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFF  1890
                I+GV+D+GI  E   F D G+GP+P+RW+G C   PG +FN +  CN+K+I A+++ 
Sbjct  155   SEAIIGVIDTGIWPESKVFNDQGLGPIPKRWRGKCE--PGEKFNATIHCNKKLIRAKYYV  212

Query  1889  KGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATA  1710
              G L           V +  S  D  GHG+  A+I  GS VPN +  G+  G VRGGA  
Sbjct  213   NGLLAEMGETFKTTTVREFKSNRDALGHGTHTATIAGGSLVPNVSFYGLARGTVRGGAPR  272

Query  1709  ARVASYKACWNLDPERFV-----CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEA  1545
             AR+ASYK CWN   +        C+ AD+L A D AIHD VDV+SVS+   +P   D E 
Sbjct  273   ARIASYKVCWNTMQKDGTGPGGSCSTADMLKAFDDAIHDGVDVLSVSISGDLP--EDTEV  330

Query  1544  ENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNG  1365
             +    +G+FHA+++GIPV+ AA N GP A T+ N  PW++TVAA+T+DR F   ITLGN 
Sbjct  331   DKPDFVGAFHAVSKGIPVVAAASNEGPKAQTVANAAPWLLTVAATTLDRSFPTKITLGNK  390

Query  1364  EKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLV  1185
             +    +  L  G  +S  L +   +  E+D      D  +VKGKIV +F  D      + 
Sbjct  391   QTLFGE-SLFTGPEISTGLAY---WDSESD------DNGDVKGKIVLVF--DTTSTYPVE  438

Query  1184  DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
              K    G  GVIY+   + D +       P +  DYD GT I  YI ++T +PTA++S+ 
Sbjct  439   TK----GVAGVIYAQ--HPDDIVDRCHAFPCIYTDYDLGTDILQYI-RTTRSPTARISAA  491

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGT  837
                 G   T KV +FSSRGP+S +P I+KPDIAAPG  I+ A    DP    GF ++SGT
Sbjct  492   TTLTGLPATTKVAEFSSRGPNSVSPAILKPDIAAPGVSILAALSPFDPNGHDGFGLASGT  551

Query  836   SHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYG  657
             S + P VS I+ALLK  HP+WSPAA +SALVTTAW +     PIFA+GS+ + AD FDYG
Sbjct  552   SMSTPVVSGIIALLKSLHPDWSPAAFRSALVTTAWRTSPSGEPIFAEGSNKKLADPFDYG  611

Query  656   GGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTR  477
             GG+VNP  A  PGLVYDM   DY  Y+C+ GYN+S I + I          + T CP  +
Sbjct  612   GGLVNPQRAAHPGLVYDMGIEDYINYMCSKGYNDSSISRVIG---------KKTKCPTPK  662

Query  476   PSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGN  297
             PS+LD+NLPS+ +P++ K VTL R+VTNVGP+ S+YKA+++SP+G  +TV P  L F   
Sbjct  663   PSILDMNLPSITIPNIEKEVTLTRSVTNVGPIKSIYKAVIESPLGITLTVNPTTLVFSSE  722

Query  296   RKK-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
              KK  SFT++      VN+ + FGSLTW+DGVH+V+ P++V+  I+
Sbjct  723   DKKVLSFTVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQTRIM  768



>ref|XP_010455450.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/757 (46%), Positives = 477/757 (63%), Gaps = 37/757 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K HDD   + ESH+ LL  ++GS      ++VYSYR+GFSGFAA LT  QA
Sbjct  30    KVYVVYLGKKTHDDPESVTESHHQLLRPLLGSKNAVHDSVVYSYRHGFSGFAAKLTKFQA  89

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ +  +++ T+R+WD+LGLS G   P  LL K N G  +IVGV+DSG+
Sbjct  90    QQISELPEVVHVIPNTLYELTTTRTWDYLGLSPGT--PKSLLHKANMGSSVIVGVIDSGV  147

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C +  G  FN S  CN+K+IGA++F  G + +  + +N
Sbjct  148   WPESEMFNDKGYGPIPSRWKGGCES--GESFNASIHCNKKLIGAKYFVDGLVAAAGI-VN  204

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +    +  S  D  GHG+ VAS + GSF+PN + LG+  G  RGGA    +A YKACW  
Sbjct  205   RTENPEYLSPRDFNGHGTHVASTIGGSFLPNVSYLGLGQGTARGGAPGVHIAIYKACW--  262

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               +   C GAD+L AID AIHD VD++S+S+ S VPL  + +      +G+FHA+++GI 
Sbjct  263   -LQTGTCTGADVLKAIDEAIHDGVDILSLSLQSSVPLFPETDMRELTSVGAFHAVSKGIA  321

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQLPNG  1329
             V+ AAGNAGP+A TI+NV PW++TVAA+T DR F   ITLGN     G+    D +L   
Sbjct  322   VVAAAGNAGPTAQTISNVAPWILTVAATTQDRSFPTAITLGNNITILGQAIFGDPEL-GF  380

Query  1328  TALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI  1149
               L++P        G+ + +    D A ++GK+V  F  +   N   +    +AG +G+I
Sbjct  381   VGLTYPDR---PLSGDCENLSANPDSA-MEGKVVLCFAANKPTNAA-ITAVRNAGGLGLI  435

Query  1148  YS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPK  972
              + NP+++ S P  N   PYV VD++ GT I  YI +ST +P  ++ + +  V R+++ K
Sbjct  436   IARNPTHLLS-PTRN--FPYVSVDFELGTDILFYI-RSTRSPIVKIDASRTLVARSVSTK  491

Query  971   VPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTS---DGGFRISSGTSHAAPHVSAIV  804
                FSSRGP+S +P I+KPDIAAPG  I+ A  P S   DGGF + SGTS + P VS +V
Sbjct  492   EATFSSRGPNSVSPAILKPDIAAPGVNILAAISPNSSLNDGGFAMMSGTSMSTPVVSGVV  551

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADD  624
              LLK  HP+WSPAAIKSA+VTTAW +D    PIFA GSS + AD FDYGGG++NP  A +
Sbjct  552   VLLKSLHPDWSPAAIKSAIVTTAWKTDPSGEPIFADGSSRKLADPFDYGGGLINPEKAVN  611

Query  623   PGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSM  444
             PGL+YDM   DY  YLC+  Y++  I + +          + T+CP  +PS+LDLNLPS+
Sbjct  612   PGLIYDMTTDDYILYLCSAEYSDVSISRVLG---------KATVCPNPKPSVLDLNLPSI  662

Query  443   VVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS  264
              +P+L   VT +RTVTNVGP+ SVYK ++  P G  VTV P  L FD    K SFT+RVS
Sbjct  663   TIPNLRDEVTFKRTVTNVGPLKSVYKVVIDPPTGVNVTVTPTELVFDSTNTKLSFTVRVS  722

Query  263   ADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
                 VN+ + FGSLTW++ +HNV  P++VR  I+  Y
Sbjct  723   TTHKVNTGYYFGSLTWTNDLHNVVIPVSVRTQILQRY  759



>ref|XP_006306827.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
 gb|EOA39725.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
Length=769

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/785 (44%), Positives = 482/785 (61%), Gaps = 42/785 (5%)
 Frame = -3

Query  2450  NGHCRSVGTNAKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMV  2271
             NG CR          +  K+++IVYLG K HDD   + ESH+ +L+ ++GS  +A  +MV
Sbjct  4     NGSCRGDKGYYSEFSKKTKEVHIVYLGEKQHDDPEFVTESHHQMLSSLLGSKADAHDSMV  63

Query  2270  YSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGEL  2091
             YSYR+GFSGFAA LT SQAKK+A    VV V+ D  +++ T+R+WD+LGLS  A  P  L
Sbjct  64    YSYRHGFSGFAAKLTDSQAKKLADSPEVVHVMADSFYELATTRTWDYLGLS--AAYPNNL  121

Query  2090  LRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKV  1911
             L  TN GD +I+G +D+G+  E  SF D G+ P+P  WKG C +  G +F  +  CNRK+
Sbjct  122   LNDTNMGDQVIIGFIDTGVWPESESFNDNGVEPIPGHWKGGCES--GEKFISTN-CNRKL  178

Query  1910  IGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGM  1731
             IGA++F  G  L+++   N     D  S  D  GHG+  ASI  GSFVPN +  G+  G 
Sbjct  179   IGAKYFING-FLAKNEGFNSTESRDYISARDFIGHGTHTASIAGGSFVPNISYKGLAGGN  237

Query  1730  VRGGATAARVASYKACWNLDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASD  1554
             +RGGA  AR+A YKACW +D    V C+ +D+L A+D ++HD V+V+S+S+G+ +PL  +
Sbjct  238   LRGGAPRARIAIYKACWYVDQLGAVACSSSDILKAMDESMHDGVNVLSLSLGAQIPLYPE  297

Query  1553  MEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITL  1374
              +  + I  G+FHA+ +GI V+ A GN+GP+A T+ N  PWV+TVAA+T+DR F   ITL
Sbjct  298   TDLRDRIATGAFHAVAKGIIVVCAGGNSGPAAQTVLNTAPWVLTVAATTLDRSFPTHITL  357

Query  1373  GNGEKYAVDWQLPNG-----TALSHPLHFAGK----YMGEADLMPRKLDPAEV-KGKIVF  1224
             GN  K  +   L  G     T+L +P + AG     Y G  + +   L+P  +  GK+V 
Sbjct  358   GN-RKVILSQALYTGQELGFTSLVYPEN-AGNTNETYSGVCEYL--DLNPNHILAGKVVL  413

Query  1223  MFGDDLDRNLVLVDKATD----AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIK  1056
              F    +     V KA      AG +GVI +     +  P  +   P V +DY+ GT + 
Sbjct  414   CF--TTNTLFTAVSKAASYVKAAGGLGVIVARNPGYNLSPCRD-DFPCVAIDYELGTDVL  470

Query  1055  DYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-  879
              YI +ST +P  ++   +  VG+ +  KV  FSSRGP+S +P I+KPDI APG  I+ A 
Sbjct  471   LYI-RSTRSPVVKIQPSRTFVGQPVGTKVATFSSRGPNSISPAILKPDIGAPGVSILAAT  529

Query  878   DPTSD---GGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSP  708
              P S+   GGF I +GTS AAP ++ +VALLK  HP WSPAA +SA+VTTAW +D +   
Sbjct  530   SPDSNNSVGGFDILAGTSMAAPVIAGVVALLKALHPNWSPAAFRSAIVTTAWRTDPFGEQ  589

Query  707   IFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISG  528
             IFA+GSS + AD FDYGGGIVNP  A DPGL+YDM   DY  YLC+ GYN+S I +    
Sbjct  590   IFAEGSSRKLADPFDYGGGIVNPEKAADPGLIYDMGTQDYILYLCSAGYNDSSISQL---  646

Query  527   NRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSP  348
                   T + T C   RPS+LD+NLPS+ +P+L   VTL RTVTNVG  +SVYK +V+ P
Sbjct  647   ------TGKVTACSNPRPSVLDVNLPSITIPNLKDEVTLTRTVTNVGLADSVYKVVVEPP  700

Query  347   VGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
             +G  V V P+ L F+  +    FT+RVS    +N+ F FGSL W+D +HNV  P++VR  
Sbjct  701   LGIRVAVTPETLVFNTKKISVPFTVRVSTTHKINTGFYFGSLMWTDSMHNVTIPVSVRTQ  760

Query  167   IVPLY  153
             ++  Y
Sbjct  761   LLQNY  765



>ref|XP_011038010.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Populus 
euphratica]
Length=704

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/731 (47%), Positives = 458/731 (63%), Gaps = 52/731 (7%)
 Frame = -3

Query  2276  MVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPG  2097
             MVYSY++GF GFAA LT SQA+KVA + GVV V+ +  H++QTSRSWDFLGLS  A+ P 
Sbjct  1     MVYSYKHGFYGFAAKLTESQAQKVAELPGVVRVIPNSLHRLQTSRSWDFLGLS--AHSPA  58

Query  2096  ELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNR  1917
               L  ++ GDG+I+GV+D+GI  E  +F D G+GP+P  WKG C +  G RF     CN+
Sbjct  59    NTLHNSSMGDGVIIGVLDTGIWPEAKAFSDKGLGPIPSHWKGVCES--GKRFKAKRHCNK  116

Query  1916  KVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDV  1737
             K+IGARWF +G L      LN     + +S  D  GHG+  AS  AG+F+ N +  G+  
Sbjct  117   KIIGARWFVEGFLAEYGQPLNTSGNREFFSPRDANGHGTHTASTAAGTFIDNVSYRGLAH  176

Query  1736  GMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLAS  1557
             G +RGGA  AR+A YK CWN+   +  C+ AD+L A D AIHD VDV+S+S+GS +PL S
Sbjct  177   GTIRGGAPRARLAIYKVCWNVLGGQ--CSSADILKAFDEAIHDGVDVLSLSIGSSIPLFS  234

Query  1556  DMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTIT  1377
             D++  +GI  GSFHA+ +GI V+  A N GP A T+ N  PW++TVAAS++DR F   IT
Sbjct  235   DIDERDGIATGSFHAVAKGITVVCGAANDGPFAQTVQNTAPWILTVAASSMDRAFPTPIT  294

Query  1376  LGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLM---PRKLDP-------------AE  1245
             LGN + +        G A+     ++GK +G   L+    + L+P             + 
Sbjct  295   LGNNKTFL-------GQAI-----YSGKEIGFRSLIYPEAKGLNPNSAGVCQFLSVDNSM  342

Query  1244  VKGKIVFMFGD-DLDRNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDA  1071
             V GK+V  F   +L   +   +   +AG VG+I + NPS  ++L       P V+VDY+ 
Sbjct  343   VAGKVVLCFTSMNLGAVISASEVVKEAGGVGLIVAKNPS--EALYPFTDGFPCVEVDYEI  400

Query  1070  GTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDK  891
             GTRI  YI +ST +P  +LS  K  VG+ +  KV  FSSRGP+S AP I+KPDIAAPG  
Sbjct  401   GTRILFYI-RSTRSPVVKLSPSKTIVGKPVLAKVARFSSRGPNSNAPAILKPDIAAPGVN  459

Query  890   IMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSD  723
             I+ A    D   D G+ + SGTS A PH+S I ALLK  HP+WSPAAIKSA VTTAW ++
Sbjct  460   ILAATSPLDRFQDSGYVMHSGTSMATPHISGITALLKAMHPDWSPAAIKSAFVTTAWINN  519

Query  722   TYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIY  543
                 PIFA+GS L+ AD FDYGGGI NPN A  PGLVYDM   DY  YLCA+ YNN+ I 
Sbjct  520   PSGFPIFAEGSPLKLADPFDYGGGIANPNGAAHPGLVYDMGSDDYVNYLCAMDYNNTAIS  579

Query  542   KTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKA  363
             +          T + T+CP   PS+L++NLPS+ +P+L   VTL RTVTN G  NS+Y+ 
Sbjct  580   RL---------TGKPTVCPTEGPSILNINLPSITIPNLRNSVTLTRTVTNAGASNSIYRV  630

Query  362   IVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPI  183
             ++++P    V+V+P VL F+   KK +F++ V+    VN+ + FGS+TW DGVH VR+P+
Sbjct  631   VIEAPFCCSVSVEPHVLVFNHTTKKNTFSVTVNTTYQVNTGYFFGSITWIDGVHTVRSPL  690

Query  182   AVRKMIVPLYL  150
             +VR  I   Y+
Sbjct  691   SVRTEISQPYI  701



>ref|XP_010436973.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=758

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/761 (46%), Positives = 478/761 (63%), Gaps = 49/761 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG   HDD     +SH+ LL  ++GS +    ++VYSYR+GFSGFAA LT SQA
Sbjct  29    KVYVVYLGKMTHDDPESATDSHHHLLWPLLGSKKAVHDSIVYSYRHGFSGFAAKLTESQA  88

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V  +  +++ T+R+WD+LGLS G +    LL K N G  +IVGV+DSG+
Sbjct  89    QQISELPEVVQVTPNTLYELTTTRTWDYLGLSPGNS--ESLLHKANMGSPVIVGVIDSGV  146

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C  + G  FN S  CNRK+IGA++F  G L++++  LN
Sbjct  147   WPESEMFNDKGYGPIPSRWKGGC--VSGELFNASIHCNRKLIGAKYFVDG-LVAENGVLN  203

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D +GHG+ VAS + GSF+PN +   +  G VRGGA    +A YKACW  
Sbjct  204   TKENPEYVSPRDFSGHGTHVASTIGGSFLPNVSYSRLGRGTVRGGAPGVFLAIYKACW--  261

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                +  C+ ADLL AID AIHD VDV+S+S+GS VPL  + +      +G FHA+ +GI 
Sbjct  262   --FQMGCSNADLLKAIDEAIHDGVDVLSLSLGSGVPLNLETDVRLFFAMGLFHAVEKGIH  319

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP+A TI NV PW++TVAA+T+DR F   ITLGN           N T L  
Sbjct  320   VVASAGNNGPAAQTIGNVAPWILTVAATTLDRSFPTAITLGN-----------NITILGQ  368

Query  1313  PLHFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLD-RNLVLVDKAT---DAGAV  1158
              + FAG  +    L       KL    ++GK+V  F  D++ R+ V+ +  T   +AG +
Sbjct  369   AI-FAGPELSFVGLTYSGDCAKLSANPMEGKVVLCFTADINPRSRVVTNARTAVKNAGGL  427

Query  1157  GVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRAL  981
             GVI + NP  V+  P  N   P V VD++ GT I  YI +ST++P A++ +P+  V   +
Sbjct  428   GVIIARNPRPVN--PTHN--FPCVTVDFELGTDILFYI-RSTISPMAKIHAPRTFVSHPV  482

Query  980   TPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTS---DGGFRISSGTSHAAPHVS  813
               KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P S   DGGF + SGTS A P V+
Sbjct  483   ATKVASFSSRGPNSISPMILKPDIAAPGVNILAAISPNSSINDGGFAMMSGTSMATPVVT  542

Query  812   AIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNA  633
              +V LL+  +P WSP+AIKSA+VTTAW +D    PIFA GS+ + AD FDYGGG+VNP  
Sbjct  543   GVVVLLRSLYPHWSPSAIKSAIVTTAWKTDPSGEPIFADGSNRKLADPFDYGGGLVNPEK  602

Query  632   ADDPGLVYDMRGIDYAQYLCA-LGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLN  456
             A  PGL+YDM   DY  YLC+   YN++ I + + GN+        T+CP  +PS+LDLN
Sbjct  603   AARPGLIYDMTIDDYVSYLCSTYNYNDASISQVL-GNK--------TVCPNPKPSVLDLN  653

Query  455   LPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFT  276
             LPS+ +P+L   VTL RTVTNVGP+NS+YK ++  P+G  +TV P  L+F+   K  SF 
Sbjct  654   LPSITIPNLKDEVTLTRTVTNVGPLNSIYKVMIDPPIGISMTVTPHTLQFNSTTKIVSFK  713

Query  275   MRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             +RVS    VN+ + FGSLTW+D +HNV  P++VR  I+  Y
Sbjct  714   VRVSTRHKVNTGYYFGSLTWTDNLHNVVIPVSVRTQILERY  754



>ref|XP_010449025.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=775

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/760 (45%), Positives = 469/760 (62%), Gaps = 53/760 (7%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             IYIVYLG + HDD   +  SH+ +L  ++   E+A  +M+YSY++GFSGFAA+LT+SQAK
Sbjct  47    IYIVYLGKREHDDPELVTASHHQMLESLLQFKEDAHNSMIYSYQHGFSGFAALLTSSQAK  106

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLS--------EGANVPGELLRKTNKGDGMIV  2055
             +++    V+ V+ ++  K++T+R+WD LGLS           +V G LL  TN G   I+
Sbjct  107   EISEHPAVIHVIPNRILKLKTTRTWDHLGLSPIPTSFSSSSLSVKG-LLHDTNMGSEAII  165

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             GV+DSGI  E     D G+GP+P+RW+G C   PG +FN +  CN K+IGA+++  G L 
Sbjct  166   GVIDSGIWPESKVVNDQGLGPIPKRWRGKCE--PGEQFNATIHCNNKLIGAKYYLNGLLA  223

Query  1874  SQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVAS  1695
             +     N+ ++ D  S  D  GHG+  A+I  GSFVPN +  G+  GMVRGGA  AR+AS
Sbjct  224   AVAGKFNRTIIQDFKSTRDANGHGTHTATIAGGSFVPNVSFYGLAGGMVRGGAPRARIAS  283

Query  1694  YKACWNLDPERF-----VCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIG  1530
             YKACWN+  +        C  AD+  A D AIHD VDV+SVS+G  +P   D E +    
Sbjct  284   YKACWNIMGDEGGRTEGRCTSADMWKAFDDAIHDGVDVLSVSIGGSIP--EDSEVDKLDY  341

Query  1529  IGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAV  1350
             I +FHA+ +GI V+ AAGN GP A T+ NV PW++TVAA+T+DR F   ITLGN +    
Sbjct  342   IAAFHAVAKGITVVAAAGNEGPGAQTVDNVAPWLLTVAATTLDRSFPTKITLGNKQTLMA  401

Query  1349  DWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD  1170
             +  L  G  +S  L F         L     D  +VKGK V +F +    +  ++ K  D
Sbjct  402   E-SLFTGPEISTGLAF---------LDVHSDDNVDVKGKTVLVFHN----SFAIIGK--D  445

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
               AV ++   P+  D L   N  +  +  DY+ GT I  YI ++T +PT ++S+     G
Sbjct  446   VAAV-ILAQKPN--DLLSRCNG-LHCIYADYELGTDILKYI-RTTRSPTVRISAATTLTG  500

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAP  822
             +  T KV  FS RGP+S +P I+KPDIAAPG  I+ A    D     GF++ SGTS A P
Sbjct  501   QPATAKVAGFSCRGPNSVSPAILKPDIAAPGVSILAASSPLDLEQHNGFKLDSGTSMATP  560

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              VS I+ALLK  HP WSPAAI+SALVTTAW +     PIFA+GS+ + AD FDYGGG+VN
Sbjct  561   VVSGIIALLKSLHPNWSPAAIRSALVTTAWRTSPSGEPIFAEGSNKKLADPFDYGGGLVN  620

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A  PGLVYDM   DY  Y+C+ GYN+S I + + G +N+        CP   PS+LD
Sbjct  621   PEKAAKPGLVYDMGIKDYINYMCSAGYNDSSISRVL-GKKNK--------CPTPEPSILD  671

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK-R  285
             +NLPS+ +P+L K VTL+RTVTNVGP+ SVYKA+++SP+G  +TVKP  L F+    +  
Sbjct  672   INLPSITIPNLEKEVTLKRTVTNVGPIKSVYKAVIESPLGITLTVKPTTLVFNSAANRVL  731

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             +F+++      VNS + FGSLTW+DGVHNV  P++V+  I
Sbjct  732   TFSVQAKTSHKVNSGYFFGSLTWTDGVHNVTIPVSVKTKI  771



>ref|NP_567633.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AAO00797.1| subtilisin proteinase - like [Arabidopsis thaliana]
 gb|AEE84485.1| Subtilase family protein [Arabidopsis thaliana]
Length=766

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/763 (44%), Positives = 470/763 (62%), Gaps = 58/763 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YIVYLG + HDD   +  SH+ +L  ++ S E+A+ +++YSY++GFSGFAA+LT+SQA
Sbjct  40    KVYIVYLGEREHDDPELVTASHHQMLESLLQSKEDAQNSLIYSYQHGFSGFAALLTSSQA  99

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLS-------EGANVPGELLRKTNKGDGMIV  2055
             KK++    V+ V+ ++  K++T+R+WD LGLS         ++V G LL  TN G   I+
Sbjct  100   KKISEHPEVIHVIPNRIRKLKTTRAWDHLGLSPIPTSFSSLSSVKG-LLHDTNLGSEAII  158

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             GV+DSGI  E  +  D G+GP+P+RW+G C   PG +FN +  CN K+IGAR++  G + 
Sbjct  159   GVIDSGIWPESKAVNDQGLGPIPKRWRGKCE--PGEQFNATIHCNNKLIGARYYLNGVVA  216

Query  1874  SQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVAS  1695
             +     N+ ++ D  S  D  GHG+  A+I  GSFVPN +  G+  G+VRGGA  AR+AS
Sbjct  217   AIGGKFNRTIIQDFQSTRDANGHGTHTATIAGGSFVPNVSYFGLAQGLVRGGAPRARIAS  276

Query  1694  YKACWNLDPERF-----VCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIG  1530
             YKACWN+  +        C  AD+  A D AIHD VDV+SVS+G  +P   D E +    
Sbjct  277   YKACWNVMRDEGGGTDGRCTSADMWKAFDDAIHDGVDVLSVSIGGGIP--EDSEVDKLDY  334

Query  1529  IGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAV  1350
             I +FHA+ +GI V+ AAGN GP A T+ NV PW++TVAA+T+DR F   ITLGN +    
Sbjct  335   IAAFHAVAKGITVVAAAGNEGPGAHTVDNVAPWLLTVAATTLDRSFPTKITLGNNQTLFA  394

Query  1349  DWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT-  1173
             +  L  G  +S  L F         L     D  +VKGK V +F           D AT 
Sbjct  395   E-SLFTGPEISTGLAF---------LDSDSDDTVDVKGKTVLVF-----------DSATP  433

Query  1172  --DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
                 G   VI +   + D L   N  +P +  DY+ GT I  YI ++T +PT ++++   
Sbjct  434   IAGKGVAAVILAQKPD-DLLSRCNG-VPCIFPDYEFGTEILKYI-RTTRSPTVRITAATT  490

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSH  831
               G+  T KV  FS RGP+S +P I+KPDIAAPG  I+ A    +P    GF + SGTS 
Sbjct  491   LTGQPATTKVAAFSCRGPNSVSPAILKPDIAAPGVSILAAISPLNPEEQNGFGLLSGTSM  550

Query  830   AAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGG  651
             + P VS I+ALLK  HP+WSPAA++SALVTTAW +     PIFA+GS+ + AD FDYGGG
Sbjct  551   STPVVSGIIALLKSLHPKWSPAAVRSALVTTAWRTSPSGEPIFAEGSNKKLADPFDYGGG  610

Query  650   IVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
             +VNP  A  PGLVYDM  +DY +Y+C+ GYN+S I + +    N         CP  +PS
Sbjct  611   LVNPEKAAKPGLVYDMGIVDYIKYMCSAGYNDSSISRVLGKKTN---------CPIPKPS  661

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
             MLD+NLPS+ +P+L K VTL RTVTNVGP+ SVY+A+++SP+G  +TV P  L F    K
Sbjct  662   MLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTTLVFKSAAK  721

Query  290   K-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             +  +F+++      VN+ + FGSLTWSDGVH+V  P++V+  I
Sbjct  722   RVLTFSVKAKTSHKVNTGYFFGSLTWSDGVHDVIIPVSVKTTI  764



>emb|CDX94043.1| BnaC07g36770D [Brassica napus]
Length=773

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/761 (44%), Positives = 464/761 (61%), Gaps = 51/761 (7%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIVYLG + +DD   +  SH+ +L   + S E+A K+M+YSY++GFSGFAA+LT+SQA 
Sbjct  43    VYIVYLGERENDDPELVTASHHQMLESFLDSKEDAHKSMIYSYQHGFSGFAALLTSSQAN  102

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSE--------GANVPGELLRKTNKGDGMIV  2055
             K++    V+ V+ ++  K+QT+R+WD L LS+          +V G LL  TN G   I+
Sbjct  103   KISDHPEVIHVIPNRILKLQTTRTWDLLDLSQIPTSFSSSTTSVKG-LLHDTNMGSEAII  161

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             GV+D+GI  E   F D G+GP+P+RW+G C   PG +FN +  CN+K+IGA+++  G L 
Sbjct  162   GVIDTGIWPESKVFNDQGLGPIPKRWRGKCE--PGEKFNATIHCNKKLIGAKYYVNGLLA  219

Query  1874  SQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVAS  1695
                       V +  S  D  GHG+  A+I  GS VPN +  G+  G VRGGA  AR+AS
Sbjct  220   EMGETFKTTTVREFKSNRDALGHGTHTATIAGGSLVPNVSFYGLARGTVRGGAPRARIAS  279

Query  1694  YKACWNLDPERFV-----CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIG  1530
             YK CWN   +        C+ AD+  A D AIHD VDV+SVS+   +P   D E +    
Sbjct  280   YKVCWNTMQKDGTGPGGSCSTADMWKAFDDAIHDGVDVLSVSISGDLP--EDTEVDKPDF  337

Query  1529  IGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAV  1350
             +G+FHA+++GIPV+ AA N GP A T+ N  PW++TVAA+T+DR F   ITLGN +    
Sbjct  338   VGAFHAVSKGIPVVAAASNEGPKAQTVANAAPWLLTVAATTLDRSFPTKITLGNKQTLFG  397

Query  1349  DWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD  1170
             +  L  G  +S  L +     G         + A+VKGKIV +F  D      +  K   
Sbjct  398   E-SLFTGPEISTGLAYWDSESG---------NNADVKGKIVLVF--DTTSTYPVETK---  442

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
              G  GVIY+   + D +       P +  DYD GT I  YI ++T +PTA++S+     G
Sbjct  443   -GVAGVIYAQ--HPDDIVDRCHAFPCIYTDYDLGTDILQYI-RTTRSPTARISAATTLTG  498

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAP  822
                T KV +FSSRGP+S +P I+KPDIAAPG  I+ A    DP    GF + SGTS   P
Sbjct  499   LPATTKVAEFSSRGPNSVSPAILKPDIAAPGVSILAALSPSDPNGHDGFGLDSGTSMVTP  558

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              VS I+ALLK  HP+WSPAA +SALVTTAW +     PIFA+GS+ + AD FDYGGG+VN
Sbjct  559   VVSGIIALLKSLHPDWSPAAFRSALVTTAWRTSPSGEPIFAEGSNKKLADPFDYGGGLVN  618

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A DPGLVYDM   DY  Y+C+ GYN+S I + +          + T CP  +PS+LD
Sbjct  619   PQRAADPGLVYDMGIEDYINYMCSKGYNDSSISRVLG---------KKTKCPTPKPSILD  669

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK-R  285
             +NLPS+ +P++ K VTL R+VTNVGP+ SVYKA+++SP+G  +TV P  L F    KK  
Sbjct  670   MNLPSITIPNIEKEVTLTRSVTNVGPIKSVYKAVIESPLGITLTVNPTTLVFSSEDKKVL  729

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             SFT++      VN+ + FGSLTW+DGVH+V+ P++V+  I+
Sbjct  730   SFTVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQTRIM  770



>ref|XP_002874634.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50893.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=781

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/763 (45%), Positives = 478/763 (63%), Gaps = 36/763 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + +SH+ +L  ++GS E+A  +MV+SYR+GFSGFAA LT SQA
Sbjct  35    KVHIVYLGEKQHDDPEFVTKSHHRMLWSLLGSKEDAHNSMVHSYRHGFSGFAAKLTKSQA  94

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V  D  +++ T+R+WD+LGLS  AN P  LL  TN G+ +I+GVVDSG+
Sbjct  95    KKLADLPEVVHVTPDSFYELATTRTWDYLGLSV-AN-PKNLLNDTNMGEEVIIGVVDSGV  152

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+GPVP  WKG C +  G  F  S  CN+K+IGA++F  G L + +   N
Sbjct  153   WPESEVFKDNGIGPVPSHWKGGCES--GENFT-SFHCNKKLIGAKYFINGFLATHE-SFN  208

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D +GHG+ VA+I  GS + N +  G+  G VRGGA  AR+A YKACW L
Sbjct  209   STESLDFISPRDHSGHGTHVATIAGGSPLHNISYKGLAGGTVRGGALRARIAMYKACWYL  268

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D  +   C+ ADLL A+D A+HD VDV+S+S+GS +P  S+ +A   I  G+FHA+ +GI
Sbjct  269   DNLDITTCSSADLLKAMDEAMHDGVDVLSLSIGSRLPYFSETDARAVIATGAFHAVLKGI  328

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ + GN+GP+  T+ N  PW++TVAA+T+DR F   ITLGN  K  +   +  G  L 
Sbjct  329   TVVCSGGNSGPAGQTVGNTAPWILTVAATTLDRSFPTPITLGN-NKVILGQAMYTGPELG  387

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVL--VDKATDA  1167
                     +P +    + G+ +L+    +   + GK+V  F        V   V    +A
Sbjct  388   FTSLVYPENPGNSNESFFGDCELLFFNSN-RTMAGKVVLCFTTSKRYTTVASAVSYVKEA  446

Query  1166  GAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             G +G+I + NP   D+L       P V VDY+ GT I  YI +ST +P  ++   K   G
Sbjct  447   GGLGIIVARNPG--DNLSPCVDDFPCVAVDYELGTDILFYI-RSTGSPVVKIQPSKTLFG  503

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTS----DGGFRISSGTSHAAP  822
             + +  KV DFSSRGP+S  P I+KPDIAAPG  I+ A  T+    D GF ++SGTS AAP
Sbjct  504   QPVGTKVADFSSRGPNSIEPAILKPDIAAPGVSILAATSTNKTFNDRGFIMASGTSMAAP  563

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S +VALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+VN
Sbjct  564   VISGVVALLKAMHRDWSPAAIRSAIVTTAWRTDPFGEQIFAEGSPRKLADPFDYGGGLVN  623

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A  PGLVYD+   DYA Y+C++GYN + I + +          + T+C   +PS+LD
Sbjct  624   PEKAAKPGLVYDLGLEDYALYMCSVGYNETSISQLVG---------KGTVCSNPKPSVLD  674

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
              NLPS+ +P+L + VTL +T+TNVGPV SVYK +++ P+G VVTV P+ L F+   K+ S
Sbjct  675   FNLPSITIPNLKEEVTLTKTLTNVGPVESVYKVVIEPPLGVVVTVTPETLVFNSTTKRVS  734

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F +RVS    +N+ + FGSLTWSD +HNV  P++VR  ++  Y
Sbjct  735   FKVRVSTKHKINTGYFFGSLTWSDSLHNVTIPLSVRTQLMQNY  777



>ref|XP_010554964.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=762

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/746 (45%), Positives = 463/746 (62%), Gaps = 32/746 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IVY+G + H+D   +  SH+ +L  V GS + ARK+M+YSYR+GFSGFAA L +SQ 
Sbjct  41    KIHIVYMGARRHEDPDLVTASHHRILELVFGSKDAARKSMIYSYRHGFSGFAATLNSSQV  100

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++    V  V  ++  +++T+RS++++GL   A  P  LL+ TN G   I+GV+DSGI
Sbjct  101   KILSEHPEVAHVAPNRILQLKTTRSFEYMGLLPSA--PKGLLQDTNMGSEAIIGVLDSGI  158

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D  +GP+P+RWKG C A  G  F+  +LCNRK+IGAR++ +  L   +   N
Sbjct  159   WPESESFNDKDVGPIPKRWKGECVA--GQGFDPEKLCNRKLIGARYYTEAILRQNNGTFN  216

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D   HG+ VA+  AGSFVP A+  G+  G  RGGA  +RVA+YK CWN 
Sbjct  217   YAQNKEYASARDGLAHGTHVAATAAGSFVPGASWKGLAGGTARGGAPRSRVAAYKVCWN-  275

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEA-ENGIGIGSFHAITRGI  1497
                R  C G+D++ AID AI D VDVIS+S+G+ +P  +D E  +N IGI SFHA+ +GI
Sbjct  276   ---RQGCPGSDMIKAIDDAIRDGVDVISISIGNAIP--NDFEVDQNDIGIASFHAVMKGI  330

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ AAGN GP   T+ NV PW+ITVAAS++DR F  ++TLGN            G    
Sbjct  331   PVVCAAGNEGPDPQTVDNVAPWIITVAASSMDRSFPVSVTLGNNLTITA-----RGVYTG  385

Query  1316  HPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMF-GDDLDRNLVLVDKATDAGAVGVIYSN  1140
               + F     G  +L    +    VKGK+V  F   +  R  + +   +     G+I + 
Sbjct  386   KEVGFVDLVFG-GELQGSDIRGGSVKGKVVLFFTATERARERMRLLMMSTGACAGIIMAE  444

Query  1139  PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDF  960
              S VD  P  +  +P V VDY+ GT I  YI Q+T  P  ++S+ K  VGR +  K+P F
Sbjct  445   -SVVDPTPCRD--MPCVGVDYELGTDILYYI-QTTANPKVKISASKTVVGRPIATKIPQF  500

Query  959   SSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD-GGFRISSGTSHAAPHVSAIVALLKISH  783
             S RGP+S +P I+KPDIAAPG  I+ A   S+   F + +GTS + P VS IVALLK+ H
Sbjct  501   SCRGPNSLSPAILKPDIAAPGVNILAASTGSNPRTFDLMTGTSMSTPAVSGIVALLKVKH  560

Query  782   PEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDM  603
             P+WSPAAI+SALVTTAW +D +   I  +G+S + A  FD+GGGI+NP  A  PGLVYDM
Sbjct  561   PDWSPAAIRSALVTTAWRTDPFGETIMTEGASPKPAGPFDFGGGIMNPERAAYPGLVYDM  620

Query  602   RGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFK  423
                DY  YLC+ GY++    K ISG   ++ T     CP  +PSMLD+NLPS+ VPDL +
Sbjct  621   GYEDYVHYLCSAGYDD----KAISGLLGKAHT-----CPNPKPSMLDVNLPSITVPDLRE  671

Query  422   PVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNS  243
              V + RTVTNVGP +SVYKA+++SP G  + V P+ L F+   KK +F ++VS+   VN+
Sbjct  672   DVVITRTVTNVGPADSVYKAVIESPSGINLEVNPQSLVFNSATKKVTFKVKVSSTHKVNT  731

Query  242   AFTFGSLTWSDGVHNVRTPIAVRKMI  165
              F FGSLTW+DG  NV  P++VR  I
Sbjct  732   EFYFGSLTWTDGTTNVTIPLSVRTKI  757



>ref|XP_007039328.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY23829.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=776

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/768 (44%), Positives = 476/768 (62%), Gaps = 31/768 (4%)
 Frame = -3

Query  2417  KVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFA  2238
             K ++     ++IVY+G K H D    K SH+ +L+ ++GS E A+ +M+YSY++GFSGFA
Sbjct  26    KCVEAAKSNVHIVYMGEKKHQDPATTKMSHHKMLSTLLGSKEAAKNSMLYSYKHGFSGFA  85

Query  2237  AVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMI  2058
             A LT SQA+++A   GVV V+ ++ H++ T+RSW+F+GL   ++    LL ++N G+G I
Sbjct  86    ARLTESQAEEIAAFPGVVHVIPNRIHRLHTTRSWEFMGLKYHSS--KNLLTQSNMGEGTI  143

Query  2057  VGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGAL  1878
             +GV+DSG+  E  SF D GMGP+P RWKG+C+   G  FN S  CN+K+IGARWF KG L
Sbjct  144   IGVIDSGVWPESESFNDRGMGPIPSRWKGTCQ--EGQLFNSSN-CNKKLIGARWFIKGIL  200

Query  1877  LSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVA  1698
                   +N     +  S  D +GHG+  AS  AG+FV NA   G+  G+ RGGA  A +A
Sbjct  201   DQIQTPINISNGEEFLSARDNSGHGTHTASTAAGNFVQNANYEGLAAGLARGGAPRAHLA  260

Query  1697  SYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSF  1518
              YKACW+   E   C  AD+L A D AI D VD++SVSVG+ +PL S ++  N I IGSF
Sbjct  261   VYKACWSF--ESGGCTDADILKAFDKAIQDGVDILSVSVGNSIPLYSYVDQRNSIAIGSF  318

Query  1517  HAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---AVD  1347
             HA  +GI V  +AGN GP+A TI N  PW+I VAA+T+DR FA  ITLGN       +VD
Sbjct  319   HATAKGITVACSAGNDGPTAMTIENTAPWIINVAATTVDRAFATAITLGNNLTLWGQSVD  378

Query  1346  WQLPN----GTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVD-  1182
               + N    G   S  +          D  P  L+     GKI+  F     +++     
Sbjct  379   TGIHNHGFTGITFSDRIAANSSDDSAQDCQPGSLNATLAAGKIILCFAQSSIQDISSAAI  438

Query  1181  KATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
                +AG VG+I++   + D L   +  IP ++VDY+ GT+I  YI +   +P A+LS PK
Sbjct  439   SVLEAGGVGLIFAQYRS-DGLGSCH-HIPCIKVDYEVGTQILSYI-RKARSPMAKLSIPK  495

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTS  834
               +G+ + P+V DFS+RGPSS +P ++KPDIAAPG  I+ A          G++  SGTS
Sbjct  496   TVIGKWIYPRVADFSARGPSSISPAVLKPDIAAPGVDILAAYIPVGKEKSSGYKFMSGTS  555

Query  833   HAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGG  654
              + PHV+ I AL+K  H  WSPAAI+SALVTTA  + T  S I  +GS+ +AAD FD GG
Sbjct  556   MSCPHVAGIAALIKSVHKNWSPAAIRSALVTTASQTRTDGSNIAEEGSTRKAADPFDIGG  615

Query  653   GIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRP  474
             G+VNPN A +PGL+YD    DY Q+LC  GY++    K ++G      T+    C K+R 
Sbjct  616   GLVNPNKAVNPGLIYDAGIEDYVQFLCGTGYSS----KAVTG-----LTQTQVNCTKSRL  666

Query  473   SMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNR  294
             ++L+LNLPS+ +P+L + VT+ R VTNVGPV+SVYKAI+++P G  + V+P++L F+   
Sbjct  667   NVLNLNLPSITIPNLKRKVTVTRAVTNVGPVDSVYKAIMQAPQGIKLKVEPQILSFNKTT  726

Query  293   KKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             +   F +   + + V+  + FGSL+W+DG H VR+PI+VR ++   Y+
Sbjct  727   QILPFKVTFFSTRKVSGDYRFGSLSWTDGKHIVRSPISVRAILFESYV  774



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/763 (46%), Positives = 467/763 (61%), Gaps = 58/763 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD + + ESH+ +L+ ++GS  EA  +MV+SYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPKHVTESHHQMLSSLLGSEVEAHDSMVHSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    VV V+ D  +++ T+R+WD+LGLS   + P  LL  TN GD +I+G +DSG+
Sbjct  88    KKIADSPDVVHVIPDSFYELATTRTWDYLGLS--VSNPKNLLNDTNMGDQVIIGFIDSGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GPVP  WKG C++  G  F  +  CNRK+IGA++F  G  L+++   N
Sbjct  146   WPESESFNDNGVGPVPSHWKGECQS--GENFMSTN-CNRKLIGAKYFING-FLAENEGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VASI  GSFVPN +  G+  G +RGGA  AR+A YKACW +
Sbjct  202   STGSRDYISARDFIGHGTHVASIAGGSFVPNVSYKGLAGGNLRGGAPRARIAIYKACWYV  261

Query  1673  DPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D    V C+ +D+L A+D A+HD VDV+S+S+G+ VPL         I  G+FHA+ +GI
Sbjct  262   DQLGAVACSSSDILKAMDEAMHDGVDVLSLSLGAQVPL---------IATGAFHAVAKGI  312

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG----  1329
              V+ A GN+GP+A T+ N  PWVITVAA+T+DR F   ITLGN     +   L  G    
Sbjct  313   IVVCAGGNSGPAAQTVLNTAPWVITVAATTLDRSFLTPITLGN-NNVILGQALYTGPEVG  371

Query  1328  -TALSHPLHFAGKYMGEADLMPR-KLDP-AEVKGKIVFMFGDDLDRNLVLVDKATD----  1170
              T+L +P +     +  + +  R  L+P   ++GK+V  F          V +A      
Sbjct  372   FTSLVYPENSGHSNVTFSGVCERLNLNPNGTMRGKVVLCF--TTATLFTAVSRAASYVKA  429

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             AG VGVI +     +  P  +   P V +DY+ GT I  YI +ST +P  ++   +  VG
Sbjct  430   AGGVGVIIARNPGYNLTPCRD-DFPCVAIDYELGTDILLYI-RSTGSPVVKIQPSRTMVG  487

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISSGTSHAAP  822
             + +  KV  FSSRGP+S +P I+KPDI APG  I+ A      +S GGF I +GTS AAP
Sbjct  488   QPVGTKVATFSSRGPNSISPAILKPDIGAPGVSILAATSPDSNSSAGGFDILAGTSMAAP  547

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S +VALLK  HP+WSPAAIKSA+VTTAW +D +   IFA+GSS + AD FDYGGG+VN
Sbjct  548   VISGVVALLKAMHPDWSPAAIKSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDYGGGLVN  607

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A DPGL+YDM   DY  YLC+                        T+C   +PS+LD
Sbjct  608   PEKAADPGLIYDMGPKDYILYLCS----------------------AVTVCSNPKPSVLD  645

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             +NLPS+ +P+L + V L RTVTNVGPVNSVYK +V+ P+G  V V PK L F+   K  S
Sbjct  646   VNLPSLTIPNLKEEVNLTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKSLS  705

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F +RVS    +N+ F FGSL W D VHNV  P++VR  I+  Y
Sbjct  706   FMVRVSTIHKINTGFYFGSLIWRDSVHNVTIPVSVRTQILQNY  748



>gb|KFK31853.1| hypothetical protein AALP_AA6G166900 [Arabis alpina]
Length=787

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/765 (45%), Positives = 474/765 (62%), Gaps = 40/765 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L  ++GS E+AR +MVYSYR+GFSGFAA LT SQA
Sbjct  41    KVHIVYLGEKQHDDPEFVTESHHQMLWSLLGSKEDARDSMVYSYRHGFSGFAAKLTKSQA  100

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A + GVV V+    +K+ T+R+WD+LGLS  A  P  LL +TN G+ MI+G++D+G+
Sbjct  101   KKLADLPGVVHVIPHSFYKLSTTRTWDYLGLS--AANPKNLLNETNMGEQMIIGIIDTGV  158

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+GPVP  WKG C +  G  FN S  CN+K+IGA++F    + S +   N
Sbjct  159   WPESEVFNDNGIGPVPSHWKGGCES--GEMFNSSH-CNKKLIGAKYFINAFIASHE-SFN  214

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VA+I  GS+VPN +  G+  G VRGGA  AR+A YKACW L
Sbjct  215   STESLDFISPRDFDGHGTHVATIAGGSYVPNISYKGLAGGTVRGGAPHARIAMYKACWYL  274

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D  +   C+ AD+L A+D A+HD VDV+S+S+GS VP+  + +  +GI  G+FHA+ +GI
Sbjct  275   DNLDITTCSSADILKAMDEAMHDGVDVLSISLGSDVPMYPETDVRDGITTGAFHAVLKGI  334

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ + GN GP A T+TN  PW++TVAA+T+DR FA  ITLGN  K  +   L  G  L 
Sbjct  335   TVVCSGGNDGPEAQTVTNTAPWIVTVAATTLDRSFATPITLGN-SKAILGQALYTGPELG  393

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMF-----GDDLDRNLVLVDKA  1176
                     +P +    + G  + +    +   + GK+V  F        + R    V +A
Sbjct  394   FTSLVYPENPGNSNESFSGTCEFLDFNSN-RTMAGKVVLCFTTSPYSGSVSRAARYVKRA  452

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
                G +GVI +        P L+   P V VDY+ GT I  YI +S+ +P  ++   K  
Sbjct  453   ---GGLGVIIAKHPGYALRPCLD-DFPCVSVDYELGTDILLYI-RSSGSPVVKIQPSKTL  507

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTS----DGGFRISSGTSHA  828
             +G+ +  KV  FSSRGP+S +  I+KPDIAAPG  I+ A  T+    D GF + SGTS A
Sbjct  508   IGQPVGTKVATFSSRGPNSISAAILKPDIAAPGVSILAATNTNTTFNDRGFIMLSGTSMA  567

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
             AP +S +VALLK  + +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+
Sbjct  568   APVISGVVALLKSLNRDWSPAAIRSAIVTTAWRTDPFGEQIFAEGSPRKLADPFDYGGGL  627

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VNP  A  PGLVYD+   DY  Y+C+  YN S I + +          + T+C   +PS+
Sbjct  628   VNPEKAAKPGLVYDLGLEDYVLYMCSAAYNESSISQLVG---------KGTVCSNPKPSV  678

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD NLPS+ +P+L + VTL RT+TNVGP++SVYKA V+   G  VTV P+ L F+   KK
Sbjct  679   LDFNLPSITIPNLKEDVTLTRTLTNVGPLDSVYKASVELLSGVQVTVTPETLVFNSTTKK  738

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SF ++VS    +N+ + FGSLTWSD VHNV  P++VR  I+  Y
Sbjct  739   VSFKVKVSTTHKINTGYYFGSLTWSDSVHNVTIPLSVRTQILQNY  783



>ref|NP_564869.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAG51764.1|AC066691_4 subtilisin-like protein; 10849-13974 [Arabidopsis thaliana]
 gb|AEE34478.1| Subtilase-like protein [Arabidopsis thaliana]
Length=753

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/748 (44%), Positives = 462/748 (62%), Gaps = 30/748 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IV+LG K HD    + +SHY +L  ++GS E A+ ++VY+Y++GFSGFAA LTASQA
Sbjct  36    KIHIVHLGAKQHDTPELVTKSHYQILEPLLGSKEAAKNSLVYNYKHGFSGFAAKLTASQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++    V+ VV  +  +++T+R++D+LGL   +  P  LL KT  G   I+GV+DSGI
Sbjct  96    KNLSAHPEVLRVVPSRVMRLKTTRTFDYLGLLPTS--PKSLLHKTKMGSEAIIGVIDSGI  153

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG C  + G  F+  + CN+K+IGA +   G +   D   +
Sbjct  154   WPESQSFNDTGLGPIPKRWKGKC--LSGNGFDAKKHCNKKLIGAEYLTVGLMEMTDGIYD  211

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                + +S S  D  GHG+ VA+I AGSFV NA   G+  G  RG A  AR+A YK CW  
Sbjct  212   YPSLGESMSPRDHVGHGTHVAAIAAGSFVANANYKGLAGGTARGAAPHARIAMYKVCW--  269

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   C  ADLL AID++I D VDVIS+S+G+  P + D++ ++ IG GSFHA+ +GIP
Sbjct  270   --REVGCITADLLKAIDHSIRDGVDVISISIGTDAPASFDID-QSDIGFGSFHAVMKGIP  326

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP+A T+ NV PW+ITVAA+++DR F   ITLGN         L  G     
Sbjct  327   VVASAGNEGPNAQTVDNVAPWIITVAATSLDRSFPIPITLGNNLTI-----LGEGLNTFP  381

Query  1313  PLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNPS  1134
              + F    + + +++ R ++  + +G IV  F  + D  +   +  T+AG  G+IY+  S
Sbjct  382   EVGFTNLILSD-EMLSRSIEQGKTQGTIVLAFTAN-DEMIRKANSITNAGCAGIIYAQ-S  438

Query  1133  NVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSS  954
              +D     +  +P   VDY+ GT I  Y  Q+T+ P A+LS  K  +GR +  +VP FS 
Sbjct  439   VIDPTVCSSVDVPCAVVDYEYGTDIL-YYMQTTVVPKAKLSPSKTLIGRPIASRVPRFSC  497

Query  953   RGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEW  774
             RGP+S +P I+KPDIAAPG  ++ A     G ++  SGTS A P VS IV LL+ +HP W
Sbjct  498   RGPNSVSPAILKPDIAAPGVNVLSA---VSGVYKFMSGTSMATPAVSGIVGLLRQTHPHW  554

Query  773   SPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGI  594
             SPAAI+SALVTTAW +D    PIF++GS+ + AD FDYGGG++NP     PGL+YDM   
Sbjct  555   SPAAIRSALVTTAWKTDPSGEPIFSEGSTRKLADPFDYGGGLINPEKVTHPGLIYDMGID  614

Query  593   DYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVT  414
             DY  YLC+  Y++  I K +    N         C   +PSMLD NLPS+ +P L   VT
Sbjct  615   DYLHYLCSAEYDDDSISKLLGKTYN---------CTSPKPSMLDFNLPSITIPSLTGEVT  665

Query  413   LRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFT  234
             + RTV NVGP  SVY+ +++SP+G  + VKPK L F  N  K +F++RV +   VN+ F 
Sbjct  666   VTRTVRNVGPARSVYRPVIESPLGIELDVKPKTLVFGSNITKITFSVRVKSSHRVNTDFY  725

Query  233   FGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             FGSL W+DGVHNV  P++VR   +  Y+
Sbjct  726   FGSLCWTDGVHNVTIPVSVRTKFMRNYV  753



>ref|XP_010529680.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Tarenaya 
hassleriana]
Length=707

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/731 (46%), Positives = 449/731 (61%), Gaps = 36/731 (5%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++GS E A  +MVYSYR+GFSGFAA LT  +A++++ +  VV VV D+ +++ T+R
Sbjct  1     MLCSLLGSEEAAHDSMVYSYRHGFSGFAAKLTEYEAEQISELPEVVHVVLDQFYQLTTTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             +WD+LGLS     P  LL +TN G+ +I GV+DSGI  E  S  D GMG +P RWKG C 
Sbjct  61    TWDYLGLSP--KHPKNLLYETNMGNQVIAGVIDSGIWPESESLNDKGMGSIPSRWKGGCE  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
             +  G  FN S  CNRK+IGA++F  G  ++ + DLN     +  S  D  GHG+ VA+ +
Sbjct  119   S--GQMFNPSTHCNRKLIGAKFFIDG-FIASNGDLNTTENPEYVSPKDFDGHGTHVATTI  175

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDP-ERFVCAGADLLAAIDYAIHDR  1605
             AGSFVPN T LG   G++RGGA  A +A YKACW++       C+ AD+L AID AI D 
Sbjct  176   AGSFVPNVTYLGFAGGIIRGGAPLAHIAMYKACWHVTAIGTATCSSADMLKAIDEAIKDG  235

Query  1604  VDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVI  1425
             VDVIS+S+   VPL  +++  +GI +G+FHA+ RGIPV+ A GNAGP+A TI N  PW++
Sbjct  236   VDVISISIAFSVPLFPEIDIRDGIAVGAFHAVARGIPVVCAGGNAGPAAQTIVNTAPWIL  295

Query  1424  TVAASTIDRIFAYTITLGNG-EKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPA  1248
             TVAA+T+DR F   ITLGN       +  + +G   +  ++    + G+ + +    +  
Sbjct  296   TVAATTLDRSFPTPITLGNNITILGQELYVGSGLGFTPLVYPESPFSGDCEKLSANPN-R  354

Query  1247  EVKGKIVFMFGDDLDRNLVLV--DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYD  1074
              + GK+V  F    D + V+      ++AG +GVI +   N   L +         +DY+
Sbjct  355   TMAGKVVLCFTTKTDPSAVISAGKAVSEAGGLGVIVAR--NPGHLLVPCVDFACAAIDYE  412

Query  1073  AGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGD  894
              GT I  YI            S K  VG  +  KV  FSSRGP+S  P I+KPDI+APG 
Sbjct  413   LGTDILFYI-----------RSTKTLVGPPVATKVATFSSRGPNSITPAILKPDISAPGV  461

Query  893   KIMCADPTSD----GGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNS  726
              I+ A   +D    GGF + SGTS A P VS IVALL+  HP WSPAAI+SA+VTTAW +
Sbjct  462   NILAATSLNDSLGAGGFVLKSGTSMATPVVSGIVALLRALHPNWSPAAIRSAIVTTAWKT  521

Query  725   DTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLI  546
             D    PIFA GS+ + AD FDYGGG+VNP  A DPGLVYDM   DY  Y+C++GY +  I
Sbjct  522   DPSGEPIFADGSNRKLADPFDYGGGLVNPEKATDPGLVYDMGTSDYIHYMCSVGYKDPSI  581

Query  545   YKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYK  366
                +          + TICP   PS+LDLNLPS+ +PDL   VT+ RTVTNVGP NSVYK
Sbjct  582   SLVVG---------KATICPHPNPSVLDLNLPSITIPDLSGEVTITRTVTNVGPRNSVYK  632

Query  365   AIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTP  186
              ++  P G  + V PK L F+   ++ SFT+RVS    VN+ F FGSLTW+D VHNV  P
Sbjct  633   VVIDPPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAIP  692

Query  185   IAVRKMIVPLY  153
             ++VR  I+P Y
Sbjct  693   VSVRTQILPRY  703



>ref|XP_010318061.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Solanum 
lycopersicum]
Length=764

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/751 (45%), Positives = 467/751 (62%), Gaps = 40/751 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVY+G + HDD      +H+ LL  V+GS + AR +++YSY++GFSGFAA LT SQA
Sbjct  35    KVHIVYMGRRQHDDVELATSAHHQLLTSVMGSQKAARDSIIYSYKHGFSGFAARLTKSQA  94

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV VV +   K+ T RSWD+LGLSE ++ P  LL + N GDG+I+GV+D+GI
Sbjct  95    KKIAELPDVVHVVPNHFFKLHTRRSWDYLGLSE-SSPPTNLLHEANMGDGIIIGVLDTGI  153

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG---ALLSQDV  1863
               E  +F D G+GP+P RWKG C++  G +F+ +  CNRK+IG++++ KG   A     +
Sbjct  154   WPESEAFNDKGLGPIPSRWKGHCQS--GDKFDPATACNRKLIGSKYYLKGFEAAAGRPAI  211

Query  1862  DLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
                 FL  D  S  D  GH +  +S   GSF PNA+   +  G V+GGA  AR+A YK C
Sbjct  212   KDPDFLRFDIASPRDRDGHDTHTSSTAGGSFTPNASYHRLGYGTVKGGAPKARIAMYKVC  271

Query  1682  WNLDPERFV--CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
             WN      +  C  AD + AID AIHD VD++S+S+G  +PL +D++  NGI   SFHA+
Sbjct  272   WNW----LIGGCTFADTMMAIDEAIHDGVDILSISLGLEIPLYADIDMRNGIAFASFHAV  327

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
             ++GI VI + GN GP   T+ N+ PW++TVAAS+IDR F   ITLGN + ++        
Sbjct  328   SKGITVICSGGNEGPYPQTVVNISPWILTVAASSIDRSFPTLITLGNNQTFS-------E  380

Query  1328  TALSHPLHFAGKYMGEADLMPR-KLDPAEVKGKIVFMF---GDDLDRNLVLVDKATDAGA  1161
             T      H     + +         +     GK+V  F   GD+L           + G 
Sbjct  381   TGFIGIAHQEISELEDTRFCNNLNTNDTWAAGKVVLCFIVKGDELYLPFTQ-QVVQEVGG  439

Query  1160  VGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRA  984
             +G+I + NP+    L  L    P ++V++D G+++ +YI + +  P  +L+  +  VG+ 
Sbjct  440   LGLIVAKNPTR--DLNYLTFDFPCIEVNFDVGSQLLNYI-RYSRKPQVKLNPTRTHVGQP  496

Query  983   LTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIV  804
             ++  +  FSSRGP+S AP I+KPDIAAPG  I+ A   +D  +R  SGTS AAPHVS IV
Sbjct  497   VSTHLASFSSRGPNSVAPAILKPDIAAPGVNILAAVLPADTPYRFESGTSMAAPHVSGIV  556

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYF-SPIFAKGSSLRAADAFDYGGGIVNPNAAD  627
             ALLK  HP WSPAAIKSALVTTAW +D +   P+ ++G+  + AD FD+GGG+VN N A 
Sbjct  557   ALLKSLHPHWSPAAIKSALVTTAWVTDPHSGEPVISEGNPNKLADPFDFGGGLVNTNGAK  616

Query  626   DPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPS  447
             DPGLVYDM   DY  YLC++GYNNS I   I         ++   CP  RPS+LD+NLPS
Sbjct  617   DPGLVYDMGTFDYILYLCSMGYNNSAISMLI---------DQAASCPIKRPSILDVNLPS  667

Query  446   MVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRV  267
             + +P L K V  RRTVTNVGPVNS Y+AI++ P+G  + VKP+ L F+ + KK SFT+ +
Sbjct  668   LTIPSLRKKV--RRTVTNVGPVNSKYEAIIEPPLGITIKVKPETLIFNSSTKKISFTITI  725

Query  266   SADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             S      + + FGSLTW+DG+H VR+P +VR
Sbjct  726   STSHKYTTYYYFGSLTWTDGMHRVRSPTSVR  756



>emb|CDY67954.1| BnaAnng25710D [Brassica napus]
Length=775

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/767 (46%), Positives = 469/767 (61%), Gaps = 48/767 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQA
Sbjct  33    KVHIVYLGQKQHDDPEFVTESHHQMLCSLLGSKEDAHGSMVYSYRHGFSGFAAKLTKSQA  92

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V+ D  +K++T+R+WD+LGLS  A+ P  LL +TN G+ +I+G++D+G+
Sbjct  93    KKIANLPEVVHVIPDSFYKLKTTRTWDYLGLS--ASSPKNLLNETNMGEQIIIGIIDTGV  150

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+G VP  WKG C++  G  FN S  CN+K+IGA++F  G  L ++   N
Sbjct  151   WPESEVFNDDGIGSVPSHWKGGCQS--GEMFNSSH-CNKKLIGAKYFING-FLEENKSFN  206

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D+ GHG+ VA+I AGS+V + +  G+  G VRGGA  AR+A YK CW L
Sbjct  207   SKESLDFISPRDLNGHGTHVATIAAGSYVQDISYKGLSGGTVRGGAPRARIAMYKGCWYL  266

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D  +   C+ AD+L A+D AIHD VDV+S+S+GS VPL  +++  +GI  G+FHA+ +GI
Sbjct  267   DDLDITTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGEIDIRDGISTGAFHAVLKGI  326

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ A GN+GP A T+TN  PW++TVAA+T+DR F   ITLGN  K  +   +  G  L 
Sbjct  327   TVVCAGGNSGPEAQTVTNTAPWIVTVAATTLDRSFPTPITLGN-NKVILGQAMYTGPELG  385

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT--DA  1167
                      P +    + G  + +    +   V GK+V  F        V     +   A
Sbjct  386   FTSLVYPEDPGNSNETFSGTCEDLSLNSNDTMV-GKVVLCFTASSSSGSVSSAAGSVKKA  444

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYI-----FQSTMTPTAQLSSPK  1002
             G + VI +     D  P L+   P V VDY+ GT I  YI     F   ++P  ++    
Sbjct  445   GGLAVIIARHPGSDLEPCLD-DFPCVSVDYELGTNILLYIRSTGHFSVDLSPVLKIQPST  503

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTS----DGGFRISSGTS  834
               VG+ +  KV  FSSRGP+S AP I+KPDIAAPG  I+ A  T+    DGGF + SGTS
Sbjct  504   TLVGQPVGTKVASFSSRGPNSIAPAILKPDIAAPGASILAATTTNTTLNDGGFIMLSGTS  563

Query  833   HAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGG  654
              AAP +S +VALLK  HP+WSPAAI+SA+VTTAW +D +   I A+GSS + AD FDYGG
Sbjct  564   MAAPVISGVVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIDAEGSSRKLADPFDYGG  623

Query  653   GIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRP  474
             G+VNP  A  PGLVYD+   DY  Y+C+L                     E T C   RP
Sbjct  624   GLVNPEKAVKPGLVYDLDLEDYVLYMCSL-------------------VGERTTCSNPRP  664

Query  473   SMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNR  294
             S+LDLNLPS+ +PDL + VTL RTVTNVGP +SVYK  V+ P+G  VTV P  L F+   
Sbjct  665   SVLDLNLPSITIPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKT  724

Query  293   KKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             KK S+ +RVS    +N+ F FGSLTWSD VH+V  P++VR  I+  Y
Sbjct  725   KKLSYHVRVSTRHKINTGFYFGSLTWSDSVHDVIIPLSVRTQILQNY  771



>ref|NP_567361.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40047.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78177.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82895.1| Subtilase family protein [Arabidopsis thaliana]
Length=775

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/765 (45%), Positives = 473/765 (62%), Gaps = 40/765 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MV+SYR+GFSGFAA LT SQA
Sbjct  29    KVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDAHSSMVHSYRHGFSGFAAKLTKSQA  88

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V  D  +++ T+R+WD+LGLS  AN P  LL  TN G+ +I+G+VDSG+
Sbjct  89    KKLADLPEVVHVTPDSFYQLDTTRTWDYLGLSV-AN-PKNLLNDTNMGEEVIIGIVDSGV  146

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+GPVP  WKG C  + G  F  S+ CN+K+IGA++F  G L + +   N
Sbjct  147   WPESEVFNDNGIGPVPSHWKGGC--VSGENFTSSQ-CNKKLIGAKYFINGFLATHE-SFN  202

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D +GHG+ VA+I  GS+VP+ +  G+  G VRGGA  AR+A YKACW L
Sbjct  203   STESLDFISPRDRSGHGTHVATIAGGSYVPSISYKGLAGGTVRGGAPRARIAMYKACWYL  262

Query  1673  DPERF---VCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITR  1503
             D  RF    C+ AD+L A+D A+HD VDV+S+S+G   P   + +    I  G+FHA+ +
Sbjct  263   D--RFDINTCSSADILKAMDEAMHDGVDVLSLSIGYRFPYFPETDVRAVIATGAFHAVLK  320

Query  1502  GIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTA  1323
             GI V+ + GN+GP+A T+ N  PW++TVAA+T+DR F   ITLGN  K  +   +  G  
Sbjct  321   GITVVCSGGNSGPAAQTVGNTAPWILTVAATTLDRSFPTPITLGN-NKLILGQAMYTGPE  379

Query  1322  L--------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLV--LVDKAT  1173
             L         +P +    + G+ +L+    +   + GK+V  F        V   V    
Sbjct  380   LGFTSLVYPENPGNSNESFSGDCELLFFNSN-HTMAGKVVLCFTTSTRYITVSSAVSYVK  438

Query  1172  DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
             +AG +GVI + NP   D+L       P V VDY+ GT I  YI +ST  P  ++   K  
Sbjct  439   EAGGLGVIVARNPG--DNLSPCEDDFPCVAVDYELGTDILLYI-RSTGLPVVKIQPSKTL  495

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTS----DGGFRISSGTSHA  828
             VG+ +  KV DFSSRGP+S  P I+KPDIAAPG  I+ A  T+    D GF   SGTS A
Sbjct  496   VGQPVGTKVADFSSRGPNSIEPAILKPDIAAPGVSILAATTTNKTFNDRGFIFLSGTSMA  555

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
             AP +S +VALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+
Sbjct  556   APTISGVVALLKALHRDWSPAAIRSAIVTTAWRTDPFGEQIFAEGSPRKLADPFDYGGGL  615

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VNP  A  PGLVYD+   DY  Y+C++GYN + I + +          + T+C   +PS+
Sbjct  616   VNPEKAAKPGLVYDLGLEDYVLYMCSVGYNETSISQLVG---------KGTVCSNPKPSV  666

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD NLPS+ +P+L   VTL RT+TNVG + SVYK +++ P+G  VTV P+ L F+   K+
Sbjct  667   LDFNLPSITIPNLKDEVTLTRTLTNVGQLESVYKVVIEPPIGIQVTVTPETLLFNSTTKR  726

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SF ++VS    +N+ + FGSLTWSD +HNV  P++VR  I+  Y
Sbjct  727   VSFKVKVSTTHKINTGYFFGSLTWSDSLHNVTIPLSVRTQILQNY  771



>ref|XP_002298975.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
 gb|EEE83780.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
Length=786

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/771 (45%), Positives = 463/771 (60%), Gaps = 55/771 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E  KK++IVY+G K H+D    K++HY++L+ ++GS E A+ +++YSYR+GFSGFAA +T
Sbjct  37    ETAKKVHIVYMGEKRHEDPATTKKTHYEMLSTLLGSKEAAQSSILYSYRHGFSGFAARIT  96

Query  2225  asqakkvagvagvvsvVE---------DKHHKVQTSRSWDFLGLSEGANVPGELLRKTNK  2073
              SQA ++AG     + ++         +  HK+ T+RSW+F+GL    + P  LL ++N 
Sbjct  97    ESQAAEIAGTIISQNSIKFPGVVQVIPNGIHKLHTTRSWEFIGLKH--HSPQNLLTQSNM  154

Query  2072  GDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWF  1893
             G G I+GV+DSG+  E  SF D GMGPVP RWKG C+   G  F     CNRK+IGARWF
Sbjct  155   GQGTIIGVIDSGVWPESKSFHDEGMGPVPSRWKGICQQ--GEHFKPYN-CNRKIIGARWF  211

Query  1892  FKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGAT  1713
              KG      +  N     +  S  D  GHG+  AS  AG+FV  A+  G+  G+ RGGA 
Sbjct  212   VKG--FQDQIHFNTTESREFMSPRDGDGHGTHTASTAAGNFVAKASYKGLATGLARGGAP  269

Query  1712  AARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGI  1533
              A +A YK CWN+  E   C  AD+L A D AIHD VD++SVS+G+ +PL S  +  N I
Sbjct  270   LAHLAIYKVCWNI--EDGGCTDADILKAFDKAIHDGVDILSVSIGNDIPLFSYADMRNSI  327

Query  1532  GIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYA  1353
              IGSFHA ++GI V+ +AGN GP + T+ N  PW+ TVAASTIDR F   I LGN +   
Sbjct  328   AIGSFHATSKGITVVCSAGNDGPISQTVANTAPWLTTVAASTIDRAFPTAIILGNNKTL-  386

Query  1352  VDWQLPNGTALS---HPLHFAGKYMGE----------ADLMPRKLDPAEVKGKIVFMFGD  1212
                    G +++   H   FAG    E           D  P  L+P    GKI+     
Sbjct  387   ------RGQSITIGKHTHRFAGLTYSERIALDPMVSSQDCQPGSLNPTLAAGKIILCLSK  440

Query  1211  DLDRNLVLVDKAT-DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQST  1035
                +++     +   AG VG+IY+   + D +  L   IP V+VDY+ GT+I  YI Q+ 
Sbjct  441   SDTQDMFSASGSVFQAGGVGLIYAQ-FHTDGIE-LCEWIPCVKVDYEVGTQILSYIRQA-  497

Query  1034  MTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--DPTSDG  861
              +PTA+LS PK  VG+ ++P++  FSSRGPSS  P ++KPDIAAPG  I+ A      D 
Sbjct  498   RSPTAKLSFPKTVVGKRVSPRLASFSSRGPSSITPEVLKPDIAAPGVDILAAYTPANKDQ  557

Query  860   G--FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSS  687
             G  +   SGTS A PHVS IVAL+K  HP WSPAAI+SALVTTA  + T    IF +GS+
Sbjct  558   GDSYEFLSGTSMACPHVSGIVALIKSLHPNWSPAAIRSALVTTASQTGTDGMKIFEEGST  617

Query  686   LRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDT  507
              + AD FD GGG VNP  A  PGLVYD    +Y QYLC++GY++S I +  +   N    
Sbjct  618   RKEADPFDMGGGHVNPEKAAYPGLVYDTTTEEYIQYLCSIGYSSSSITRLTNTKIN----  673

Query  506   EEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTV  327
                  C K   + L+LNLPS+ +P+L K VT+ R VTNVG VNSVYKAIV++P+G  + V
Sbjct  674   -----CVKKTNTRLNLNLPSITIPNLKKKVTVTRKVTNVGNVNSVYKAIVQAPIGISMAV  728

Query  326   KPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             +PK L F+   K  SF +   + + V   + FGSLTW+DG H VR+PI+VR
Sbjct  729   EPKTLSFNRINKILSFRVTFLSSQKVQGEYRFGSLTWTDGEHFVRSPISVR  779



>emb|CBI23066.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/741 (46%), Positives = 444/741 (60%), Gaps = 58/741 (8%)
 Frame = -3

Query  2366  KPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagv  2187
             + H D   I  +H+++L  V+GS E +  +M+YSYR+GFSGFAA LT +QA+ V+ +  V
Sbjct  2     RQHHDPELITNTHHEMLTTVLGSKEASVDSMLYSYRHGFSGFAAKLTEAQAQAVSELPDV  61

Query  2186  vsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGD  2007
             V V+  + HK++T+RSWD+LGLS  ++    LL +TN GDG+I+G++DSGI  E   F D
Sbjct  62    VQVMPSRLHKLKTTRSWDYLGLSS-SHSSTNLLHETNMGDGIIIGLLDSGIWPESKVFSD  120

Query  2006  AGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG--ALLSQDVDLNKFLVSDS  1833
              G+GP+P RWKG C +  G  FN ++ CNRK+IGAR+F KG  A + + ++  ++L  + 
Sbjct  121   KGLGPIPSRWKGGCSS--GQSFNATKHCNRKLIGARYFLKGLEAEIGEPLNTTEYL--EY  176

Query  1832  YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVC  1653
              S  D  GHG+  +SI  GS V NA+  G+  G VRGGA  AR+A YKACWNL      C
Sbjct  177   LSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKACWNLGGG--FC  234

Query  1652  AGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGN  1473
             + AD+L A D AIHD VDVI                     IGSFHA+ +GI V+ AAGN
Sbjct  235   SDADILKAFDKAIHDGVDVIL--------------------IGSFHAVAQGISVVCAAGN  274

Query  1472  AGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGK  1293
              GPSA T+ N  PW++TVAAS+IDR F   ITLGN           N T +   +   G 
Sbjct  275   GGPSAQTVDNTAPWILTVAASSIDRSFPTPITLGN-----------NRTVMGQAM-LIGN  322

Query  1292  YMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYS-NPSNVDSLP  1116
             + G A L+       E+ GK+   F               +A  +GVI + N  N  +  
Sbjct  323   HTGFASLVYPDDPHVEMAGKVALCFTSGTFETQFAASFVKEARGLGVIIAENSGNTQASC  382

Query  1115  ILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSF  936
             I  +  P ++V Y+ G++I  YI  ST  P   LS  K  VG+ +   V  FSSRGPS  
Sbjct  383   I--SDFPCIKVSYETGSQILHYI-SSTRHPHVSLSPSKTHVGKPVPTNVAYFSSRGPSFP  439

Query  935   APGIMKPDIAAPGDKIMCADPTSD----GGFRISSGTSHAAPHVSAIVALLKISHPEWSP  768
             +P ++KPDIA PG +I+ A P SD      F   SGTS A PH++ IVALLK  HP WSP
Sbjct  440   SPAVLKPDIAGPGAQILGAVPPSDLKKNTEFAFHSGTSMATPHIAGIVALLKSLHPHWSP  499

Query  767   AAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDY  588
             AAIKSA+VTT W +D    PIFA+G   + AD FD+GGGIVNPN A DPGLVYDM   DY
Sbjct  500   AAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFGGGIVNPNRAADPGLVYDMGTADY  559

Query  587   AQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLR  408
               YLC LGYNNS I++          TE+   CP    S+LDLNLPS+ +P L    +L 
Sbjct  560   IHYLCTLGYNNSAIFQF---------TEQSIRCPTGEHSILDLNLPSITIPSLQNSTSLT  610

Query  407   RTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFG  228
             R VTNVG VNS YKA + SP G  +TVKP  L FD   K  +F++ VS+   VN+ ++FG
Sbjct  611   RNVTNVGAVNSTYKASIISPAGITITVKPDTLIFDSTIKTVTFSVTVSSIHQVNTGYSFG  670

Query  227   SLTWSDGVHNVRTPIAVRKMI  165
             SLTW DGVH VR+PI+VR MI
Sbjct  671   SLTWIDGVHAVRSPISVRTMI  691



>ref|NP_567360.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03437.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=50.7, E=4.7e-13, n=3) [Arabidopsis thaliana]
 emb|CAB40046.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78176.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82894.1| Subtilase family protein [Arabidopsis thaliana]
Length=747

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/760 (44%), Positives = 467/760 (61%), Gaps = 57/760 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K HD+   + ESH+ +L  ++GS E    ++VYSYR+GFSGFAA LT SQA
Sbjct  28    KVYVVYLGEKEHDNPESVTESHHQMLWSLLGSKEAVLDSIVYSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ +  +++ T+R+WD+LG+S G +    LL+K N G  +IVGV+D+G+
Sbjct  88    QQISELPEVVQVIPNTLYEMTTTRTWDYLGVSPGNS--DSLLQKANMGYNVIVGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C +  G  FN S  CNRK+IGA++F   A  +Q   LN
Sbjct  146   WPESEMFNDKGYGPIPSRWKGGCES--GELFNGSIHCNRKLIGAKYFID-ANNAQFGVLN  202

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             K    D  S  D  GHG+ VAS + GSF+PN + LG+  G  RGGA    +A YKACW  
Sbjct  203   KTENPDYLSPRDFNGHGTHVASTIGGSFLPNVSYLGLGRGTARGGAPGVHIAVYKACW--  260

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                +  C+GAD+L A+D AIHD VD++S+S+ + VPL  + +A     +G+FHA+ +GIP
Sbjct  261   --VQRGCSGADVLKAMDEAIHDGVDILSLSLQTSVPLFPETDARELTSVGAFHAVAKGIP  318

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ AA NAGP+A T++NV PWV+TVAA+T DR F   ITLGN           N T L  
Sbjct  319   VVAAASNAGPTAQTLSNVAPWVLTVAATTQDRSFPTAITLGN-----------NITILGQ  367

Query  1313  PLHFAGKYMG-----------EADLMPRKLDP-AEVKGKIVFMFGDDLDRNLVLVDKATD  1170
              + F G  +G             D      +P + ++GK+V  F      N   +    +
Sbjct  368   AI-FGGSELGFVGLTYPESPLSGDCEKLSANPKSAMEGKVVLCFAASTPSNAA-ITAVIN  425

Query  1169  AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
             AG +G+I + NP+++   P+ N   PYV VD++ GT I  YI +ST +P   + + +   
Sbjct  426   AGGLGLIMARNPTHLLR-PLRN--FPYVSVDFELGTDILFYI-RSTRSPIVNIQASRTLF  481

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVS  813
             G++++ KV  FSSRGP+S +P I+K         +      +DGGF + SGTS A P VS
Sbjct  482   GQSVSTKVATFSSRGPNSVSPAILK---------LFLQIAINDGGFAMMSGTSMATPVVS  532

Query  812   AIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNA  633
              +V LLK  HP+WSP+AIKSA+VTTAW +D    PIFA GSS + AD FDYGGG++NP  
Sbjct  533   GVVVLLKSLHPDWSPSAIKSAIVTTAWRTDPSGEPIFADGSSRKLADPFDYGGGLINPEK  592

Query  632   ADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNL  453
             A  PGL+YDM   DY  Y+C++ Y++  I + +          + T+CP  +PS+LDLNL
Sbjct  593   AVKPGLIYDMTTDDYVMYMCSVDYSDISISRVLG---------KITVCPNPKPSVLDLNL  643

Query  452   PSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTM  273
             PS+ +P+L   VTL RTVTNVGPVNSVYK ++  P G  V V P  L FD    KRSFT+
Sbjct  644   PSITIPNLRGEVTLTRTVTNVGPVNSVYKVVIDPPTGVNVAVTPTELVFDSTTTKRSFTV  703

Query  272   RVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             RVS    VN+ + FGSLTW+D +HNV  P++VR  I+  Y
Sbjct  704   RVSTTHKVNTGYYFGSLTWTDTLHNVAIPVSVRTQILQRY  743



>gb|KFK28745.1| hypothetical protein AALP_AA7G041500 [Arabis alpina]
Length=764

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/764 (44%), Positives = 466/764 (61%), Gaps = 54/764 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             +N  K+YIVYLG + HDD   + +SH+ +L  +  S E+A  +M+YSY++GFSGFAA+LT
Sbjct  36    DNNSKVYIVYLGEREHDDPEFVTDSHHQMLESLHDSKEDAHNSMIYSYQHGFSGFAALLT  95

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLS-------EGANVPGELLRKTNKGD  2067
              SQ KK++    VV  + ++  K++T+R+WD LGLS         ++V G LL  TN G 
Sbjct  96    PSQVKKISEHPAVVHAIPNQILKLKTTRTWDHLGLSPLPTSYSSSSSVKG-LLHDTNMGS  154

Query  2066  GMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFK  1887
               I+GV+D+GI  E   F D G+GP+P+RW+G C++  G +FN    CN+K+IGA+++ K
Sbjct  155   EAIIGVMDTGIWPESKVFDDQGLGPIPKRWRGKCKS--GEQFNAKIHCNKKLIGAKYYLK  212

Query  1886  GALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAA  1707
             G L       NK    D  S  DV GHG+  A+I  GSFVPNA+  G+  G VRGGA  A
Sbjct  213   GMLAEIGGKFNKTTFRDFKSNRDVDGHGTHTATIAGGSFVPNASFYGLARGTVRGGAPRA  272

Query  1706  RVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGI  1527
              +ASYK CWN       C+ AD+  A D AIHD VDV+SVS+G+ VP  S+++  + +  
Sbjct  273   CIASYKVCWN----NLGCSSADMWKAFDDAIHDGVDVLSVSIGAKVPEESEVDKLSFVA-  327

Query  1526  GSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD  1347
              +FHA+ +GIPV+ AAGN GP A T+ NV PW++TVAA+T+DR F   ITLGN +    +
Sbjct  328   -AFHAVAKGIPVVAAAGNEGPGAQTVANVAPWLLTVAATTLDRSFPTKITLGNKQTLFAE  386

Query  1346  WQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDA  1167
               L  G  +S  L F           P   D  ++KGK V +F  +         +    
Sbjct  387   -SLFTGPEISTDLAF---------FDPESDDNVDLKGKTVLVFNSET--------QIAGK  428

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQS----TMTPTAQLSSPKI  999
             G VGVI++     D L      +P +  DY+ GT I  YI  +      + T ++S+   
Sbjct  429   GLVGVIFAQKP--DDLRARCHNVPCIYTDYELGTDILQYIRTTRSSILKSATVRISAATT  486

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSH  831
               G   T KV   S RGP+S +P I+KPDIAAPG  I+ A    DP    GF + SGTS 
Sbjct  487   LTGLPTTTKVAAVSCRGPNSVSPAILKPDIAAPGVSILAALSPLDPEEHDGFGLVSGTSM  546

Query  830   AAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGG  651
             A P VS I+ALLK  HP+WSPAAI+SALVTTAW +     PIFA+GS+ + AD FDYGGG
Sbjct  547   ATPVVSGIIALLKSLHPKWSPAAIRSALVTTAWRTSPSGEPIFAEGSNKKIADPFDYGGG  606

Query  650   IVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
             +VNP  A  PGLVYDM   DY  Y+C+ GYN+S I + +          + T C   +PS
Sbjct  607   LVNPEKAAKPGLVYDMGIEDYINYMCSAGYNDSSISRVVG---------KKTKCQTPKPS  657

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
             +LD+NLPS+ +P+L + VTL RTVTNVGP+ SVYKA+++SP+G  +TV P +L F  + K
Sbjct  658   ILDINLPSITIPNLEQEVTLTRTVTNVGPIKSVYKAVIESPLGITLTVNPTILVFSSSAK  717

Query  290   K-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             +  +F+++      VN+ + FGSLTW+DGVH+V+ P++V+  I+
Sbjct  718   RLLTFSVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVKTKIM  761



>gb|KFK41045.1| hypothetical protein AALP_AA2G078300 [Arabis alpina]
Length=757

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/753 (45%), Positives = 462/753 (61%), Gaps = 45/753 (6%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             ++IY V+LG + HDD   + ESH+D+L  ++GS E +R++M+YSYR+GFSGFAA LT+SQ
Sbjct  38    RQIYTVHLGERQHDDPNLVTESHHDILGPLLGSKEASRESMIYSYRHGFSGFAAKLTSSQ  97

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A++++    V+ V + K  K++T+R  D+LGL+  A  P  L+  T+ G   IVG++DSG
Sbjct  98    ARELSEHPDVIHVTKGKIMKLKTTRVSDYLGLTPTA--PTGLIHDTDMGSEGIVGILDSG  155

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+GP+P RW G C  + G  FN S  CNRK+IGAR++  G L   +   
Sbjct  156   IWPESESFNDYGLGPIPARWMGQC--VSGEAFNASS-CNRKLIGARYYANGLLQKYNGSF  212

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     +  S  D  GHG+  AS  AGSFV +A+ LG+ +G  RG A  ARVASYK CWN
Sbjct  213   NAADHDEFMSPMDKIGHGTHCASTAAGSFVQDASFLGLAMGTARGSAPRARVASYKVCWN  272

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENG-IGIGSFHAITRG  1500
                    C   D++ A+D+AIHD VDVIS+S+GS VPL  D E +     I +FHA+ +G
Sbjct  273   NQE----CFTPDIVKAMDHAIHDGVDVISLSLGSEVPL--DFEVDRSDFAIAAFHAVMKG  326

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             IPV+ A GN GP   TI+NV PW+ITVAA+T+DR F   ITLGN           N T L
Sbjct  327   IPVVCAGGNDGPHTQTISNVSPWIITVAATTMDRQFFTPITLGN-----------NITVL  375

Query  1319  SHPLHFAGKYMGEADLM------PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAV  1158
                  + GK +G  DL+             + KGKI+F F    ++N  +V   +   A 
Sbjct  376   GQEGLYTGKEVGFTDLLFLNDMTKEDFKAGKAKGKILFFFQTGKNQNDFVVFAKSKGAAG  435

Query  1157  GVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALT  978
              +I S P+  DS+   +A I    VDY+ G  I  YI Q+T +P A++S  K  VGR  +
Sbjct  436   IIIASQPT--DSVEPSSADIACAYVDYELGMDILLYI-QTTTSPKAKISPTKTFVGRPTS  492

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVAL  798
              KV  FSSRGP+S +P I+KPDIAAPG  I+ A P+    +   SGTS A P VS IVAL
Sbjct  493   TKVAKFSSRGPNSLSPAILKPDIAAPGSGILAAVPSR---YEFMSGTSMATPVVSGIVAL  549

Query  797   LKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPG  618
             L+  HP+WSPAAI+SALVTTA  +D    PI A+GS  + AD FDYGGG+VNP    DPG
Sbjct  550   LRQKHPDWSPAAIRSALVTTASQTDPSGEPIAAEGSPRKLADPFDYGGGLVNPGKVADPG  609

Query  617   LVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVV  438
             LVYDM   +Y  YLC+ GY++  I   +S         +   CP   PSMLD+NLPS+ +
Sbjct  610   LVYDMGYDEYVHYLCSAGYDDRSISILLS---------KPYTCPSPTPSMLDVNLPSITI  660

Query  437   PDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSAD  258
             P L + +T+ RTVTNVGPV S+YKA+++ P+G  + V P+ L F  N  K +F ++VS  
Sbjct  661   PYLSQEITITRTVTNVGPVGSIYKAVIEPPLGINLQVSPETLEFGSNTNKITFMVKVSTT  720

Query  257   KLVNSAFTFGSLTWSD-GVHNVRTPIAVRKMIV  162
               VN+ + FGSLTW+D G H+VR P ++R  ++
Sbjct  721   HRVNTDYHFGSLTWTDNGAHDVRIPFSIRTRVL  753



>ref|XP_011038012.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/759 (45%), Positives = 462/759 (61%), Gaps = 39/759 (5%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E  KK++IVY+G K H+D    K++H+++L+ ++GS E A+ +++YSYR+GFSGFAA +T
Sbjct  37    ETAKKVHIVYMGEKRHEDPATTKKTHFEMLSTLLGSKEAAQSSILYSYRHGFSGFAARIT  96

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
             ASQA ++A   GVV V+ +  HK+ T+RSW+F+GL    + P  LL ++N G G I+GV+
Sbjct  97    ASQAAEIAEFPGVVQVIPNGIHKLHTTRSWEFIGLEH--HSPQNLLTQSNMGQGTIIGVI  154

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             DSG+  E  SF D GMGPVP  WKG C+   G  F +S  CNRK+IGARWF KG      
Sbjct  155   DSGVWPESKSFHDEGMGPVPSHWKGICQQ--GEHF-KSYNCNRKIIGARWFVKG--FQDQ  209

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
                N     +  S  D  GHG+  AS  AG+FV  A+  G+  G+ RGGA  A +A YK 
Sbjct  210   THFNTTGSREFMSPRDGDGHGTHTASTAAGNFVAKASYKGLATGLARGGAPLAHLAIYKV  269

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN++ +   C  AD+L A D AIHD VD++SVS+G  +PL S ++  N I IGSFHA +
Sbjct  270   CWNIE-DGGGCTDADILKAFDKAIHDGVDILSVSIGINIPLFSYVDMRNSIAIGSFHATS  328

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GI V+ +AGN GP + T+ N  PW+ TVAASTIDR F   I LGN +      +  + T
Sbjct  329   KGITVVCSAGNDGPISQTVANTAPWLTTVAASTIDRAFPTAIILGNNKTL----RGQSIT  384

Query  1325  ALSHPLHFAGKYMGE----------ADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKA  1176
                H   F G    E           D  P  L+P    GKI+  F     +++     +
Sbjct  385   KGKHNHRFVGLTYSERIALNPMVSSQDCQPGSLNPTLAAGKIILCFSKSDTQDMFSASGS  444

Query  1175  T-DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
                AG VG+IY+   N D +  L   IP V+VDY+ GT+I  YI Q+  +PTA+LS PK 
Sbjct  445   VFQAGGVGLIYAQFHN-DGIE-LCEWIPCVKVDYEVGTQILSYIRQA-RSPTAKLSFPKT  501

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSH  831
              VG+ ++P++  FSSRGPSS  P ++KPDIAAPG  I+ A    +      +   SGTS 
Sbjct  502   VVGKRVSPRLASFSSRGPSSITPEVLKPDIAAPGVDILAAYTPANKDHGNSYEFLSGTSM  561

Query  830   AAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGG  651
             A PHVS IVAL+K  HP WSPAAI+SALVTTA  + T    IF +GS+ + AD FD GGG
Sbjct  562   ACPHVSGIVALIKSLHPNWSPAAIRSALVTTASQTGTDGMKIFEEGSTRKEADPFDMGGG  621

Query  650   IVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
              VNP  A  PGLVYD    +Y QYLC++GY++S I +  +   N         C K   +
Sbjct  622   HVNPEKAAYPGLVYDTTTEEYIQYLCSIGYSSSSITRLTNTKIN---------CMKNTNT  672

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
              L+LNLPS+ +P+L   VT+ R VTNVG VNSVYKAIV++P+G  + V+P+ L F+   K
Sbjct  673   RLNLNLPSITIPNLKTKVTVTRKVTNVGNVNSVYKAIVQAPIGISLAVEPQTLSFNRINK  732

Query  290   KRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
               SF +   + + V   + FGSL W+DG H VR+PI+VR
Sbjct  733   ILSFRVTFLSSQKVQGEYRFGSLIWTDGEHFVRSPISVR  771



>ref|XP_002278450.2| PREDICTED: subtilisin-like protease SBT3.3 [Vitis vinifera]
Length=787

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/773 (44%), Positives = 479/773 (62%), Gaps = 51/773 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    +YIVY+G K H+D   IK+ H+++L+ ++GS E A+ +++YSY++GFSGFAA LT
Sbjct  41    ETTSNVYIVYMGEKKHEDPATIKKCHHEMLSTLLGSKEAAKSSILYSYKHGFSGFAAKLT  100

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+ +AG  GVV V+ ++ H++ T+RSWDFLGL    + P  +L +TN G G+I+GV+
Sbjct  101   ESQAEDIAGFPGVVQVIPNRIHRLHTTRSWDFLGLQH--DYPTNVLTETNLGRGVIIGVI  158

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             DSG+  E  SF D GMGP+P RWKG C+   G RFN +  CNRK+IGARWFFKG  + Q+
Sbjct  159   DSGVWPESESFKDEGMGPIPSRWKGICQH--GERFNSTN-CNRKLIGARWFFKG--IHQE  213

Query  1865  VDLNKFL-VSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVA  1698
             +   KF+ ++D+    S  D  GHG+  AS  AG FV  A   G+  G+ RGGA  AR+A
Sbjct  214   I--GKFMNITDNLEFLSPRDGIGHGTHTASTAAGYFVEKANYRGLATGLARGGAPLARLA  271

Query  1697  SYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSF  1518
              YKACW +      C+ AD+L A D AIHD VD++S+SVG+ +PL S ++  + I I SF
Sbjct  272   IYKACWAIISG--ACSDADILKAFDKAIHDGVDILSLSVGNDIPLFSYVDQRDSIAIASF  329

Query  1517  HAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQL  1338
             HAI +GI V+ +AGN GP + TI N  PW+ITVAA+TIDR F   I LGN + + +   +
Sbjct  330   HAIAKGITVVCSAGNDGPFSQTIANTAPWLITVAATTIDRAFPTAIILGNNQTF-LGQSI  388

Query  1337  PNGTALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDLDRNLV  1191
               G    H L F G    E            D  P  L+     GKI+  F     ++++
Sbjct  389   DTG---KHKLGFTGLTYSERVALDPKDDSAKDCQPGSLNATLAAGKIILCFSKSDKQDII  445

Query  1190  LVDKAT-DAGAVGVIYSN--PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTA  1020
                 A  +AG +G+I++    S ++S  +    IP ++V+Y+ GT+I  YI +   +PTA
Sbjct  446   SASGAVLEAGGIGLIFAQFPTSQLESCDL----IPCIKVNYEVGTQILTYI-RKARSPTA  500

Query  1019  QLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFR  852
             +L  PK   G+  +P V  FSSRGPSS +P ++KPD+AAPG  I+ A    D  +  GF 
Sbjct  501   KLKFPKTVTGKWASPHVAYFSSRGPSSMSPAVLKPDVAAPGVNILAAYSPVDAGTSNGFA  560

Query  851   ISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAAD  672
               SGTS A PHVS + AL+K +HP WSPAAI+SALVT+A  + T    I  +G + +AAD
Sbjct  561   FLSGTSMACPHVSGLAALIKSAHPTWSPAAIRSALVTSASQTGTDGMDIIEEGPTRKAAD  620

Query  671   AFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTI  492
              FD GGG VNPN A  PGL+Y++   DY Q+LC++GY+N  I +          T+  T 
Sbjct  621   PFDIGGGHVNPNKALKPGLIYNISMEDYIQFLCSMGYSNPSIGRL---------TKTTTN  671

Query  491   CPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVL  312
             C +     L+LNLPS+ +P+L K VT+ RTVTNVG +NSVYKA V++P G  + V+P +L
Sbjct  672   CTRGSHFQLNLNLPSITIPNLKKKVTVMRTVTNVGHINSVYKAEVQAPYGIKMAVEPHIL  731

Query  311   RFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              F+   +   F +   + + V+  + FGSLTW+DG H VR+PIA+R +   +Y
Sbjct  732   SFNLTTQFLHFKVTFFSTQTVHGDYKFGSLTWTDGEHFVRSPIAIRAIKFDMY  784



>ref|XP_007039327.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY23828.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=869

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/760 (44%), Positives = 474/760 (62%), Gaps = 31/760 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +++IVY+G K H D    K SH+ +L+ ++GS E A+ +M+YSY++GFSGFAA LT SQA
Sbjct  127   QVHIVYMGEKKHQDPATTKMSHHKMLSTLLGSKEAAKNSMLYSYKHGFSGFAARLTESQA  186

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +++A   GVV V+ ++ H++ T+RSW+F+GL   ++    LL ++N G+G I+GV+DSG+
Sbjct  187   EEIAAFPGVVHVIPNRIHRLHTTRSWEFMGLKYHSS--KNLLTQSNMGEGTIIGVIDSGV  244

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D GMGP+P RWKG+C+   G  FN S  CN+K+IGARWF KG L      +N
Sbjct  245   WPESESFNDRGMGPIPSRWKGTCQE--GQLFNSSN-CNKKLIGARWFIKGILDQIQTPIN  301

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D +GHG+  AS  AG+FV NA   G+  G+ RGGA  A +A YKACW+ 
Sbjct  302   ISNGEEFLSARDNSGHGTHTASTAAGNFVQNANYEGLAAGLARGGAPRAHLAVYKACWSF  361

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               E   C  AD+L A D AI D VD++SVSVG+ +PL S ++  N I IGSFHA  +GI 
Sbjct  362   --ESGGCTDADILKAFDKAIQDGVDILSVSVGNSIPLYSYVDQRNSIAIGSFHATAKGIT  419

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---AVDWQLPN---  1332
             V  +AGN GP+A TI N  PW+I VAA+T+DR FA  ITLGN       +VD  + N   
Sbjct  420   VACSAGNDGPTAMTIENTAPWIINVAATTVDRAFATAITLGNNLTLWGQSVDTGIHNHGF  479

Query  1331  -GTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVD-KATDAGAV  1158
              G   S  +          D  P  L+     GKI+  F     +++        +AG V
Sbjct  480   TGITFSDRIAANSSDDSAQDCQPGSLNATLAAGKIILCFAQSSIQDISSAAISVLEAGGV  539

Query  1157  GVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALT  978
             G+I++   + D L   +  IP ++VDY+ GT+I  YI +   +P A+LS PK  +G+ + 
Sbjct  540   GLIFAQYRS-DGLGSCH-HIPCIKVDYEVGTQILSYI-RKARSPMAKLSIPKTVIGKWIY  596

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSA  810
             P+V DFS+RGPSS +P ++KPDIAAPG  I+ A          G++  SGTS + PHV+ 
Sbjct  597   PRVADFSARGPSSISPAVLKPDIAAPGVDILAAYIPVGKEKSSGYKFMSGTSMSCPHVAG  656

Query  809   IVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAA  630
             I AL+K  H  WSPAAI+SALVTTA  + T  S I  +GS+ +AAD FD GGG+VNPN A
Sbjct  657   IAALIKSVHKNWSPAAIRSALVTTASQTRTDGSNIAEEGSTRKAADPFDIGGGLVNPNKA  716

Query  629   DDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLP  450
              +PGL+YD    DY Q+LC  GY++    K ++G      T+    C K+R ++L+LNLP
Sbjct  717   VNPGLIYDAGIEDYVQFLCGTGYSS----KAVTG-----LTQTQVNCTKSRLNVLNLNLP  767

Query  449   SMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMR  270
             S+ +P+L + VT+ R VTNVGPV+SVYKAI+++P G  + V+P++L F+   +   F + 
Sbjct  768   SITIPNLKRKVTVTRAVTNVGPVDSVYKAIMQAPQGIKLKVEPQILSFNKTTQILPFKVT  827

Query  269   VSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
               + + V+  + FGSL+W+DG H VR+PI+VR ++   Y+
Sbjct  828   FFSTRKVSGDYRFGSLSWTDGKHIVRSPISVRAILFESYV  867



>emb|CAB40021.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
 emb|CAB78178.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=803

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/787 (44%), Positives = 474/787 (60%), Gaps = 58/787 (7%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQ
Sbjct  32    RKVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQ  91

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDS-  2040
             AKK+A +  VV V+ D  +K+ T+R+WD+LGLS  A  P  LL +TN G+ +I+GV+D+ 
Sbjct  92    AKKIADLPDVVHVIPDSFYKLATTRTWDYLGLS--AANPKSLLHETNMGEQIIIGVIDTD  149

Query  2039  ------------------------GISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNES  1932
                                     G+  E   F D+G GPVP  WKG C    G  FN S
Sbjct  150   FLSLVLLLIPFLSASMTKMLSVVAGVWPESEVFNDSGFGPVPSHWKGGCET--GENFNSS  207

Query  1931  ELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATT  1752
               CN+K+IGA++F  G  L+++   N     D  S  D+ GHG+ V++I  GSFVPN + 
Sbjct  208   N-CNKKLIGAKYFING-FLAENESFNSTNSLDFISPRDLDGHGTHVSTIAGGSFVPNISY  265

Query  1751  LGIDVGMVRGGATAARVASYKACWNLDPE-RFVCAGADLLAAIDYAIHDRVDVISVSVGS  1575
              G+  G VRGGA  A +A YKACW LD +    C+ AD+L A+D A+HD VDV+S+S+GS
Sbjct  266   KGLAGGTVRGGAPRAHIAMYKACWYLDDDDTTTCSSADILKAMDEAMHDGVDVLSISLGS  325

Query  1574  PVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRI  1395
              VPL  + +  +GI  G+FHA+ +GI V+ + GN+GP + T+TN  PW+ITVAA+T+DR 
Sbjct  326   SVPLYGETDIRDGITTGAFHAVLKGITVVCSGGNSGPDSLTVTNTAPWIITVAATTLDRS  385

Query  1394  FAYTITLGNGEKYAVDWQLPNGTAL--------SHPLHFAGKYMGEADLMPRKLDPAEVK  1239
             FA  +TLGN  K  +   +  G  L         +P +    + G  + +    +   ++
Sbjct  386   FATPLTLGN-NKVILGQAMYTGPGLGFTSLVYPENPGNSNESFSGTCEELLFNSN-RTME  443

Query  1238  GKIVFMFGDDLDRNLVL--VDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGT  1065
             GK+V  F        VL        AG +GVI +        P L+   P V VD++ GT
Sbjct  444   GKVVLCFTTSPYGGAVLSAARYVKRAGGLGVIIARHPGYAIQPCLD-DFPCVAVDWELGT  502

Query  1064  RIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIM  885
              I  Y  +S+ +P  ++   K  VG+ +  KV  FSSRGP+S AP I+KPDIAAPG  I+
Sbjct  503   DILLYT-RSSGSPVVKIQPSKTLVGQPVGTKVATFSSRGPNSIAPAILKPDIAAPGVSIL  561

Query  884   CADPT---SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYF  714
              A      SD GF + SGTS AAP +S + ALLK  H +WSPAAI+SA+VTTAW +D + 
Sbjct  562   AATTNTTFSDQGFIMLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIVTTAWKTDPFG  621

Query  713   SPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTI  534
               IFA+GS  + AD FDYGGG+VNP  + +PGLVYDM   DY  Y+C++GYN + I + I
Sbjct  622   EQIFAEGSPPKLADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLI  681

Query  533   SGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVK  354
                       + T+C   +PS+LD NLPS+ +P+L   VT+ RTVTNVGP+NSVY+  V+
Sbjct  682   G---------KTTVCSNPKPSVLDFNLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVE  732

Query  353   SPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
              P+G  VTV P+ L F+   KK  F ++VS     N+ + FGSLTWSD +HNV  P++VR
Sbjct  733   PPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVR  792

Query  173   KMIVPLY  153
               I+  Y
Sbjct  793   TQILQNY  799



>ref|XP_011040612.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/762 (45%), Positives = 461/762 (60%), Gaps = 42/762 (6%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E  KK++IVY+G K H+D    K+ HY++L  ++GS E AR +++YSYR+GFSGFAA LT
Sbjct  37    EATKKVHIVYMGEKEHEDPAITKKIHYEMLLTLLGSKEAARSSILYSYRHGFSGFAAKLT  96

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+ +A   GVV V+ +  HK+ T+RSW+F+GL+  +  P  LL+++N G G I+GV+
Sbjct  97    ESQAEDIAEFPGVVQVIPNGIHKLHTTRSWEFIGLNHHS--PQNLLKQSNMGQGTIIGVI  154

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             DSG+  E  SF D GMGPVP  WKG C+   G  FN S  CNRK+IGARWF KG      
Sbjct  155   DSGVWPESKSFHDEGMGPVPSHWKGICQQ--GESFNLSN-CNRKIIGARWFVKG--FQDQ  209

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
             +  N     +  S  D  GHGS  AS  AG+FV   +  G+  G+ RGGA  A +A YK 
Sbjct  210   IPFNTTESGEFMSPRDGEGHGSHTASTAAGNFVEKVSYKGLAAGLARGGAPLAHLAIYKV  269

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN+  E   C  ADLL A D AIHD VD++SVS+G+ +PL S ++  N I IGSFHA  
Sbjct  270   CWNI--EDGGCTDADLLKAFDKAIHDGVDILSVSIGNNIPLFSYVDMRNSIAIGSFHATL  327

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
              GIPVI +AGN GP + T+ N  PW+ITVAASTIDR F   ITLGN +     W     T
Sbjct  328   NGIPVICSAGNDGPISQTVENTAPWLITVAASTIDRTFPTAITLGNNKTL---WGQSITT  384

Query  1325  ALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDK  1179
                H   FA     E            D  P  L+     GKI+    +   +++     
Sbjct  385   G-QHNHGFASLTYSERIPLNPMVDSAKDCQPGSLNATLATGKIILCLSESNTQDMFSAST  443

Query  1178  AT-DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
             +  +AG VG+I+    ++D + +   +IP V+VDY+ GT+I  YI +   +PTA+LS PK
Sbjct  444   SVFEAGGVGLIFVQ-FHLDGIEL--CKIPCVKVDYEVGTQIVSYI-RKARSPTAKLSFPK  499

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDG----GFRISSGTS  834
               VGR ++P++  FSSRGPSS +P ++KPDIAAPG  I+ A   ++      +   SGTS
Sbjct  500   TVVGRRVSPRLASFSSRGPSSISPEVLKPDIAAPGVDILAAHRPANKDQVDSYEFLSGTS  559

Query  833   HAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGG  654
              + PHV+ IVAL+K  H  WSPAAI+SALVTTA  + T    IF +GS+ + ADAFD GG
Sbjct  560   MSCPHVTGIVALIKSLHQNWSPAAIRSALVTTASQTGTDGMKIFEEGSTTKEADAFDIGG  619

Query  653   GIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRP  474
             G VNP  A  PGLVYD    +Y Q+LC++GY++S + +  +   N         C K   
Sbjct  620   GHVNPEKAVYPGLVYDTNTKEYIQFLCSMGYSSSSVTRLTNATIN---------CMKKAN  670

Query  473   SMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNR  294
             + L+LNLPS+ +P+L     + R VTNVG VNS YKAIV++P G  + V+P  L F+ + 
Sbjct  671   TRLNLNLPSITIPNLKTRAKVARKVTNVGNVNSEYKAIVQAPFGINMRVEPPTLSFNMSN  730

Query  293   KKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
             K  S+ +   + + V   + FGSLTW+DG H VR+PI+VR M
Sbjct  731   KILSYEVTFFSTQKVQGGYRFGSLTWTDGEHFVRSPISVRAM  772



>ref|XP_010056037.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=773

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/771 (46%), Positives = 467/771 (61%), Gaps = 53/771 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
              +YIVY G +   D      SH+D+LA V+GS E A K+++YSY +GFSGFAA LT SQA
Sbjct  29    NVYIVYFGARKQGDPTVETNSHHDMLASVLGSKEAAAKSILYSYSHGFSGFAAKLTESQA  88

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +++AG  GVV V+ +   ++QT+RSWDFLGLS  ++ P  LL K+  GDG+IVG++D+GI
Sbjct  89    QELAGFPGVVRVMPNTLFRLQTTRSWDFLGLSP-SHSPTSLLYKSRMGDGVIVGMIDTGI  147

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P RWKG C      +F+ ++ CNRK+IGARWF  G L      LN
Sbjct  148   WPESKSFSDEGLGPIPSRWKGGCEL--AEQFDPAKHCNRKIIGARWFVDGFLAEYGKPLN  205

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+  +S   GSFV N +  GI  G  RGGA  AR+A YK CWN+
Sbjct  206   ASGDLEFLSPRDANGHGTHTSSTAVGSFVSNVSYRGIGYGTARGGAPRARLAVYKVCWNV  265

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                +  C+ AD+L A D AIHD VDV+SVS+G+ +PL SD++  +GI  G+FHA+ +GI 
Sbjct  266   LNGQ--CSSADILKAFDEAIHDGVDVLSVSIGTAIPLFSDVDDRDGIATGAFHAVAQGIT  323

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+  AGN GP+A T+ N  PW++TV A++IDR F   ITLGN E          G A+  
Sbjct  324   VVCGAGNDGPAAQTVQNTAPWILTVGATSIDRAFRTIITLGNNETLV-------GQAI--  374

Query  1313  PLHFAGKYMGEADLM-PR--KLDPAE-------------VKGKIVFMFGDDLDRNLVLVD  1182
                + GK +G   L+ P    LDP               + GK+V  F     R  V + 
Sbjct  375   ---YTGKEIGFTTLLYPEGTTLDPTSGGVCERLSPNATLMAGKVVLCFTSTAGRFAVTLA  431

Query  1181  KATDAGAVGV---IYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
              A    + GV   +  NP   D L   +   P V+VDY+ GTRI  Y F+S   P  +LS
Sbjct  432   SAAVKASRGVGVIVAKNPR--DGLAPCSGDFPCVEVDYEIGTRILFY-FRSARFPKVKLS  488

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISS  843
                  VG+A+  KV  FSSRGP+S +P ++KPD+AAPG  I+ A    +P+ D G+ + S
Sbjct  489   RTITAVGKAVQAKVALFSSRGPTSISPAVLKPDVAAPGVNILAATLPFNPSEDNGYTMLS  548

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFD  663
             GTS + PHV+ IVALLK  HP+WSPAA +SALVTTAW S+    PIFA GS  + AD FD
Sbjct  549   GTSMSTPHVAGIVALLKALHPDWSPAAFRSALVTTAWRSNPLGFPIFASGSPPKLADPFD  608

Query  662   YGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPK  483
              GGGIVNPN+A +PGL+YD+   DY  YLCA+GYN++ I            T +   CP 
Sbjct  609   MGGGIVNPNSAAEPGLIYDVGMPDYILYLCAMGYNDTEISHL---------TGKPAPCPA  659

Query  482   TRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFD  303
              RPS+ D+NLPS+ +P L   VT+ RTV N G   S Y A+++ P G  VTV+P VL FD
Sbjct  660   RRPSVSDVNLPSITIPRLTSTVTVTRTVKNTGNPESRYWAVIEPPSGTTVTVRPHVLAFD  719

Query  302   GNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM-IVPLY  153
                KK +F++ V A   VN+ + FGSL W+DGVH VR+P+AVR +   P Y
Sbjct  720   PETKKAAFSVTVCAAVPVNTGYYFGSLVWTDGVHAVRSPLAVRVLNQTPFY  770



>ref|XP_010318062.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010318063.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
Length=732

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/758 (44%), Positives = 468/758 (62%), Gaps = 58/758 (8%)
 Frame = -3

Query  2375  LGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagv  2196
             +G + HDD      +H+ LL  V+GS + AR +++YSY++GFSGFAA LT SQAKK+A +
Sbjct  1     MGRRQHDDVELATSAHHQLLTSVMGSQKAARDSIIYSYKHGFSGFAARLTKSQAKKIAEL  60

Query  2195  agvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPS  2016
               VV VV +   K+ T RSWD+LGLSE ++ P  LL + N GDG+I+GV+D+GI  E  +
Sbjct  61    PDVVHVVPNHFFKLHTRRSWDYLGLSE-SSPPTNLLHEANMGDGIIIGVLDTGIWPESEA  119

Query  2015  FGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG---ALLSQDVDLNKFL  1845
             F D G+GP+P RWKG C++  G +F+ +  CNRK+IG++++ KG   A     +    FL
Sbjct  120   FNDKGLGPIPSRWKGHCQS--GDKFDPATACNRKLIGSKYYLKGFEAAAGRPAIKDPDFL  177

Query  1844  VSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPE  1665
               D  S  D  GH +  +S   GSF PNA+   +  G V+GGA  AR+A YK CWN    
Sbjct  178   RFDIASPRDRDGHDTHTSSTAGGSFTPNASYHRLGYGTVKGGAPKARIAMYKVCWNW---  234

Query  1664  RFV--CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPV  1491
               +  C  AD + AID AIHD VD++S+S+G  +PL +D++  NGI   SFHA+++GI V
Sbjct  235   -LIGGCTFADTMMAIDEAIHDGVDILSISLGLEIPLYADIDMRNGIAFASFHAVSKGITV  293

Query  1490  IVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHP  1311
             I + GN GP   T+ N+ PW++TVAAS+IDR F   ITLGN + ++       G ++   
Sbjct  294   ICSGGNEGPYPQTVVNISPWILTVAASSIDRSFPTLITLGNNQTFS-------GQSM---  343

Query  1310  LHFAGKYMGEADLMPRKLDPAE--------------VKGKIVFMF---GDDLDRNLVLVD  1182
               + GK  G   +  +++   E                GK+V  F   GD+L        
Sbjct  344   --YTGKETGFIGIAHQEISELEDTRFCNNLNTNDTWAAGKVVLCFIVKGDELYLPFTQ-Q  400

Query  1181  KATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
                + G +G+I + NP+    L  L    P ++V++D G+++ +YI + +  P  +L+  
Sbjct  401   VVQEVGGLGLIVAKNPTR--DLNYLTFDFPCIEVNFDVGSQLLNYI-RYSRKPQVKLNPT  457

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAA  825
             +  VG+ ++  +  FSSRGP+S AP I+KPDIAAPG  I+ A   +D  +R  SGTS AA
Sbjct  458   RTHVGQPVSTHLASFSSRGPNSVAPAILKPDIAAPGVNILAAVLPADTPYRFESGTSMAA  517

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYF-SPIFAKGSSLRAADAFDYGGGI  648
             PHVS IVALLK  HP WSPAAIKSALVTTAW +D +   P+ ++G+  + AD FD+GGG+
Sbjct  518   PHVSGIVALLKSLHPHWSPAAIKSALVTTAWVTDPHSGEPVISEGNPNKLADPFDFGGGL  577

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VN N A DPGLVYDM   DY  YLC++GYNNS I   I         ++   CP  RPS+
Sbjct  578   VNTNGAKDPGLVYDMGTFDYILYLCSMGYNNSAISMLI---------DQAASCPIKRPSI  628

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD+NLPS+ +P L K V  RRTVTNVGPVNS Y+AI++ P+G  + VKP+ L F+ + KK
Sbjct  629   LDVNLPSLTIPSLRKKV--RRTVTNVGPVNSKYEAIIEPPLGITIKVKPETLIFNSSTKK  686

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
              SFT+ +S      + + FGSLTW+DG+H VR+P +VR
Sbjct  687   ISFTITISTSHKYTTYYYFGSLTWTDGMHRVRSPTSVR  724



>ref|XP_002874635.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50894.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/765 (45%), Positives = 473/765 (62%), Gaps = 39/765 (5%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             K ++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MV+SYR+GFSGFAA LT SQ
Sbjct  28    KVVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDAHNSMVHSYRHGFSGFAAKLTKSQ  87

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AKK+A +  VV V+ D  +K+ T+R+WD+LGLS  A  P  LL +TN G+  I+GV+D+G
Sbjct  88    AKKIADLPDVVHVIPDSFYKLATTRTWDYLGLS--AANPKSLLHETNMGEQSIIGVIDTG  145

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   F D G GPVP  WKG C    G  F  S LCN+K+IGA++F  G   +++   
Sbjct  146   VWPESEVFNDNGFGPVPSHWKGGCEI--GENFTSS-LCNKKLIGAKYFING-FQAENESF  201

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     D  S  D  GHG+ V++I  GS+VPN +  G+  G VRGGA  AR+A YKACW 
Sbjct  202   NSTDSLDFISPRDFDGHGTHVSTIAGGSYVPNISYKGLAGGTVRGGAPRARIAMYKACWY  261

Query  1676  LDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             LD E    C+ AD+L A+D A+HD VDV+S+S+GS VPL+ + +  +G+  G+FHA+ +G
Sbjct  262   LDDEDITTCSSADILKAMDEAMHDGVDVLSISLGSEVPLSDETDIRDGMTTGAFHAVLKG  321

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ + GN+GP + T+TN  PW++TVAA+T+DR FA  +TLGN  K  +   +  G  L
Sbjct  322   ITVVCSGGNSGPDSLTVTNTAPWMVTVAATTLDRSFATPLTLGN-NKVILGQAMYTGPEL  380

Query  1319  --------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMF-----GDDLDRNLVLVDK  1179
                      +P +    + G  + +    +   ++GK+V  F     G    R    V +
Sbjct  381   GFTSLVYPENPGNSNESFSGTCEELLFNSN-RTMEGKVVLCFTTSPYGGAALRAARYVKR  439

Query  1178  ATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
                AG +GVI +        P  +   P V VD+  GT I  Y  +S+ +P  ++   K 
Sbjct  440   ---AGGLGVIIARHPGYAIQPCQD-DFPCVAVDWVLGTDILLYT-RSSGSPMVKIQPSKT  494

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT---SDGGFRISSGTSHA  828
              +G+ +  KV  FSSRGP+S AP I+KPDIAAPG  I+ A      SD GF + SGTS A
Sbjct  495   LIGQPVGTKVATFSSRGPNSIAPAILKPDIAAPGVSILAATTNTTFSDRGFIMLSGTSMA  554

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
             AP +S +VALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+
Sbjct  555   APAISGVVALLKALHRDWSPAAIRSAIVTTAWRTDPFGEQIFAEGSPPKLADPFDYGGGL  614

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VNP  A +PGLVYD+   DY  YLC++GYN + I + + G R        T+C   +PS+
Sbjct  615   VNPEKAANPGLVYDLGLEDYILYLCSVGYNETSISQLV-GKR--------TVCSNPKPSI  665

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD NLPS+ +P+L   VTL RT+TNVG + SVYK  V+ P+G  VTV P+ L F+   K+
Sbjct  666   LDFNLPSITIPNLKDEVTLTRTLTNVGLLKSVYKVAVEPPLGFKVTVTPETLVFNTRTKR  725

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SF ++VS    +N+ F FGSLTWSD +HNV  P++VR  I+  Y
Sbjct  726   VSFKVKVSTKHKINTGFYFGSLTWSDSMHNVTIPLSVRTQILQNY  770



>ref|XP_010528996.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=756

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/750 (44%), Positives = 462/750 (62%), Gaps = 40/750 (5%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIV+LG   HD    +  SH+ +L  ++GS E ARK+M+YSYR+GFSGFAA LT++QA+
Sbjct  36    VYIVHLGELRHDVPELVTRSHHGILEPLLGSGEAARKSMIYSYRHGFSGFAARLTSAQAR  95

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
              ++    VV +   +  K+QT+R++D+LGL+  A+ P  LL     G G I+GVVDSGI 
Sbjct  96    NLSEHPDVVHLSRSRIMKLQTTRAFDYLGLT--ASSPKGLLNDVAMGSGAIIGVVDSGIW  153

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVD-LN  1854
              E  SF D G+GP+P+RWKG C  I G +F+    CN+K+IGA+++ KG +  Q+ +  N
Sbjct  154   PESRSFNDEGLGPIPKRWKGKC--IGGDQFDPKVHCNKKLIGAKYYIKGLIQEQNNEPFN  211

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+  AS  AGSFV N +  G   G VRGGA  AR+A+YK CWN 
Sbjct  212   ASETGDFMSPRDKIGHGTHCASTAAGSFVQNVSRFGYAAGTVRGGAPHARIAAYKVCWNG  271

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   CA  D+L AID +I D VDVIS+S+G  +P   +++ ++     +FHA+ +GIP
Sbjct  272   GR----CASPDILKAIDQSIRDGVDVISLSLGGGLPANFEVDQKD-TSTAAFHAVMKGIP  326

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ AAGN GP++ T+ NV PW+ITVAA+ +DR F   +TLGN      +     G     
Sbjct  327   VVFAAGNEGPNSQTVDNVAPWIITVAAANMDRAFIAAMTLGNNRTIYAE-----GFFEGP  381

Query  1313  PLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYS-NP  1137
                F G  +   ++ P  +   ++KGK+V +F     R  + VD     G  G+I++ NP
Sbjct  382   ETGFVG-LVAVDEIKPLDIMEGKLKGKVVLVFDTSSGRGPI-VDIIKKEGCKGIIFAQNP  439

Query  1136  ----SNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
                       P LN       +DY+ G+ +  Y +Q+T +P  ++S  K  +G  ++ K+
Sbjct  440   YEKLERCKGFPCLN-------IDYELGSDLLLY-YQTTKSPVVKISRTKTVIGGPISTKI  491

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP-TSDGGFRISSGTSHAAPHVSAIVALLK  792
               FS RGP+S +P I+KPDIAAPG  I+ A P    G +   SGTS A P V+ IVALLK
Sbjct  492   ASFSCRGPNSVSPTILKPDIAAPGVNILAAIPGPGAGAYEFYSGTSMATPAVAGIVALLK  551

Query  791   ISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLV  612
             + HP WSPAAIKSAL+TTAW +D    PI ++ S  + AD FDYGGG+VNP  A DPGLV
Sbjct  552   MKHPHWSPAAIKSALITTAWRTDPSGEPIISETSPRKMADPFDYGGGLVNPEGASDPGLV  611

Query  611   YDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPD  432
             YD+   DYA YLCA G+++  I + +          +H  CP  RPSMLD+N+PS+ +P 
Sbjct  612   YDLGLHDYAHYLCAEGFDDMSIRRLL---------RKHKACPNPRPSMLDVNMPSITIPY  662

Query  431   LFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKL  252
             L + VT+ RTVTNVGPV+SVY+A+V++P+G  + VKP+ L F+   KK S+T+ VS    
Sbjct  663   LNEDVTITRTVTNVGPVDSVYRAVVEAPLGIKLVVKPETLVFNSQTKKVSYTVSVSTSHK  722

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             VN+ + FGSLTW+DG HNV  P++VR  I+
Sbjct  723   VNTGYLFGSLTWTDGTHNVAIPVSVRTKIM  752



>ref|XP_006829610.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
 gb|ERM97026.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
Length=732

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/757 (47%), Positives = 460/757 (61%), Gaps = 45/757 (6%)
 Frame = -3

Query  2375  LGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagv  2196
             +G K H+D   +++ H+ +L  ++GS E AR++MVYSYRYGFSGFAA LT +QAK ++G 
Sbjct  1     MGEKHHEDPDVVRDLHHSVLTTLLGSAEAARESMVYSYRYGFSGFAAKLTENQAKILSGF  60

Query  2195  agvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPS  2016
              GVV V+ ++ +K+ T+RSWDFLGL+    +P  LLRK N GDG+IVGV+DSG+  E  S
Sbjct  61    EGVVRVLPNRMYKLHTTRSWDFLGLNP--KLPSTLLRKANSGDGVIVGVIDSGVWPESES  118

Query  2015  FGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSD  1836
             F D GMGP+P+RWKG C+  PG +FN S  CNRK+IGARWF KG        L+  +  +
Sbjct  119   FNDKGMGPIPRRWKGICQ--PGKQFNSSN-CNRKLIGARWFVKGLEAQLGAPLSN-VPGE  174

Query  1835  SYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFV  1656
               S  D   HG+  AS   GS V +AT  G+ VG  RGGA  AR+A YK  W        
Sbjct  175   ILSARDSVDHGTHTASTAVGSPVTSATFRGLAVGTARGGAPLARLAVYKTAW----LGGS  230

Query  1655  CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDM-EAENGIGIGSFHAITRGIPVIVAA  1479
              + AD+L A DYAIHD VDV+S+S+G  +PL S + E  +GI IG+FHA+ RGI V+ + 
Sbjct  231   VSAADMLKAFDYAIHDGVDVLSLSLGVSLPLYSYVDEGPDGIMIGAFHAMARGITVVCSG  290

Query  1478  GNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---AVDWQLPN----GTAL  1320
             GN+GP   T+ +  PW++TVAASTIDR F   ITLGN   +   A++ +  +    G   
Sbjct  291   GNSGPEPQTVEDAAPWILTVAASTIDRTFPTAITLGNNHTFLGQAMNTEKKSEAFVGLVD  350

Query  1319  SHPLHFAGKYMGEA-DLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYS  1143
             S  L        EA   +   L      GK+V  F    D+    V     AG +GVI+ 
Sbjct  351   SKSLSTNDSVEDEARKCLSGYLRRGSATGKVVLCFTSMNDQAAQAV---ASAGGIGVIFV  407

Query  1142  NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPD  963
               S+    P     IP  +VDY  GT+I  YI Q++ +P  ++S  K  VG   +PKV  
Sbjct  408   QSSDTILSPC--KPIPCTEVDYQVGTQILFYI-QTSSSPVVKISHSKTLVGSIKSPKVAT  464

Query  962   FSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDG---GFRISSGTSHAAPHVSAIVALLK  792
             FSSRGP+S +P I+KPDIAAPG  I+ A P+ D     F   SGTS A PHV+ IVALL 
Sbjct  465   FSSRGPNSLSPAILKPDIAAPGVNILAAVPSPDSTSDKFMFMSGTSMACPHVAGIVALLM  524

Query  791   ISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLV  612
               HP+WSPAAIKSALVTTA   D    P+ A+G   + AD FDYGGG VNPN A DPGL+
Sbjct  525   SIHPDWSPAAIKSALVTTASTMDKNEEPMLAEGYPRKVADPFDYGGGHVNPNQAADPGLI  584

Query  611   YDMRGIDYAQYLCALGYNNSLI----YKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSM  444
             YDM   DY  + CA+GYNNS I     KTIS             CPK  PS+ ++NLPS+
Sbjct  585   YDMDISDYILFFCAMGYNNSAISLVTSKTIS-------------CPKDPPSIPNMNLPSI  631

Query  443   VVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS  264
             V+P+L   VT+ R VTNVG V+SVYKA+V+SP G  V V+PKVL F+       F +  +
Sbjct  632   VIPELKTSVTIARKVTNVGKVHSVYKAMVESPTGVKVVVEPKVLYFNEATIVLPFKVTFT  691

Query  263   ADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
                 +   +TFGSL WSDG H VR+PIAVR++I   Y
Sbjct  692   VVHQMQGDYTFGSLIWSDGEHFVRSPIAVRRVIYDSY  728



>ref|XP_009137200.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=766

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/768 (45%), Positives = 471/768 (61%), Gaps = 50/768 (7%)
 Frame = -3

Query  2423  NAKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSG  2244
             +AK L +N  K+YIVYLG + HDD   +  SH+++L  ++ S E+A  +M+Y Y++GFSG
Sbjct  32    SAKTL-DNDSKVYIVYLGERVHDDPELVTASHHEMLESLLESKEDAHNSMIYIYQHGFSG  90

Query  2243  FAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSE---------GANVPGEL  2091
             FAA+LT++QA K++    V+ V+ ++  K+QT+R+WD LGLS+           +V G L
Sbjct  91    FAALLTSTQANKISEHPEVIHVIPNRILKLQTTRTWDHLGLSQISTPFSSPSSTSVKG-L  149

Query  2090  LRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKV  1911
             L  TN G   I+GV+DSGI  E   F D G+GP+P+ W+G C  + G +FNE+  CN+K+
Sbjct  150   LHDTNMGSEAIIGVIDSGIWPESKVFNDQGLGPIPKLWRGKC--VSGEKFNETIHCNKKL  207

Query  1910  IGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGM  1731
             IGA+++  G L       N+ ++ D  S  D+ GHG+  A+I  GSFV NA+  G+  G 
Sbjct  208   IGAKYYVNGLLAEMGGKFNRTIIQDFKSSRDIIGHGTHTATIAGGSFVSNASYYGLAQGT  267

Query  1730  VRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDM  1551
             VRGGA  AR+A+YKACWN       C  AD+  A D AIHD VDV+SVS+G  +P   D 
Sbjct  268   VRGGAPKARIAAYKACWNGVEPAGGCTTADMWKAFDDAIHDGVDVLSVSIGGGIP--EDS  325

Query  1550  EAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLG  1371
             E +    I +FHA+T+GIPV+ AAGNAGP+A T+ NV PW++TVAA+T+DR F   ITLG
Sbjct  326   EVDKLDNIAAFHAVTKGIPVVAAAGNAGPAAQTVVNVAPWLLTVAATTLDRSFPTKITLG  385

Query  1370  NGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLV  1191
             N + +  +  L  G  +S  L F         L     D  ++KGK V +F         
Sbjct  386   NNQTFLAE-SLYTGPEISTGLAF---------LDSSSHDNVDMKGKTVLVFDS-------  428

Query  1190  LVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
                  T  G  GVI+S     D L         +  DY+ GT I  YI ++T +PT +++
Sbjct  429   -TTPITFKGVAGVIFSQKP--DDLLQRCHSFACIFADYELGTDILQYI-RTTRSPTVRIN  484

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISS  843
             S     G   T KV  FS RGP+S +P I+KPDIAAPG  I+ A    D     GF + +
Sbjct  485   SATTLTGLPATTKVAAFSCRGPNSVSPAILKPDIAAPGVSILAALSPFDSREHDGFGLDT  544

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFD  663
             GTS + P VS I+ALLK  HP WSPAA++SALVTTAW +     PIFA+GS+ + AD FD
Sbjct  545   GTSMSTPVVSGIIALLKSLHPNWSPAAVRSALVTTAWRTSPSGEPIFAEGSNKKLADPFD  604

Query  662   YGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPK  483
             YGGG+VNP  A  PGLVYDM   DY  Y+C+ GYN+S    +ISG   +      T CP 
Sbjct  605   YGGGLVNPQKASKPGLVYDMGIQDYINYMCSAGYNDS----SISGMVGKI-----TKCPN  655

Query  482   TRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFD  303
              +PS+LD+NLPS+ +P+L K VTL RTVTNVGP+ SVYKA+++SP+G  +TV P  L F 
Sbjct  656   PKPSILDMNLPSITIPNLEKKVTLTRTVTNVGPIKSVYKAVIESPLGITLTVTPNTLVFS  715

Query  302   GNRKK-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
                K+  +F ++      VN+ + FGSLTW+DGVH+V+ P++V+  I+
Sbjct  716   SAAKRVLTFKVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQTKIM  763



>ref|XP_011012404.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=789

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/770 (45%), Positives = 463/770 (60%), Gaps = 50/770 (6%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E  KK++IVY+G K H+D    K++H+++L+ ++GS E A+ +++YSYR+GFSGFAA +T
Sbjct  37    ETAKKVHIVYMGEKRHEDPATTKKTHFEMLSTLLGSKEAAQSSILYSYRHGFSGFAARIT  96

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
             ASQA ++A   GVV V+ +  HK+ T+RSW+F+GL    + P  LL ++N G G I+GV+
Sbjct  97    ASQAAEIAEFPGVVQVIPNGIHKLHTTRSWEFIGLEH--HSPQNLLTQSNMGQGTIIGVI  154

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             DSG+  E  SF D GMGPVP  WKG C+   G  F +S  CNRK+IGARWF KG      
Sbjct  155   DSGVWPESKSFHDEGMGPVPSHWKGICQQ--GEHF-KSYNCNRKIIGARWFVKG--FQDQ  209

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
                N     +  S  D  GHG+  AS  AG+FV  A+  G+  G+ RGGA  A +A YK 
Sbjct  210   THFNTTGSREFMSPRDGDGHGTHTASTAAGNFVAKASYKGLATGLARGGAPLAHLAIYKV  269

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN++ +   C  AD+L A D AIHD VD++SVS+G  +PL S ++  N I IGSFHA +
Sbjct  270   CWNIE-DGGGCTDADILKAFDKAIHDGVDILSVSIGINIPLFSYVDMRNSIAIGSFHATS  328

Query  1505  RGI-----------PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEK  1359
             +GI           PVI +AGN GP + T+ N  PW+ TVAASTIDR F   I LGN + 
Sbjct  329   KGITVVCSATLNGIPVICSAGNDGPISQTVANTAPWLTTVAASTIDRAFPTAIILGNNKT  388

Query  1358  YAVDWQLPNGTALSHPLHFAGKYMGE----------ADLMPRKLDPAEVKGKIVFMFGDD  1209
                  +  + T   H   F G    E           D  P  L+P    GKI+  F   
Sbjct  389   L----RGQSITKGKHNHRFVGLTYSERIALNPMVSSQDCQPGSLNPTLAAGKIILCFSKS  444

Query  1208  LDRNLVLVDKAT-DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTM  1032
               +++     +   AG VG+IY+   N D +  L   IP V+VDY+ GT+I  YI Q+  
Sbjct  445   DTQDMFSASGSVFQAGGVGLIYAQFHN-DGIE-LCEWIPCVKVDYEVGTQILSYIRQA-R  501

Query  1031  TPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSD  864
             +PTA+LS PK  VG+ ++P++  FSSRGPSS  P ++KPDIAAPG  I+ A    +    
Sbjct  502   SPTAKLSFPKTVVGKRVSPRLASFSSRGPSSITPEVLKPDIAAPGVDILAAYTPANKDHG  561

Query  863   GGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSL  684
               +   SGTS A PHVS IVAL+K  HP WSPAAI+SALVTTA  + T    IF +GS+ 
Sbjct  562   NSYEFLSGTSMACPHVSGIVALIKSLHPNWSPAAIRSALVTTASQTGTDGMKIFEEGSTR  621

Query  683   RAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTE  504
             + AD FD GGG VNP  A  PGLVYD    +Y QYLC++GY++S I +  +   N     
Sbjct  622   KEADPFDMGGGHVNPEKAAYPGLVYDTTTEEYIQYLCSIGYSSSSITRLTNTKIN-----  676

Query  503   EHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVK  324
                 C K   + L+LNLPS+ +P+L   VT+ R VTNVG VNSVYKAIV++P+G  + V+
Sbjct  677   ----CMKNTNTRLNLNLPSITIPNLKTKVTVTRKVTNVGNVNSVYKAIVQAPIGISLAVE  732

Query  323   PKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             P+ L F+   K  SF +   + + V   + FGSL W+DG H VR+PI+VR
Sbjct  733   PQTLSFNRINKILSFRVTFLSSQKVQGEYRFGSLIWTDGEHFVRSPISVR  782



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/763 (44%), Positives = 464/763 (61%), Gaps = 55/763 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H D   + +SH+ +L  ++GS ++A  +MVYSYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHHDPEFVTKSHHQMLWSLLGSKKDAHDSMVYSYRHGFSGFAAKLTKSQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V+ D  +++ T+R+WD+LGLS  +  P  LL  TN GD +I+GV+D+G+
Sbjct  88    KKIADLPEVVHVIPDGFYELATTRTWDYLGLSAAS--PKNLLNDTNMGDQVIIGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P++WKG C +    R   S  CNRK+IGA++F KG  L+ +   N
Sbjct  146   WPESESFNDNGVGPIPRKWKGGCESGENFR---STNCNRKLIGAKYFMKG-FLAXNKGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VASI  GSFVPN +   +  G +RGGA  ARVA YKACW L
Sbjct  202   STKSPDYISARDFDGHGTHVASIAGGSFVPNVSYKALAGGTLRGGAPRARVAMYKACWYL  261

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +  +   C  +D++ AID A+HD VDV+S+S+   VPL  + +  N    G FHA+ +GI
Sbjct  262   EELDGVTCVNSDIMKAIDEAMHDGVDVLSISLVGQVPLLPETDMLNEFATGLFHAVAKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ A GN GP A T+ N+ PW++TVAA+T+DR F   ITLGN           N   L 
Sbjct  322   VVVCAGGNDGPEAQTVVNIAPWILTVAATTLDRSFPTPITLGN-----------NKVILG  370

Query  1316  HPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNP  1137
                 + G  +G   L    + PA+            +  +L L    T AG V + ++  
Sbjct  371   QAT-YTGPKLGLTSL----VYPADAGNS------SGVCESLNLNSNHTMAGKVVLCFTTS  419

Query  1136  SNVDSLPILNARI-----------PYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
                 ++P   + +           P V +DY+ GT I  YI +ST +P  ++   +   G
Sbjct  420   RTNTAIPTAASFVKTAGGLGXDDFPCVAIDYELGTDILAYI-RSTRSPVVKIQPSRTLFG  478

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAP  822
             + +  KV +FSSRGP+S +P I+KPDIAAPG +I+ A       S GGF I SGTS A P
Sbjct  479   QPVGTKVVNFSSRGPNSMSPVILKPDIAAPGVRILAATSPNSTLSAGGFAILSGTSMATP  538

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S ++ALLK  HP+WSPAA +SA+VTTAW +D +   IFA+GS  + AD FDYGGG+VN
Sbjct  539   AISGVIALLKALHPDWSPAAFRSAIVTTAWRTDPFGEQIFAEGSFSKVADPFDYGGGLVN  598

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A +PGL+YDM   DY  YLC+ GYN+S I + +          E T+C   +PS+LD
Sbjct  599   PEKAAEPGLIYDMGSEDYKLYLCSAGYNDSSISQLVG---------EVTVCSNPKPSVLD  649

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             +NLPS+ +P+L   VTL RTVTNVGPV+SVYK +V+ P+G +V V P++L F+   K  S
Sbjct  650   VNLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVVVEPPLGVIVVVTPEILVFNSKFKSVS  709

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             FT+RVS    +N+ +   SLTW+D VHNV  P++VR  I+  Y
Sbjct  710   FTVRVSTTHKINTGYX-SSLTWTDSVHNVIIPVSVRTQILQNY  751



>ref|NP_564412.1| Subtilase 3.5 [Arabidopsis thaliana]
 sp|Q9MAP7.1|SBT35_ARATH RecName: Full=Subtilisin-like protease SBT3.5; AltName: Full=Subtilase 
subfamily 3 member 5; Short=AtSBT3.5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31278.1|AC006424_7 First of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAL67022.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAP04132.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE31542.1| Subtilase 3.5 [Arabidopsis thaliana]
Length=774

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/763 (46%), Positives = 479/763 (63%), Gaps = 36/763 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L+ ++GS  +A ++MVYSYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPEFVSESHHQMLSSLLGSKVDAHESMVYSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    VV V+ D  +++ T+R+WD+LGLS  AN P  LL  TN GD +I+G +D+G+
Sbjct  88    KKLADSPEVVHVMADSFYELATTRTWDYLGLSV-AN-PNNLLNDTNMGDQVIIGFIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P  WKG C +  G +F  +  CNRK+IGA++F  G  L+++   N
Sbjct  146   WPESESFNDNGVGPIPSHWKGGCES--GEKFISTN-CNRKLIGAKYFING-FLAENEGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+  ASI  GSFVPN +  G+  G +RGGA  AR+A YKACW +
Sbjct  202   TTESRDYISARDFIGHGTHTASIAGGSFVPNISYKGLAGGNLRGGAPRARIAIYKACWYV  261

Query  1673  DPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D    V C+ +D+L A+D ++HD VDV+S+S+G+ +PL  + +  + I  G+FHA+ +GI
Sbjct  262   DQLGAVACSSSDILKAMDESMHDGVDVLSLSLGAQIPLYPETDLRDRIATGAFHAVAKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG----  1329
              V+ A GN+GP+A T+ N  PW+ITVAA+T+DR F   ITLGN  K  +   L  G    
Sbjct  322   IVVCAGGNSGPAAQTVLNTAPWIITVAATTLDRSFPTPITLGN-RKVILGQALYTGQELG  380

Query  1328  -TALSHPLHFAGKYMGEADLMPR-KLDPAE-VKGKIVFMFGDDLDRNLVLVDKATD----  1170
              T+L +P +        + +  R  L+P   + GK+V  F    +     V +A      
Sbjct  381   FTSLVYPENAGFTNETFSGVCERLNLNPNRTMAGKVVLCF--TTNTLFTAVSRAASYVKA  438

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             AG +GVI +     +  P  +   P V +DY+ GT +  YI +ST +P  ++   +  VG
Sbjct  439   AGGLGVIIARNPGYNLTPCRD-DFPCVAIDYELGTDVLLYI-RSTRSPVVKIQPSRTLVG  496

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHAAP  822
             + +  KV  FSSRGP+S +P I+KPDI APG  I+ A  P S+   GGF I +GTS AAP
Sbjct  497   QPVGTKVATFSSRGPNSISPAILKPDIGAPGVSILAATSPDSNSSVGGFDILAGTSMAAP  556

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              V+ +VALLK  HP WSPAA +SA+VTTAW +D +   IFA+GSS + AD FDYGGGIVN
Sbjct  557   VVAGVVALLKALHPNWSPAAFRSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDYGGGIVN  616

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A DPGL+YDM   DY  YLC+ GYN+S I + + GN         T+C   + S+LD
Sbjct  617   PEKAADPGLIYDMGPRDYILYLCSAGYNDSSITQLV-GNV--------TVCSTPKTSVLD  667

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             +NLPS+ +PDL   VTL RTVTNVG V+SVYK +V+ P+G  V V P+ L F+   K  S
Sbjct  668   VNLPSITIPDLKDEVTLTRTVTNVGTVDSVYKVVVEPPLGIQVVVAPETLVFNSKTKNVS  727

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             FT+RVS    +N+ F FG+L W+D +HNV  P++VR  I+  Y
Sbjct  728   FTVRVSTTHKINTGFYFGNLIWTDSMHNVTIPVSVRTQILQNY  770



>ref|XP_006413751.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
 gb|ESQ55204.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
Length=766

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/760 (45%), Positives = 464/760 (61%), Gaps = 52/760 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             +N  K+YIVYLG + HDD   +  SH+ +L     S E+A  +++YSY++GFSGFAA+LT
Sbjct  36    DNNSKVYIVYLGEREHDDPEVVTASHHQMLESFFESKEDAHNSIIYSYQHGFSGFAAILT  95

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGE----------LLRKTN  2076
              SQAKK++    V+ V+ ++  K+QT+R+WD LGLS    +P            LL  TN
Sbjct  96    PSQAKKISEHPSVIHVIPNRILKLQTTRTWDHLGLSR---IPTSLSTSSTSSKGLLHDTN  152

Query  2075  KGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARW  1896
              G   I+GV+D+GI  E     D G+GP+P+RW+G C  + G +FN +  CN K+IGA++
Sbjct  153   MGSEAIIGVMDTGIWPESKVVEDQGLGPIPKRWRGKC--VSGDQFNATIHCNNKLIGAKF  210

Query  1895  FFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGA  1716
             +  G L   +   N   + +  S  D +GHG+  A+I  GSFV N +  G+  G VRGGA
Sbjct  211   YLDGLLAETEGKFNITELQEFKSNRDASGHGTHTATIAGGSFVHNVSFYGLAGGTVRGGA  270

Query  1715  TAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENG  1536
               AR+ASYK CW+       C  AD+  A D AIHDRVDV+SVS+G  +P  S+++A + 
Sbjct  271   PRARIASYKVCWS----GVGCTTADMWKAYDDAIHDRVDVLSVSLGGHIPEDSEVDALDF  326

Query  1535  IGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY  1356
             I   +FHA+ +GIPV+ AAGN GP A T+ NV PW +TVAA+T+DR F   ITLGN + +
Sbjct  327   IA--AFHAVAQGIPVVAAAGNYGPRAQTVLNVAPWFLTVAATTLDRSFPTKITLGNNQTF  384

Query  1355  AVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKA  1176
              V+  L  G  +S  L F   Y  E      ++D   VKGK + +F          +D  
Sbjct  385   FVE-SLYTGPEISTGLAFLNPYSDE------RID---VKGKTIIVFDTHFPMG---IDSL  431

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYV-QVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
              + G VG+I +     D L +     P V   DY+ GT I  YI ++T +PT ++S+ K 
Sbjct  432   FNIGVVGIILAQKP--DDLILECHDSPCVFTTDYELGTDILQYI-RTTRSPTVRISAAKS  488

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDG---GFRISSGTSH  831
               G   T KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P   G   GF + +GTS 
Sbjct  489   LTGPPATTKVAAFSSRGPNSVSPAILKPDIAAPGVNILAALSPLHLGAYNGFGLETGTSM  548

Query  830   AAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGG  651
             + P VS IVALLK  HP WSPAAI+SALVTTAW +     PIFA+GS+ + AD FDYGGG
Sbjct  549   STPVVSGIVALLKSLHPHWSPAAIRSALVTTAWRTSPSGEPIFAEGSNKKLADPFDYGGG  608

Query  650   IVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
             +VNP  A  PGLVYDM    Y  Y+C+ GYN+S I + +          + TICP   PS
Sbjct  609   LVNPEKAAKPGLVYDMGIEGYISYMCSAGYNDSSISRVLG---------KKTICPTPEPS  659

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
             +LD+NLPS+ +P+L + VTL RTVTNVGP+ SVYKA+V+SP+G  +TV P  L F    K
Sbjct  660   ILDINLPSITIPNLEEEVTLTRTVTNVGPIKSVYKAVVESPLGINLTVSPTTLVFSSATK  719

Query  290   K-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             +  +FT++      VN+ + FGSLTW+DGVHNV  P++V+
Sbjct  720   RVLTFTVKAKRSHKVNTGYFFGSLTWTDGVHNVTIPVSVK  759



>ref|XP_002317660.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
 gb|EEE98272.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
Length=786

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/770 (44%), Positives = 462/770 (60%), Gaps = 50/770 (6%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E  KK++IVY+G K H+D    K+ HY++L+ ++GS E AR +++YSYR+GFSGFAA LT
Sbjct  37    EATKKVHIVYMGEKEHEDPAITKKIHYEMLSTLLGSKEAARSSILYSYRHGFSGFAARLT  96

Query  2225  asqakkvagvagv--------vsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKG  2070
              SQA+ +AG   V        V V+ +  HK+ T+RSW+F+GL+  +  P  LLR++N G
Sbjct  97    ESQAEDIAGTIIVDNSKFPGVVQVIPNGIHKLHTTRSWEFIGLNHHS--PQNLLRQSNMG  154

Query  2069  DGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFF  1890
              G I+GV+DSG+  E  SF D GMGPVP  WKG C+   G  FN S  CNRK+IGARWF 
Sbjct  155   QGTIIGVIDSGVWPESKSFHDEGMGPVPSHWKGICQQ--GESFNSSN-CNRKIIGARWFV  211

Query  1889  KGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATA  1710
             KG      +  N     +  S  D  GHGS  AS  AG+FV   +  G+  G+ RGGA  
Sbjct  212   KG--FQDQLPFNTTESREFMSPRDGEGHGSHTASTAAGNFVEKVSYKGLAAGLARGGAPL  269

Query  1709  ARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIG  1530
             A +A YK CWN+  E   C  ADLL A D AIHD VD++SVS+G+ +PL S ++  N I 
Sbjct  270   AHLAIYKVCWNI--EDGGCTDADLLKAFDKAIHDGVDILSVSIGNNIPLFSYVDMRNSIA  327

Query  1529  IGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAV  1350
             IGSFHA   GI VI +AGN GP + T+ N  PW+ITVAASTIDR F   ITLGN +    
Sbjct  328   IGSFHATLNGISVICSAGNDGPISQTVENTAPWLITVAASTIDRTFPTAITLGNNKTL--  385

Query  1349  DWQLPNGTALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDLD  1203
              W     T   H   FA     E            D  P  L+     GKI+    +   
Sbjct  386   -WGQSITTG-QHNHGFASLTYSERIPLNPMVDSAKDCQPGSLNATLAAGKIILCLSESNT  443

Query  1202  RNLVLVDKAT-DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTP  1026
             +++     +  +AG VG+I+    ++D + +   +IP V+VDY+ GT+I  YI +   +P
Sbjct  444   QDMFSASTSVFEAGGVGLIFVQ-FHLDGMEL--CKIPCVKVDYEVGTQIVSYI-RKARSP  499

Query  1025  TAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDG----G  858
             TA+L+ PK  VG+ ++P++  FSSRGPSS +P ++KPDIAAPG  I+ A   ++      
Sbjct  500   TAKLNFPKTVVGKRVSPRLASFSSRGPSSISPEVLKPDIAAPGVDILAAHRPANKDQVDS  559

Query  857   FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRA  678
             +   SGTS A PHV+ IVAL+K  HP WSPAAI+SALVTTA  + T    IF +GS+ + 
Sbjct  560   YAFLSGTSMACPHVTGIVALIKSLHPNWSPAAIRSALVTTASQTGTDGMKIFEEGSTRKE  619

Query  677   ADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEH  498
             AD FD GGG VNP  A  PGLVYD    +Y Q+LC++GY++S + +  +   N       
Sbjct  620   ADPFDIGGGHVNPEKAVYPGLVYDTNTKEYIQFLCSMGYSSSSVTRLTNATIN-------  672

Query  497   TICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPK  318
               C K   + L+LNLPS+ +P+L     + R VTNVG VNSVYKAIV++P G  + V+P 
Sbjct  673   --CMKKANTRLNLNLPSITIPNLKTSAKVARKVTNVGNVNSVYKAIVQAPFGINMRVEPT  730

Query  317   VLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
              L F+ N K  S+ +   + + V   + FGSLTW+DG H VR+PI+VR M
Sbjct  731   TLSFNMNNKILSYEVTFFSTQKVQGGYRFGSLTWTDGEHFVRSPISVRAM  780



>ref|NP_567358.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40044.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78174.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82892.1| Subtilase family protein [Arabidopsis thaliana]
Length=765

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/782 (44%), Positives = 477/782 (61%), Gaps = 43/782 (5%)
 Frame = -3

Query  2438  RSVGTNAKVLKENGKKI---YIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVY  2268
             R+V     VL+     I   +IVYLG K HDD   + ESH+ +L  ++GS EEA  +MV+
Sbjct  3     RAVSCREPVLRARYSTIIYVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEEAHGSMVH  62

Query  2267  SYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELL  2088
             S+R+GFSGFAA LT SQAKK+A +  VV V+ D+ +K  T+R+WD+LGLS     P  LL
Sbjct  63    SFRHGFSGFAAKLTESQAKKIADLPEVVHVIPDRFYKPATTRTWDYLGLS--PTNPKNLL  120

Query  2087  RKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVI  1908
              +TN G+ MI+G++DSG+  E   F D  +GPVP  WKG C +  G  FN S  CN+K+I
Sbjct  121   NQTNMGEQMIIGIIDSGVWPESEVFNDNEIGPVPSHWKGGCES--GEDFNSSH-CNKKLI  177

Query  1907  GARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMV  1728
             GA++F   A L+     N     D  S     GHG+ VA+I  GS+VPN +  G+  G V
Sbjct  178   GAKYFIN-AFLATHESFNSSESLDFISPRGYNGHGTHVATIAGGSYVPNTSYKGLAGGTV  236

Query  1727  RGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDME  1548
             RGGA  AR+A YK CW LD +   C+ AD+L A+D AIHD VDV+S+S+G   PL  + +
Sbjct  237   RGGAPRARIAVYKTCWYLDLDIAACSSADILKAMDEAIHDGVDVLSLSLGFE-PLYPETD  295

Query  1547  AENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN  1368
               +GI  G+FHA+ +GI V+ AAGNAGP+A T+ N  PW++TVAA+T+DR F   +TLGN
Sbjct  296   VRDGIATGAFHAVLKGITVVCAAGNAGPAAQTVGNTAPWILTVAATTLDRSFVTPMTLGN  355

Query  1367  GEKYAVDWQLPNGT-----ALSHPLHFAGKYMGEADLMPRKLDPAE--VKGKIVFMFGDD  1209
               K  +   +  GT     +L +P +        +    R L  +   + GK+V  F + 
Sbjct  356   -NKVILGQAIYTGTEVGFTSLVYPENPGNSNESFSGTCERLLINSNRTMAGKVVLCFTES  414

Query  1208  -----LDRNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYI  1047
                  + R    V +A   G +GVI +  P NV   P L+   P V VDY+ GT I  YI
Sbjct  415   PYSISVTRAAHYVKRA---GGLGVIIAGQPGNVLR-PCLD-DFPCVAVDYELGTYILFYI  469

Query  1046  FQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT-  870
              +S  +P  ++   +  +G+ +  KV  FSSRGP+  +  I+KPDIAAPG  I+ A  T 
Sbjct  470   -RSNGSPVVKIQPSRTLIGQPVGTKVASFSSRGPNPISAAILKPDIAAPGVSILAATTTN  528

Query  869   ---SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFA  699
                +D GF   SGTS A P +S IVALLK  HP+WSPAAI+SA+VTTAW +D +   IFA
Sbjct  529   TTFNDRGFIFLSGTSMATPTISGIVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIFA  588

Query  698   KGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRN  519
             +GS  + AD FDYGGG+VNP  A  PGLVYD+   DY  Y+C++GYN + I + +     
Sbjct  589   EGSPRKPADPFDYGGGLVNPEKATKPGLVYDLGLEDYVLYMCSVGYNETSISQLVG----  644

Query  518   RSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGA  339
                  + T+C   +PS+LD NLPS+ +P+L + VTL RT+TNVGP+ SVY+  V+ P+G 
Sbjct  645   -----KGTVCSYPKPSVLDFNLPSITIPNLKEEVTLPRTLTNVGPLESVYRVAVEPPLGT  699

Query  338   VVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVP  159
              VTV P+ L F+   K+ SF + VS    +N+ + FGSLTWSD +HNV  P++VR  ++P
Sbjct  700   QVTVTPETLVFNSTTKRVSFKVSVSTTHKINTGYYFGSLTWSDSLHNVTIPLSVRTQLLP  759

Query  158   LY  153
              Y
Sbjct  760   YY  761



>ref|XP_010529681.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X3 [Tarenaya 
hassleriana]
Length=704

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/727 (45%), Positives = 445/727 (61%), Gaps = 31/727 (4%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++GS E A  +MVYSYR+GFSGFAA LT  +A++++ +  VV VV D+ +++ T+R
Sbjct  1     MLCSLLGSEEAAHDSMVYSYRHGFSGFAAKLTEYEAEQISELPEVVHVVLDQFYQLTTTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             +WD+LGLS     P  LL +TN G+ +I GV+DSGI  E  S  D GMG +P RWKG C 
Sbjct  61    TWDYLGLSP--KHPKNLLYETNMGNQVIAGVIDSGIWPESESLNDKGMGSIPSRWKGGCE  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
             +  G  FN S  CNRK+IGA++F  G  ++ + DLN     +  S  D  GHG+ VA+ +
Sbjct  119   S--GQMFNPSTHCNRKLIGAKFFIDG-FIASNGDLNTTENPEYVSPKDFDGHGTHVATTI  175

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDP-ERFVCAGADLLAAIDYAIHDR  1605
             AGSFVPN T LG   G++RGGA  A +A YKACW++       C+ AD+L AID AI D 
Sbjct  176   AGSFVPNVTYLGFAGGIIRGGAPLAHIAMYKACWHVTAIGTATCSSADMLKAIDEAIKDG  235

Query  1604  VDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVI  1425
             VDVIS+S+   VPL  +++  +GI +G+FHA+ RGIPV+ A GNAGP+A TI N  PW++
Sbjct  236   VDVISISIAFSVPLFPEIDIRDGIAVGAFHAVARGIPVVCAGGNAGPAAQTIVNTAPWIL  295

Query  1424  TVAASTIDRIFAYTITLGNG-EKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPA  1248
             TVAA+T+DR F   ITLGN       +  + +G   +  ++    + G+ + +    +  
Sbjct  296   TVAATTLDRSFPTPITLGNNITILGQELYVGSGLGFTPLVYPESPFSGDCEKLSANPN-R  354

Query  1247  EVKGKIVFMFGDDLDRNLVLV--DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYD  1074
              + GK+V  F    D + V+      ++AG +GVI +   N   L +         +DY+
Sbjct  355   TMAGKVVLCFTTKTDPSAVISAGKAVSEAGGLGVIVAR--NPGHLLVPCVDFACAAIDYE  412

Query  1073  AGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGD  894
              GT I  YI +ST +P  ++   +  VG  +  KV  FSSRGP+S  P I+K        
Sbjct  413   LGTDILFYI-RSTKSPVVKIQPSRTLVGPPVATKVATFSSRGPNSITPAILK--------  463

Query  893   KIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYF  714
              +   D    GGF + SGTS A P VS IVALL+  HP WSPAAI+SA+VTTAW +D   
Sbjct  464   -VSLNDSLGAGGFVLKSGTSMATPVVSGIVALLRALHPNWSPAAIRSAIVTTAWKTDPSG  522

Query  713   SPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTI  534
              PIFA GS+ + AD FDYGGG+VNP  A DPGLVYDM   DY  Y+C++GY +  I   +
Sbjct  523   EPIFADGSNRKLADPFDYGGGLVNPEKATDPGLVYDMGTSDYIHYMCSVGYKDPSISLVV  582

Query  533   SGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVK  354
                       + TICP   PS+LDLNLPS+ +PDL   VT+ RTVTNVGP NSVYK ++ 
Sbjct  583   G---------KATICPHPNPSVLDLNLPSITIPDLSGEVTITRTVTNVGPRNSVYKVVID  633

Query  353   SPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
              P G  + V PK L F+   ++ SFT+RVS    VN+ F FGSLTW+D VHNV  P++VR
Sbjct  634   PPSGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAIPVSVR  693

Query  173   KMIVPLY  153
               I+P Y
Sbjct  694   TQILPRY  700



>ref|XP_002872521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=766

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/783 (44%), Positives = 483/783 (62%), Gaps = 44/783 (6%)
 Frame = -3

Query  2438  RSVGTNAKVLKEN---GKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVY  2268
             R+V    +VL+E       ++IVYLG K HDD   + +SH+ +L  ++GS E+A  +MV+
Sbjct  3     RAVSWRERVLRERYSIDNYVHIVYLGEKQHDDPELVTKSHHRMLWSLLGSKEDAHNSMVH  62

Query  2267  SYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELL  2088
             ++R+GFSGFAA LT SQAKK+A +  VV V+ DK +K  T+R+WD+LGLS  A  P  LL
Sbjct  63    NFRHGFSGFAAKLTESQAKKIADLPEVVHVIPDKFYKPATTRTWDYLGLS--ATNPKNLL  120

Query  2087  RKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVI  1908
              +T  G+ MI+G++D+G+  E   F D G+GPVP  WKG C +  G  FN S  CN+K+I
Sbjct  121   SETIMGEQMIIGIIDTGVWPESEVFNDNGIGPVPSHWKGGCES--GEDFNSSH-CNKKLI  177

Query  1907  GARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMV  1728
             GA++F  G  L+++   N     D  S     GHG+ VA+I  GS+VPN +  G+  G V
Sbjct  178   GAKYFING-FLAENESFNFTESLDFISPRGYNGHGTHVATIAGGSYVPNISYKGLAGGTV  236

Query  1727  RGGATAARVASYKACWNLDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDM  1551
             RGGA  AR+A YK C  LD      C+ AD+L A+D AIHD VDV+S+S+G   PL  + 
Sbjct  237   RGGAPRARIAVYKTCLYLDDLDITSCSSADILKAMDEAIHDGVDVLSLSLGFE-PLYPET  295

Query  1550  EAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLG  1371
             +  +GI  G+FHA+ +GI V+ AAGNAGP+A T+TN+ PW+ITVAA+T+DR F   +TLG
Sbjct  296   DVRDGIATGAFHAVLKGITVVCAAGNAGPAAQTVTNLAPWIITVAATTLDRSFVTPMTLG  355

Query  1370  NGEKYAVDWQLPNG-----TALSHPLHFAGKYMGEADLMPRKLDPAE--VKGKIVFMFGD  1212
             N  K  +   +  G     T+L +P +        +    R L  +   + GK+V  F +
Sbjct  356   N-NKVILGQAIYTGPEVAFTSLVYPENPGNSNESFSGTCERLLINSNRTMAGKVVLCFTE  414

Query  1211  D-----LDRNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDY  1050
                   + R    V +A   G +GVI +  P NV   P L+   P V VDY+ GT I  Y
Sbjct  415   SPYSISVSRAARYVKRA---GGLGVIIAGQPGNVLR-PCLD-DFPCVSVDYELGTYILFY  469

Query  1049  IFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT  870
             I +S  +P  ++   +  +G+ +  KV  FSSRGP+  +  I+KPDIAAPG  I+ A  T
Sbjct  470   I-RSNGSPVVKIQPSRTLIGQPVGTKVASFSSRGPNPISAAILKPDIAAPGVSILAATTT  528

Query  869   ----SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIF  702
                 +D GF   SGTS A P +S +VALLK  HP+WSPAAI+SA+VTTAW +D +   IF
Sbjct  529   NTTFNDRGFIFLSGTSMATPTISGVVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIF  588

Query  701   AKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNR  522
             A+GS  + AD FDYGGG+VNP  A  PGLVYD+   DY  Y+C++GYN S I + +    
Sbjct  589   AEGSPRKPADPFDYGGGLVNPEKATKPGLVYDLGLEDYVLYMCSIGYNESSISQLVG---  645

Query  521   NRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVG  342
                   + T+C   +PS+LD NLPS+ +P+L + VTL RT+TNVGP++SVY+  V+ P+G
Sbjct  646   ------KGTVCSNPKPSVLDFNLPSITIPNLKEEVTLTRTLTNVGPLDSVYRVAVELPLG  699

Query  341   AVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
               VTV P+ L F+   K  SF +RVS    +N+ + FGSLTWSD +HNV  P++VR  ++
Sbjct  700   IQVTVTPETLVFNSTTKGVSFKVRVSTTHKINTGYYFGSLTWSDSLHNVTIPLSVRTQLL  759

Query  161   PLY  153
             P Y
Sbjct  760   PYY  762



>emb|CBI34615.3| unnamed protein product [Vitis vinifera]
Length=737

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/763 (44%), Positives = 473/763 (62%), Gaps = 51/763 (7%)
 Frame = -3

Query  2375  LGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagv  2196
             +G K H+D   IK+ H+++L+ ++GS E A+ +++YSY++GFSGFAA LT SQA+ +AG 
Sbjct  1     MGEKKHEDPATIKKCHHEMLSTLLGSKEAAKSSILYSYKHGFSGFAAKLTESQAEDIAGF  60

Query  2195  agvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPS  2016
              GVV V+ ++ H++ T+RSWDFLGL    + P  +L +TN G G+I+GV+DSG+  E  S
Sbjct  61    PGVVQVIPNRIHRLHTTRSWDFLGLQH--DYPTNVLTETNLGRGVIIGVIDSGVWPESES  118

Query  2015  FGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFL-VS  1839
             F D GMGP+P RWKG C+   G RFN +  CNRK+IGARWFFKG  + Q++   KF+ ++
Sbjct  119   FKDEGMGPIPSRWKGICQH--GERFNSTN-CNRKLIGARWFFKG--IHQEI--GKFMNIT  171

Query  1838  DSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDP  1668
             D+    S  D  GHG+  AS  AG FV  A   G+  G+ RGGA  AR+A YKACW +  
Sbjct  172   DNLEFLSPRDGIGHGTHTASTAAGYFVEKANYRGLATGLARGGAPLARLAIYKACWAIIS  231

Query  1667  ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVI  1488
                 C+ AD+L A D AIHD VD++S+SVG+ +PL S ++  + I I SFHAI +GI V+
Sbjct  232   G--ACSDADILKAFDKAIHDGVDILSLSVGNDIPLFSYVDQRDSIAIASFHAIAKGITVV  289

Query  1487  VAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPL  1308
              +AGN GP + TI N  PW+ITVAA+TIDR F   I LGN + + +   +  G    H L
Sbjct  290   CSAGNDGPFSQTIANTAPWLITVAATTIDRAFPTAIILGNNQTF-LGQSIDTG---KHKL  345

Query  1307  HFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT-DAG  1164
              F G    E            D  P  L+     GKI+  F     ++++    A  +AG
Sbjct  346   GFTGLTYSERVALDPKDDSAKDCQPGSLNATLAAGKIILCFSKSDKQDIISASGAVLEAG  405

Query  1163  AVGVIYSN--PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
              +G+I++    S ++S  +    IP ++V+Y+ GT+I  YI +   +PTA+L  PK   G
Sbjct  406   GIGLIFAQFPTSQLESCDL----IPCIKVNYEVGTQILTYI-RKARSPTAKLKFPKTVTG  460

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAP  822
             +  +P V  FSSRGPSS +P ++KPD+AAPG  I+ A    D  +  GF   SGTS A P
Sbjct  461   KWASPHVAYFSSRGPSSMSPAVLKPDVAAPGVNILAAYSPVDAGTSNGFAFLSGTSMACP  520

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
             HVS + AL+K +HP WSPAAI+SALVT+A  + T    I  +G + +AAD FD GGG VN
Sbjct  521   HVSGLAALIKSAHPTWSPAAIRSALVTSASQTGTDGMDIIEEGPTRKAADPFDIGGGHVN  580

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             PN A  PGL+Y++   DY Q+LC++GY+N  I +          T+  T C +     L+
Sbjct  581   PNKALKPGLIYNISMEDYIQFLCSMGYSNPSIGRL---------TKTTTNCTRGSHFQLN  631

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             LNLPS+ +P+L K VT+ RTVTNVG +NSVYKA V++P G  + V+P +L F+   +   
Sbjct  632   LNLPSITIPNLKKKVTVMRTVTNVGHINSVYKAEVQAPYGIKMAVEPHILSFNLTTQFLH  691

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F +   + + V+  + FGSLTW+DG H VR+PIA+R +   +Y
Sbjct  692   FKVTFFSTQTVHGDYKFGSLTWTDGEHFVRSPIAIRAIKFDMY  734



>ref|NP_567632.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB36807.1| serine protease-like protein [Arabidopsis thaliana]
 emb|CAB81270.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AEE84483.1| Subtilase family protein [Arabidopsis thaliana]
Length=772

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/771 (43%), Positives = 468/771 (61%), Gaps = 58/771 (8%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGV-------------VGSHEEARKAMVYS  2265
             ++  K+YIVYLG + HDD      SH+ +L  +             + S ++A  +++YS
Sbjct  34    DSDSKVYIVYLGEREHDDPELFTASHHQMLESLLQRSTSLTCVSNDIYSKDDAHNSLIYS  93

Query  2264  YRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGE---  2094
             Y+YGFSGFAA+LT+SQAKK++    V+ V+ ++  K++T+R+WD LGLS           
Sbjct  94    YQYGFSGFAALLTSSQAKKISEHPEVIHVIPNRILKLKTTRTWDHLGLSPNPTSFSSSSS  153

Query  2093  ---LLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELC  1923
                LL +TN G   I+GVVD+GI  E   F D G+GP+PQRW+G C +  G +FN    C
Sbjct  154   AKGLLHETNMGSEAIIGVVDTGIWPESKVFNDHGLGPIPQRWRGKCES--GEQFNAKIHC  211

Query  1922  NRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGI  1743
             N K+IGA+++  G L       N+ ++ D  S  D  GHG+  A+I  GSFVPN +  G+
Sbjct  212   NNKLIGAKYYLSGLLAETGGKFNRTIIQDFKSNRDAIGHGTHTATIAGGSFVPNVSFYGL  271

Query  1742  DVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPL  1563
               G VRGGA  AR+ASYK CWN+     +C  AD+  A D AIHD+VDV+SVS+G+ +P 
Sbjct  272   ARGTVRGGAPRARIASYKVCWNVVGYDGICTVADMWKAFDDAIHDQVDVLSVSIGAGIPE  331

Query  1562  ASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYT  1383
              S++++ + I   +FHA+ +GI V+ A GN GP A  ITN  PW++TVAA+T+DR F   
Sbjct  332   NSEVDSVDFIA--AFHAVAKGITVVAAGGNDGPGAQNITNAAPWLLTVAATTLDRSFPTK  389

Query  1382  ITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLD  1203
             ITLGN +    +  L  G  +S  L F      ++D         +VKGK +  F     
Sbjct  390   ITLGNNQTLFAE-SLFTGPEISTSLAFL-----DSD------HNVDVKGKTILEFDSTHP  437

Query  1202  RNLVLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPT  1023
              ++         G V VI +   + D L   N+ IPY+  DY+ GT I  YI ++T +PT
Sbjct  438   SSIA------GRGVVAVILAKKPD-DLLARYNS-IPYIFTDYEIGTHILQYI-RTTRSPT  488

Query  1022  AQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGF  855
              ++S+     G+    KV +FSSRGP+S +P I+KPDIAAPG  I+ A    DP +  GF
Sbjct  489   VRISAATTLNGQPAMTKVAEFSSRGPNSVSPAILKPDIAAPGVSILAAVSPLDPDAFNGF  548

Query  854   RISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAA  675
              + SGTS + P VS I+ALLK  HP WSPAA++SALVTTAW +     PIFA+GS+ + A
Sbjct  549   GLYSGTSMSTPVVSGIIALLKSLHPNWSPAAMRSALVTTAWRTSPSGEPIFAQGSNKKLA  608

Query  674   DAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHT  495
             D FDYGGG+VNP+ A  PGLVYDM   DY  Y+C+ GY +S I + +          + T
Sbjct  609   DPFDYGGGLVNPDKAAQPGLVYDMGIKDYINYMCSAGYIDSSISRVLG---------KKT  659

Query  494   ICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKV  315
              C   +PS+LD+NLPS+ +P+L K VTL RTVTNVGP+ SVYKA+++SP+G  +TV P  
Sbjct  660   KCTIPKPSILDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIESPLGITLTVNPTT  719

Query  314   LRFDGNRKK-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             L F+   K+  +F+++      VNS + FGSLTW+DGVH+V  P++V+  I
Sbjct  720   LVFNSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVIIPVSVKTTI  770



>gb|AAD03438.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=49.7, E=9.2e-13, n=3) [Arabidopsis thaliana]
Length=774

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/790 (44%), Positives = 478/790 (61%), Gaps = 50/790 (6%)
 Frame = -3

Query  2438  RSVGTNAKVLKENGKKI---YIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVY  2268
             R+V     VL+     I   +IVYLG K HDD   + ESH+ +L  ++GS EEA  +MV+
Sbjct  3     RAVSCREPVLRARYSTIIYVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEEAHGSMVH  62

Query  2267  SYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELL  2088
             S+R+GFSGFAA LT SQAKK+A +  VV V+ D+ +K  T+R+WD+LGLS     P  LL
Sbjct  63    SFRHGFSGFAAKLTESQAKKIADLPEVVHVIPDRFYKPATTRTWDYLGLS--PTNPKNLL  120

Query  2087  RKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVI  1908
              +TN G+ MI+G++DSG+  E   F D  +GPVP  WKG C +  G  FN S  CN+K+I
Sbjct  121   NQTNMGEQMIIGIIDSGVWPESEVFNDNEIGPVPSHWKGGCES--GEDFNSSH-CNKKLI  177

Query  1907  GARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMV  1728
             GA++F   A L+     N     D  S     GHG+ VA+I  GS+VPN +  G+  G V
Sbjct  178   GAKYFIN-AFLATHESFNSSESLDFISPRGYNGHGTHVATIAGGSYVPNTSYKGLAGGTV  236

Query  1727  RGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDME  1548
             RGGA  AR+A YK CW LD +   C+ AD+L A+D AIHD VDV+S+S+G   PL  + +
Sbjct  237   RGGAPRARIAVYKTCWYLDLDIAACSSADILKAMDEAIHDGVDVLSLSLGFE-PLYPETD  295

Query  1547  AENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN  1368
               +GI  G+FHA+ +GI V+ AAGNAGP+A T+ N  PW++TVAA+T+DR F   +TLGN
Sbjct  296   VRDGIATGAFHAVLKGITVVCAAGNAGPAAQTVGNTAPWILTVAATTLDRSFVTPMTLGN  355

Query  1367  GEKYAVDWQL--PNG-----------TALSHPLHFAGKYMGEADLMPRKLDPAE--VKGK  1233
              +   V  +    NG           T+L +P +        +    R L  +   + GK
Sbjct  356   NKVILVTTRYIHHNGQAIYTGTEVGFTSLVYPENPGNSNESFSGTCERLLINSNRTMAGK  415

Query  1232  IVFMFGDD-----LDRNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDA  1071
             +V  F +      + R    V +A   G +GVI +  P NV   P L+   P V VDY+ 
Sbjct  416   VVLCFTESPYSISVTRAAHYVKRA---GGLGVIIAGQPGNVLR-PCLD-DFPCVAVDYEL  470

Query  1070  GTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDK  891
             GT I  YI +S  +P  ++   +  +G+ +  KV  FSSRGP+  +  I+KPDIAAPG  
Sbjct  471   GTYILFYI-RSNGSPVVKIQPSRTLIGQPVGTKVASFSSRGPNPISAAILKPDIAAPGVS  529

Query  890   IMCADPT----SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSD  723
             I+ A  T    +D GF   SGTS A P +S IVALLK  HP+WSPAAI+SA+VTTAW +D
Sbjct  530   ILAATTTNTTFNDRGFIFLSGTSMATPTISGIVALLKALHPDWSPAAIRSAIVTTAWRTD  589

Query  722   TYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIY  543
              +   IFA+GS  + AD FDYGGG+VNP  A  PGLVYD+   DY  Y+C++GYN + I 
Sbjct  590   PFGEQIFAEGSPRKPADPFDYGGGLVNPEKATKPGLVYDLGLEDYVLYMCSVGYNETSIS  649

Query  542   KTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKA  363
             + +          + T+C   +PS+LD NLPS+ +P+L + VTL RT+TNVGP+ SVY+ 
Sbjct  650   QLVG---------KGTVCSYPKPSVLDFNLPSITIPNLKEEVTLPRTLTNVGPLESVYRV  700

Query  362   IVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPI  183
              V+ P+G  VTV P+ L F+   K+ SF + VS    +N+ + FGSLTWSD +HNV  P+
Sbjct  701   AVEPPLGTQVTVTPETLVFNSTTKRVSFKVSVSTTHKINTGYYFGSLTWSDSLHNVTIPL  760

Query  182   AVRKMIVPLY  153
             +VR  ++P Y
Sbjct  761   SVRTQLLPYY  770



>ref|XP_002891020.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67279.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/765 (45%), Positives = 475/765 (62%), Gaps = 40/765 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L+ ++GS  +A  +MVYSYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPEFVTESHHQMLSSLLGSKVDAHDSMVYSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    VV V+ D  +++ T+R+WD+LGLS  A  P  LL  TN GD +I+G +D+G+
Sbjct  88    KKLADSPEVVHVMADSLYELATTRTWDYLGLS--AANPNNLLNDTNMGDQVIIGFIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P  WKG C +  G +F  +  CNRK+IGA++F  G  L+++   N
Sbjct  146   WPESESFNDNGVGPLPSHWKGGCES--GEKFISTN-CNRKLIGAKYFING-FLAENEGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+  ASI  GSFVPN +  G+  G +RGGA  AR+A YKACW +
Sbjct  202   TTKSRDYISARDFIGHGTHTASIAGGSFVPNISYKGLAGGNLRGGAPRARIAIYKACWYV  261

Query  1673  DPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D    V C+ +D+L A+D A+HD VDV+S+S+G+ +PL  + +  + I  G+FHA+ +GI
Sbjct  262   DQLGIVACSSSDILKAMDEAMHDGVDVLSLSLGAQIPLYPETDLRDRIATGAFHAVAKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ A GN+GP+A T+ N  PW++TVAA+T+DR F   ITLGN  K  +   L  G  L 
Sbjct  322   IVVCAGGNSGPAAQTVLNTAPWILTVAATTLDRSFPTPITLGN-RKVILGQALYTGQELG  380

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAE-VKGKIVFMFGDDLDRNLVLVDKATD--  1170
                     +P +    + G  + +   L+P   + GK+V  F    +     V +A    
Sbjct  381   FTSLGYPENPGNTNETFSGVCESL--NLNPNRTMAGKVVLCF--TTNTLFTAVSRAASYV  436

Query  1169  --AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
               AG +GVI +     +  P  +   P V +DY+ GT +  YI +ST +P  ++   +  
Sbjct  437   KAAGGLGVIIARNPGYNLTPCRD-NFPCVAIDYELGTDVLLYI-RSTRSPVVKIQPSRTL  494

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHA  828
             VG+ +  KV  FSSRGP+S +P I+KPDI APG  I+ A  P S+   GGF I SGTS A
Sbjct  495   VGQPVGTKVATFSSRGPNSISPAILKPDIGAPGVSILSATSPDSNSSVGGFDILSGTSMA  554

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
             AP V+ +VALLK  HP WSPAA +SA+VTTAW +D +   IFA+GSS + AD FDYGGG+
Sbjct  555   APVVAGVVALLKALHPNWSPAAFRSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDYGGGV  614

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VN   A +PGL+YDM   DY  YLC+ GYN+S I + + GN         T+C   +PS+
Sbjct  615   VNAEKAAEPGLIYDMGTQDYILYLCSAGYNDSSITQLV-GNV--------TVCSNPKPSV  665

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD+NLPS+ +P+L   VTL RTVTNVGPV+SVYK ++  P+G  V V P+ L F+   K 
Sbjct  666   LDVNLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVVLDPPLGIRVVVTPETLVFNSKTKS  725

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SFT+ VS    +N+ F FG+L W+D +HNV  P++VR  I+  Y
Sbjct  726   VSFTVGVSTTHKINTGFYFGNLIWTDSMHNVTIPVSVRTQILQNY  770



>emb|CAN80173.1| hypothetical protein VITISV_018392 [Vitis vinifera]
Length=928

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/744 (45%), Positives = 461/744 (62%), Gaps = 36/744 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
              +YIVY+G + H +   I + H+ +L+ V+GS E + ++MVYSY++GFSGFAA LT +QA
Sbjct  40    NVYIVYMGERQHGNLDLITDGHHRMLSEVLGSDEASVESMVYSYKHGFSGFAAKLTEAQA  99

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +  A +  VV V+ ++ HK+QT+RSWD+LGL    + P  LL +T  GDG I+G++D+GI
Sbjct  100   QMFAELPDVVQVIPNRLHKLQTTRSWDYLGLP--LDSPTSLLHETKMGDGTIIGLLDTGI  157

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F + G+GP+P RW G C +  G  F+ ++ CNRK+IGAR+  KG         N
Sbjct  158   WPESEVFSEKGLGPIPSRWNGVCES--GELFHGAKACNRKLIGARYLIKGLEAEIGQPFN  215

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+  ++I  GS V N +  G+ +G VRGGA  AR+A YK CWNL
Sbjct  216   TTENPDYLSPRDWLGHGTHTSTIAGGSSVHNVSYNGLGLGTVRGGAPRARLAMYKVCWNL  275

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                  VCA AD+   ID AIHD VDV+S+S+ S +PL S ++  +GI I SFHA+ RGIP
Sbjct  276   --YGGVCADADIFKGIDEAIHDGVDVLSLSISSDIPLFSHVDQHDGISIASFHAVVRGIP  333

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---AVDWQLPNG-T  1326
             V+ AAGN+GPSA T++N  PW+ITVAAST+DR+FA  ITLGN +     AV      G T
Sbjct  334   VVSAAGNSGPSAETVSNTAPWIITVAASTMDRLFATHITLGNNQTITGEAVYLGKDTGFT  393

Query  1325  ALSHPL---HFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVG  1155
              L++P      A +Y     L+P     A   G +V  F  D     +  +    AG +G
Sbjct  394   NLAYPEVSDLLAPRYC--ESLLPNDTFAA---GNVVLCFTSDSSH--IAAESVKKAGGLG  446

Query  1154  VIYSNPSNV-DSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALT  978
             VI +  SNV + L   +   P +QV  + G RI DYI +ST  P  +LS  +  +G  + 
Sbjct  447   VIVA--SNVKNDLSSCSQNFPCIQVSNEIGARILDYI-RSTRHPQVRLSPSRTHLGNPVP  503

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT---SDGGFRISSGTSHAAPHVSAI  807
              KV  FSSRGPSS AP I+KPDIA PG +I+ A+P+   +   + + SGTS A PHVS  
Sbjct  504   TKVASFSSRGPSSIAPAILKPDIAGPGFQILGAEPSFVPTSTKYYLMSGTSMATPHVSGA  563

Query  806   VALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAAD  627
             VALL+  + EWSPAAIKSA+VTTAW +D    P+FA+G  ++ AD FD+GGGI+NPN A 
Sbjct  564   VALLRALNREWSPAAIKSAIVTTAWTTDPSGEPVFAEGQPMKLADPFDFGGGILNPNGAG  623

Query  626   DPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPS  447
             +PGLVYDM   D   YLCA+GYNNS I K          T   T CP  RPS+LD+NLPS
Sbjct  624   NPGLVYDMGKDDCILYLCAMGYNNSAIAKV---------TGRPTSCPCNRPSILDVNLPS  674

Query  446   MVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRV  267
             + +P+L   V+L R+VTNVG V+S Y A++  P G  + ++P  L F+   +  +F + V
Sbjct  675   ITIPNLQYSVSLTRSVTNVGAVDSEYNAVIDPPPGVTIKLEPDRLVFNSKIRTITFRVMV  734

Query  266   SADKLVNSAFTFGSLTWSDGVHNV  195
             S+ + V++ F+FGSL WSDG H +
Sbjct  735   SSARRVSTGFSFGSLAWSDGEHAI  758


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             ++IVYLG + H D   I  +H+++L  V+GS E +  +M+YSYR+GFSGFAA LT
Sbjct  853   VHIVYLGKRQHHDPEFITNTHHEMLTTVLGSKEASVDSMLYSYRHGFSGFAAKLT  907



>gb|KFK41050.1| hypothetical protein AALP_AA2G078900 [Arabis alpina]
Length=757

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/749 (45%), Positives = 460/749 (61%), Gaps = 34/749 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IV+LG K HD   R+ +SHY +L  ++GS E A+  ++YSYR+GFSGFAA LTASQA
Sbjct  40    KIHIVHLGAKQHDSPERVTKSHYQILEPILGSKEAAKNCIIYSYRHGFSGFAAKLTASQA  99

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++  + V+ V+  +  +++T+R +D+LGL   +  P  LL  T+ G   I+GVVDSGI
Sbjct  100   KNLSAHSEVLCVIPSRVLRLKTTRIFDYLGLLPSS--PKGLLHDTSMGSEAIIGVVDSGI  157

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG--ALLSQDVD  1860
               E  SF D G+GP+P+RWKG+C  + G+ F+  + CN+K+IGA +F  G   + ++  D
Sbjct  158   WPESNSFNDTGLGPIPKRWKGNC--VSGIGFDGKKHCNKKLIGAEFFVGGLAEMTNEQYD  215

Query  1859  LNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
              +   V +  S  D  GHG+ VA+I AGSFV +A+  G+  G  RG A  AR+ASYKACW
Sbjct  216   FDS--VHEFRSSRDGIGHGTHVAAIAAGSFVASASYNGLAGGHARGVAPHARIASYKACW  273

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
                     C   D+L AID++I D VDVIS+S+G+  P + D++ E+ I  GSF A+ +G
Sbjct  274   ----RNVGCLTPDILKAIDHSIRDGVDVISISIGTDAPASFDVD-ESDIAFGSFQAVMKG  328

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             IPV+ AAGN GP+A T+ NV PW+ITVAA+++DR F   ITLGN         +  G   
Sbjct  329   IPVVCAAGNEGPNALTVDNVAPWIITVAATSMDRSFPTPITLGNNLTI-----VGEGLNT  383

Query  1319  SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSN  1140
                + F    + + ++M   +   + KGKIV  F    D  +  VD    AG  G+IY+ 
Sbjct  384   LPEVGFTDLILSD-EMMETSIGQGQTKGKIVLAF-TSTDTTIRKVDHILKAGCAGIIYAQ  441

Query  1139  PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDF  960
              S +D        +P   VDY+ GT +  YI Q+T  P A+LS  K   GR +  +V  F
Sbjct  442   -SVIDPTVCNGLDVPCAVVDYEFGTDMLYYI-QTTDVPIAKLSPSKTLTGRPIASRVARF  499

Query  959   SSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHP  780
             S RGP+S +P I+KPDIAAPG  ++ A     G ++  SGTS A P VS IV LL+   P
Sbjct  500   SCRGPNSVSPAILKPDIAAPGVNVLSA---VSGVYKFMSGTSMATPVVSGIVGLLRQIRP  556

Query  779   EWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMR  600
             +WSPAAI+SALVTTAW +D +  PIF++GS+ + AD FDYGGG++NP    +PGLVYDM 
Sbjct  557   DWSPAAIRSALVTTAWRTDPFGEPIFSEGSTRKLADPFDYGGGLINPGKVAEPGLVYDMG  616

Query  599   GIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKP  420
               DY  YLC+  Y+++ I K +          +   CP  +PSMLD N+PS+ +P L   
Sbjct  617   IDDYVHYLCSADYDDASISKLLG---------QAYKCPWPKPSMLDFNMPSITIPSLTGE  667

Query  419   VTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSA  240
             VTL RTVTNVGP  SVY+ IV+ P G  + V P  L F  N  K +F++RV  +  VNS 
Sbjct  668   VTLTRTVTNVGPSGSVYRPIVEPPSGIELEVNPNTLIFGSNTTKITFSVRVRTNHKVNSD  727

Query  239   FTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F FGSL W+DGVHNV  P++VR  I+  Y
Sbjct  728   FYFGSLCWTDGVHNVTIPVSVRTKILRNY  756



>ref|XP_009344068.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Pyrus x 
bretschneideri]
Length=758

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/774 (46%), Positives = 480/774 (62%), Gaps = 65/774 (8%)
 Frame = -3

Query  2423  NAKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSG  2244
             N++ + E    ++IVYLG   HD+   + + H++LLA VV S E A + MVYSY++GFSG
Sbjct  19    NSQGMTER-SNVHIVYLGETQHDNPELVVDLHHELLASVVRSKELASELMVYSYKHGFSG  77

Query  2243  FAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDG  2064
             FAA LT SQ ++++ + GVV ++ +  HK++T+RSW+FLGLS  +  P  +L K+  GDG
Sbjct  78    FAAKLTESQVQQLSELPGVVRIIPNSLHKLETTRSWNFLGLSPHS--PSNILPKSKMGDG  135

Query  2063  MIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG  1884
             +I+GV+D+GI  E  SF + G+GPVP  WKG C +  G  FN +  CN+K+IGARWF KG
Sbjct  136   VIIGVLDTGIWPESESFNEKGLGPVPFHWKGVCES--GENFNTTIHCNKKIIGARWFIKG  193

Query  1883  ALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAAR  1704
              L      L+    +D  S  D  GHG+ ++SI AGSFV N +  G+  G VRGGA  AR
Sbjct  194   LLAEYGEPLDT--STDFLSPRDANGHGTAISSIAAGSFVYNISYKGLGGGTVRGGAPNAR  251

Query  1703  VASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             +A YK CWNL      C+ AD+L A+D AIH+ V V+S+S+G  VP+++ ++  + I IG
Sbjct  252   LAMYKVCWNL--FNGYCSSADILKAVDVAIHEGVHVLSLSLGDSVPISTIVD--DAIAIG  307

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW  1344
             S+HAITR I V+ +AGN GP A T+TN  PWVITVAAST+DR F  +ITLGN        
Sbjct  308   SYHAITRDIIVVCSAGNDGPFAQTVTNTAPWVITVAASTMDRAFPTSITLGNNITL----  363

Query  1343  QLPNGTALSHPLHFAGKYMGEADLMPRK-----------------LDPAEVKGKIVFMFG  1215
                 G +L     F G + G   L+  K                 L+   V G +V  F 
Sbjct  364   ---QGQSL-----FTGPHTGFTRLIYPKSTKIDSTSTSICDSLSSLNKTMVSGNVVLCFT  415

Query  1214  DDLDRNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQS  1038
                +  L       +AG VGVI + NPS++  LP  +   P +QVDY+ GTRI  YI +S
Sbjct  416   SYSEEAL------REAGCVGVIIAMNPSDL-MLP-SDDDFPTIQVDYEVGTRILSYI-RS  466

Query  1037  TMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTS--  867
             T  P  +LS  K  VG+ ++ KV  FSSRGP+S  P I+KPD+AAPG  I+ A  P    
Sbjct  467   TSAPLVKLSRTKTIVGKLISAKVAAFSSRGPNSATPAILKPDVAAPGVNILAAYSPLRSY  526

Query  866   -DGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFS--PIFAK  696
              DGG+ + SGTS + PHVS IVALLK+ HP WSPAAI+SALVTTA  +    S  PIFA+
Sbjct  527   VDGGYAVKSGTSLSTPHVSGIVALLKVMHPSWSPAAIRSALVTTASRNGPSCSILPIFAE  586

Query  695   GSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNR  516
             GS  + A+ FDYGGGIVNPN A  PGLVYDM   DY  +LCA+GYN S + + +      
Sbjct  587   GSPRKLANPFDYGGGIVNPNKAAYPGLVYDMGREDYINFLCAVGYNTSALSQIVG-----  641

Query  515   SDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAV  336
                 + T C  T+PS+LD+NLPS+ +P+L   + L R+VTNVGPV+SVYK  +  P+G  
Sbjct  642   ----QVTACSSTKPSVLDVNLPSITIPNLRDNINLTRSVTNVGPVDSVYKVDIDPPLGVN  697

Query  335   VTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             V V+P  L F+ + K  +FT+ VS    VN+ + FGSLTW+DG H V + ++VR
Sbjct  698   VAVRPDTLVFNSSVKTITFTVAVSTTHHVNTGYYFGSLTWTDGKHVVTSAVSVR  751



>emb|CDY07491.1| BnaA07g25700D [Brassica napus]
Length=759

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/752 (45%), Positives = 458/752 (61%), Gaps = 43/752 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD + + +SH+D+L  ++GS E +R++M+YSYR+GFSGF+A LT+SQA
Sbjct  39    QIYTVHLGKRQHDDPKLVTDSHHDILGSLLGSKEASRESMIYSYRHGFSGFSAKLTSSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV V   K+ K+ T+R  D+LGL+  A  P  L+  T+ G   I+G+VDSGI
Sbjct  99    RELSENPHVVHVTRSKNMKLTTTRVSDYLGLTSTA--PTGLVHDTDMGSDAIIGIVDSGI  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
                  SF D G+GP+P RWKG C  + G  FN S +CNRK+IGA ++ KG          
Sbjct  157   WPGSKSFNDNGLGPIPARWKGQC--VSGEGFNAS-MCNRKLIGATYYAKGLARKYKGAFK  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  ++ S  D  GHG+  AS  AGSFV NA  LG+  G  RG A  ARVA+YK CWN 
Sbjct  214   AAEKDEAMSPLDKVGHGTHCASTAAGSFVQNANYLGLGQGTARGSAPRARVAAYKVCWNN  273

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENG-IGIGSFHAITRGI  1497
             +     C   D+L A+D+A+ D VDV+S+S+GS +PL  D E +     I +FHA+ +GI
Sbjct  274   EE----CFTPDILKAMDHAMRDGVDVLSLSLGSEIPL--DFEVDRSDFAIAAFHAVMKGI  327

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ A GN GP   TI+NV PW+ITVAA+T+DR F   ITLGN           N T L 
Sbjct  328   TVVCAGGNDGPETQTISNVAPWIITVAATTMDREFFTPITLGN-----------NVTVLG  376

Query  1316  HPLHFAGKYMGEADLM------PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVG  1155
                 + G+ +G  DL+          +  + KGKI+F F  D   + +  + A   G VG
Sbjct  377   QEGLYIGEEVGFTDLIYFDDLTKADFEAGKAKGKILFTFLTDRSTDQI-AEFAKSKGVVG  435

Query  1154  VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             +I +    +D +    A I   +VDY+ G  I  Y+ Q+T  P A++S  K  VGR    
Sbjct  436   IIIAT-KPIDLIEPGTAGIASARVDYEIGMDILLYL-QTTKFPKAKISPTKTFVGRPSAT  493

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALL  795
             KV  FSSRGP+S +P I+KPDIAAPG  I+ A PT  G +   SGTS A P V+ IVALL
Sbjct  494   KVARFSSRGPNSISPAILKPDIAAPGVGILAAVPTGVG-YEFMSGTSMATPVVTGIVALL  552

Query  794   KISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGL  615
             K   P+WSPAAI+SALVTTA+ +D    PI A+GS  + AD FDYGGG+VNP    DPGL
Sbjct  553   KQKRPDWSPAAIRSALVTTAFQTDPSGEPIAAEGSPRKIADPFDYGGGLVNPGKVADPGL  612

Query  614   VYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVP  435
             VYDM   +Y  YLC+ GY +  I K +          +   CP   PSMLD+NLPS+ +P
Sbjct  613   VYDMGHDEYVHYLCSAGYEDISISKLLG---------KVYTCPSPTPSMLDVNLPSITIP  663

Query  434   DLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADK  255
              L + +T+ RTVTNVGPV SVYKA+++ P+G  + V PK L F  N KK +FT++VS   
Sbjct  664   YLSQEITITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTH  723

Query  254   LVNSAFTFGSLTWSD-GVHNVRTPIAVRKMIV  162
              VN+ + FGSLTW+D G HNVR P++VR  ++
Sbjct  724   RVNTDYHFGSLTWTDNGAHNVRIPLSVRTRVM  755



>ref|XP_006415136.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
 gb|ESQ33489.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
Length=782

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/763 (45%), Positives = 464/763 (61%), Gaps = 36/763 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L+ V+GS E+A  +MV+SYR+GFSGFAA LT SQA
Sbjct  36    KVHIVYLGEKQHDDPDFVTESHHQILSSVLGSKEDAHDSMVHSYRHGFSGFAAKLTESQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K +A    VV V+ D  +++ T+R+WD+LGLS  AN P  LL  TN G  +I+G +DSG+
Sbjct  96    KILADSREVVHVIPDSFYELATTRTWDYLGLSV-AN-PKNLLNDTNMGGQVIIGFIDSGV  153

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P  WKG C  + G +F  +  CNRK+IGA++F  G  L+++   N
Sbjct  154   WPESESFNDNGVGPIPSHWKGKC--VLGEKFIATN-CNRKLIGAKYFING-FLAENEGFN  209

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VASI  G FVPN +  G+  G +RGGA  AR+A YKACW L
Sbjct  210   STESPDYISARDFLGHGTHVASIAGGLFVPNVSYKGLASGNLRGGAPRARIAIYKACWYL  269

Query  1673  DPERF---VCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITR  1503
               ER     C+ +D+L A+D AIHD VDV+S+S+G+ VPL    +  + I  G+FHA+ +
Sbjct  270   --ERLGTVACSSSDILKAMDEAIHDGVDVLSLSLGAQVPLFPKTDLRDRIATGAFHAVAK  327

Query  1502  GIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQL  1338
             GI V+ A GN+GP+A T+ N  PWVITVAA+T+DR F   ITLGN     G+      QL
Sbjct  328   GIIVVCAGGNSGPAAQTVLNTAPWVITVAATTLDRSFPTPITLGNNNMILGQALFTGPQL  387

Query  1337  PNGTALSHPLHFAGKYMGEADLMPR-KLDP-AEVKGKIVFMFGDDLDRNLV--LVDKATD  1170
                T+L +P +          +  R  L+P   + GK+V  F        V         
Sbjct  388   -GFTSLVYPENPVSSNETFTGVCERLNLNPNGTMAGKVVLCFTTTTLFTAVSRAASYVKA  446

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
              G +G+I +     +  P  +   P V +DY+ GT I  YI +ST +P   +   +  VG
Sbjct  447   DGGLGLIIARNPGYNLTPCRD-DFPCVAIDYELGTDILLYI-RSTRSPVVNIQPSRTLVG  504

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIM----CADPTSDGGFRISSGTSHAAP  822
             + +  KV  FSSRGP+S +P I+KPDI APG  I+        +S  GF I +GTS AAP
Sbjct  505   QPVGTKVATFSSRGPNSNSPAILKPDIGAPGVSILGSTSPDSKSSSKGFDILAGTSMAAP  564

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S +VALLK  HP WSPAA +SA+VTTAW +D +   IFA+GSS + AD FDYGGG+VN
Sbjct  565   VISGVVALLKALHPNWSPAAFRSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDYGGGLVN  624

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
                A DPG +YDM   DY  YLC+ GYN+S I + +          + T+C   +PS+ D
Sbjct  625   AEKAADPGFIYDMGTKDYILYLCSAGYNDSSISQLVG---------KVTVCSNPKPSVFD  675

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
             +NLPS+ +P+L   VTL RTVTNVGPV+SVYK +V+ P G  V V P+ LRF+   K  S
Sbjct  676   VNLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVVVEPPFGVRVVVTPETLRFNSKTKSVS  735

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F +RVS    +N+ F FGSL W+D +HNV  P++VR  I+  Y
Sbjct  736   FKVRVSTTHKINTGFFFGSLIWTDSLHNVTIPVSVRTQILQNY  778



>emb|CDX98693.1| BnaA03g44780D [Brassica napus]
Length=765

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/768 (44%), Positives = 466/768 (61%), Gaps = 51/768 (7%)
 Frame = -3

Query  2423  NAKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSG  2244
             +AK L  + K  Y   LG + HDD   +  SH+++L  ++ S E+A  +M+Y Y++GFSG
Sbjct  32    SAKTLDNDSKAFY---LGERVHDDPELVTASHHEMLESLLESKEDAHNSMIYIYQHGFSG  88

Query  2243  FAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSE---------GANVPGEL  2091
             FAA+LT++QA K++    V+ V+ ++  K+QT+R+WD LGLS+           +V G L
Sbjct  89    FAALLTSTQANKISEHPEVIHVIPNRILKLQTTRTWDHLGLSQISTPFSSPSSTSVKG-L  147

Query  2090  LRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKV  1911
             L  TN G   I+GV+DSGI  E   F D G+GP+P+RW+G C  + G +FN +  CN+K+
Sbjct  148   LHDTNMGSEAIIGVIDSGIWPESKVFNDQGLGPIPKRWRGKC--VSGEKFNATIHCNKKL  205

Query  1910  IGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGM  1731
             IGA+++  G L       N+ ++ D  S  D+ GHG+  A+I  GSFV NA+  G+  G 
Sbjct  206   IGAKYYVNGLLAEMGGKFNRTIIQDFKSSRDIIGHGTHTATIAGGSFVSNASYYGLAQGT  265

Query  1730  VRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDM  1551
             VRGGA  AR+A+YKACWN       C  AD+  A D AIHD VDV+SVS+G  +P   D 
Sbjct  266   VRGGAPKARIAAYKACWNGVEPAGGCTTADMWKAFDDAIHDGVDVLSVSIGGGIP--EDS  323

Query  1550  EAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLG  1371
             E +    I +FHA+T+GIPV+ AAGNAGP+A T+ NV PW++TVAA+T+DR F   ITLG
Sbjct  324   EVDKLDNIAAFHAVTKGIPVVAAAGNAGPAAQTVVNVAPWLLTVAATTLDRSFPTKITLG  383

Query  1370  NGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLV  1191
             N + +  +  L  G  +S  L F         L     D  ++KGK V +F       L 
Sbjct  384   NNQTFLAE-SLYTGPEISTGLAF---------LDSSSHDNVDMKGKTVLVFDSTTPITL-  432

Query  1190  LVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
                     G  GVI+S     D L         +  DY+ GT I  YI ++T +PT +++
Sbjct  433   -------KGVAGVIFSQKP--DDLLQRCHSFACIFADYELGTDILQYI-RTTRSPTVRIN  482

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISS  843
             S     G   T KV  FS RGP+S +P I+KPDIAAPG  I+ A    +P +  GF + S
Sbjct  483   SATTLTGLPATTKVAAFSCRGPNSVSPAILKPDIAAPGVSILAALSRRNPQAHDGFGLLS  542

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFD  663
             GTS + P VS I+ALLK  HP WSPAA +SALVTTAW +     PIFA+GS+ + AD FD
Sbjct  543   GTSMSTPVVSGIIALLKSLHPTWSPAAFRSALVTTAWRTSPSGEPIFAEGSNKKLADPFD  602

Query  662   YGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPK  483
             YGGG+VNP  A +PGLVYDM   DY  Y+C+ GY +S I + I    N+        CP 
Sbjct  603   YGGGLVNPQRASNPGLVYDMGIQDYIDYMCSAGYKDSSISRIIRKKTNK--------CPT  654

Query  482   TRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFD  303
              +PS+LD+NLPS+ +P+L K VTL RTVTNVGP+ SVYKA+++SP+G  +TV P  L F 
Sbjct  655   PKPSVLDMNLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIESPLGITLTVTPNTLVFS  714

Query  302   GNRKK-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
                K+  +F ++      VN+ + FGSLTW+DGVH+V+ P++V+  I+
Sbjct  715   SAAKRVLTFKVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQTKIM  762



>gb|KCW72614.1| hypothetical protein EUGRSUZ_E01074 [Eucalyptus grandis]
Length=758

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/767 (46%), Positives = 466/767 (61%), Gaps = 55/767 (7%)
 Frame = -3

Query  2399  GKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTas  2220
             G  +YIVY G +   D     +SH+D+LA V+GS E A  +++YSYR+GFSGFAA LT S
Sbjct  11    GNGVYIVYFGVRKQGDPTVETDSHHDMLASVLGSKEAAAISILYSYRHGFSGFAAKLTES  70

Query  2219  qakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDS  2040
             QA+++AG  GVV V+ +   ++QT+RSWDFLGLS  ++ P  LL K+  GDG+IVG++D+
Sbjct  71    QAQELAGFPGVVRVMPNTLFRLQTTRSWDFLGLSP-SHSPTSLLYKSRMGDGVIVGMIDT  129

Query  2039  GISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVD  1860
             GI  E  SF D G+GP+P RWKG C   P  +F+ ++ CNRK+IGARWF  G L      
Sbjct  130   GIWPESKSFSDEGLGPIPSRWKGGCE--PAEQFDPAKHCNRKIIGARWFVDGFLAEYGKP  187

Query  1859  LNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
             LN     +  S  D  GHG+  +S   GSFV N +  GI  G  RGGA  AR+A YK CW
Sbjct  188   LNASGDLEFLSPRDANGHGTHTSSTAVGSFVSNVSYRGIGYGTARGGAPRARLAVYKVCW  247

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             N+      C+ AD+L A D AIHD VDV+SVS+G+ +PL SD++  + I  G+FHA+ +G
Sbjct  248   NV--LNVQCSSADILKAFDEAIHDGVDVLSVSIGTAIPLFSDVDDRDAIATGAFHAVAQG  305

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+  AGN GP+A T+ N  PW++TV A++IDR F   ITLGN E          G A+
Sbjct  306   ITVVCGAGNDGPAAQTVQNTAPWILTVGATSIDRAFRTIITLGNNETLV-------GQAI  358

Query  1319  SHPLHFAGKYMGEADLM-PR--KLDPAE-------------VKGKIVFMFGDDLDRNLVL  1188
                  + GK +G   L+ P    LDP               + GK+V  F   + R   +
Sbjct  359   -----YTGKEIGFTTLLYPEGTTLDPTSAGVCERLSPNATLMAGKVVLCF-TSIARRFEV  412

Query  1187  VDKATDA----GAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPT  1023
             V  A+ A      +GVI + NPS  D L   +   P V+VDY+ GT+I  Y F+S   P 
Sbjct  413   VPLASAAVKASRGIGVIVAKNPS--DGLAPCSGDFPCVEVDYEIGTQILVY-FRSARFPK  469

Query  1022  AQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGF  855
              +LS     VG+A+  KV  FSSRGPSS +P ++KPD+ APG  I+ A     P+ D G+
Sbjct  470   VKLSPTITAVGKAVQAKVAFFSSRGPSSISPAVLKPDVTAPGVNILAATSPFSPSEDNGY  529

Query  854   RISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAA  675
             RI SGTS A PHV+ IVALLK  HP+WSPAA +SALVTTAW ++    PIFA G   + A
Sbjct  530   RILSGTSMATPHVAGIVALLKALHPDWSPAAFRSALVTTAWRTNPPGFPIFASGFPPKLA  589

Query  674   DAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHT  495
             D FD GGG VNPN+A +PGL+YD+   DY  YLCA+GYN++ I            T +  
Sbjct  590   DPFDMGGGNVNPNSAAEPGLIYDVGTPDYILYLCAMGYNDTEISHL---------TGKPA  640

Query  494   ICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKV  315
              CP  RPS+ D+NLPS+ +  L   VT+ RTVTN G     Y A+++ P G  VTV+P V
Sbjct  641   PCPARRPSVSDVNLPSITIARLTSTVTVTRTVTNTGNPKLRYWAVIEPPSGTTVTVRPHV  700

Query  314   LRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             L FD   KK +F++ V A   VN+ + FGSL W+DGVH VR+P+AVR
Sbjct  701   LAFDRETKKAAFSVTVCAAAPVNTGYYFGSLVWTDGVHAVRSPLAVR  747



>ref|XP_010470495.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/754 (45%), Positives = 466/754 (62%), Gaps = 46/754 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD   + ESH+D+L  ++GS E +R++M+YSYR+GFSGFAA LT+SQA
Sbjct  39    QIYTVHLGKRQHDDPDLVTESHHDILGPLLGSKEASRESMIYSYRHGFSGFAAKLTSSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV V   K+ K+ T+R  D+LGL+  A  P  LL +T+ G G+I+G+VDSG+
Sbjct  99    RELSEHPDVVHVTRSKNMKLTTTRVNDYLGLTPTA--PTGLLHETDMGSGVIIGIVDSGV  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               + PSF D G+GP+P+RWKG C  + G  F  S  CNRK+IGA ++ KG     +  LN
Sbjct  157   WPDSPSFNDNGLGPIPRRWKGRC--VSGKGFKASS-CNRKLIGATYYSKGLKKMYNGKLN  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+  A+  AGSFV +A  LG+  G  RG A  AR+ASYK CWN 
Sbjct  214   ITEKDEVMSPLDKVGHGTHCATTAAGSFVQDANYLGLAKGTARGTAPKARIASYKVCWN-  272

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   C   D++ A+D+AI D VDV+S+SVG  +PLA +++ ++   I +FHA+ +G+P
Sbjct  273   ---NIKCFTPDIIKAMDHAIRDGVDVLSLSVGDEIPLAFEVDRDD-FSIAAFHAVMKGVP  328

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP + TI+N+ PW+ITVAA+T+DR F   ITLGN           N T L  
Sbjct  329   VVAAGGNDGPDSQTISNIAPWIITVAATTMDREFFTPITLGN-----------NITLLGQ  377

Query  1313  PLHFAGKYMGEA------DLMPRKLDPAEVKGKIVFMF-GDDLDRNLVLVDKATDAGAVG  1155
                + GK +G +      DL          KGKI+F F    L  N  +V +    GAVG
Sbjct  378   EGVYTGKEVGFSEILYFDDLTKEDFKAGIAKGKILFSFIRGTLAENFGVVMQ--KVGAVG  435

Query  1154  VIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALT  978
             +I +  P+  D++    A IP   VDY+ G  I  Y+ Q+T  P A++S  K  VG+   
Sbjct  436   LIIAIKPT--DTVVTAKADIPVAYVDYELGMDILLYM-QTTKKPIAKISPTKTFVGKPSA  492

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVAL  798
              KV  FSSRGP++ +P I+KPDIAAPG  I+ A P S  G+   SGTS A P V+ IVAL
Sbjct  493   TKVAGFSSRGPNTISPAILKPDIAAPGSGILAAMP-SWSGYEFLSGTSMATPIVAGIVAL  551

Query  797   LKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPG  618
             +K +HP+WSPAAI+SALVTTA  +D    PI A+GS  + AD FDYGGG+VNP    DPG
Sbjct  552   VKQNHPDWSPAAIRSALVTTALQTDPSGEPISAEGSPRKLADPFDYGGGVVNPVKVADPG  611

Query  617   LVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVV  438
             LVYDM   +Y  YLC+ GYNN+ I K +          +   CP   PSMLD+NLPS+ +
Sbjct  612   LVYDMGENEYVHYLCSAGYNNTSISKLLG---------KIYTCPSPSPSMLDVNLPSITI  662

Query  437   PDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGN-RKKRSFTMRVSA  261
             P L K +T+ RTVTNVGPV SVYKA+++ P G  + V P+ L F  N   K +FT++VS 
Sbjct  663   PYLSKEITVTRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFSSNTTNKLTFTVKVST  722

Query  260   DKLVNSAFTFGSLTWSD-GVHNVRTPIAVRKMIV  162
                 N+ + FGSL+W D G H+VR P++VR  ++
Sbjct  723   AHRANTDYHFGSLSWIDNGGHSVRIPLSVRTRLL  756



>ref|NP_564413.2| subtilase family protein [Arabidopsis thaliana]
 gb|AEE31543.1| subtilase family protein [Arabidopsis thaliana]
Length=773

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/764 (45%), Positives = 474/764 (62%), Gaps = 39/764 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD + + ESH+ +L+ ++GS ++A ++MVYSYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPKFVTESHHQMLSSLLGSKDDAHESMVYSYRHGFSGFAAKLTKSQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    V+ V+ D ++++ T+R WD+LG S  A+    L+  TN GD  I+GV+D+G+
Sbjct  88    KKIADSPEVIHVIPDSYYELATTRIWDYLGPS--ADNSKNLVSDTNMGDQTIIGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GPVP  WKG C   PG  F  +  CNRK+IGA++F  G L       N
Sbjct  146   WPESESFNDYGVGPVPSHWKGGCE--PGENFISTN-CNRKLIGAKYFINGFLAENQ--FN  200

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VASI  GSFVPN +  G+  G +RGGA  AR+A YKACW +
Sbjct  201   ATESPDYISARDFDGHGTHVASIAGGSFVPNVSYKGLGRGTLRGGAPRARIAMYKACWYI  260

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +  +   C+ +D++ AID AIHD VDV+S+S+G  VPL S+ +  +GI  G+FHA+ +GI
Sbjct  261   NELDGVTCSFSDIMKAIDEAIHDGVDVLSISLGGRVPLNSETDLRDGIATGAFHAVAKGI  320

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQLPN  1332
              V+ A GNAGPS+ T+ N  PW++TVAA+T+DR FA  I LGN     G+   +  +L  
Sbjct  321   VVVCAGGNAGPSSQTVVNTAPWILTVAATTLDRSFATPIILGNNQVILGQAMYIGPEL-G  379

Query  1331  GTALSHPL---HFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD---  1170
              T+L +P    +    + G  + +    +   + GK+V  F     R+  +V  A     
Sbjct  380   FTSLVYPEDPGNSIDTFSGVCESLNLNSN-RTMAGKVVLCF--TTARDFTVVSTAASIVK  436

Query  1169  -AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
              AG +G+I +     +  P  +   P V +D + GT I  YI + T +P  ++   +  V
Sbjct  437   AAGGLGLIIARNPGYNLAPCSD-DFPCVAIDNELGTDILFYI-RYTGSPVVKIQPSRTLV  494

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD----GGFRISSGTSHAA  825
             G  +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A   +D    GGF + SGTS AA
Sbjct  495   GEPVGTKVATFSSRGPNSISPAILKPDIAAPGVSILAATSPNDTLNAGGFVMRSGTSMAA  554

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P +S ++ALLK  HP+WSPAA +SA+VTTAW +D +   I A+ SSL+  D FDYGGG+V
Sbjct  555   PVISGVIALLKSLHPDWSPAAFRSAIVTTAWRTDPFGEQIAAESSSLKVPDPFDYGGGLV  614

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A +PGL+ DM   DY  YLC+ GYN+S I + +          + T+C   +PS+L
Sbjct  615   NPEKAAEPGLILDMDSQDYVLYLCSAGYNDSSISRLVG---------KVTVCSNPKPSVL  665

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             D+NLPS+ +P+L   VTL RTVTNVGPV+SVYK +V+ P+G  V V P+ L F+   K  
Sbjct  666   DINLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVLVEPPLGIQVVVTPETLVFNSKTKSV  725

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             SFT+ VS    +N+ F FGSLTW+D +HNV  P++VR  I+  Y
Sbjct  726   SFTVIVSTTHKINTGFYFGSLTWTDSIHNVVIPVSVRTQILQNY  769



>ref|XP_009128705.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128707.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128709.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=723

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/738 (46%), Positives = 460/738 (62%), Gaps = 34/738 (5%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQAKK+A +  VV V+ D  +K++T+R
Sbjct  1     MLCSLLGSKEDAHGSMVYSYRHGFSGFAAKLTKSQAKKIANLPEVVHVIPDSFYKLKTTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             +WD+LGLS  A+ P  LL +TN G+ +I+G++D+G+  E   F D G+G VP  WKG C+
Sbjct  61    TWDYLGLS--ASSPKNLLNETNMGEQIIIGIIDTGVWPESEVFNDDGIGSVPSHWKGGCQ  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
             +  G  FN S  CN+K+IGA++F  G  L ++   N     D  S  D+ GHG+ VA+I 
Sbjct  119   S--GEMFNSSH-CNKKLIGAKYFING-FLEENKSFNSKESLDFISPRDLNGHGTHVATIA  174

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDP-ERFVCAGADLLAAIDYAIHDR  1605
             AGS+V + +  G+  G VRGGA  AR+A YK CW LD  +   C+ AD+L A+D AIHD 
Sbjct  175   AGSYVQDISYKGLAGGTVRGGAPRARIAMYKGCWYLDDLDITTCSSADILKAMDEAIHDG  234

Query  1604  VDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVI  1425
             VDV+S+S+GS VPL  + +  +GI  G+FHA+ +GI V+ A GN+GP A T+TN  PW++
Sbjct  235   VDVLSLSLGSVVPLHGETDIRDGISTGAFHAVLKGITVVCAGGNSGPEAQTVTNTAPWIV  294

Query  1424  TVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL--------SHPLHFAGKYMGEADLM  1269
             TVAA+T+DR F   ITLGN  K  +   +  G  L          P +    + G  + +
Sbjct  295   TVAATTLDRSFPTPITLGN-NKVILGQAMYTGPELGFTSLVYPEDPGNSNETFSGTCEDL  353

Query  1268  PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT--DAGAVGVIYSNPSNVDSLPILNARIP  1095
                 +   V GK+V  F        V     +   AG + VI +     D  P L+   P
Sbjct  354   SLNSNDTMV-GKVVLCFTASSSSGSVSSAAGSVKKAGGLAVIIARHPGSDLEPCLD-DFP  411

Query  1094  YVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKP  915
              V VDY+ GT I  YI +ST +P  ++      VG+ +  KV  FSSRGP+S AP I+KP
Sbjct  412   CVSVDYELGTNILLYI-RSTGSPVLKIQPSTTLVGQPVGTKVASFSSRGPNSIAPAILKP  470

Query  914   DIAAPGDKIMCADPTS----DGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSAL  747
             DIAAPG  I+ A  T+    DGGF + SGTS AAP +S +VALLK  HP+WSPAAI+SA+
Sbjct  471   DIAAPGASILAATTTNTTLNDGGFIMLSGTSMAAPVISGVVALLKALHPDWSPAAIRSAI  530

Query  746   VTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCAL  567
             VTTAW +D +   I A+GSS + AD FDYGGG+VNP  A  PGLVYD+   DY  Y+C++
Sbjct  531   VTTAWRTDPFGEQIDAEGSSRKLADPFDYGGGLVNPEKAVKPGLVYDLDLEDYVLYMCSV  590

Query  566   GYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVG  387
             GYN+S I + +          E T C   RPS+LDLNLPS+ +PDL + VTL RTVTNVG
Sbjct  591   GYNDSSISQLVG---------ERTTCSNPRPSVLDLNLPSITIPDLKEEVTLTRTVTNVG  641

Query  386   PVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDG  207
             P +SVYK  V+ P+G  VTV P  L F+   KK S+ +RVS    +N+ F FGSLTWSD 
Sbjct  642   PPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKKLSYHVRVSTRHKINTGFYFGSLTWSDS  701

Query  206   VHNVRTPIAVRKMIVPLY  153
             VH+V  P++VR  I+  Y
Sbjct  702   VHDVIIPLSVRTQILQNY  719



>ref|XP_010511549.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/755 (46%), Positives = 464/755 (61%), Gaps = 48/755 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD   + ESH+D+L  ++GS E +R++M+YSYR+GFSGFAA LT+SQA
Sbjct  39    QIYTVHLGKRQHDDPDLVTESHHDILGPLLGSKEASRESMIYSYRHGFSGFAAKLTSSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV V   K+ K+ T+R  D+LGL+  A  P  LL +T+ G G+I+G+VDSG+
Sbjct  99    RELSEHPDVVHVTRSKNMKLTTTRVNDYLGLTPTA--PTGLLHETDMGSGVIIGIVDSGV  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               + PSF D G+G +P+RWKG C  + G  F  S  CNRK+IGA ++ KG     +  LN
Sbjct  157   WPDSPSFNDNGLGQIPRRWKGRC--VSGEGFKASS-CNRKLIGATYYSKGLKEMYNGMLN  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+  A+  AGSFV +A  LG+  G  RG A  AR+ASYK CWN 
Sbjct  214   LTEKDEVMSPLDKIGHGTHCATTAAGSFVQDANYLGLAKGTARGTAPKARIASYKVCWN-  272

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   C   D++ A+D+AI D VDV+S+SVG  +PL  +++ ++   I +FHA+ +G+P
Sbjct  273   ---NIKCFTPDIIKAMDHAIRDGVDVLSLSVGDEIPLGFEVDRDD-FAIAAFHAVMKGVP  328

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP   TI+N+ PW+ITVAA+T+DR F   ITLGN           N T L  
Sbjct  329   VVAAGGNDGPDTQTISNIAPWIITVAATTMDREFFTPITLGN-----------NITLLGQ  377

Query  1313  PLHFAGKYMGEA------DLMPRKLDPAEVKGKIVFMF--GDDLDRNLVLVDKATDAGAV  1158
                + GK +G +      DL    L     KGKI+F F  G   +   V + K    GAV
Sbjct  378   EGVYTGKEVGFSEIINFEDLTKEDLTAGIAKGKILFSFIRGTLAENFGVAMQKV---GAV  434

Query  1157  GVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRAL  981
             G+I +  P+  DS+    A IP   VDY+ G  I  Y+ Q+T  P A++S  K  VG+  
Sbjct  435   GLIIAIKPT--DSVVTEKADIPVAYVDYELGMDILLYM-QTTKKPIAKISPTKTFVGKPS  491

Query  980   TPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVA  801
               KV  FSSRGP+S +P I+KPDIAAPG  I+ A P S  G+   SGTS A P V+ IVA
Sbjct  492   ATKVAGFSSRGPNSISPAILKPDIAAPGSGILAAMP-SWSGYEFLSGTSMATPIVAGIVA  550

Query  800   LLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDP  621
             LLK +HP+WSPAAI+SALVTTA  +D    PI A+GS  + AD FDYGGG+VNP    DP
Sbjct  551   LLKQNHPDWSPAAIRSALVTTARQTDPSGEPISAEGSPRKLADPFDYGGGLVNPMKVADP  610

Query  620   GLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMV  441
             GLVYDM   +Y  YLC+ GYNN+ I K +          +   CP   PSMLD+NLPS+ 
Sbjct  611   GLVYDMGENEYVHYLCSAGYNNTSISKLLG---------KIYTCPFPFPSMLDVNLPSIT  661

Query  440   VPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR-SFTMRVS  264
             +P L K +T+ RTVTNVGPV SVYKA+++ P G  + V P+ L F  N   R +FT++VS
Sbjct  662   IPYLSKEITITRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFSSNTTNRITFTVKVS  721

Query  263   ADKLVNSAFTFGSLTWSD-GVHNVRTPIAVRKMIV  162
                  N+ + FGSLTW D G HNVR P++VR  ++
Sbjct  722   TTHKANTDYHFGSLTWIDNGGHNVRIPLSVRTRLL  756



>ref|XP_009105192.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/752 (45%), Positives = 457/752 (61%), Gaps = 43/752 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD + + +SH+D+L  ++GS E +R++M+YSYR+GFSGF+A LT+SQA
Sbjct  39    QIYTVHLGKRQHDDPKLVTDSHHDILGSLLGSKEASRESMIYSYRHGFSGFSAKLTSSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV V   K+ K+ T+R  D+LGL+  A  P  L+  T+ G   I+G+VDSGI
Sbjct  99    RELSENPHVVHVTRSKNMKLTTTRVSDYLGLTSTA--PTGLVHDTDMGSDAIIGIVDSGI  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
                  SF D G+GP+P RWKG C  + G  FN S +CNRK+IGA ++ KG          
Sbjct  157   WPGSKSFNDNGLGPIPARWKGQC--VSGEGFNAS-MCNRKLIGATYYAKGLARKYKGAFK  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  ++ S  D  GHG+  AS  AGSFV NA  LG+  G  RG A  ARVA+YK CWN 
Sbjct  214   AAEKDEAMSPLDKVGHGTHCASTAAGSFVQNANYLGLGQGTARGSAPRARVAAYKVCWNN  273

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENG-IGIGSFHAITRGI  1497
             +     C   D+L A+D+A+ D VDV+S+S+GS +PL  D E +     I +FHA+ +GI
Sbjct  274   EE----CFTPDILKAMDHAMRDGVDVLSLSLGSEIPL--DFEVDRSDFAIAAFHAVMKGI  327

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ A GN GP   TI+NV PW+ITV A+T+DR F   ITLGN           N T L 
Sbjct  328   TVVCAGGNDGPETQTISNVAPWIITVGATTMDREFFTPITLGN-----------NVTVLG  376

Query  1316  HPLHFAGKYMGEADLM------PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVG  1155
                 + G+ +G  DL+          +  + KGKI+F F  D   + +  + A   G VG
Sbjct  377   QEGLYIGEEVGFTDLIYFDDLTKADFEAGKAKGKILFTFLTDRSTDQI-AEFAKSKGVVG  435

Query  1154  VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             +I +    +D +    A I   +VDY+ G  I  Y+ Q+T  P A++S  K  VGR    
Sbjct  436   IIIAT-KPIDLIEPGTAGIASARVDYEIGMDILLYL-QTTKFPKAKISPTKTFVGRPSAT  493

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALL  795
             KV  FSSRGP+S +P I+KPDIAAPG  I+ A PT  G +   SGTS A P V+ IVALL
Sbjct  494   KVARFSSRGPNSISPAILKPDIAAPGVGILAAVPTGVG-YEFMSGTSMATPVVTGIVALL  552

Query  794   KISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGL  615
             K   P+WSPAAI+SALVTTA+ +D    PI A+GS  + AD FDYGGG+VNP    DPGL
Sbjct  553   KQKRPDWSPAAIRSALVTTAFQTDPSGEPIAAEGSPRKIADPFDYGGGLVNPGKVADPGL  612

Query  614   VYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVP  435
             VYDM   +Y  YLC+ GY +  I K +          +   CP   PSMLD+NLPS+ +P
Sbjct  613   VYDMGHDEYVHYLCSAGYEDISISKLLG---------KVYTCPSPTPSMLDVNLPSITIP  663

Query  434   DLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADK  255
              L + +T+ RTVTNVGPV SVYKA+++ P+G  + V PK L F  N KK +FT++VS   
Sbjct  664   YLSQEITITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTH  723

Query  254   LVNSAFTFGSLTWSD-GVHNVRTPIAVRKMIV  162
              VN+ + FGSLTW+D G HNVR P++VR  ++
Sbjct  724   RVNTDYHFGSLTWTDNGAHNVRIPLSVRTRVL  755



>ref|XP_010263869.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=787

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/779 (44%), Positives = 465/779 (60%), Gaps = 69/779 (9%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIVY+G + H D + I++SH+++L+ ++GS E AR +++YSY++GFSGFAAVL+ SQAK
Sbjct  42    VYIVYMGERRHYDSQLIQDSHHEVLSTLLGSQEAARASILYSYKHGFSGFAAVLSQSQAK  101

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
              +A   GV+ VV ++   V T+RSWDFL L   + +   +L ++  GDG I+GV+D+GI 
Sbjct  102   AIADFPGVIRVVPNRILNVHTTRSWDFLQLK--SEIIDGILSRSQSGDGSIIGVLDTGIW  159

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
              E  SF D GMG VP RW G C+   G  FN S  CNRK+IGARW+ KG     + +  K
Sbjct  160   PESESFNDDGMGEVPSRWNGVCQE--GEEFNSSN-CNRKIIGARWYIKG----YEAEFGK  212

Query  1850  FLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
                S S    S  D  GHG+  +S  AG+ V NA+ +G+  G+ RGGA+AAR+A YK CW
Sbjct  213   LNTSGSIEFLSPRDAVGHGTHTSSTAAGALVGNASFMGLAQGLARGGASAARLAIYKVCW  272

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             +       C+ ADLLAA D AI D VDV+SVS+GS  PL+  +E  + + IGSFHA+ +G
Sbjct  273   STGG----CSSADLLAAFDDAIFDGVDVLSVSLGSAPPLSPYIE--DTLAIGSFHAVAKG  326

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             IPV+ + GN+GP + T+ N  PW+ITVAASTIDR F   ITLGN +          G AL
Sbjct  327   IPVVCSGGNSGPYSQTVINTAPWIITVAASTIDRAFPTAITLGNNQTIV-------GQAL  379

Query  1319  SHPLHF-------AGKYMGEADLMPRK--------LDPAEVKGKIVFMFGDDLDR-NLVL  1188
                 H         G+ +   D    K        L+    +GK+V  F     R   V 
Sbjct  380   LTEKHVDKFYPIVYGESIASNDSDEDKARSCDVGSLNATLARGKVVLCFQSQSQRLAFVA  439

Query  1187  VDKATDAGAVGVIYSN--PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQL  1014
                 T    VGVI++     +V S P     +P + VD+  GT + +YI +ST  P  + 
Sbjct  440   TRTVTKVKGVGVIFAQLPKKDVASTP----GVPCIHVDFTIGTHVLEYI-RSTRNPVVRF  494

Query  1013  SSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGG--------  858
             S  K  +GR ++P+V  FSSRGPSS +P ++KPDIAAPG  I+ +   +           
Sbjct  495   SLTKTSLGRQISPEVAFFSSRGPSSLSPSVLKPDIAAPGVNILASWSPASPSSSIHQHKV  554

Query  857   ----FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGS  690
                 F+I SGTS + PH+SAIVALLK  HP WSPAAIKSALVTTA   D Y   I A+GS
Sbjct  555   PPLKFKIESGTSMSCPHISAIVALLKSMHPNWSPAAIKSALVTTASTKDEYGQSIVAEGS  614

Query  689   SLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSD  510
               + AD F+YGGG V+PN + DPGL+YDM   D+ ++LC +GYN+S +            
Sbjct  615   PHKQADPFEYGGGHVDPNKSADPGLIYDMGITDHVRFLCLMGYNDSAVSLM---------  665

Query  509   TEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVT  330
             T+  T+C +T  S+ DLNLPS+ +P+L K +T+ RTVTNVGPVNSVY   VKSP G +V 
Sbjct  666   TKHPTVCHETSKSLADLNLPSISIPELKKSLTVSRTVTNVGPVNSVYSVRVKSPPGVIVQ  725

Query  329   VKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             V+P VL F+   KK +F +   +   V   ++FG L+W DG H VR P+ VR +I   Y
Sbjct  726   VEPPVLSFNSTAKKLTFKVIFHSQLRVQGRYSFGYLSWEDGGHVVRIPLIVRAVIDDFY  784



>ref|XP_010056036.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=774

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/765 (46%), Positives = 465/765 (61%), Gaps = 55/765 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
              +YIVY G +   D     +SH+D+LA V+GS E A  +++YSYR+GFSGFAA LT SQA
Sbjct  29    NVYIVYFGVRKQGDPTVETDSHHDMLASVLGSKEAAAISILYSYRHGFSGFAAKLTESQA  88

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +++AG  GVV V+ +   ++QT+RSWDFLGLS  ++ P  LL K+  GDG+IVG++D+GI
Sbjct  89    QELAGFPGVVRVMPNTLFRLQTTRSWDFLGLSP-SHSPTSLLYKSRMGDGVIVGMIDTGI  147

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P RWKG C   P  +F+ ++ CNRK+IGARWF  G L      LN
Sbjct  148   WPESKSFSDEGLGPIPSRWKGGCE--PAEQFDPAKHCNRKIIGARWFVDGFLAEYGKPLN  205

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+  +S   GSFV N +  GI  G  RGGA  AR+A YK CWN+
Sbjct  206   ASGDLEFLSPRDANGHGTHTSSTAVGSFVSNVSYRGIGYGTARGGAPRARLAVYKVCWNV  265

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   C+ AD+L A D AIHD VDV+SVS+G+ +PL SD++  + I  G+FHA+ +GI 
Sbjct  266   --LNVQCSSADILKAFDEAIHDGVDVLSVSIGTAIPLFSDVDDRDAIATGAFHAVAQGIT  323

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+  AGN GP+A T+ N  PW++TV A++IDR F   ITLGN E          G A+  
Sbjct  324   VVCGAGNDGPAAQTVQNTAPWILTVGATSIDRAFRTIITLGNNETLV-------GQAI--  374

Query  1313  PLHFAGKYMGEADLM-PR--KLDPAE-------------VKGKIVFMFGDDLDRNLVLVD  1182
                + GK +G   L+ P    LDP               + GK+V  F   + R   +V 
Sbjct  375   ---YTGKEIGFTTLLYPEGTTLDPTSAGVCERLSPNATLMAGKVVLCF-TSIARRFEVVP  430

Query  1181  KATDA----GAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQ  1017
              A+ A      +GVI + NPS  D L   +   P V+VDY+ GT+I  Y F+S   P  +
Sbjct  431   LASAAVKASRGIGVIVAKNPS--DGLAPCSGDFPCVEVDYEIGTQILVY-FRSARFPKVK  487

Query  1016  LSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRI  849
             LS     VG+A+  KV  FSSRGPSS +P ++KPD+ APG  I+ A     P+ D G+RI
Sbjct  488   LSPTITAVGKAVQAKVAFFSSRGPSSISPAVLKPDVTAPGVNILAATSPFSPSEDNGYRI  547

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS A PHV+ IVALLK  HP+WSPAA +SALVTTAW ++    PIFA G   + AD 
Sbjct  548   LSGTSMATPHVAGIVALLKALHPDWSPAAFRSALVTTAWRTNPPGFPIFASGFPPKLADP  607

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FD GGG VNPN+A +PGL+YD+   DY  YLCA+GYN++ I            T +   C
Sbjct  608   FDMGGGNVNPNSAAEPGLIYDVGTPDYILYLCAMGYNDTEISHL---------TGKPAPC  658

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
             P  RPS+ D+NLPS+ +  L   VT+ RTVTN G     Y A+++ P G  VTV+P VL 
Sbjct  659   PARRPSVSDVNLPSITIARLTSTVTVTRTVTNTGNPKLRYWAVIEPPSGTTVTVRPHVLA  718

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             FD   KK +F++ V A   VN+ + FGSL W+DGVH VR+P+AVR
Sbjct  719   FDRETKKAAFSVTVCAAAPVNTGYYFGSLVWTDGVHAVRSPLAVR  763



>gb|KFK31852.1| hypothetical protein AALP_AA6G166800 [Arabis alpina]
Length=1462

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/761 (47%), Positives = 480/761 (63%), Gaps = 50/761 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VYLG K HDD   + +SH+ LL  ++GS E A  ++VYSYR+GFSGFAA LT SQA
Sbjct  734   KVYVVYLGEKEHDDPESVTKSHHQLLWSLLGSKEAALDSIVYSYRHGFSGFAAKLTESQA  793

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+++  +++ T+R+WDFLGLS G   P  LL+K N G  +IVGVVD+G+
Sbjct  794   QQISELPEVVHVIQNTLYELTTTRTWDFLGLSPGN--PKSLLQKANMGSDVIVGVVDTGV  851

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C +  G RF+ S  CNRK+IGA++F  G LL+   +LN
Sbjct  852   WPESEMFNDKGFGPIPSRWKGGCES--GERFSGSIHCNRKIIGAKYFVDG-LLADLGELN  908

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +    +  S  D  GHG+ VAS + GSF+PN + LG+  G  RGGA   R+A YKACW  
Sbjct  909   RTENPEYASPRDFNGHGTHVASTIGGSFLPNVSYLGLGRGTARGGAPGIRIAIYKACWLR  968

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   C+GAD+L AID AIHD VDV+S+S+GS VPL  + +      +G+FHA+ +GIP
Sbjct  969   SGS---CSGADVLKAIDEAIHDGVDVLSLSLGSKVPLFPETDVRELTSVGAFHAVAKGIP  1025

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ AAGN GP+A TI NV PW++TVAAST+DR F   ITLGN           N T L  
Sbjct  1026  VVAAAGNDGPAAQTIANVAPWILTVAASTLDRSFPTAITLGN-----------NITILGQ  1074

Query  1313  PLHFAG---KYMGEADLMPRKLDPAE------VKGKIVFMFGDDLDRNLVLVDKATDAGA  1161
              + F G    ++G A  + R  +         ++GK+V  F    ++ +  V    +AG 
Sbjct  1075  AI-FGGPELDFVGLAYPLSRDCEDLSTSPDNTIEGKVVLCFTTRTNQAITAV---RNAGG  1130

Query  1160  VGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRA  984
             +GVI + NP+++ S P +N   P V VD++ GT I  YI +ST +P  ++ + +  VG  
Sbjct  1131  LGVIIARNPTHLLS-PSVN--FPSVAVDFELGTDILFYI-RSTRSPIVKIHASRTLVGHP  1186

Query  983   LTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHAAPHV  816
             +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P S    GGF + SGTS A P V
Sbjct  1187  VATKVATFSSRGPNSISPAILKPDIAAPGVNILAAMSPNSSFNVGGFAMMSGTSMATPIV  1246

Query  815   SAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPN  636
             S IV LLK  HP WSP+AIKSA+VTTAW +D    PIFA GSS + AD FDYGGG+VNP 
Sbjct  1247  SGIVVLLKSLHPHWSPSAIKSAIVTTAWKTDPSGEPIFADGSSRKLADPFDYGGGLVNPE  1306

Query  635   AADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLN  456
              A  PGLVYDM   DY  YLC+  Y++  I + +          + T+CP  +PS+LDLN
Sbjct  1307  KAAKPGLVYDMATHDYIMYLCSADYSDISISRVLG---------KTTVCPNPKPSVLDLN  1357

Query  455   LPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFT  276
             LPS+ +P+L   VT+ RTVTNVGP++S+Y  ++  P G  VTV P  L F+   +K SFT
Sbjct  1358  LPSITIPNLKDEVTVTRTVTNVGPLDSIYNVVIDPPTGINVTVTPTTLVFNSTTRKLSFT  1417

Query  275   MRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             +RVS    VN+ + FGSL+W+D +H+V  P++VR   +  Y
Sbjct  1418  VRVSTTHKVNTGYYFGSLSWTDNLHDVAIPVSVRTQKLQRY  1458


 Score =   530 bits (1365),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 327/725 (45%), Positives = 451/725 (62%), Gaps = 37/725 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L   +GS E A  +MV+S+R+GFSGFAA LT S+A
Sbjct  34    KVHIVYLGEKQHDDPEFVTESHHQMLWSFLGSKENAHDSMVHSFRHGFSGFAAKLTNSEA  93

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V+ D+ +K+ T+R+WD+LG+S  AN P  LL  TN G+ MI+GV+D+G+
Sbjct  94    KKIADLPEVVHVIPDRFYKLATTRTWDYLGVST-AN-PKNLLNDTNLGEQMIIGVIDTGV  151

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+GPVP  WKG C +  G  FN S  CN+K+IGA++F   A L++    N
Sbjct  152   WPESEVFNDNGIGPVPSHWKGGCES--GEMFNSSH-CNKKLIGAKYFIN-AFLAEHESFN  207

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S     GHG+ VA+I  GS+VPN +  G+  G VRGGA  A +A YK CW L
Sbjct  208   FTKSLDFISPRAYNGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAPRAHIAVYKTCWYL  267

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D  +  +C+ AD+L A+D AI+D VDV+S+S+G   PL ++ +  +GI  G+FHA+ +GI
Sbjct  268   DDLDATLCSSADILKAMDEAIYDGVDVLSLSLGYE-PLFAETDVRDGISTGAFHAVLKGI  326

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQLPN  1332
              V+ AAGNAGP+A T+TN+ PW+ITVAA+T+DR FA  +TLGN     G+      +L  
Sbjct  327   TVVCAAGNAGPAAQTVTNLAPWIITVAATTLDRSFATPMTLGNNRVILGQAMYAGPEL-G  385

Query  1331  GTALSHPLHFAGKYMGEADLMPRKL-DPAE-VKGKIVFMFGDDLDRNLVLVDKA---TDA  1167
              T+L +P +        + +  R L +P   + GK+V  F   L  +  +   A     A
Sbjct  386   FTSLVYPENPENSNQNFSGVCERLLINPNHTMAGKVVLCF-TTLPYDTSVSKAARYVKRA  444

Query  1166  GAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             G  GVI +  P N+   P L+   P V VDY+ GT I  YI +S+ +P   +   +  +G
Sbjct  445   GGFGVIIAGQPGNILK-PCLD-DFPCVSVDYELGTNILLYI-RSSGSPVVNIQPSRTLIG  501

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT----SDGGFRISSGTSHAAP  822
             + +  KV  FSSRGP+  +  I+KPDIAAPG  I+ A  T    +D GF   SGTS A P
Sbjct  502   QPVGTKVATFSSRGPNPISAVILKPDIAAPGVSILAATTTNTTFNDRGFIFLSGTSMATP  561

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S +VALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+VN
Sbjct  562   TISGVVALLKSLHRDWSPAAIRSAIVTTAWRTDPFGELIFAEGSPRKLADPFDYGGGLVN  621

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A   GLVYD+   DY  Y+C+ GYN+S I + +          + T+C   RPS+LD
Sbjct  622   PEKAAKAGLVYDLGLEDYVLYMCSAGYNDSSISQLVG---------KGTVCSNPRPSVLD  672

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
              NLPS+ +P+L + VTL RT+TNVGP++SVYK  V+ P+G  VTV PK L F+   K+ S
Sbjct  673   FNLPSITIPNLKEEVTLTRTLTNVGPLDSVYKVAVEPPLGVQVTVTPKTLVFNSRTKRVS  732

Query  281   FTMRV  267
             F + V
Sbjct  733   FKVYV  737



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/762 (45%), Positives = 465/762 (61%), Gaps = 52/762 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQA
Sbjct  33    KVHIVYLGEKQHDDPEFVTESHHQMLCSLLGSKEDAHGSMVYSYRHGFSGFAAKLTKSQA  92

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V+ D  +K++T+R+WD+LGLS  A+ P   L +TN G+ +I+G++D+G+
Sbjct  93    KKIANLPEVVHVIPDSFYKLKTTRTWDYLGLS--ASSPKNHLNETNMGEQIIIGIIDTGV  150

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+G VP  WKG C++  G  FN S  CN+K+IGA++F  G  L ++   N
Sbjct  151   WPESEVFNDDGIGSVPSHWKGGCQS--GEMFNSSH-CNKKLIGAKYFING-FLEENKSFN  206

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D+ GHG+ VA+I AG +V + +  G+  G+VRGGA  AR+A YK CW L
Sbjct  207   SKESLDFISPRDLNGHGTHVATIAAGYYVQDISYKGLAGGVVRGGAPRARIAMYKGCWYL  266

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D  +   C+ AD+L A+D AIHD VDV+S+S+GS VPL  +++  +GI  G+FHA+ +GI
Sbjct  267   DDLDITTCSSADILKAMDEAIHDGVDVLSLSLGSVVPLHGEIDIRDGISTGAFHAVLKGI  326

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ A GN+GP A T+TN  PW++TVAA+T+DR F   ITLGN  K  +   +  G  L 
Sbjct  327   TVVCAGGNSGPEAQTVTNTAPWIVTVAATTLDRSFPTPITLGN-NKVILGQAMYTGPELG  385

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT--DA  1167
                      P +    + G  + +    +   V GK+V  F        V     +   A
Sbjct  386   FTSLVYPEDPGNSNETFSGTCEDLSLNSNDTMV-GKVVLCFTTSSSSGSVSSAAGSVKKA  444

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
             G +GVI +     D  P L+   P V VDY+ GT I  YI +ST +P  ++      VG+
Sbjct  445   GGLGVIIARHPGSDLEPCLD-DFPCVSVDYELGTNILLYI-RSTGSPVLKIQPSTTLVGQ  502

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTS----DGGFRISSGTSHAAPH  819
                               P   KPDIAAPG  I+ A  T+    DGGF + SGTS AAP 
Sbjct  503   ------------------PVGTKPDIAAPGASILAATTTNTTLNDGGFIMLSGTSMAAPV  544

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             +S +VALLK  HP+WSPAAI+SA+VTTAW +D +   I A+GSS + AD FDYGGG+VNP
Sbjct  545   ISGVVALLKALHPDWSPAAIRSAIVTTAWRTDPFGEQIDAEGSSRKLADPFDYGGGLVNP  604

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               A  PGLVYD+   DY  Y+CA+GYN+S I + +          E T C   RPS+LDL
Sbjct  605   EKAVKPGLVYDLGLQDYVLYMCAVGYNDSSISQLVG---------ERTTCSNPRPSVLDL  655

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +PDL + VTL RTVTNVGP+NSVYK  V+ P+G  VTV PK L F+   K  S+
Sbjct  656   NLPSITIPDLKEEVTLTRTVTNVGPLNSVYKVKVEPPLGIQVTVVPKKLVFNSKTKTLSY  715

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              +RVS    +N+ F FGSLTWSD VHNV  P++VR  I+  Y
Sbjct  716   QVRVSTRHKINTGFYFGSLTWSDSVHNVIIPLSVRTQILQNY  757



>emb|CBI34614.3| unnamed protein product [Vitis vinifera]
Length=2139

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/739 (47%), Positives = 458/739 (62%), Gaps = 55/739 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E    ++IVYLG + H+D   +++SH+D+LA +VGS E A + MVYSY++GFSGFAA LT
Sbjct  763   ETRTNVHIVYLGERQHNDPELVRDSHHDMLASIVGSKEVASELMVYSYKHGFSGFAAKLT  822

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+++A + GV+ V+ +  H++QT+RSWD+LGLS  +  P  +L  +N GDG+I+GV+
Sbjct  823   ESQAQRIAELPGVLRVIPNSLHQLQTTRSWDYLGLSFQS--PKNILHSSNMGDGVIIGVL  880

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  SF D G GP+P +WKG C +  G +FN +  CNRKVIGARWF  G L    
Sbjct  881   DTGIWPESKSFNDEGFGPIPSQWKGVCES--GQQFNSTMHCNRKVIGARWFVNGFLAEYG  938

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               LN     +  S  D  GHG+  +S   GSFV N +  G+ +G VRGGA  AR+A YK 
Sbjct  939   QPLNTSGNQEFLSPRDANGHGTHTSSTAGGSFVGNVSYKGLALGTVRGGAPHARLAIYKV  998

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CWN+   +  C+ AD+L A D AI+D V V+S+S+GS +PL SD++  +GI  GSFHA+ 
Sbjct  999   CWNVLGGQ--CSSADILKAFDEAINDGVHVLSLSIGSSIPLFSDIDERDGIATGSFHAVA  1056

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GI V+  A N GP A T+ N  PW++TVAAST+DR F   ITLGN           N T
Sbjct  1057  KGITVVCGASNDGPQAQTVQNTAPWILTVAASTMDRAFPTPITLGN-----------NKT  1105

Query  1325  ALSHPLHFAGKYMGEADLM----------------PRKLDPAEVKGKIVFMFGDDLDRNL  1194
              L   L F GK  G + L+                   LD   V GK+V  F   + R  
Sbjct  1106  LLGQAL-FTGKETGFSGLVYPEVSGLALNSAGQCEALSLDQTSVAGKVVLCFTSTV-RRA  1163

Query  1193  VLVDKATD---AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTP  1026
              L+  ++D   AG VGVI + NP   D+L   +   P V+VDY+ GTRI  YI +ST  P
Sbjct  1164  TLISASSDVQAAGGVGVIIAKNPG--DNLAACSNDFPCVEVDYEIGTRILYYI-RSTRLP  1220

Query  1025  TAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGG  858
                LS  K  VG A+  KV  FSSRGP+S AP I+KPDI APG  I+ A    +   DGG
Sbjct  1221  VVNLSPSKTFVGEAVLAKVAYFSSRGPNSIAPAILKPDITAPGVNILAATGPLNRVMDGG  1280

Query  857   FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRA  678
             + + SGTS A PHVS +VALLK  HP+WSPAAIKSALVTTAW +     PIFA+G   + 
Sbjct  1281  YAMLSGTSMATPHVSGVVALLKALHPDWSPAAIKSALVTTAWRNGPSGLPIFAEGFPKKL  1340

Query  677   ADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEH  498
             AD FD+GGGIVNPN A DPGLVYD+   D+  YLCA+GYNNS I +          T + 
Sbjct  1341  ADPFDFGGGIVNPNGATDPGLVYDVGATDHIYYLCAVGYNNSAISQL---------TGQS  1391

Query  497   TICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPK  318
              +CP  RPS+LD+NLPS+ +P+L    TL RTVTNVG   S+Y+ +++ P+G V+TV P 
Sbjct  1392  IVCPSERPSILDVNLPSITIPNLRNSTTLTRTVTNVGAPESIYRVVIQPPIGVVITVNPD  1451

Query  317   VLRFDGNRKKRSFTMRVSA  261
             VL F+   K  +F + VS+
Sbjct  1452  VLVFNSMTKSITFKVTVSS  1470


 Score =   505 bits (1301),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 310/707 (44%), Positives = 414/707 (59%), Gaps = 105/707 (15%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVG-SHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             ++IVYLG + + D R + +SH+D+LA V+G   + A  +MVYSY++GFSGFAA LT SQA
Sbjct  1524  VHIVYLGDRQNSDPRLVTDSHHDILASVLGRKSKSAFDSMVYSYKHGFSGFAAKLTDSQA  1583

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +KVA + GVV V+ ++ HK+QT+RSWD+LGLS  +  P  LL +TN G G+I+G++D+G+
Sbjct  1584  QKVADLPGVVHVIPNRLHKLQTTRSWDYLGLS--SQSPSNLLHETNMGGGIIIGLLDTGV  1641

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P  WKG C  + G  FN +  CNRK+IGARW+  G L   +   N
Sbjct  1642  CPESEVFNDEGFGPIPSHWKGGC--VSGELFNATTDCNRKLIGARWYIDGFLADNEQPSN  1699

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+  ++I +GSF+ NA+  G+ +G+VRGGA  AR+A YK CWN+
Sbjct  1700  TTENPDYLSPRDSIGHGTHTSTIASGSFLVNASYQGLGLGIVRGGAPRARIAMYKVCWNV  1759

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                +  CA AD+L A D AIHD VDV+SVS+GS +PL S+++  +GI IGSFHA+ +G+ 
Sbjct  1760  AAGQ--CASADILKAFDEAIHDGVDVLSVSLGSDIPLFSEVDERDGIAIGSFHAVAKGMT  1817

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+  A   GPSA ++ N  PW++TVAASTIDR F   ITLGN           N T L  
Sbjct  1818  VVCGASTDGPSAQSVQNTAPWILTVAASTIDRSFPTPITLGN-----------NVTILGQ  1866

Query  1313  PLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNPS  1134
              + F GK +G + L+       E  G +    G  +  +L L +  T AG V + ++   
Sbjct  1867  AM-FPGKEIGFSGLV-----HPETPGLLPTAAG--VCESLSL-NNTTVAGNVVLCFTT--  1915

Query  1133  NVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSS  954
                                + GT+I  YI +ST +PT +LSS K  VG+ ++ K+  FSS
Sbjct  1916  -------------------ELGTKILFYI-RSTSSPTVKLSSSKTLVGKPVSTKIAYFSS  1955

Query  953   RGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKIS  786
             RGPSS AP  +KPDIAAP   I+ A    DP  DGGF + SGTS A PH+S IVALLK  
Sbjct  1956  RGPSSIAPANLKPDIAAPSVSILAASSPLDPFMDGGFALHSGTSMATPHISGIVALLKAL  2015

Query  785   HPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYD  606
             HP WSP AIKSALVTTAW +D    PIF +GS  + AD FDYGGGIVNPN A +PGLVYD
Sbjct  2016  HPSWSPVAIKSALVTTAWRTDPLGEPIFVEGSPRKLADPFDYGGGIVNPNKAAEPGLVYD  2075

Query  605   MRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLF  426
             M   DY  YLC++GYNNS I +                                      
Sbjct  2076  MGTSDYIHYLCSVGYNNSAISQ--------------------------------------  2097

Query  425   KPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
                           +NS+YKA+++ P+G  VTV+P +L F+   K +
Sbjct  2098  --------------LNSMYKAMIEPPLGIPVTVRPDILVFNSTTKTQ  2130



>ref|XP_010538683.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=696

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/726 (45%), Positives = 461/726 (63%), Gaps = 38/726 (5%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  V GS E AR++++YSYR+GFS FAA LT SQ KK++    V+ V  +++ K+ T+R
Sbjct  1     MLESVFGSEESARESLIYSYRHGFSAFAAKLTDSQVKKLSVHPDVIGVRPNRNLKMLTTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
              +D+LGLS   ++P  LL  TN G  +I+GV+DSGI  E  SF D G+GP+P+ WKG C 
Sbjct  61    VFDYLGLSP--SLPTGLLPDTNMGRDVIIGVIDSGIMPESESFNDEGLGPIPKHWKGQCV  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSY-SGYDVAGHGSQVASI  1785
             A  G  F+ ++ CN+K+IGAR++  G    ++ +  +    D Y S  D  GHG+  ASI
Sbjct  119   A--GDNFDPAKHCNKKLIGARYYMDGF---KEKNGAEIAFDDEYKSPRDAYGHGTACASI  173

Query  1784  VAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDR  1605
              AGS VPNA+  G+  G++RG A  AR+ASYK CW    +   C  AD + A D A+HD 
Sbjct  174   AAGSIVPNASYRGMARGVMRGAAPRARIASYKVCWL---KGASCGLADTVKAFDDAVHDG  230

Query  1604  VDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVI  1425
             VDV+S+S+G   P+ S+++  + I +G+FHA+T+GIPV+ AAGNAGP A T+ NV PW++
Sbjct  231   VDVLSISLGGQSPVDSEIDGTDDIALGAFHAVTKGIPVVAAAGNAGPDAQTLANVSPWIL  290

Query  1424  TVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAE  1245
             TVAA+T+DR F+  ITLGN               +S  +H        + L         
Sbjct  291   TVAATTLDRSFSVVITLGNNLTIRGQAVYNRSAVVSEVVHIDDWNSNTSSL---------  341

Query  1244  VKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGT  1065
              +GK+V +F  +     +   +A      GVIY  PS  DS+      IP + V+Y+AGT
Sbjct  342   -QGKVVLIFLKNEMDVFMGTSQAMRTRPAGVIYVKPS--DSMFESFIGIPEISVNYEAGT  398

Query  1064  RIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIM  885
             +I  YI +ST +PT ++SS +  VGR +  ++  FSSRGP+S +P I+KPDIAAPG +I+
Sbjct  399   KILRYI-RSTSSPTIRISSTETPVGRPIPTRIAGFSSRGPNSLSPAILKPDIAAPGSQIL  457

Query  884   CA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTY  717
              A    +P  D G  +++GTS++AP V+ IVALLK  HP+WSPAA+KSA++TTAW +D Y
Sbjct  458   VASIMSNPRFDTGISLNTGTSYSAPAVAGIVALLKSLHPDWSPAALKSAVITTAWKTDPY  517

Query  716   FSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKT  537
               PIF++GSS + AD FDYGGG++NP  A DPGLVYDM   DY  Y CA  YN+S I K 
Sbjct  518   GQPIFSEGSSQKLADPFDYGGGLINPEKARDPGLVYDMGIEDYIHYFCARSYNDSAISKL  577

Query  536   ISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPV-TLRRTVTNVGPVNSVYKAI  360
             +          +   CP  RPS+LD+N+PS+ +PDL +   T+ RTVTNVGPV+SVY+A+
Sbjct  578   VG---------KSVTCPSPRPSILDVNVPSITIPDLDEEAVTVTRTVTNVGPVDSVYRAV  628

Query  359   VKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIA  180
             V+ P+G  + VKP+ L F+ + KK++F+M VS     N+ F FGSL W+DG  NV  P++
Sbjct  629   VEPPLGINILVKPEALAFNSDTKKQTFSMSVSTSHKTNTGFFFGSLVWTDGTRNVSVPLS  688

Query  179   VRKMIV  162
             VR  +V
Sbjct  689   VRTQLV  694



>ref|XP_010437025.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=778

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/765 (44%), Positives = 470/765 (61%), Gaps = 41/765 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L  ++GS E+A  +MV+S+R+GFSGFAA LT SQA
Sbjct  33    KVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEQAHDSMVHSFRHGFSGFAAKLTESQA  92

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    VV V+ D+ +K  T+R+WD+LG+S  A  P  LL +TN G+ MI+G++D+G+
Sbjct  93    KKIADSPEVVHVIPDRFYKPTTTRTWDYLGVS--AANPKNLLNETNMGEQMIIGIIDTGV  150

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+GPVP  WKG   +  G  FN S  CN+K+IGA++F  G L + +   N
Sbjct  151   WPESEVFNDNGIGPVPSHWKGGRES--GEDFNSSH-CNKKLIGAKYFINGFLATHE-SFN  206

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S     GHG+ VA+I  GS+VPN +  G+  G VRGGA  AR+A YK CW L
Sbjct  207   STESLDFISPRGYNGHGTHVATIAGGSYVPNTSYKGLARGTVRGGAPRARIAVYKTCWYL  266

Query  1673  DPERF-VCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D E   +C+ AD+L A+D AI D VDV+S+S+G   PL  + +  +GI IG+FHA+ +GI
Sbjct  267   DDEDITICSAADILKAMDEAIDDGVDVLSLSLGYE-PLYPETDVRDGIAIGAFHAVMKGI  325

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG----  1329
              V+ AAGNAGP+A T+TN+ PW+ITVAA+T+DR FA  + LGN  K  +   +  G    
Sbjct  326   TVVCAAGNAGPAAQTVTNLAPWIITVAATTLDRSFATPMILGN-NKVILGQAIYTGPEVD  384

Query  1328  -TALSHPLHFAGKYMGEADLMPRKL--DPAEVKGKIVFMFGDD-----LDRNLVLVDKAT  1173
              T+L +P +        +    R +    + + GK+V  F +      + R    V +A 
Sbjct  385   FTSLVYPENPGNSNESFSGTCERLIINSNSTMAGKVVLCFTESPYSTSVSRAARYVKRA-  443

Query  1172  DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
               G +GVI +  P N+   P L+   P V VDY+ GT I  YI +S  +P  ++   +  
Sbjct  444   --GGLGVIIAGQPGNILR-PCLD-EFPCVAVDYELGTNILFYI-RSNGSPVVKIQPSRTL  498

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT----SDGGFRISSGTSHA  828
             +G+ +  KV  FSSRGP+  +  I+KPDIAAPG  I+ A  T    +DGGF   SGTS A
Sbjct  499   IGQPVGTKVASFSSRGPNPISAAILKPDIAAPGVSILAATTTNTTFNDGGFIFLSGTSMA  558

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P +S +VALLK  H +WSPAAI+SA+VTTAW +D     I A+GS  +  D FDYGGG+
Sbjct  559   TPTISGVVALLKALHHDWSPAAIRSAIVTTAWRTDPLGEQITAEGSPRKLTDPFDYGGGL  618

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VNP  A  PGLVYD+   DY  Y+C++GYN + I + +          + T+C   +PS+
Sbjct  619   VNPEKATKPGLVYDLGLEDYVLYMCSVGYNETSISQLVG---------KGTVCSIPKPSV  669

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD NLPS+ +P+L   VTL +T TNVGP+ SVY   V+ P+G  VTV P+ L F+   K+
Sbjct  670   LDFNLPSITIPNLKDEVTLTKTFTNVGPLESVYNVTVEPPLGIQVTVTPETLVFNSTTKR  729

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SF +RVS    +N+ + FGSLTWSD +HNV  P++VR  I+  Y
Sbjct  730   ASFKVRVSTTHKINTGYYFGSLTWSDSLHNVTIPLSVRTQILRYY  774



>ref|NP_001078370.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82897.1| subtilisin-like protease [Arabidopsis thaliana]
Length=722

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/737 (45%), Positives = 456/737 (62%), Gaps = 33/737 (4%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQAKK+A +  VV V+ D  +K+ T+R
Sbjct  1     MLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQAKKIADLPDVVHVIPDSFYKLATTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             +WD+LGLS  A  P  LL +TN G+ +I+GV+D+G+  E   F D+G GPVP  WKG C 
Sbjct  61    TWDYLGLS--AANPKSLLHETNMGEQIIIGVIDTGVWPESEVFNDSGFGPVPSHWKGGCE  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
                G  FN S  CN+K+IGA++F  G  L+++   N     D  S  D+ GHG+ V++I 
Sbjct  119   T--GENFNSSN-CNKKLIGAKYFING-FLAENESFNSTNSLDFISPRDLDGHGTHVSTIA  174

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPE-RFVCAGADLLAAIDYAIHDR  1605
              GSFVPN +  G+  G VRGGA  A +A YKACW LD +    C+ AD+L A+D A+HD 
Sbjct  175   GGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWYLDDDDTTTCSSADILKAMDEAMHDG  234

Query  1604  VDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVI  1425
             VDV+S+S+GS VPL  + +  +GI  G+FHA+ +GI V+ + GN+GP + T+TN  PW+I
Sbjct  235   VDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKGITVVCSGGNSGPDSLTVTNTAPWII  294

Query  1424  TVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL--------SHPLHFAGKYMGEADLM  1269
             TVAA+T+DR FA  +TLGN  K  +   +  G  L         +P +    + G  + +
Sbjct  295   TVAATTLDRSFATPLTLGN-NKVILGQAMYTGPGLGFTSLVYPENPGNSNESFSGTCEEL  353

Query  1268  PRKLDPAEVKGKIVFMFGDDLDRNLVL--VDKATDAGAVGVIYSNPSNVDSLPILNARIP  1095
                 +   ++GK+V  F        VL        AG +GVI +        P L+   P
Sbjct  354   LFNSN-RTMEGKVVLCFTTSPYGGAVLSAARYVKRAGGLGVIIARHPGYAIQPCLD-DFP  411

Query  1094  YVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKP  915
              V VD++ GT I  Y  +S+ +P  ++   K  VG+ +  KV  FSSRGP+S AP I+KP
Sbjct  412   CVAVDWELGTDILLYT-RSSGSPVVKIQPSKTLVGQPVGTKVATFSSRGPNSIAPAILKP  470

Query  914   DIAAPGDKIMCADPT---SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALV  744
             DIAAPG  I+ A      SD GF + SGTS AAP +S + ALLK  H +WSPAAI+SA+V
Sbjct  471   DIAAPGVSILAATTNTTFSDQGFIMLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIV  530

Query  743   TTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALG  564
             TTAW +D +   IFA+GS  + AD FDYGGG+VNP  + +PGLVYDM   DY  Y+C++G
Sbjct  531   TTAWKTDPFGEQIFAEGSPPKLADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVG  590

Query  563   YNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGP  384
             YN + I + I          + T+C   +PS+LD NLPS+ +P+L   VT+ RTVTNVGP
Sbjct  591   YNETSISQLIG---------KTTVCSNPKPSVLDFNLPSITIPNLKDEVTITRTVTNVGP  641

Query  383   VNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGV  204
             +NSVY+  V+ P+G  VTV P+ L F+   KK  F ++VS     N+ + FGSLTWSD +
Sbjct  642   LNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSL  701

Query  203   HNVRTPIAVRKMIVPLY  153
             HNV  P++VR  I+  Y
Sbjct  702   HNVTIPLSVRTQILQNY  718



>dbj|BAE98849.1| subtilisin-like protease -like protein [Arabidopsis thaliana]
Length=722

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/737 (45%), Positives = 456/737 (62%), Gaps = 33/737 (4%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQAKK+A +  VV V+ D  +K+ T+R
Sbjct  1     MLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQAKKIADLPDVVHVIPDGFYKLATTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             +WD+LGLS  A  P  LL +TN G+ +I+GV+D+G+  E   F D+G GPVP  WKG C 
Sbjct  61    TWDYLGLS--AANPKSLLHETNMGEQIIIGVIDTGVWPESEVFNDSGFGPVPSHWKGGCE  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
                G  FN S  CN+K+IGA++F  G  L+++   N     D  S  D+ GHG+ V++I 
Sbjct  119   T--GENFNSSN-CNKKLIGAKYFING-FLAENESFNSTNSLDFISPRDLDGHGTHVSTIA  174

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPE-RFVCAGADLLAAIDYAIHDR  1605
              GSFVPN +  G+  G VRGGA  A +A YKACW LD +    C+ AD+L A+D A+HD 
Sbjct  175   GGSFVPNISYKGLAGGTVRGGAPRAHIAMYKACWYLDDDDTTTCSSADILKAMDEAMHDG  234

Query  1604  VDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVI  1425
             VDV+S+S+GS VPL  + +  +GI  G+FHA+ +GI V+ + GN+GP + T+TN  PW+I
Sbjct  235   VDVLSISLGSSVPLYGETDIRDGITTGAFHAVLKGITVVCSGGNSGPDSLTVTNTAPWII  294

Query  1424  TVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL--------SHPLHFAGKYMGEADLM  1269
             TVAA+T+DR FA  +TLGN  K  +   +  G  L         +P +    + G  + +
Sbjct  295   TVAATTLDRSFATPLTLGN-NKVILGQAMYTGPGLGFTSLVYPENPGNSNESFSGTCEEL  353

Query  1268  PRKLDPAEVKGKIVFMFGDDLDRNLVL--VDKATDAGAVGVIYSNPSNVDSLPILNARIP  1095
                 +   ++GK+V  F        VL        AG +GVI +        P L+   P
Sbjct  354   LFNSN-RTMEGKVVLCFTTSPYGGAVLSAARYVKRAGGLGVIIARHPGYAIQPCLD-DFP  411

Query  1094  YVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKP  915
              V VD++ GT I  Y  +S+ +P  ++   K  VG+ +  KV  FSSRGP+S AP I+KP
Sbjct  412   CVAVDWELGTDILLYT-RSSGSPVVKIQPSKTLVGQPVGTKVATFSSRGPNSIAPAILKP  470

Query  914   DIAAPGDKIMCADPT---SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALV  744
             DIAAPG  I+ A      SD GF + SGTS AAP +S + ALLK  H +WSPAAI+SA+V
Sbjct  471   DIAAPGVSILAATTNTTFSDQGFIMLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIV  530

Query  743   TTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALG  564
             TTAW +D +   IFA+GS  + AD FDYGGG+VNP  + +PGLVYDM   DY  Y+C++G
Sbjct  531   TTAWKTDPFGEQIFAEGSPPKLADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVG  590

Query  563   YNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGP  384
             YN + I + I          + T+C   +PS+LD NLPS+ +P+L   VT+ RTVTNVGP
Sbjct  591   YNETSISQLIG---------KTTVCSNPKPSVLDFNLPSITIPNLKDEVTITRTVTNVGP  641

Query  383   VNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGV  204
             +NSVY+  V+ P+G  VTV P+ L F+   KK  F ++VS     N+ + FGSLTWSD +
Sbjct  642   LNSVYRVTVEPPLGFQVTVTPETLVFNSTTKKVYFKVKVSTTHKTNTGYYFGSLTWSDSL  701

Query  203   HNVRTPIAVRKMIVPLY  153
             HNV  P++VR  I+  Y
Sbjct  702   HNVTIPLSVRTQILQNY  718



>ref|XP_010455451.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=1533

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/763 (45%), Positives = 470/763 (62%), Gaps = 36/763 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L  ++GS ++A  ++V+SYR+GFSGFAA LT SQA
Sbjct  787   KVHIVYLGEKQHDDPESVTESHHQMLWSLLGSKKDADNSLVHSYRHGFSGFAAKLTKSQA  846

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V  D  +++ T+++WD+LGLS  A  P  LL  TN G+ +I+GVVDSG+
Sbjct  847   KKIADLPEVVHVTPDSFYELATTQTWDYLGLS--AANPKNLLNDTNMGEDVIIGVVDSGV  904

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D  +GP+P  WKG C A  G  FN S  CN+K+IGA++F  G L + +   N
Sbjct  905   WPESEVFNDNVIGPIPSHWKGGCEA--GEMFNASH-CNKKLIGAKYFINGFLATHE-SFN  960

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D +GHG+ VA+I  GS+VPN +  G+  G VRGGA  AR+A YKACW L
Sbjct  961   STESLDFISPRDHSGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAQRARIAMYKACWYL  1020

Query  1673  DPERF-VCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D      C+ ADLL A+D A+HD VDV+S+S+G  +P   + +    I  G+FHA+ +GI
Sbjct  1021  DDLDINTCSSADLLKAMDEAMHDGVDVLSLSIGYRLPYYPETDIRAAIATGAFHAVLKGI  1080

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ + GN+GP++ T+ N  PW++TVAA+T+DR F   I LGN  K  +   +  G  L 
Sbjct  1081  TVVCSGGNSGPASQTVGNTAPWILTVAATTLDRSFPTPIILGN-NKAVLGQAMYTGPELG  1139

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLV--LVDKATDA  1167
                     +P +    + G  +L+    +   + GK+V  F        V   V     A
Sbjct  1140  FTSLVYPENPGNSNESFFGTCELLFFNSN-RTMAGKVVLCFTTSTRYTTVSSAVSYVKKA  1198

Query  1166  GAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             G +G+I + NP   D+L       P V VDY+ GT I  YI +ST +P  ++   K  VG
Sbjct  1199  GGLGLIVARNPG--DNLSPCVDDFPCVSVDYELGTNILFYI-RSTGSPVVKIKPSKTLVG  1255

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTS----DGGFRISSGTSHAAP  822
             + +  KV DFSSRGP+S  P I+KPDIAAPG  I+ A  T+    D GF I SGTS AAP
Sbjct  1256  QPVGTKVADFSSRGPNSIEPAILKPDIAAPGVSILAATSTNRTFNDQGFIILSGTSMAAP  1315

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S +VALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+VN
Sbjct  1316  VISGVVALLKARHRDWSPAAIRSAIVTTAWRTDPFGEQIFAEGSPRKLADPFDYGGGLVN  1375

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A  PGLVYD+   DY  Y+C++GYN S I + +          + T+C   +PS+LD
Sbjct  1376  PEKAAKPGLVYDLGLEDYVHYMCSVGYNESSISQLVG---------KGTVCSIPKPSVLD  1426

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
              NLPS+ +P+L   VTL RT+TNVGP+NS+YK +V+ P+G  VTV P+ L F+   K+ S
Sbjct  1427  FNLPSITIPNLKDVVTLTRTLTNVGPLNSIYKVMVEPPLGIQVTVSPETLVFNSTTKRAS  1486

Query  281   FTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F +RVS    +N+ + FGSLTWSD  HNV  P++VR   +P Y
Sbjct  1487  FKVRVSTTHKINTGYYFGSLTWSDSEHNVTIPLSVRTQTLPYY  1529


 Score =   568 bits (1465),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 335/745 (45%), Positives = 460/745 (62%), Gaps = 36/745 (5%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K++IV+LG K HDD   + E+H+ +L  ++GS E+   +MVYSYR+GFSGFAA LT +Q
Sbjct  31    RKVHIVHLGEKQHDDPDFVTETHHQMLWSLLGSKEDVHDSMVYSYRHGFSGFAAKLTKTQ  90

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AKK+A +  VV V+ D  +K++T+R+WD+LGLS  A  P  LL +TN G+  I+GV+D+G
Sbjct  91    AKKIADLPEVVHVIPDSFYKLKTTRTWDYLGLS--AANPRNLLDETNMGEQSIIGVIDTG  148

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   F D G+GPVP  WKG C +  G  FN S  CN+K+IGA++F  G  ++++   
Sbjct  149   VWPESEVFNDYGIGPVPSHWKGGCES--GEAFNSSH-CNKKLIGAKYFING-FIAENESF  204

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     D  S  D  GHG+ VA+I  GS+VPN +  G+  G VRGGA  AR+A YK CW 
Sbjct  205   NSTKSLDFISPRDHDGHGTHVATIAGGSYVPNISYKGLAGGTVRGGAPRARIAMYKTCWY  264

Query  1676  LDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             LD E  + C+ AD+L AID A+HD VDV+S+S+GS VP+  + +  +GI  G+FHA+ +G
Sbjct  265   LDDEDIMSCSSADILKAIDEAMHDGVDVLSISLGSDVPMYGETDIPDGITTGAFHAVLKG  324

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG---  1329
             I V+ A GN+GP A T+TN  PW++TVAA+T+DR FA  ITLGN  K  +   +  G   
Sbjct  325   ITVVCAGGNSGPEAQTVTNTAPWIVTVAATTLDRSFATPITLGN-NKAILGQAMYTGPEI  383

Query  1328  --TALSHPLHFAGK----YMGEADLMPRKLDPAEVKGKIVFMFGDD--LDRNLVLVDKAT  1173
               T+L +P +  GK    + G  + +    +   V GK+V  F                 
Sbjct  384   GFTSLVYPEN-PGKSDHSFSGTCEELSVNSNLTMV-GKVVLCFTTSPYSASASSAARSVK  441

Query  1172  DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
              AG +GVI +        P L+   P V VD++ GT I  YI +S   P  ++   +   
Sbjct  442   TAGGIGVIIARQPGYVIRPCLD-DFPCVAVDWELGTDILLYI-RSNGFPVVKIQPSRTLT  499

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT----SDGGFRISSGTSHAA  825
             G+ +  KV  FSSRGP+S A  I+KPDIAAPG  I+ A  T    +D GF + SGTS AA
Sbjct  500   GQPVGTKVATFSSRGPNSIAAAILKPDIAAPGVSILAATTTNTTFNDRGFNMMSGTSMAA  559

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P +S +VALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+V
Sbjct  560   PAISGVVALLKALHRDWSPAAIRSAIVTTAWRTDPFGEQIFAEGSPRKLADPFDYGGGLV  619

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A  PGLVYD+   DY  Y+C+ GYN S I + +          + T+C   +PS+L
Sbjct  620   NPEKAAKPGLVYDLGLEDYVLYMCSAGYNESSISQLVG---------KGTVCSNPKPSIL  670

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             D NLPS+ +P+L   VTL RT+TNVGP+ SVY+  V+ P+G  VTV PK L F    K+ 
Sbjct  671   DFNLPSITIPNLKDEVTLTRTLTNVGPLKSVYRVKVEPPLGFQVTVTPKTLVFKAKTKRV  730

Query  284   SFTMRVSADKLVNSAFTFGSLTWSD  210
             SF +R+S    +N+ + FGSLTWSD
Sbjct  731   SFKVRISTTHKINTGYYFGSLTWSD  755



>ref|XP_006286616.1| hypothetical protein CARUB_v10002407mg, partial [Capsella rubella]
 gb|EOA19514.1| hypothetical protein CARUB_v10002407mg, partial [Capsella rubella]
Length=719

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/742 (45%), Positives = 457/742 (62%), Gaps = 55/742 (7%)
 Frame = -3

Query  2435  SVGTNAKVLK-ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYR  2259
             S+  N+++LK EN   +Y+VYLG K HD+   + ESH+ +L  ++GS ++A  ++VYSYR
Sbjct  11    SLENNSELLKIEN--PVYVVYLGEKEHDNPDSVTESHHQMLWPILGSKKDAHDSIVYSYR  68

Query  2258  YGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKT  2079
             +GFSGFAA LT SQA++++ +  VV V+ +  +++ T+R+W++LG+S   +    LL+K 
Sbjct  69    HGFSGFAAKLTESQAQQISELPEVVQVIPNTLYEMTTTRTWEYLGISPANS--NSLLQKA  126

Query  2078  NKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGAR  1899
             N G  +IVGV+D+G+  E   F D G GP+P RWKG C +  G  FN S  CN+K+IGA+
Sbjct  127   NMGSQVIVGVIDTGVWPESEMFNDKGYGPIPSRWKGGCES--GEIFNGSVHCNKKLIGAK  184

Query  1898  WFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGG  1719
             +F    +    V LNK +  D  S  D  GHG+ VAS + GSF+PN   LG+  G  RGG
Sbjct  185   YFIDANVADFGV-LNKTVNPDYLSPRDFEGHGTHVASTIGGSFLPNVNYLGLGRGTARGG  243

Query  1718  ATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAEN  1539
             A    +A YKACW     +  C+GAD+L AID AIHD VD++S+S+ + VPL  + +  +
Sbjct  244   APGVHIAIYKACW----IQRGCSGADVLKAIDEAIHDGVDILSLSLQTSVPLFPETDMRS  299

Query  1538  GIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEK  1359
                +G+FHA+ +GIPV+ AAGNAGP+A TI NV PW++TVAA+T DR F   ITLGN   
Sbjct  300   LASVGAFHAVAKGIPVVAAAGNAGPTAQTICNVAPWILTVAATTQDRSFPTAITLGN---  356

Query  1358  YAVDWQLPNGTALSHPLHFAGKYMG-----------EADLMPRKLDPAE-VKGKIVFMFG  1215
                     N T L   + FAG  +G             D      +P+  ++GK+V  F 
Sbjct  357   --------NITILGQAI-FAGPELGFVGLTYPERPLSGDCEKLSANPSSAMEGKVVLCFT  407

Query  1214  DDLDRNLVLVDKATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQS  1038
              +   N  L     +AG +G+I + NP++   L       PYV VD++ GT I  YI +S
Sbjct  408   ANEPSNAALT-AVRNAGGLGLIMARNPTH---LLTPTRAFPYVSVDFELGTDILFYI-RS  462

Query  1037  TMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPT  870
             T +P   + + +  +GR++  KV  FSSRGP+S +P I+KPDIAAPG  I+ A       
Sbjct  463   TRSPIVNIQASRTLIGRSVATKVATFSSRGPNSVSPAILKPDIAAPGVNILAAISPNSSL  522

Query  869   SDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGS  690
             SDGGF + SGTS A P VS +V LLK  HP+WSPAAIKSA+VTTAW +D    PIFA GS
Sbjct  523   SDGGFAMMSGTSMATPVVSGVVVLLKSLHPDWSPAAIKSAIVTTAWKTDPSGEPIFADGS  582

Query  689   SLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSD  510
             S + AD FDYGGG++N   A  PGL+YDM   DY  YLC++ Y++  I + +        
Sbjct  583   SRKLADPFDYGGGLINAEKAVKPGLIYDMNTNDYILYLCSVDYSDISISRVLG-------  635

Query  509   TEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVT  330
               + T+CP  +PS+LDLNLPS+ +P+L   VT  RTVTNVGPVNSVYK ++  P G  V 
Sbjct  636   --KTTVCPNPKPSVLDLNLPSITIPNLRDEVTFTRTVTNVGPVNSVYKVVIDPPTGVNVA  693

Query  329   VKPKVLRFDGNRKKRSFTMRVS  264
             V P  L FD    K S+T+RVS
Sbjct  694   VTPTELVFDSTTTKLSYTVRVS  715



>ref|XP_010436935.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/765 (45%), Positives = 476/765 (62%), Gaps = 51/765 (7%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K+Y+VYLG K H++   + ESH+ +L  ++GS +    ++VYSYR+GFSGFAA LT SQ
Sbjct  27    RKVYVVYLGEKEHNNPESVTESHHQILWSLLGSKKSVHDSIVYSYRHGFSGFAAKLTESQ  86

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A++++ +  VV V+ +  +++ T+R+W++LGLS G +    LL K N G  +IVGV+D+G
Sbjct  87    AQQISELPEVVQVIPNTLYEMTTTRTWNYLGLSPGNS--NGLLHKANMGYQVIVGVIDTG  144

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E   F D G GP+P RWKG C +  G  FN S  CN+K+IGA++F  G + +  V +
Sbjct  145   VWPESEMFNDKGYGPIPSRWKGGCES--GESFNASIHCNKKLIGAKYFVDGLVAAAGV-V  201

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N+    +  S  D +GHG+ VAS + GSF+PN + LG+  G  RGGA    +A YKACW 
Sbjct  202   NRTENPEYLSPRDFSGHGTHVASTIGGSFLPNVSYLGLGQGTARGGAPGVHIAIYKACW-  260

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                +   C GAD+L AID AIHD VD++S+S+ S +PL  + +      +G+FHA+ +GI
Sbjct  261   --LQIGTCTGADVLKAIDEAIHDGVDILSLSLQSSIPLFPETDMRELTSVGAFHAVAKGI  318

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ AAGNAGP+A TI+NV PW++TVAA+T DR F   ITLGN           N T L 
Sbjct  319   AVVAAAGNAGPTAQTISNVAPWILTVAATTQDRSFPTAITLGN-----------NITILG  367

Query  1316  HPLHFAGKYMG-----------EADLMPRKLDP-AEVKGKIVFMFGDDLDRNLVLVDKAT  1173
               + F G  +G             D      +P + ++GK+V  F  +   N   +    
Sbjct  368   QAI-FGGPELGFVGLTYPERPLSGDCEKLSANPDSAMEGKVVLCFTANKPTNAA-ITAVI  425

Query  1172  DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
              AG +G+I + NP+++ S P  N   PYV VD++ GT I  YI +ST  P   + + +  
Sbjct  426   KAGGLGLIIARNPTHLLS-PTRN--FPYVSVDFELGTDILFYI-RSTRFPIVNIDASRTL  481

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTS---DGGFRISSGTSHA  828
             V R+++ KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P S   DGGF + SGTS +
Sbjct  482   VARSVSTKVATFSSRGPNSVSPAILKPDIAAPGVNILAAISPNSSINDGGFAMMSGTSMS  541

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P VS +V LLK  HP+WSPAAIKSA+VTTAW +D    PIFA GSS + AD FDYGGG+
Sbjct  542   TPVVSGVVVLLKSLHPDWSPAAIKSAIVTTAWKTDPSGEPIFADGSSRKLADPFDYGGGL  601

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             +NP  A +PGL+YDM   DY  YLC+  YN+  I + +          + T+CP  +PS+
Sbjct  602   INPEKAVNPGLIYDMTTDDYILYLCSAEYNDISISRVLG---------KATVCPNPKPSV  652

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LDLNLPS+ +P+L + VT +RTVTNVGP+ SVYK ++  P G  VTV P  L FD    K
Sbjct  653   LDLNLPSITIPNLREEVTFKRTVTNVGPLKSVYKVVIDPPTGVTVTVTPTELLFDSTNTK  712

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SFT+RVS    VN+ + FGSLTW++ +HNV  P++VR  I+  Y
Sbjct  713   LSFTVRVSTTHKVNTGYYFGSLTWTNDLHNVVIPVSVRTQILQRY  757



>ref|XP_002867836.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44095.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=758

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/761 (44%), Positives = 460/761 (60%), Gaps = 68/761 (9%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YIVYLG + HDD   +  SH+ +L  ++ S E+AR +++YSY++GFSGFAA+LT+SQA
Sbjct  40    KVYIVYLGEREHDDPELVTASHHQMLESLLQSKEDARNSLIYSYQHGFSGFAALLTSSQA  99

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLS-------EGANVPGELLRKTNKGDGMIV  2055
             KK++    V+  + ++  K++T+R+WD LGLS         ++V G LL  TN G   I+
Sbjct  100   KKISEHPAVIHFIPNRILKLKTTRTWDHLGLSPIPTSFSSLSSVKG-LLHDTNLGREAII  158

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             GV+DSGI  E  +  D  +GP+P+RW+G C   PG +FN +  CN K+IGA+++  GA+ 
Sbjct  159   GVIDSGIWPESKALNDQWLGPIPKRWRGKCE--PGEQFNATIHCNNKLIGAKYYLNGAVA  216

Query  1874  SQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVAS  1695
             +     N+ ++ D  S  D  GHG+  A+I  GSFVPN +  G+  G+VRGGA  AR+AS
Sbjct  217   AIGGKFNRTIIQDFKSTRDANGHGTHTATIAGGSFVPNVSIYGLARGLVRGGAPRARIAS  276

Query  1694  YKACWNLDPER-----FVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIG  1530
             YKACWN+  +        C  AD+  A D AIHD VDV+SVS+G  +P   D E +    
Sbjct  277   YKACWNVMGDEGGGTDGRCTTADMWKAFDDAIHDGVDVLSVSIGGAIP--EDSEVDKLDY  334

Query  1529  IGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAV  1350
             I +FHA+ +GI V+ AAGN GP A T+ NV PW++TVAA+T+DR F   ITLGN +    
Sbjct  335   IAAFHAVAKGITVVTAAGNEGPGAQTVNNVAPWLLTVAATTLDRSFPTKITLGNKQTLFA  394

Query  1349  DWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD  1170
             +  L  G  +S  L F         L     D  +VKGK V +F           D AT 
Sbjct  395   E-SLFTGPEISTGLVF---------LDSDSDDNVDVKGKTVLVF-----------DSATP  433

Query  1169  AGAVGV----IYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
                 GV    +   P   D L   N  +  +  DY+ GT I  YI ++T +PT ++S+ +
Sbjct  434   IAGKGVAALILAQKPD--DLLARCNG-LGCIFADYELGTEILKYI-RTTRSPTVRISAAR  489

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTS  834
                G+  T KV  FS RGP+S +P I+KPDIAAPG  I+ A    +P    GF + SGTS
Sbjct  490   TLTGQPATTKVAAFSCRGPNSVSPAILKPDIAAPGVSILAAISPLNPEQQNGFGLLSGTS  549

Query  833   HAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGG  654
              + P VS I+ALLK  HP WSPAA++SALVTT         PIFA+GS+ + AD FDYGG
Sbjct  550   MSTPVVSGIIALLKSLHPNWSPAAMRSALVTT--------EPIFAEGSNKKLADPFDYGG  601

Query  653   GIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRP  474
             G+VNP  A  PGLVYDM   DY  Y+C+ GYN+S I + +          + T CP   P
Sbjct  602   GLVNPEKAAKPGLVYDMGIDDYINYMCSAGYNDSSISRVLG---------KKTKCPIPEP  652

Query  473   SMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNR  294
             SMLD+NLPS+ +P+L K VTL RTVTNVGP+ SVYKA+++ P+G  +TV P  L F    
Sbjct  653   SMLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIEPPLGITLTVNPTTLVFKSAA  712

Query  293   KK-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             K+  +F+++      VNS + FGSLTW+DGVH+V  P++V+
Sbjct  713   KRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVIIPVSVK  753



>ref|XP_006301525.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
 gb|EOA34423.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
Length=757

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/755 (45%), Positives = 458/755 (61%), Gaps = 52/755 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD   + ESH+D+L  ++GS E +R++M+YSYR+GFSGFAA LT+SQA
Sbjct  40    QIYTVHLGMRQHDDPDLVTESHHDILGPLLGSKEASRESMIYSYRHGFSGFAAKLTSSQA  99

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV V   ++ K++T+R  D+LGL+  A  P  L+ +T+ G   IVG+VDSG+
Sbjct  100   RELSAHPHVVHVTRSRNMKLKTTRVNDYLGLTPTA--PTGLMHETDMGSEAIVGIVDSGV  157

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               + PSF D G+GP+P+RWKG C  + G  FN S  CNRK+IGA ++  G     +   N
Sbjct  158   WPDSPSFSDNGLGPIPRRWKGRC--VSGEGFNASS-CNRKLIGANYYSNGITQKYNGKPN  214

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             K    +  S  D  GHG+  A+  AGSFV + +  G+  G  RG A  AR+ASYK CWN 
Sbjct  215   K---GEVMSPLDKVGHGTHCATTAAGSFVQDVSFHGLAKGTARGSAPKARIASYKVCWNN  271

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENG-IGIGSFHAITRGI  1497
             +     C   D++ A+D+AI D VDV+S+S+G+ VPL  D E +     I +FHA+ +GI
Sbjct  272   EE----CFTPDIVKAMDHAIRDGVDVLSLSLGATVPL--DFEVDRSDFAIAAFHAVMKGI  325

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ A GN GP   TI+NV PW+ITVAA+T+DR     ITLGN           N T L 
Sbjct  326   PVVCAGGNDGPQTQTISNVAPWIITVAATTMDREVFTPITLGN-----------NITLLG  374

Query  1316  HPLHFAGKYMG------EADLMPRKLDPAEVKGKIVFMF--GDDLDRNLVLVDKATDAGA  1161
                 + GK +G        DL          KGKI+F F  G   +   V    A   GA
Sbjct  375   QEGVYLGKEVGFTEILFHDDLTKEDFQAGRAKGKILFYFQPGKAQEDYAVF---AESKGA  431

Query  1160  VGVIY-SNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRA  984
             VGVI  ++PS  D++ I +  I    VD++ G  I  YI Q+T  P A++S  K  VGR 
Sbjct  432   VGVIIATHPS--DNIEIGSTDIASAYVDFELGMDILLYI-QTTKQPIAKISPTKTFVGRP  488

Query  983   LTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIV  804
                KV  FSSRGP+S +P I+KPDIAAPG  I+ A P S  G+   SGTS AAP +S IV
Sbjct  489   SATKVAKFSSRGPNSISPAILKPDIAAPGSGILSAVP-SKTGYEFMSGTSMAAPIISGIV  547

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADD  624
             ALL+   P+WSPAAI+SALVTTA  +D    PI A+GS  + AD FDYGGG+VNP    D
Sbjct  548   ALLRQKRPDWSPAAIRSALVTTALQTDPSGEPIAAEGSPRKLADPFDYGGGLVNPGKVAD  607

Query  623   PGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSM  444
             PGLVYDM   +Y  YLC+ GY++  I K +  N           CP   PSMLD+NLPS+
Sbjct  608   PGLVYDMGHNEYVHYLCSAGYDDISISKLLGKNNT---------CPSPMPSMLDVNLPSI  658

Query  443   VVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS  264
              +P L + +T+ RTVTNVGP  SVYKA++++P G  + V P+ L F  N  K +FT++VS
Sbjct  659   TIPYLSQEITITRTVTNVGPAGSVYKAMIQAPQGINLQVSPETLDFSSNTNKITFTVKVS  718

Query  263   ADKLVNSAFTFGSLTWSD-GVHNVRTPIAVRKMIV  162
                  N+ + FGSLTW D G HNVR PI+VR  ++
Sbjct  719   TTHRSNTDYHFGSLTWIDNGGHNVRIPISVRTRVL  753



>ref|XP_006391365.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
 gb|ESQ28651.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
Length=791

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/789 (43%), Positives = 455/789 (58%), Gaps = 85/789 (11%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD + + +SH+D+L  ++GS + +R++++YSYR+GFSGF+A LT SQA
Sbjct  39    QIYTVHLGERQHDDPKLVTDSHHDILGSLLGSKKASRESIIYSYRHGFSGFSAKLTTSQA  98

Query  2213  kkvagvagvvs--------------------------------vVEDKHHKVQTSRSWDF  2130
             ++++G                                      +   K+ K++T+R  D+
Sbjct  99    RELSGKFKSTLYDKTCCTRIRSNYETNIHFGFGFVIEHPHVVHITRSKNMKLKTTRVNDY  158

Query  2129  LGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPG  1950
             LGL+  A  P  L ++T+ G   I+G++DSGI  +  SF D G+GP+P RWKG C  + G
Sbjct  159   LGLTPTA--PTGLFQETDMGSDAIIGILDSGIWPDSKSFNDVGLGPIPTRWKGQC--VSG  214

Query  1949  LRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSF  1770
               FN S  CNRK+IGA ++ KG L   +   N     +  S  D  GHG+  AS   GSF
Sbjct  215   EAFNASS-CNRKLIGATYYAKGLLTKYNGTFNAAAKDEVLSPLDKVGHGTHCASTAVGSF  273

Query  1769  VPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVIS  1590
             V +A  LG+  G  RG A  AR+ASYK CWN +     C   D+L AID+AI D VDV+S
Sbjct  274   VQDANFLGLAQGTARGSAPRARIASYKVCWNNEE----CFTPDILKAIDHAIRDGVDVLS  329

Query  1589  VSVGSPVPLASDMEAENG-IGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAA  1413
             +S+GS +PL  D E +     I +FHA+ +GIPV+ A GN GP + TI+NV PW+ITVAA
Sbjct  330   LSLGSEIPL--DFEVDRSDFAIAAFHAVMKGIPVVCAGGNDGPQSQTISNVAPWIITVAA  387

Query  1412  STIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLM------PRKLDP  1251
              T+DR F   ITLGN           N T L     + GK +G ADL+            
Sbjct  388   MTMDREFFTPITLGN-----------NITLLGQESLYIGKEVGFADLLYFDDLKKEDFQA  436

Query  1250  AEVKGKIVF-----MFGDDLDRNLVLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQ  1086
                KGKI+F      F DD       V      GAVGVI +     D++    A I    
Sbjct  437   GIAKGKILFSFQTVKFADDF------VTFVQSKGAVGVIIAT-QPTDTVEPCTASIACAY  489

Query  1085  VDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIA  906
             VDY+ G  I  Y+ Q+T  P A++S  K  VGR    KV  FSSRGP+S +P I KPDIA
Sbjct  490   VDYELGMDILLYL-QTTTYPKAKISPTKTFVGRPSASKVSRFSSRGPNSLSPAIFKPDIA  548

Query  905   APGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNS  726
             APG  I+ A P S  G+   SGTS A P VS IVAL++  HP+WSPAAI+SALVTTA+ S
Sbjct  549   APGAGILAAVP-SPAGYEFMSGTSMATPVVSGIVALVRKKHPDWSPAAIRSALVTTAFQS  607

Query  725   DTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLI  546
             D    PI A+GS  + AD FDYGGG+VNP    DPGLVYDM   +Y  YLC+ GY++  I
Sbjct  608   DPSGEPIAAEGSPRKLADPFDYGGGLVNPGKVADPGLVYDMGYNEYVHYLCSAGYDDRSI  667

Query  545   YKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYK  366
              K +  N           CP   PSMLD+NLPS+ +P L + +T+ RTVTNVGPV SVYK
Sbjct  668   SKLLGKNYT---------CPSPTPSMLDVNLPSITIPYLSEEITITRTVTNVGPVGSVYK  718

Query  365   AIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSD-GVHNVRT  189
             A+++ P G  V V P+ L F  N KK +F ++VS     N+ + FGSLTW+D G HNVR 
Sbjct  719   ALIEPPQGINVQVTPETLEFGSNAKKITFKVKVSTTHRTNTDYLFGSLTWTDNGAHNVRI  778

Query  188   PIAVRKMIV  162
             P++VR  ++
Sbjct  779   PLSVRTRVL  787



>ref|NP_564868.2| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 dbj|BAC43166.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64891.1| At1g66210 [Arabidopsis thaliana]
 gb|AEE34477.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=759

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/751 (45%), Positives = 458/751 (61%), Gaps = 43/751 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD   + ESH+D+L  ++GS + + ++M+YSYR+GFSGFAA LT+SQA
Sbjct  39    QIYTVHLGERQHDDPNIVTESHHDILGPLLGSKKASHESMIYSYRHGFSGFAAKLTSSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++G   VV V   K+ K++T+R  D+LGL+  A  P  LL +T+ G   IVG++DSGI
Sbjct  99    RELSGHPDVVRVTRSKNMKLKTTRVSDYLGLTSAA--PTGLLHETDMGSEAIVGILDSGI  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               +  SF D G+GP+P RWKG C  +    FN S  CNRK+IGA ++ KG     +   N
Sbjct  157   WPDSKSFNDNGLGPIPTRWKGKC--VSAEAFNASS-CNRKLIGAMYYSKGLESKYNGSFN  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+  AS   GSFVP+A  L +  G  RG A  AR+ASYK CWN 
Sbjct  214   AAEKGEVMSPLDKIGHGTHCASTAVGSFVPDANVLSLAQGTARGSAPRARIASYKVCWNN  273

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             +     C   D++ AID+AI D VDV+S+S+GS VP+  +++ ++   I +FHA+ +GIP
Sbjct  274   EE----CFTPDIVKAIDHAIRDGVDVLSLSLGSEVPVDFEVDRDD-FAIAAFHAVMKGIP  328

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP   TI+NV PW+ITVAA+T+DR +   ITLGN           N T L  
Sbjct  329   VVCAGGNDGPEKETISNVAPWLITVAATTMDREYFTPITLGN-----------NITLLGQ  377

Query  1313  PLHFAGKYMGEADLM------PRKLDPAEVKGKIVFMFGD-DLDRNLVLVDKATDAGAVG  1155
                + G+ +G  DL+         ++  +  GKI+  F   + + +     K+   GAVG
Sbjct  378   EGLYIGEEVGFTDLLFYDDVTREDMEAGKATGKILLFFQRANFEDDFAAYAKS--KGAVG  435

Query  1154  VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             VI +     DS+      I    VD + G  I  YI Q+T +P A++S  K  VGR L  
Sbjct  436   VIIAT-QPTDSIDASTVDIAIAYVDNELGMDILLYI-QTTKSPIAKISPTKTFVGRPLAT  493

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALL  795
             KV  FSSRGP+S +P I+KPDIAAPG  I+ A PT  GG+   SGTS + P VS IVALL
Sbjct  494   KVARFSSRGPNSLSPVILKPDIAAPGSGILAAVPTG-GGYDFMSGTSMSTPVVSGIVALL  552

Query  794   KISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGL  615
             +   P+WSPAAI+SALVTTA  +D    PI A+GS  + AD FDYGGG+VNP    DPGL
Sbjct  553   RKKRPDWSPAAIRSALVTTALQTDPSGEPIAAEGSPRKLADPFDYGGGLVNPVKVADPGL  612

Query  614   VYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVP  435
             VYDM   +Y  YLC+ GY+N+ I K +          E   CP   PSMLD+N+PS+ +P
Sbjct  613   VYDMGHDEYVHYLCSAGYDNTSISKLLG---------EIYTCPTPIPSMLDVNMPSITIP  663

Query  434   DLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADK  255
              L + +T+ RTVTNVGPV SVYKA++++P G  + V P+ L F  N  K +FT++VS   
Sbjct  664   YLSEEITITRTVTNVGPVGSVYKAVIQAPQGINLQVSPETLEFGSNTNKTTFTVKVSTTH  723

Query  254   LVNSAFTFGSLTWSDGV-HNVRTPIAVRKMI  165
               N+ + FGSLTW+D   HNVR P++VR  +
Sbjct  724   RANTDYLFGSLTWADNEGHNVRIPLSVRTRV  754



>gb|AAF31277.1|AC006424_6 Second of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
Length=763

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/765 (44%), Positives = 470/765 (61%), Gaps = 51/765 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD + + ESH+ +L+ ++GS ++A ++MVYSYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPKFVTESHHQMLSSLLGSKDDAHESMVYSYRHGFSGFAAKLTKSQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    V+ V+ D ++++ T+R WD+LG S  A+    L+  TN GD  I+GV+D+G+
Sbjct  88    KKIADSPEVIHVIPDSYYELATTRIWDYLGPS--ADNSKNLVSDTNMGDQTIIGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GPVP  WKG C   PG  F  +  CNRK+IGA++F  G L       N
Sbjct  146   WPESESFNDYGVGPVPSHWKGGCE--PGENFISTN-CNRKLIGAKYFINGFLAENQ--FN  200

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VASI  GSFVPN +  G+  G +RGGA  AR+A YKACW +
Sbjct  201   ATESPDYISARDFDGHGTHVASIAGGSFVPNVSYKGLGRGTLRGGAPRARIAMYKACWYI  260

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +  +   C+ +D++ AID AIHD VDV+S+S+G  VPL S+ +  +GI  G+FHA+ +GI
Sbjct  261   NELDGVTCSFSDIMKAIDEAIHDGVDVLSISLGGRVPLNSETDLRDGIATGAFHAVAKGI  320

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQLPN  1332
              V+ A GNAGPS+ T+ N  PW++TVAA+T+DR FA  I LGN     G+   +  +L  
Sbjct  321   VVVCAGGNAGPSSQTVVNTAPWILTVAATTLDRSFATPIILGNNQVILGQAMYIGPEL-G  379

Query  1331  GTALSHPL---HFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD---  1170
              T+L +P    +    + G  + +    +   + GK+V  F     R+  +V  A     
Sbjct  380   FTSLVYPEDPGNSIDTFSGVCESLNLNSN-RTMAGKVVLCF--TTARDFTVVSTAASIVK  436

Query  1169  -AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYI-FQSTMTPTAQLSSPKIQ  996
              AG +G+I +     +  P  +   P V +D + GT I  YI +  T+            
Sbjct  437   AAGGLGLIIARNPGYNLAPCSD-DFPCVAIDNELGTDILFYIRYTGTL------------  483

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD----GGFRISSGTSHA  828
             VG  +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A   +D    GGF + SGTS A
Sbjct  484   VGEPVGTKVATFSSRGPNSISPAILKPDIAAPGVSILAATSPNDTLNAGGFVMRSGTSMA  543

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
             AP +S ++ALLK  HP+WSPAA +SA+VTTAW +D +   I A+ SSL+  D FDYGGG+
Sbjct  544   APVISGVIALLKSLHPDWSPAAFRSAIVTTAWRTDPFGEQIAAESSSLKVPDPFDYGGGL  603

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VNP  A +PGL+ DM   DY  YLC+ GYN+S I + +          + T+C   +PS+
Sbjct  604   VNPEKAAEPGLILDMDSQDYVLYLCSAGYNDSSISRLVG---------KVTVCSNPKPSV  654

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD+NLPS+ +P+L   VTL RTVTNVGPV+SVYK +V+ P+G  V V P+ L F+   K 
Sbjct  655   LDINLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVLVEPPLGIQVVVTPETLVFNSKTKS  714

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              SFT+ VS    +N+ F FGSLTW+D +HNV  P++VR  I+  Y
Sbjct  715   VSFTVIVSTTHKINTGFYFGSLTWTDSIHNVVIPVSVRTQILQNY  759



>ref|XP_009135013.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=751

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/758 (44%), Positives = 462/758 (61%), Gaps = 56/758 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             +   K+YIVYLG + HDD   +  SH+ +L  +  S EEA  +M+YSY++GFSGFAA+LT
Sbjct  37    DKNTKVYIVYLGEREHDDPELVTASHHQMLESLHESKEEAHNSMIYSYQHGFSGFAALLT  96

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGE-----LLRKTNKGDGM  2061
             +SQAKK++    V+ V+ ++  K++T+R+WD LGLS+            LL +TN G   
Sbjct  97    SSQAKKISEHPSVIHVIPNRIVKLKTTRTWDHLGLSQVPTSSSPSSVKGLLNETNMGSDA  156

Query  2060  IVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGA  1881
             I+G++D+GI  E   F D G GP+P+RW+G C +  G  FN +  CN K+IGA+++ KG 
Sbjct  157   IIGLLDTGIWPESEVFNDQGFGPIPKRWRGKCES--GEDFNATIHCNNKLIGAKYYQKG-  213

Query  1880  LLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARV  1701
             ++++     K +  +  S  D  GHG+  A+I  GSFV NA+  G+  G VRGGA  AR+
Sbjct  214   MMAEIRGKRKSMTREFKSNRDAIGHGTHTATIAGGSFVSNASFYGLAQGTVRGGAPRARI  273

Query  1700  ASYKACWNLDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             ASYK CW+L    F+ C+  D+  A D AIHD VDV+SVS+G  VP  S+++  + +   
Sbjct  274   ASYKVCWDL---FFLGCSIVDMWKAYDDAIHDGVDVLSVSLGGDVPEGSEVDQVDFVA--  328

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW  1344
             +FHA+T+GIPV+ AAGN GP+A ++ NV PW +TVAA+T+DR F   ITLGN + +  + 
Sbjct  329   AFHAVTKGIPVVAAAGNDGPNAQSVINVAPWFLTVAATTLDRSFPTKITLGNNQTFYAE-  387

Query  1343  QLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAG  1164
              L  G  ++  L F   Y      M         KGK V  F   + +  +        G
Sbjct  388   SLFTGPDITTGLAFLESYSHNTTGM---------KGKTVLAFDKRVPKEGL--------G  430

Query  1163  AVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRA  984
             AV +  S P         +   PY+   Y+ G  I  YI ++T +PT ++S+     G  
Sbjct  431   AVILAQSVP---------DESYPYILTSYEHGADILQYI-RTTRSPTVRISAATTLTGPP  480

Query  983   LTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHV  816
                KV  FSSRGP+S +P I+KPDIAAPG  I+ A    +P S  GF + SGTS + P V
Sbjct  481   AAAKVVVFSSRGPNSVSPAILKPDIAAPGVNILAALNPLNPDSHNGFGLLSGTSMSTPVV  540

Query  815   SAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPN  636
             S I ALLK  HP+WSPAAI+SALVTTAW +     PIFA+GSS + AD FDYGGG+VNP 
Sbjct  541   SGITALLKCLHPDWSPAAIRSALVTTAWRTSKSGEPIFAEGSSKKLADPFDYGGGLVNPE  600

Query  635   AADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLN  456
             +A DPGLVYDM   DY  Y+C+ GYN++ I + +    N         CP    S+LD+N
Sbjct  601   SAADPGLVYDMGIKDYISYMCSAGYNDTSISRVLGKKTN---------CPSPGASILDIN  651

Query  455   LPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFT  276
             LPS+ +P+L + VTL RT+TNVGP NSVYKA+++SP+G  +TV P  L F G+ +  S+ 
Sbjct  652   LPSITIPNLDQEVTLTRTLTNVGPNNSVYKAVIESPLGVTLTVSPTTLVF-GSGEVLSYA  710

Query  275   MRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             +       VN+ + FGSLTW+DGVH+VR P++V+  I+
Sbjct  711   VTAKTSHEVNTGYFFGSLTWTDGVHDVRIPVSVQTTIM  748



>ref|XP_008775642.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=737

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/758 (44%), Positives = 460/758 (61%), Gaps = 41/758 (5%)
 Frame = -3

Query  2375  LGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagv  2196
             +G + H+D   ++ SH+++L  ++GS E A+ +++YSY++GFSGFAA LT SQA +VA  
Sbjct  1     MGARHHEDSTTVESSHHEVLTTLLGSKEAAQDSILYSYKHGFSGFAAKLTKSQADRVAEF  60

Query  2195  agvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPS  2016
              G++ V+ ++  K+ T+RSWDF+GL   +     LL ++  G  MI+GV+DSGI  E  S
Sbjct  61    PGIIQVIPNRVRKLHTTRSWDFIGLHRSSGR--SLLSESRMGREMIIGVIDSGIWPESES  118

Query  2015  FGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSD  1836
             F D GMGPVP RWKG+C    G  FN +  CN+K+IGARWF KG +  ++  +     S+
Sbjct  119   FNDRGMGPVPSRWKGACEH--GELFNFTN-CNKKLIGARWFGKGLIAEKERPIKTAAPSE  175

Query  1835  SYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFV  1656
               S  D  GHG+  AS  AG  + NA+  G+  G  RGGA  AR+A YKACW+  P    
Sbjct  176   YLSPRDATGHGTHTASTAAGRLIKNASYRGLAAGTARGGAPFARLAVYKACWDTHPGE--  233

Query  1655  CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAG  1476
             C+ AD+L A D AIHD VDVISVS+G+ VPL S +E ++ I IGSFHA  RGI V+ +AG
Sbjct  234   CSDADILKAFDEAIHDGVDVISVSLGNHVPLLSYVE-DDSISIGSFHAAARGISVVCSAG  292

Query  1475  NAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLH---  1305
             N GP + T+TN  PWV TVAA++IDR F   I LGN   + V  Q  N        H   
Sbjct  293   NDGPFSQTVTNTAPWVTTVAAASIDRAFPTAIILGN--NHTVLGQTLNTRGYKGGFHELR  350

Query  1304  ---FAGKYMGEADLMPR----KLDPAEVKGKIVFMFGDDLDRNLVLVDKA---TDAGAVG  1155
                F  K   +A+         L+    KGK++  F   L  +  + + A   + AG +G
Sbjct  351   YSEFVKKEKADAEYSRSCYIGTLNATLAKGKVILCF-SSLAEDAYISEAAQSVSRAGGIG  409

Query  1154  VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             +I++   + +  P     +P ++V+Y+ GT+I  YI Q+   P  +LS PK   GR  +P
Sbjct  410   LIFAQTQDSELDPCDG--VPCIKVNYEVGTQILSYIRQAKF-PVVKLSHPKTLTGRLASP  466

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--DPT-SDGGFRISSGTSHAAPHVSAIV  804
             ++  FSSRGPSS +P  +KPDIAAPG  I+ A  +P  +D  F   SGTS A PHV+ IV
Sbjct  467   RIAHFSSRGPSSLSPAFLKPDIAAPGVSILAAHRNPADADDAFAFMSGTSMACPHVTGIV  526

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADD  624
             AL+K  H +WSPAAI+SALVTTA  + T    I A+  S + AD FDYGGG V+PN A D
Sbjct  527   ALIKSIHRDWSPAAIRSALVTTATQTGTDGGLIVAQDGSRKPADPFDYGGGHVDPNRAAD  586

Query  623   PGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSM  444
             PGLVY+M  IDY  +LC+L YN+  I   +         ++   CP T  S LDLNLPS+
Sbjct  587   PGLVYNMSTIDYVPFLCSLSYNDPAISNLM---------DQQITCPITT-SELDLNLPSI  636

Query  443   VVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMR-V  267
             V+P+L    T+ RT+TNVGP NSVY+A+V  P G  + V P +L F+      SFT+   
Sbjct  637   VIPNLKGTATISRTMTNVGPANSVYEALVHPPRGIKMQVMPLILEFNSTTTSISFTVTFA  696

Query  266   SADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             S  + V+S + FGSLTW+DGVH VR+P+AVR ++   Y
Sbjct  697   SPSRKVHSDYRFGSLTWTDGVHVVRSPVAVRAILFDSY  734



>ref|XP_010463200.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/755 (43%), Positives = 471/755 (62%), Gaps = 46/755 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H+D   +  SH  +L  ++GS ++A +++V+SYR+GFSGFAA LT +QA
Sbjct  23    KVHIVYLGEKEHNDPELVTASHLSMLESLLGSKKDASESIVHSYRHGFSGFAAHLTDAQA  82

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++    VV V  + ++++QT+R++D+LGLS   + P  LLR    G+ +I+GV+DSG+
Sbjct  83    KKISEHPNVVQVTPNTYYELQTTRTFDYLGLSH--STPKGLLRDAKIGEDIIIGVLDSGV  140

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+PQRWKG C  + G  F+  + CNRK+IGAR++ +        D +
Sbjct  141   WPESESFNDKGLGPIPQRWKGMC--VDGEDFDSKKHCNRKLIGARYYMESLFRKNKTD-S  197

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +   ++  S  +V  HG+ VAS   GSFV N +  G  VG +RGGA  AR+A YK CW  
Sbjct  198   RIPDTEYMSAREVLPHGTHVASTAGGSFVSNVSVNGFGVGTIRGGAPGARIAVYKVCWQR  257

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               E   CA A+++ A+D AI D VD+I++S+G P P  ++++  N I  G+FHA+  GIP
Sbjct  258   --EDGSCASAEIIKAMDDAIADGVDLITISIGRPNPTLTELDLYNQISYGAFHAVANGIP  315

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP  +++ N+ PW+ITVAA+++DR ++  +TLGN           N T ++ 
Sbjct  316   VLSAGGNYGPDDYSVQNIAPWIITVAATSLDRWYSTPLTLGN-----------NMTLMAR  364

Query  1313  PLHFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAV---G  1155
                + GK + EA+LM      ++  A  KGK+V  F  + +    L D  T+   V   G
Sbjct  365   SA-YKGKEI-EAELMFVYSANEMTSA-AKGKVVLAFPTESE----LTDYVTNLSTVQTEG  417

Query  1154  VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             +I++     D L + +  I  + VDY+ G+ +  YI ++T +PT ++SS     G  +  
Sbjct  418   LIFATKRE-DDLKV-SEGIAMITVDYEQGSTMFKYI-RTTSSPTIKISSAVALNGPLVAT  474

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT----SDGGFRISSGTSHAAPHVSAI  807
             KV +FS RGP+  +P ++KPDIAAPG  I+ A       ++ GF   SGTS A P V+ +
Sbjct  475   KVAEFSGRGPNPVSPYVLKPDIAAPGVGIVAASTPEKMGAEEGFYAESGTSMATPVVAGL  534

Query  806   VALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAAD  627
             VALL+  HP+WSPAA+KSALVTTA  +D Y  PIF++G + + AD FD+GGG+V+PN A 
Sbjct  535   VALLRAVHPDWSPAALKSALVTTASKTDLYGEPIFSEGLTRKLADPFDFGGGLVSPNKAA  594

Query  626   DPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPS  447
             DPGLVYD    DY  +LCA  Y+   I K      +R++T     CP  RPSMLDLNLPS
Sbjct  595   DPGLVYDAGAEDYRLFLCASNYDEMHITKI-----SRTNTLYR--CPSPRPSMLDLNLPS  647

Query  446   MVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRV  267
             + +P L + VTL RTVTNVGPV+SVYK IV+ P+G  ++V P  L F+ N KK SF + V
Sbjct  648   ITIPFLKEDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVKKLSFKVTV  707

Query  266   SADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             S     NS + FGSLTW+DG HNV  P++VR  ++
Sbjct  708   STTHKSNSIYYFGSLTWTDGSHNVTIPLSVRTQML  742



>gb|AAG51763.1|AC066691_3 hypothetical protein; 8963-6048 [Arabidopsis thaliana]
Length=758

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/751 (45%), Positives = 459/751 (61%), Gaps = 44/751 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + HDD   + ESH+D+L  ++GS + + ++M+YSYR+GFSGFAA LT+SQA
Sbjct  39    QIYTVHLGERQHDDPNIVTESHHDILGPLLGSKKASHESMIYSYRHGFSGFAAKLTSSQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++G   VV V   K+ K++T+R  D+LGL+  A  P  LL +T+ G   IVG++DSGI
Sbjct  99    RELSGHPDVVRVTRSKNMKLKTTRVSDYLGLTSAA--PTGLLHETDMGSEAIVGILDSGI  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               +  SF D G+GP+P RWKG C  +    FN S  CNRK+IGA ++ KG     +   N
Sbjct  157   WPDSKSFNDNGLGPIPTRWKGKC--VSAEAFNASS-CNRKLIGAMYYSKGLESKYNGSFN  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+  AS   GSFVP+A  L +  G  RG A  AR+ASYK CWN 
Sbjct  214   AAEKGEVMSPLDKIGHGTHCASTAVGSFVPDANVLSLAQGTARGSAPRARIASYKVCWNN  273

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             +     C   D++ AID+AI D VDV+S+S+GS VP+  +++ ++   I +FHA+ +GIP
Sbjct  274   EE----CFTPDIVKAIDHAIRDGVDVLSLSLGSEVPVDFEVDRDD-FAIAAFHAVMKGIP  328

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP   TI+NV PW+ITVAA+T+DR +   ITLGN           N T L  
Sbjct  329   VVCAGGNDGPEKETISNVAPWLITVAATTMDREYFTPITLGN-----------NITLLVQ  377

Query  1313  PLHFAGKYMGEADLM------PRKLDPAEVKGKIVFMFGD-DLDRNLVLVDKATDAGAVG  1155
              L+  G+ +G  DL+         ++  +  GKI+  F   + + +     K+   GAVG
Sbjct  378   GLYI-GEEVGFTDLLFYDDVTREDMEAGKATGKILLFFQRANFEDDFAAYAKS--KGAVG  434

Query  1154  VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             VI +     DS+      I    VD + G  I  YI Q+T +P A++S  K  VGR L  
Sbjct  435   VIIAT-QPTDSIDASTVDIAIAYVDNELGMDILLYI-QTTKSPIAKISPTKTFVGRPLAT  492

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALL  795
             KV  FSSRGP+S +P I+KPDIAAPG  I+ A PT  GG+   SGTS + P VS IVALL
Sbjct  493   KVARFSSRGPNSLSPVILKPDIAAPGSGILAAVPTG-GGYDFMSGTSMSTPVVSGIVALL  551

Query  794   KISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGL  615
             +   P+WSPAAI+SALVTTA  +D    PI A+GS  + AD FDYGGG+VNP    DPGL
Sbjct  552   RKKRPDWSPAAIRSALVTTALQTDPSGEPIAAEGSPRKLADPFDYGGGLVNPVKVADPGL  611

Query  614   VYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVP  435
             VYDM   +Y  YLC+ GY+N+ I K +          E   CP   PSMLD+N+PS+ +P
Sbjct  612   VYDMGHDEYVHYLCSAGYDNTSISKLLG---------EIYTCPTPIPSMLDVNMPSITIP  662

Query  434   DLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADK  255
              L + +T+ RTVTNVGPV SVYKA++++P G  + V P+ L F  N  K +FT++VS   
Sbjct  663   YLSEEITITRTVTNVGPVGSVYKAVIQAPQGINLQVSPETLEFGSNTNKTTFTVKVSTTH  722

Query  254   LVNSAFTFGSLTWSDGV-HNVRTPIAVRKMI  165
               N+ + FGSLTW+D   HNVR P++VR  +
Sbjct  723   RANTDYLFGSLTWADNEGHNVRIPLSVRTRV  753



>emb|CBI23085.3| unnamed protein product [Vitis vinifera]
Length=1884

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/768 (46%), Positives = 456/768 (59%), Gaps = 72/768 (9%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + H D   I  +H+++L  V+GS E +  +M+YSYR+GFSGFAA LT +QA
Sbjct  1164  KVHIVYLGKRQHHDPEFITNTHHEMLTTVLGSKEASVDSMLYSYRHGFSGFAAKLTEAQA  1223

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             + V+ +  VV V+  + HK++T+RSWD+LGLS  ++    LL +TN GDG+I+G++DSGI
Sbjct  1224  QAVSELPDVVQVMPSRLHKLKTTRSWDYLGLSS-SHSSTNLLHETNMGDGIIIGLLDSGI  1282

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG--ALLSQDVD  1860
               E   F D G+GP+P RWKG C +  G  FN ++ CNRK+IGAR+F KG  A + + ++
Sbjct  1283  WPESKVFSDKGLGPIPSRWKGGCSS--GQSFNATKHCNRKLIGARYFLKGLEAEIGEPLN  1340

Query  1859  LNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
               K+L  +  S  D  GHG+  +SI  GS V NA+  G+  G VRGGA  AR+A YKACW
Sbjct  1341  TTKYL--EYLSPRDALGHGTHTSSIAGGSPVVNASYYGLGFGTVRGGAPGARLAMYKACW  1398

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
             NL      C+ AD+L A D AIHD VDVI                     IGSFHA+ +G
Sbjct  1399  NLGGG--FCSDADILKAFDKAIHDGVDVIL--------------------IGSFHAVAQG  1436

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ AAGN GPSA T+ N  PW++TVAAS+IDR F   ITLGN           N T +
Sbjct  1437  ISVVCAAGNGGPSAQTVENTAPWILTVAASSIDRSFPTPITLGN-----------NRTVM  1485

Query  1319  SHPLHFAGKYMGEADLM----PRKLDPAE----------VKGKIVFMFGDDLDRNLVLVD  1182
                +   G + G A L+    P    P+           V GK+   F            
Sbjct  1486  GQAM-LIGNHTGFASLVYPDDPHLQSPSNCLSISPNDTSVAGKVALCFTSGTVETEFSAS  1544

Query  1181  KATDAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
                 A  +GVI + N  N  +  I  +  P ++V Y+ G++I  YI  ST  P  +LS  
Sbjct  1545  FVKAALGLGVIIAENSGNTQASCI--SDFPCIKVSYETGSQILHYI-SSTRHPHVRLSPS  1601

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD----GGFRISSGT  837
             K  VG+ +   V  FSSRGPS  +P ++KPDIA PG +I+ A P SD      F   SGT
Sbjct  1602  KTHVGKPVPTNVAYFSSRGPSFPSPAVLKPDIAGPGAQILGAVPPSDLKKNTEFAFHSGT  1661

Query  836   SHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYG  657
             S A PH++ IVALLK  HP WSPAAIKSA+VTT W +D    PIFA+G   + AD FD+G
Sbjct  1662  SMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWTTDPSGEPIFAEGDPTKLADPFDFG  1721

Query  656   GGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTR  477
             GGIVNPN A DPGLVYDM   DY  YLC LGYNNS I++          TE+   CP   
Sbjct  1722  GGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNNSAIFQF---------TEQSIRCPTRE  1772

Query  476   PSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGN  297
              S+LDLNLPS+ +P L    +L R VTNVG VNS YKA + SP G  +TVKP  L FD  
Sbjct  1773  HSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISPAGTTITVKPDTLIFDST  1832

Query  296   RKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              K  +F++ VS+ + VN+ ++FGSLTW DGVH VR+PI+VR MI   Y
Sbjct  1833  IKTVTFSVTVSSIQQVNTGYSFGSLTWIDGVHAVRSPISVRTMIKESY  1880


 Score =   433 bits (1113),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 251/531 (47%), Positives = 331/531 (62%), Gaps = 32/531 (6%)
 Frame = -3

Query  1733  MVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASD  1554
              +RGGA  AR+A YK CWNL     VCA AD+   ID AIHD VDV+S+S+ S +PL S 
Sbjct  616   FMRGGAPRARLAMYKVCWNL--YGGVCADADIFKGIDEAIHDGVDVLSLSISSDIPLFSH  673

Query  1553  MEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITL  1374
             ++  +GI I SFHA+ RGIPV+ AAGN+GPSA T++N  PW+ITVAAST+DR+FA  ITL
Sbjct  674   VDQHDGISIASFHAVVRGIPVVSAAGNSGPSAETVSNTAPWIITVAASTMDRLFATHITL  733

Query  1373  GNGEKY---AVDWQLPNG-TALSHPL---HFAGKYMGEADLMPRKLDPAEVKGKIVFMFG  1215
             GN +     AV      G T L++P      A +Y     L+P     A   G +V  F 
Sbjct  734   GNNQTITGEAVYLGKDTGFTNLAYPEVSDLLAPRYC--ESLLPNDTFAA---GNVVLCFT  788

Query  1214  DDLDRNLVLVDKATDAGAVGVIYSNPSNV-DSLPILNARIPYVQVDYDAGTRIKDYIFQS  1038
              D     +  +    AG +GVI +  SNV + L   +   P +QV  + G RI DYI +S
Sbjct  789   SDSSH--IAAESVKKAGGLGVIVA--SNVKNDLSSCSQNFPCIQVSNEIGARILDYI-RS  843

Query  1037  TMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT---S  867
             T  P  +LS  +  +G  +  KV  FSSRGPSS AP I+KPDIA PG +I+ A+P+   +
Sbjct  844   TRHPQVRLSPSRTHLGNPVPTKVASFSSRGPSSIAPAILKPDIAGPGFQILGAEPSFVPT  903

Query  866   DGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSS  687
                + + SGTS A PHVS  VALL+  + EWSPAAIKSA+VTTAW +D    P+FA+G  
Sbjct  904   STKYYLMSGTSMATPHVSGAVALLRALNREWSPAAIKSAIVTTAWTTDPSGEPVFAEGQP  963

Query  686   LRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDT  507
             ++ AD FD+GGGI+NPN A +PGLVYDM   D   YLCA+GYNNS I K          T
Sbjct  964   MKLADPFDFGGGILNPNGAGNPGLVYDMGKDDCILYLCAMGYNNSAIAKV---------T  1014

Query  506   EEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTV  327
                T CP  RPS+LD+NLPS+ +P+L   V+L R+VTNVG V+S Y A++  P G  + +
Sbjct  1015  GRPTSCPCNRPSILDVNLPSITIPNLQYSVSLTRSVTNVGAVDSEYNAVIDPPPGVTIKL  1074

Query  326   KPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             +P  L F+   +  +F + VS+ + V++ F+FGSL WSDG H VR PI+VR
Sbjct  1075  EPDRLVFNSKIRTITFRVMVSSARRVSTGFSFGSLAWSDGEHAVRIPISVR  1125


 Score =   104 bits (259),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIVY+G + H +   I + H+ +L+ V+GS E + ++MVYSY++GFSGFAA LT +QA+
Sbjct  493   VYIVYMGERQHGNLDLITDGHHRMLSEVLGSDEASVESMVYSYKHGFSGFAAKLTEAQAQ  552

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
               A +  VV V+ ++ HK+QT+RSWD+LGL    + P  LL +T  GDG I+G++D+GI 
Sbjct  553   MFAELPDVVQVIPNRLHKLQTTRSWDYLGLP--LDSPTSLLHETKMGDGTIIGLLDTGIW  610

Query  2030  TELPSFGDAG  2001
              E   F   G
Sbjct  611   PESEVFMRGG  620



>gb|AAL24366.1| subtilisin proteinase-like [Arabidopsis thaliana]
 gb|AAM91203.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=703

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/739 (44%), Positives = 454/739 (61%), Gaps = 58/739 (8%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++ S E+A+ +++YSY++GFSGFAA+LT+SQAKK++    V+ V+ ++  K++T+R
Sbjct  1     MLESLLQSKEDAQNSLIYSYQHGFSGFAALLTSSQAKKISEHPEVIHVIPNRIRKLKTTR  60

Query  2141  SWDFLGLS-------EGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQ  1983
             +WD LGLS         ++V G LL  TN G   I+GV+DSGI  E  +  D G+GP+P+
Sbjct  61    AWDHLGLSPIPTSFSSLSSVKG-LLHDTNLGSEAIIGVIDSGIWPESKAVNDQGLGPIPK  119

Query  1982  RWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHG  1803
             RW+G C   PG +FN +  CN K+IGAR++  G + +     N+ ++ D  S  D  GHG
Sbjct  120   RWRGKCE--PGEQFNATIHCNNKLIGARYYLNGVVAAIGGKFNRTIIQDFQSTRDANGHG  177

Query  1802  SQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERF-----VCAGADL  1638
             +  A+I  GSFVPN +  G+  G+VRGGA  AR+ASYKACWN+  +        C  AD+
Sbjct  178   THTATIAGGSFVPNVSYFGLAQGLVRGGAPRARIASYKACWNVMRDEGGGTDGRCTSADM  237

Query  1637  LAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSA  1458
               A D AIHD VDV+SVS+G  +P   D E +    I +FHA+ +GI V+ AAGN GP A
Sbjct  238   WKAFDDAIHDGVDVLSVSIGGGIP--EDSEVDKLDYIAAFHAVAKGITVVAAAGNEGPGA  295

Query  1457  FTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEA  1278
              T+ NV PW++TVAA+T+DR F   ITLGN +    +  L  G  +S  L F        
Sbjct  296   HTVDNVAPWLLTVAATTLDRSFPTKITLGNNQTLFAE-SLFTGPEISTGLAF--------  346

Query  1277  DLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT---DAGAVGVIYSNPSNVDSLPILN  1107
              L     D  +VKGK V +F           D AT     G   VI +   + D L   N
Sbjct  347   -LDSDSDDTVDVKGKTVLVF-----------DSATPIAGKGVAAVILAQKPD-DLLSRCN  393

Query  1106  ARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPG  927
               +P +  DY+ GT I  YI ++T +PT ++++     G+  T KV  FS RGP+S +P 
Sbjct  394   G-VPCIFPDYEFGTEILKYI-RTTRSPTVRITAATTLTGQPATTKVAAFSCRGPNSVSPA  451

Query  926   IMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAI  759
             I+KPDIAAPG  I+ A    +P    GF + SGTS + P VS I+ALLK  HP+WSPAA+
Sbjct  452   ILKPDIAAPGVSILAAISPLNPEEQNGFGLLSGTSMSTPVVSGIIALLKSLHPKWSPAAV  511

Query  758   KSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQY  579
             +SALVTTAW +     PIFA+GS+ + AD FDYGGG+VNP  A  PGLVYDM  +DY +Y
Sbjct  512   RSALVTTAWRTSPSGEPIFAEGSNKKLADPFDYGGGLVNPEKAAKPGLVYDMGIVDYIKY  571

Query  578   LCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTV  399
             +C+ GYN+S I + +    N         CP  +PSMLD+NLPS+ +P+L K VTL RTV
Sbjct  572   MCSAGYNDSSISRVLGKKTN---------CPIPKPSMLDINLPSITIPNLEKEVTLTRTV  622

Query  398   TNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK-RSFTMRVSADKLVNSAFTFGSL  222
             TNVGP+ SVY+A+++SP+G  +TV P  L F    K+  +F+++      VN+ + FGSL
Sbjct  623   TNVGPIKSVYRAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSL  682

Query  221   TWSDGVHNVRTPIAVRKMI  165
             TWSDGVH+V  P++V+  I
Sbjct  683   TWSDGVHDVIIPVSVKTTI  701



>emb|CDX79081.1| BnaA01g11480D [Brassica napus]
Length=751

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/760 (43%), Positives = 460/760 (61%), Gaps = 56/760 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             +   K+YIVYLG + HDD   +  SH  +L  +  S EEA  +M+YSY++GFSGFAA+LT
Sbjct  37    DKNTKVYIVYLGEREHDDPELVTASHRQMLESLHESKEEAHNSMIYSYQHGFSGFAALLT  96

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGE-----LLRKTNKGDGM  2061
             +SQAKK++    V+ V+ ++  K++T+R+WD LGLS+            LL +TN G   
Sbjct  97    SSQAKKISEHPSVIHVIPNRIVKLKTTRTWDHLGLSQVPTSSSPSSVKGLLNETNMGSDA  156

Query  2060  IVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGA  1881
             I+G++D+GI  E   F D G GP+P+RW+G C +  G  FN +  CN K+IGA+++ KG 
Sbjct  157   IIGLLDTGIWPESEVFNDQGFGPIPKRWRGKCES--GEDFNATIHCNNKLIGAKYYQKG-  213

Query  1880  LLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARV  1701
             ++++     K +  +  S  D  GHG+  A+I  GSFV NA+  G+  G VRGGA  AR+
Sbjct  214   MMAEIRGKRKSMTREFKSNRDAIGHGTHTATIAGGSFVSNASFYGLAQGTVRGGAPRARI  273

Query  1700  ASYKACWNLDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             ASYK CW+L    F+ C+  D+  A D AIHD VDV+SVS+G  VP  S+++  + +   
Sbjct  274   ASYKVCWDL---FFLGCSIVDMWKAYDDAIHDGVDVLSVSLGGDVPEGSEVDQVDFVA--  328

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW  1344
             +FHA+ +GIPV+ AAGN GP+A ++ NV PW +TVAA+T+DR F   ITLGN + +  + 
Sbjct  329   AFHAVAKGIPVVAAAGNDGPNAQSVINVAPWFLTVAATTLDRSFPTKITLGNNQTFYAE-  387

Query  1343  QLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAG  1164
              L  G  ++  L F   Y      M         KGK V  F   + +           G
Sbjct  388   SLFTGPDITTGLAFLESYSHNTTGM---------KGKTVLAFDKRVPKE--------GLG  430

Query  1163  AVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRA  984
             AV +  S P         +   PY+   Y+ G  I  YI ++T +PT ++S+     G  
Sbjct  431   AVILAQSVP---------DESYPYILTSYEHGADILQYI-RTTRSPTVRISAATTLTGPP  480

Query  983   LTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHV  816
                KV  FSSRGP+S +P I+KPDIAAPG  I+ A    +P S  GF + SGTS + P V
Sbjct  481   AAAKVVVFSSRGPNSVSPAILKPDIAAPGVNILAALTPLNPDSHNGFGLLSGTSMSTPVV  540

Query  815   SAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPN  636
             S I ALLK  HP+WSPAAI+SALVTTAW +     PIFA+GS+ + AD FDYGGG+VNP 
Sbjct  541   SGITALLKCLHPDWSPAAIRSALVTTAWRTSKSGEPIFAEGSNKKLADPFDYGGGLVNPE  600

Query  635   AADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLN  456
             +A DPGLVYDM   DY  Y+C+ GYN++ I + +    N         CP    S+LD+N
Sbjct  601   SAADPGLVYDMGIKDYISYMCSAGYNDTSISRVLGKKTN---------CPSPGASILDIN  651

Query  455   LPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFT  276
             LPS+ +P+L + VTL RT+TNVGP NSVYKA++KSP+G  +TV P  L F G+ +  S+ 
Sbjct  652   LPSITIPNLDQEVTLTRTLTNVGPNNSVYKAVIKSPLGITLTVSPTTLVF-GSGEVLSYA  710

Query  275   MRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPL  156
             +       VN+ + FGSLTW+DGVH+VR P++V+  I+ +
Sbjct  711   VTAKTSHKVNTGYFFGSLTWTDGVHDVRIPVSVQTKIMNM  750



>ref|XP_002887016.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63275.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=753

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/762 (44%), Positives = 470/762 (62%), Gaps = 47/762 (6%)
 Frame = -3

Query  2408  KENG-KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAV  2232
             + NG  KI+IV+LG K HD    + +SHY +L  ++GS E AR ++VY+Y++GFSGFAA 
Sbjct  30    QPNGLNKIHIVHLGAKQHDTPELVTKSHYQILEPLLGSKEAARNSLVYNYKHGFSGFAAK  89

Query  2231  LTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVG  2052
             LTASQAK ++    V+SVV  +  +++T+R++D+LGLS  +  P  LL +T  G   I+G
Sbjct  90    LTASQAKNLSAHPEVLSVVPSRVMRLKTTRTFDYLGLSLTS--PKGLLHETRMGSEAIIG  147

Query  2051  VVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLS  1872
             V+DSGI  E  SF D G+GP+P+ WKG C  + G  F+ ++ CN+K+IGA +F +G L S
Sbjct  148   VIDSGIWPESQSFNDTGLGPIPKHWKGKC--VSGNGFDANKHCNKKLIGAEFFTEGLLES  205

Query  1871  QDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASY  1692
              + + +     +S S  D+ GHG+ V++I AGSFV  A   G+  G  RG A  AR+A Y
Sbjct  206   TNGEYDFVSHDESKSPRDIEGHGTHVSAIAAGSFVATANYNGLAGGTARGAAPHARIAMY  265

Query  1691  KACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHA  1512
             KACW    +   C   D+L AID++I D VDVIS+S+G+  P + D++ ++ I  GSF A
Sbjct  266   KACW----KGIGCITPDMLKAIDHSIRDGVDVISISIGTDAPASFDID-QSDIAFGSFQA  320

Query  1511  ITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPN  1332
             + +GIPV+ +AGN GP+A TI NV PW+ITVAA+++DR F   ITLGN           N
Sbjct  321   VMKGIPVVASAGNEGPNAQTIDNVAPWIITVAATSLDRSFPIPITLGN-----------N  369

Query  1331  GTALSHPLH------FAGKYMGEADLMPRKLDPAEVKGKIVFMF--GDDLDRNLVLVDKA  1176
              T L   L+      F    + + ++M   ++  + +G IV  F   DD  R     +  
Sbjct  370   LTILGEGLNTFPEAGFTDLILSD-EMMSASIEQGQTQGTIVLAFTPNDDAIRK---ANTI  425

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
               AG  G+IY+  S +D     +  +P   VDY+ GT I  YI Q+T  P A++S  K  
Sbjct  426   VRAGCAGIIYAQ-SVIDPTVCSDVHVPCAVVDYEYGTDILYYI-QTTDVPKAKISPSKTL  483

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHV  816
             +GR +  +VP FS RGP+S +P I+KPDIAAPG  ++ A     G ++  SGTS A P V
Sbjct  484   IGRPIASRVPRFSCRGPNSVSPAILKPDIAAPGVNVLSA---VTGVYKFMSGTSMATPVV  540

Query  815   SAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPN  636
             S IV LL+ + P+WSPAAI+SALVTTAW +D    PIF++GS+ + AD FDYGGG++NP 
Sbjct  541   SGIVGLLRQTRPDWSPAAIRSALVTTAWKTDPSGEPIFSEGSTRKLADPFDYGGGLINPE  600

Query  635   AADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLN  456
                DPGL+YDM   DY  YLC+  Y+N+ I K +              C   +PSMLD N
Sbjct  601   KVTDPGLIYDMGIDDYLHYLCSAEYDNASISKLLGKTYK---------CTYPKPSMLDFN  651

Query  455   LPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFT  276
             LPS+ +P L   VT+ RTVTNVGP +SVY+ +++SP G  + V PK L F  N  K +F+
Sbjct  652   LPSITIPSLTGEVTVTRTVTNVGPASSVYRPVIESPFGIELDVNPKTLVFGSNITKITFS  711

Query  275   MRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             +RV     VN+ + FGSL W+DGVHNV TP++VR  I+  Y+
Sbjct  712   VRVKTSHRVNTDYYFGSLCWTDGVHNVSTPVSVRTKILRNYV  753



>ref|XP_002893749.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70008.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
Length=717

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/771 (43%), Positives = 451/771 (58%), Gaps = 104/771 (13%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG + HDD   + ESH+ +L  ++GS E A  +MVYSYR+GFS FAA LT SQ 
Sbjct  23    KVHIVYLGERQHDDPDSVTESHHQMLWSILGSKEAAHDSMVYSYRHGFSAFAAKLTDSQV  82

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
              ++            + +++QT+R+WD+L     +  P  LL +TN GD +I+GVVDSG+
Sbjct  83    IQL-----------SEFYELQTTRTWDYL--KHTSRHPKNLLNQTNMGDKVIIGVVDSGM  129

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG                  K +  R               
Sbjct  130   WPESESFSDNGLGPIPKRWKG------------------KYVSPR---------------  156

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                        D  GHG+ VA+  AGSFV +A+ L +  G  RGGA  AR+A YKACW+L
Sbjct  157   -----------DFNGHGTHVAATAAGSFVADASYLALGRGTARGGAPRARIAMYKACWHL  205

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                    C+ AD+L AID AIHD VDV+S+S   P+PL  +++A + + +G+FHA+ +GI
Sbjct  206   ASIGTATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDARDAMAVGAFHAVAKGI  265

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD--WQLPNG--  1329
             PV+ + GNAGP++ T+TN  PW+ITVAA+T DR F   ITLGN         +Q P+   
Sbjct  266   PVVCSGGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNITIVGQALYQGPDMDF  325

Query  1328  TALSHPLHFAGK---YMGEADLMPRKLDPAEV-KGKIVFMFGDDLDRNLVLVDKATDAGA  1161
             T L +P         + G  + + +  +PA + K KIV  F            K+TD G 
Sbjct  326   TGLVYPEGPGASNETFSGVCEDLSK--NPARIIKEKIVLCF-----------TKSTDYGT  372

Query  1160  VGVIYSNPSNVDSLPILNAR-----------IPYVQVDYDAGTRIKDYIFQSTMTPTAQL  1014
             V    S+  N+D   ++ AR            P + VDY+ GT I  YI +S+ +P A++
Sbjct  373   VIQAASDVFNLDGYGVIVARNPGYQLNPCDGFPCLAVDYELGTDILFYI-RSSRSPVAKI  431

Query  1013  SSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRIS  846
                +  VG  +  KV  FSSRGPSS +P I+KPDIAAPG  I+ A    D   D GF + 
Sbjct  432   QPTRTLVGIPVATKVATFSSRGPSSISPAILKPDIAAPGVNILAATSPNDTFYDRGFAMK  491

Query  845   SGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAF  666
             SGTS + P V+ IVALLK  HP WSPAAI+SA+VTTAW +D    PIFA GS+ + AD F
Sbjct  492   SGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWRTDPSGEPIFADGSNRKLADPF  551

Query  665   DYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICP  486
             DYGGG+VN   A  PGLVYDM   DY  YLC++GY +S I + +          + T+C 
Sbjct  552   DYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTDSSITRLV---------RKKTVCA  602

Query  485   KTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRF  306
               +PS+LDLNLPS+ +P+L K VT+ RTVTNVGPV SVYKA++++P+G  VTV P+ L F
Sbjct  603   NPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGPVGSVYKAVIEAPMGVNVTVTPRTLVF  662

Query  305   DGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             +   +K SF +RV  +  VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  663   NAKTRKLSFKVRVITNHRVNTGYYFGSLTWTDSVHNVVIPVSVRTQILQRY  713



>ref|XP_010919042.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Elaeis 
guineensis]
Length=792

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/774 (44%), Positives = 465/774 (60%), Gaps = 48/774 (6%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRR-IKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFA  2238
             +       ++IVY+G + H+D    ++ SH+D+L  ++GS E A+ +++YSY++ FSGFA
Sbjct  44    IFLAEASNVHIVYMGARDHEDSTTTVESSHHDVLTTLLGSKEAAKDSILYSYKHSFSGFA  103

Query  2237  AVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMI  2058
             A LT SQA+++A   G+V V+ +K  K+ T+RSWDF+GL    N    LL ++  G  +I
Sbjct  104   ARLTKSQAERLAEFPGIVQVIPNKVRKLHTTRSWDFIGLHP--NSRDSLLSESRMGKELI  161

Query  2057  VGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGAL  1878
             +GV+DSGI  E  SF D GMGP+P RWKG+C    G  F+ +  CN+K+IGARWF KG +
Sbjct  162   IGVIDSGIWPESESFNDEGMGPIPSRWKGTCEH--GELFDSTN-CNKKLIGARWFGKGLI  218

Query  1877  LSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVA  1698
                   +     S+  S  D  GHG+  ASIVAG  +  A+  G+  G  RGGA  AR+A
Sbjct  219   AEMKRPIKTVAPSEYLSPRDATGHGTHTASIVAGRLIKKASYKGLAAGTARGGAPLARLA  278

Query  1697  SYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSF  1518
              YKACW    E   CA AD+L A D AI D VDVISVS+G  +PL+   E  + + IGSF
Sbjct  279   VYKACWATKAEE--CADADVLKAFDEAIRDGVDVISVSLGEQLPLSPYFE-HDSVSIGSF  335

Query  1517  HAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQL  1338
             HA  RGI V+ +AGN GP + T+TN  PWV TVAA++IDR F   I LGN   +    Q 
Sbjct  336   HAAARGISVVCSAGNDGPFSQTVTNTAPWVTTVAAASIDRAFPTAIILGNNHTFL--GQT  393

Query  1337  PNGTALS---HPLHFAGKYMGEADLMPR--------KLDPAEVKGKIVFMFGDDLDRNLV  1191
              N        H L ++ +++ E ++            L+    KGK++  F   +  +  
Sbjct  394   LNTRGYKGGFHGLEYS-EFIAEENVDADDSRGCDMDTLNATLAKGKVILCFS--VTGDAY  450

Query  1190  LVDKATD---AGAVGVIY--SNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTP  1026
             + D A+    AGA+G+I+  S  S VD+       +P ++V+Y+ GT I  YI Q+   P
Sbjct  451   ISDAASSVSRAGAIGLIFAQSQDSYVDACD----EVPCIKVNYEVGTEILSYIRQAQF-P  505

Query  1025  TAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--DPT-SDGGF  855
               +L  PK   GR  +P++  FSSRGP+S +P I+KPDIAAPG  I+ A  DP  ++  F
Sbjct  506   VVKLGRPKTLTGRLASPRIAYFSSRGPNSLSPAILKPDIAAPGVSILAAHRDPADANDAF  565

Query  854   RISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAA  675
                SGTS + PHV+AIV L+K  H +WSPAAIKSAL+TTA    T    I A+  S + A
Sbjct  566   AFMSGTSMSCPHVTAIVTLIKSIHQDWSPAAIKSALITTATQIGTDGGLIVAEDGSQKTA  625

Query  674   DAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHT  495
             D FDYGGG V+P  A +PGLVY+M  +DY  +LC+LGYN+S I   I+   N        
Sbjct  626   DPFDYGGGHVDPKRAANPGLVYNMSTVDYVPFLCSLGYNDSAISNLINQQIN--------  677

Query  494   ICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKV  315
              CP T  S LDLNLPS+V+P+L   VT+ RT+TNVGP NSVY+A V  P G  + V P +
Sbjct  678   -CPITS-SALDLNLPSIVIPNLKGTVTITRTMTNVGPANSVYEARVHPPRGIKMEVMPLI  735

Query  314   LRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             L F+      SFT+  ++ + V+S + FGSLTW+DGVH VR+P+AVR +I   Y
Sbjct  736   LEFNSTITSISFTVTFTSSRRVHSDYRFGSLTWTDGVHVVRSPVAVRAIIYDSY  789



>ref|XP_006289363.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
 gb|EOA22261.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
Length=789

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/738 (45%), Positives = 448/738 (61%), Gaps = 36/738 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD   + ESH+ +L  ++GS E+   +MV+SYR+GFSGFAA LT SQA
Sbjct  46    KVHIVYLGEKQHDDRESVTESHHQMLWSLLGSKEDVHNSMVHSYRHGFSGFAAKLTKSQA  105

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V  D  +++ T+R+WD+LGLS  A  P  LL  TN G+ +I+G+VDSG+
Sbjct  106   KKIADLPEVVHVTPDSFYELATTRTWDYLGLS--AATPKNLLNDTNMGEEVIIGIVDSGV  163

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+GPVP  WKG C +  G  FN S  CN+K+IGA++F  G L +     N
Sbjct  164   WPESEVFNDNGIGPVPSHWKGDCES--GEMFNASH-CNKKLIGAKYFINGFLATHKT-FN  219

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D +GHG+ VA+I  GS+VPN +  G+  G VRGGA  AR+A YKACW L
Sbjct  220   STESLDFISPRDNSGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAIRARIAMYKACWYL  279

Query  1673  DPERF-VCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D      C+ ADLL A+D A+HD VDV+S+S+G  +P   + +    I  G+FHA+ +GI
Sbjct  280   DDLDINTCSSADLLKAMDEAMHDGVDVLSLSIGYRLPYYPETDVRAAIATGAFHAVLKGI  339

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL-  1320
              V+ + GN+GP+A T+ N  PW++TVAA+T+DR F   I LGN  K  +   +  G  L 
Sbjct  340   TVVCSGGNSGPAAQTVGNTAPWILTVAATTLDRSFPTPIILGN-NKAILGQAMYTGPELG  398

Query  1319  -------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLV--LVDKATDA  1167
                     +P +    + G  +L+    +   + GK+V  F        V   V     A
Sbjct  399   FTSLVYPENPGNSNESFFGTCELLFFNSN-RTMAGKVVLCFTTSTRYTTVSSAVSYVKKA  457

Query  1166  GAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
             G +G+I + NP   D+L       P V VDY+ GT I  YI +ST +P  ++   K  VG
Sbjct  458   GGLGLIVARNPG--DNLSPCVDDFPCVSVDYELGTNILFYI-RSTGSPVVKIQPSKTLVG  514

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTS----DGGFRISSGTSHAAP  822
             + ++ KV DFSSRGP+S  P I+KPDIAAPG  I+ A  T+    D GF + SGTS AAP
Sbjct  515   QPVSTKVADFSSRGPNSIEPSILKPDIAAPGVSILAATTTNRTFNDKGFIMLSGTSMAAP  574

Query  821   HVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVN  642
              +S +VALLK  H +WSPAAI+SA+VTTAW +D +   IFA+GS  + AD FDYGGG+VN
Sbjct  575   VISGVVALLKARHRDWSPAAIRSAIVTTAWRTDPFGEQIFAEGSPRKLADPFDYGGGLVN  634

Query  641   PNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             P  A  PGLVYD+   DY  Y+C+ GYN S I + +          + T+C   +PS+LD
Sbjct  635   PEKAAKPGLVYDLGLKDYVLYMCSAGYNESSIAQLVG---------KVTVCSNPKPSVLD  685

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRS  282
              NLPS+ +P+L   V L RT+TNVGP+NSVYK +V+ P G  VTV P+ L F+   K  S
Sbjct  686   FNLPSITIPNLKDEVILTRTLTNVGPLNSVYKVVVEPPSGIQVTVTPETLVFNSTTKTVS  745

Query  281   FTMRVSADKLVNSAFTFG  228
             F +RVS    +N+A   G
Sbjct  746   FKVRVSTKHKINTARLHG  763



>ref|XP_006304869.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
 gb|EOA37767.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
Length=759

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/752 (43%), Positives = 465/752 (62%), Gaps = 33/752 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H+D +    SH  +L  ++GS ++A +++V+SYR+GFSGFAA LT +QA
Sbjct  34    KVHIVYLGEKEHNDPKLETASHLRMLESLLGSKKDASESIVHSYRHGFSGFAAHLTDAQA  93

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++    VV V  + ++++QT+R++D+LGLS   + P  LLR    G+ +I+GV+DSG+
Sbjct  94    KKISEHPNVVQVTPNVYYELQTTRTFDYLGLSH--STPKGLLRDAKMGEDVIIGVLDSGV  151

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG C  I G  F+  + CN+K+IGAR++ +        D +
Sbjct  152   WPESESFNDKGLGPIPKRWKGMC--IDGEDFDSKKHCNKKLIGARYYMESLFRKNKTD-S  208

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +   ++  S  +   HG+ VAS  AGSFV N +  G  VG VRGGA  AR+A YK CW  
Sbjct  209   RIPDTEYMSAREKLPHGTHVASTAAGSFVSNVSANGFGVGTVRGGAPGARIAVYKVCWQR  268

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   CA A+++ A+D AI D VD+I++S+G P P  S+++A N I  G+FHA+  GIP
Sbjct  269   RDGS--CASAEIIKAMDDAIADGVDLITISIGRPNPTLSEIDAYNQISYGAFHAVANGIP  326

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP+ +T+ N+ PW+ITVAA+++DR ++  +TLGN           N T ++ 
Sbjct  327   VLSAGGNFGPNDYTVQNIAPWIITVAATSLDRWYSTPLTLGN-----------NITLMAR  375

Query  1313  PLHFAGKYMGEADLMPRKLD-PAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNP  1137
               +   +   E   + R  +  +  KGK+V  F    +  +  V   +   A G+I++  
Sbjct  376   SAYKGSEIQAELMFVYRANEMTSAAKGKVVVAFITTDNEVMDYVSTFSTVEASGLIFATK  435

Query  1136  SNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFS  957
                D L + +  +  + +DY+ G  I  YI ++T +PT ++SS     G  +  KV +FS
Sbjct  436   RE-DDLKV-SEGMAMITIDYEQGATIFKYI-RTTSSPTIKISSAITLNGPLVATKVAEFS  492

Query  956   SRGPSSFAPGIMKPDIAAPGDKIMCADPT----SDGGFRISSGTSHAAPHVSAIVALLKI  789
              RGP++ +P ++KPDIAAPG  I+ A       ++ GF   SGTS A P V+ +VALL+ 
Sbjct  493   GRGPNTISPYVLKPDIAAPGVAIVAASTPEKMGAEDGFYAESGTSMATPVVAGLVALLRA  552

Query  788   SHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVY  609
              HP+WSPAA+KSALVTTA  +D Y  PIF++G + + AD FD+GGG+VNPN A DPGLVY
Sbjct  553   VHPDWSPAALKSALVTTASQTDPYGEPIFSEGLTRKLADPFDFGGGLVNPNKAADPGLVY  612

Query  608   DMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL  429
             D    DY  +LCA  Y+   I +      +R +T     CP  RPSMLDLNLPS+ +P L
Sbjct  613   DAGAEDYRLFLCASNYDEVHITRI-----SRINTLYR--CPSPRPSMLDLNLPSITIPFL  665

Query  428   FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLV  249
              + VTL RTVTNVGPV+SVYK +V+ P+G  ++V P  L F+ N KK SF + VS     
Sbjct  666   KEDVTLTRTVTNVGPVDSVYKLVVEPPLGIKISVTPNTLLFNSNVKKLSFKVTVSTTHKA  725

Query  248   NSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             NS + FGSLTW+DG HNV  P++VR  ++  +
Sbjct  726   NSIYYFGSLTWTDGSHNVTIPLSVRTQMLKYF  757



>ref|XP_004146562.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004160980.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN53334.1| hypothetical protein Csa_4G047950 [Cucumis sativus]
Length=764

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/772 (43%), Positives = 460/772 (60%), Gaps = 69/772 (9%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             +   K++IVYLG KPH D +   +SH+ LL+ ++GS E++ +AMVYSY++GFSGFAA LT
Sbjct  30    DQNPKVHIVYLGEKPHHDTKFTIDSHHQLLSTILGSKEKSMEAMVYSYKHGFSGFAAKLT  89

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              SQA+K++ ++ VV VV    +KV T+RSWDFLGLS        LL +   G+ +I+GV+
Sbjct  90    KSQAQKLSEMSRVVRVVPSSLYKVHTTRSWDFLGLSSSPFESSNLLHRAQMGENVIIGVI  149

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             D+GI  E  SF D G+G +P RWKG+C +  G +FN +  CN+K+IGARWF KG +    
Sbjct  150   DTGIWPESESFKDKGVGSIPSRWKGTCES--GEQFNSTN-CNKKIIGARWFMKGFV----  202

Query  1865  VDLNKFLVSDSY-SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYK  1689
              DL +  ++  Y S  D+ GHG+  ASI AGSFV N        G VRGGA  AR+A YK
Sbjct  203   ADLGRDALAKEYLSPRDLNGHGTHTASIAAGSFVANINYHNNAAGTVRGGAPLARLAIYK  262

Query  1688  ACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
             A W  D    V + AD+L AID AI+D VDV+S+S+GS  P   +    N I  GSFHAI
Sbjct  263   ALWTKDA---VGSTADILKAIDEAINDGVDVLSMSIGSLTPFLPEFNEANDIAFGSFHAI  319

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
              +GI V+ AAGN+GP+  T+ NV PW+ TVAA+TIDR F  +IT            LP+ 
Sbjct  320   AKGISVVCAAGNSGPTPQTVENVAPWIFTVAANTIDRAFLASIT-----------TLPDN  368

Query  1328  TALSHPLHFAGKYMGEADLMPRKLDPAE------------------VKGKIVFMFGDDLD  1203
             T           ++G++ L  +K   AE                  + GK+V  F +  D
Sbjct  369   TT----------FLGQSLLDSKKDLVAELETLDTGRCDDLLGNETFINGKVVMCFSNLAD  418

Query  1202  RNLVLVDKA---TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDY-IFQST  1035
              N +  D A     A   G+I +   + D    + + IP + VD D G+++    + Q++
Sbjct  419   HNTIY-DAAMAVARANGTGIIVAGQQDDDLFSCIPSPIPCILVDTDVGSKLFFINLLQNS  477

Query  1034  MTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTS  867
               P  +L + +  +G+ +TP +  FSSRGP+S +  I+KPDI+APG  I+ A       +
Sbjct  478   TNPVVRLRATRTIIGKPITPAISYFSSRGPNSVSNPILKPDISAPGSNILAAVSPHHIFN  537

Query  866   DGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSS  687
             + GF + SGTS A PH+SAIVALLK  HP WSPAAIKSAL+TTA    +   PIFA+G+ 
Sbjct  538   EKGFMLLSGTSMATPHISAIVALLKSVHPTWSPAAIKSALMTTARTEVSPGLPIFAEGTP  597

Query  686   LRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQ-YLCALGYNNSLIYKTISGNRNRSD  510
              + AD FDYGGGIV+ NAA DPGLVYDM   DY   YLC +GY +  I            
Sbjct  598   PKMADPFDYGGGIVDANAAVDPGLVYDMGRKDYIDYYLCGMGYKDEDISHL---------  648

Query  509   TEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVT  330
             T+  T+CP  R S+LDLNLP++ +P L     + RTVTNVG ++ VYKA ++SP G  V+
Sbjct  649   TQRKTVCPLQRLSVLDLNLPAITIPSLVNSTIVTRTVTNVGNLSCVYKAEIESPFGCKVS  708

Query  329   VKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             V P+VL F+   KK SF +        N  ++FG LTW+DG+H V+ P++VR
Sbjct  709   VNPQVLVFNSQVKKISFKVMFFTQVQRNYGYSFGRLTWTDGIHVVKIPLSVR  760



>ref|XP_009105193.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=757

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/749 (44%), Positives = 466/749 (62%), Gaps = 32/749 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IV+LG K HD    + +SHY +L  ++GS E A+K++VY+Y++GFSGFAA LTASQA
Sbjct  40    KVHIVHLGAKKHDTPELVTKSHYQILEPILGSKEAAQKSIVYNYKHGFSGFAAKLTASQA  99

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++    V+ V+  +  +++T+R++D+L L   +  P  LL  T  G   I+G++DSGI
Sbjct  100   KNLSAHPEVLCVIPSRTLRLKTTRAFDYLRLLPSS--PKGLLHDTRLGSEAIIGIIDSGI  157

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+PQRWKG C  + G  F+ S+ CN+K+IGA  F+  +L ++     
Sbjct  158   WPESESFKDTGLGPIPQRWKGKC--VSGDGFDASKHCNKKLIGAE-FYVDSLAAETNGQY  214

Query  1853  KFLVSDSY-SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
              F   + Y S  D AGHG+ V++I AGSFV NA+  G+  G  RG    AR+A YK CW 
Sbjct  215   DFHAENEYRSARDGAGHGTHVSAIAAGSFVANASYKGLGGGTARGVGPHARIAMYKTCWG  274

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                 +  C   D+L AID++I D VDVIS+S+G+  P   +++  + +  GSFHA+ +GI
Sbjct  275   ----KLGCLTPDVLKAIDHSIRDGVDVISISIGADAPAGFEIDTSD-VSFGSFHAVMKGI  329

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ +AGN GP+A T+ NV PW+ITVAA+++DR F   ITLGN         L  G    
Sbjct  330   PVVCSAGNEGPNAQTVDNVAPWIITVAATSMDRSFPIPITLGNNITI-----LGEGLNTF  384

Query  1316  HPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNP  1137
               + F    + E +LM   +   ++KGKIV  F  + +  +   D+  +AG  G+IY+  
Sbjct  385   PEVGFTDLLLQE-ELMETSIAQGQIKGKIVLAFTPN-NEAIQKADRVLNAGCAGIIYAQ-  441

Query  1136  SNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFS  957
             S VD        +P   VDY+ GT +  YI ++T  P A+LS+ K  VGR +  +V  FS
Sbjct  442   SVVDPTVCSGLDVPCAVVDYEFGTDMLYYI-ETTDVPLAKLSTSKTLVGRPVASRVARFS  500

Query  956   SRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHPE  777
              RGP+S +P I+KPDIAAPG  I+ A P    G++  SGTS + P VS IV L++ + P+
Sbjct  501   CRGPNSVSPAILKPDIAAPGVNILSAVPD---GYKFMSGTSMSTPIVSGIVGLIRQTRPD  557

Query  776   WSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRG  597
             WSPAAI+SALVTTAW +D    PIF++G++ + AD FDYGGG++NP    DPGLVYDM  
Sbjct  558   WSPAAIRSALVTTAWRTDPSGEPIFSEGATRKLADPFDYGGGLINPEKVTDPGLVYDMGL  617

Query  596   IDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPV  417
              DY  YLC+  Y+++ I K I G  N+        CP  RPSMLDLN+PS+ +P L   V
Sbjct  618   DDYIHYLCSADYSDNEISKLI-GKPNQ--------CPSPRPSMLDLNMPSITIPSLTGEV  668

Query  416   TLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAF  237
             T+ RTVTNVGP +SVYK +++ P G  + V PK L F  N  K +F++RV ++  VN  F
Sbjct  669   TVTRTVTNVGPADSVYKPVIEPPFGIELEVNPKTLVFGSNTTKNTFSVRVRSNHQVNGDF  728

Query  236   TFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
              FGSL W+DG HNV  P+++R  I+  Y+
Sbjct  729   YFGSLCWTDGAHNVTIPVSIRTKILRNYV  757



>ref|XP_010474133.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=754

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/747 (45%), Positives = 454/747 (61%), Gaps = 31/747 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IV+LG K HD    + +SHY +L  ++GS E A+ ++VY+Y++GFSGFAA LTASQA
Sbjct  38    KIHIVHLGAKQHDTPELVTKSHYQILEPLLGSKEAAKNSIVYNYKHGFSGFAAKLTASQA  97

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++    V+SVV  +    +T+R++D+LGLS  +  P  LL  T  G  +I+GV+DSGI
Sbjct  98    KNLSVHPEVLSVVPSRVMWPKTTRTYDYLGLSPTS--PKGLLHDTKLGSEVIIGVIDSGI  155

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG C +  G  F+  + CN+K+IGA +F +G LL+ + + +
Sbjct  156   WPESHSFNDTGLGPIPKRWKGKCMS--GDGFDPKKHCNKKLIGAEFFTEG-LLNSEAEYD  212

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+ VA+  AGSFV NA+  G+ VG  RG A  AR+A YK CW  
Sbjct  213   FESEREFRSPRDAKGHGTHVAATAAGSFVSNASYKGLAVGTARGAAPHARIAMYKTCW--  270

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                R  C  ADLL AID++I D VDVISVS+G+  P + D++ ++ I  GSF A+ +GIP
Sbjct  271   --RRAGCITADLLKAIDHSIRDGVDVISVSIGNDPPASFDVDMDD-IAFGSFQAVMKGIP  327

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP A TI NV PW+ITVAA++ DR F   ITLGN         L  G     
Sbjct  328   VVASAGNEGPDAQTIDNVAPWIITVAATSFDRSFPVPITLGNNLTV-----LAEGLNTFP  382

Query  1313  PLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNPS  1134
              + F  +     +L+   ++    KG IV  F           D   +AG  G+IY+  S
Sbjct  383   EVGFI-ELQNAIELLDTNIEEGVTKGSIVLAFTATATAAKKAHD-ILEAGCAGIIYAQ-S  439

Query  1133  NVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSS  954
              ++        +P   VDY+  T I  YI Q++ +P A++S  K  +G+ L  +V  FSS
Sbjct  440   VINPTVCNGVDVPCAVVDYEYATDILHYI-QTSDSPKAKISPSKTLIGQPLASRVAYFSS  498

Query  953   RGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEW  774
             RGP+S  P I+KPDIAAPG  ++ A     G + I SG+S A P VS IV LL+  HP W
Sbjct  499   RGPNSVTPAILKPDIAAPGVNVLSA---VSGVYTILSGSSMATPIVSGIVGLLRQIHPGW  555

Query  773   SPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGI  594
             SPAAI+SALVTTAW +D     IF++GS+ + AD FDYGGG++NP    +PGL+YDM   
Sbjct  556   SPAAIRSALVTTAWRTDPSGEQIFSEGSTRKLADPFDYGGGLINPEKVANPGLIYDMGIN  615

Query  593   DYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVT  414
             DY  YLC+  Y++  I K +          +   CP   PSMLD N+PS+++P L + VT
Sbjct  616   DYVHYLCSAEYDDGSISKLLG---------KPIKCPYPLPSMLDFNMPSIIIPSLTREVT  666

Query  413   LRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFT  234
             L RTVTNVGP +SVYK +V+SP+G  + V PK L F  N  K +F +RV     VNS + 
Sbjct  667   LTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASNITKGTFNVRVKTSHRVNSDYY  726

Query  233   FGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             FGSL W+DGVHNV  PIAVR  I+  Y
Sbjct  727   FGSLCWTDGVHNVTIPIAVRTKILKSY  753



>ref|XP_002872522.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48781.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/762 (44%), Positives = 452/762 (59%), Gaps = 71/762 (9%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YIVYLG K HD+   + ESH+ +L+ ++GS +    ++VYSYR+GFSGFAA LT SQA
Sbjct  28    KVYIVYLGEKEHDNPESVTESHHQMLSSLLGSKKAVLDSIVYSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V+ +  +++ T+R+WD+LG+S G +    LL K   G  +IVGV+D+G+
Sbjct  88    QQISELPEVVQVIPNTLYEMTTTRTWDYLGISPGNS--DSLLEKARMGYQVIVGVLDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C +  G  FN S  CNRK+IGA++F         V LN
Sbjct  146   WPESEMFNDKGYGPIPSRWKGGCES--GDLFNGSIHCNRKLIGAKYFVDANNAEFGV-LN  202

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             K    D  S  D+ GHG+ VAS + GSF+PN + LG+  G  RGGA    +A YK CW  
Sbjct  203   KTENPDYLSPRDINGHGTHVASTIGGSFLPNVSYLGLGRGTARGGAPGVHIAVYKVCW--  260

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                +  C+GAD+L A+D AIHD    IS +      L                       
Sbjct  261   --LQRGCSGADVLKAMDEAIHDGCSFISRNRFEGADLCWS--------------------  298

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
              I  AGNAGP+A TI+NV PWV+TVAA+T DR F   ITLGN           N T L  
Sbjct  299   -ISCAGNAGPTAQTISNVAPWVLTVAATTQDRSFPTAITLGN-----------NITILGQ  346

Query  1313  PLHFAGKYMG---------EADLMPRKLDP-AEVKGKIVFMFGDDLDRNLVLVDKATDAG  1164
              + FAG  +G           D      +P + ++GK+V  F      N   +    +AG
Sbjct  347   AI-FAGPELGFVGLTYPEFSGDCEKLSSNPNSAMQGKVVLCFTASRPSN-AAITTVRNAG  404

Query  1163  AVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
              +GVI + NP+++ + P  N   PYV VD++ GT I  YI +ST +P   + + K   G+
Sbjct  405   GLGVIIARNPTHLLT-PTRN--FPYVSVDFELGTDILYYI-RSTRSPIVNIQASKTLFGQ  460

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTS---DGGFRISSGTSHAAPH  819
             +++ KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P S   DGGF + SGTS A P 
Sbjct  461   SVSTKVATFSSRGPNSVSPAILKPDIAAPGVNILAAISPNSSINDGGFAMMSGTSMATPV  520

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             VS +V LLK  HP+WSP+AIKSA+VTTAW +D    PIFA GSS + AD FDYGGG++NP
Sbjct  521   VSGVVVLLKSLHPDWSPSAIKSAIVTTAWRTDPSGEPIFADGSSRKLADPFDYGGGLINP  580

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               A  PGL+YDM   DY  Y+C++ Y++  I + +          + T+CP  +PS+LDL
Sbjct  581   EKAVKPGLIYDMTTDDYVMYMCSVDYSDISISRVLG---------KTTVCPNPKPSVLDL  631

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +P+L   VTL RTVTNVGPVNSVYK ++  P G  V V P  L FD    KRSF
Sbjct  632   NLPSITIPNLRGEVTLTRTVTNVGPVNSVYKVVIDPPTGVNVAVTPTELVFDSTTTKRSF  691

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             T+RVS    VN+ + FGSLTW+D +HNV  P++VR  I+  Y
Sbjct  692   TVRVSTTHKVNTGYYFGSLTWTDNLHNVAIPVSVRTQILQRY  733



>emb|CDY49641.1| BnaCnng17930D [Brassica napus]
Length=743

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/752 (44%), Positives = 450/752 (60%), Gaps = 59/752 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +IY V+LG + H+D + + +SH+D+L  ++GS E +R++M+YSYR+GFSGF+A LT++QA
Sbjct  39    QIYTVHLGKRQHNDPKLVTDSHHDILGSLLGSKEASRESMIYSYRHGFSGFSAKLTSAQA  98

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV +   K+ K+ T+R  D++GL+  A  P  L+  T+ G   I+G+VDSGI
Sbjct  99    RELSENPHVVHLTRSKNMKLTTTRVSDYVGLTSTA--PTGLVHDTDMGSDTIIGIVDSGI  156

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
                  SF D G+GP+P RWKG C  + G  FN S +CNRKVIGA ++ KG         N
Sbjct  157   WPGSKSFNDNGLGPIPARWKGQC--VSGEGFNAS-MCNRKVIGATYYAKGIARKYKGAFN  213

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  ++ S  D  GHG+  AS  AGSFV NA  LG+  G  RG A  ARVA+YK CWN 
Sbjct  214   AAERDEAMSPLDKIGHGTHCASTAAGSFVQNANFLGLGQGTARGSAPRARVAAYKVCWNN  273

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENG-IGIGSFHAITRGI  1497
             +     C   D+L A+D+A+ D VDV+S+S+GS +PL  D E +     I +FHA+ +GI
Sbjct  274   EE----CFTPDILKAMDHAMRDGVDVLSLSLGSEIPL--DFEVDRSDFAIAAFHAVMKGI  327

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ A GN GP   TI+NV PW+ITVAA+T+DR F   ITLGN           N T L 
Sbjct  328   TVVCAGGNDGPETQTISNVAPWIITVAATTMDREFFTPITLGN-----------NVTVLG  376

Query  1316  HPLHFAGKYMGEADLM------PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVG  1155
                 + G+ +G  DL+          +  + KGKI+F F  D   +  + + A   G VG
Sbjct  377   QEGLYIGEEVGFTDLIYFDDLTKADFEAGKAKGKILFTFLTDRFTDQ-MAEFAKSKGVVG  435

Query  1154  VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             +I +    +D +    A I   +VDY+ G  I  Y+ Q+   P A++S  K  VGR    
Sbjct  436   IIIATKP-IDLIEPGTAGIASARVDYEIGMDILLYL-QTAKFPKAKISPTKTFVGRPSAT  493

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALL  795
             KV  FSSRGP+S +P I+KPDIAAPG  I+ A PT   G+   SGTS A P V+ IVALL
Sbjct  494   KVARFSSRGPNSISPAILKPDIAAPGVGILAAVPTG-AGYEFMSGTSMATPVVTGIVALL  552

Query  794   KISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGL  615
             K   P+WSPAAI+SALVTTA+ +D    PI A+GS  + AD FDYGGG+VNP    DPGL
Sbjct  553   KQKRPDWSPAAIRSALVTTAFQTDPSGEPIAAEGSPRKIADPFDYGGGLVNPGKVADPGL  612

Query  614   VYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVP  435
             VYDM   +Y  YL                            CP   PSMLD+NLPS+ +P
Sbjct  613   VYDMGHDEYVHYL-------------------------FYTCPSPTPSMLDVNLPSITIP  647

Query  434   DLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADK  255
              L + +T+ RTVTNVGPV SVYKA+++ P+G  + V PK L F  N KK +FT++VS   
Sbjct  648   YLSQEITITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPNTKKITFTVKVSTTH  707

Query  254   LVNSAFTFGSLTWSD-GVHNVRTPIAVRKMIV  162
              VN+ + FGSLTW+D GVHNVR P++VR  ++
Sbjct  708   RVNTDYHFGSLTWTDNGVHNVRIPLSVRTRVL  739



>ref|XP_002518939.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43472.1| Cucumisin precursor, putative [Ricinus communis]
Length=752

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/765 (44%), Positives = 457/765 (60%), Gaps = 42/765 (5%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E   K++IVY+G K ++D    K+SH+ +L+ ++GS E A+ +++YSY++GFSGFAA LT
Sbjct  4     EATMKVHIVYMGEKKYEDPATTKKSHHQMLSTLLGSKEAAKSSILYSYKHGFSGFAARLT  63

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              +QA K+A   GV+ V+ ++ HK+ T+RSW+F+GL+  ++    LL ++N G+G I+GV+
Sbjct  64    EAQAVKIAEFPGVIQVIPNRIHKLHTTRSWEFIGLNHHSS--KNLLAQSNMGEGTIIGVI  121

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             DSGI  E  SF D GMGPVP  WKG C+   G  FN S  CNRK+IGARWF KG     +
Sbjct  122   DSGIWPESKSFNDRGMGPVPSHWKGICQE--GECFNYSN-CNRKLIGARWFIKGFREEIE  178

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               +N    ++  S  D  GHG+  AS  AG FV NA+  G+  G+ RGGA  A +A YK 
Sbjct  179   KPVNTTNSTEFLSPRDGDGHGTHTASTAAGYFVENASYKGLATGLARGGAPLAHLAVYKV  238

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CW +D     C  ADLL A D AI D VD++SVS+G+ +PL S  +  + I IGSFHA  
Sbjct  239   CWGIDVGG--CTDADLLKAFDKAIQDGVDILSVSIGNEIPLFSYADQRDAIAIGSFHATA  296

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
              GIPVI +AGN GP++ TI N  PW+ITVAA+TIDR F   ITLGN       W      
Sbjct  297   SGIPVICSAGNDGPTSQTIVNTAPWLITVAATTIDRAFPTAITLGNNSTL---WGKSIDK  353

Query  1325  ALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDK  1179
               +H   F G    E            D     L+     GK++  F     +N+V    
Sbjct  354   GRNHH-GFLGLTYSERIAVDSLDDSAKDCQLGSLNTTLAAGKVILCFSKTDTQNIVSASN  412

Query  1178  AT-DAGAVGVIYSNPSN--VDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSS  1008
             +   AG + +I++   N  +DS  +    IP ++VDY+ GT I  YI + T  P A+LS 
Sbjct  413   SVFQAGGIALIFAQFHNDGLDSCKL----IPCIKVDYEVGTFILSYI-RKTRYPIAKLSF  467

Query  1007  PKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMC----ADPTSDGGFRISSG  840
             PK  +G   +P+V  FSSRGPSS +P ++KPDIAAPG  I+     AD  +   + + SG
Sbjct  468   PKTVIGNQASPRVASFSSRGPSSISPLVLKPDIAAPGVDILAAYRPADNENRNTYTLLSG  527

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS A PHV+ I AL+K  HP WSPAAI+SALVTTA    T    I+++G + + AD FD 
Sbjct  528   TSMACPHVAGIAALIKSVHPNWSPAAIRSALVTTASQIGTDGMNIYSEGPTSKPADPFDI  587

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGG V P  A +PGLVYD+   DY Q+LC++GY++S I          +  +    C K 
Sbjct  588   GGGHVTPEKAVNPGLVYDISKEDYVQFLCSMGYSSSSISSL-------TKAKATIFCKKN  640

Query  479   RPSM-LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFD  303
               +  L+LNLPSM +P+L + VT+ R VTNVG + SVYKA V+ P G  + ++PKVL F+
Sbjct  641   SSNFKLNLNLPSMTIPNLKRKVTVTRKVTNVGHIKSVYKAKVEPPFGIRIRLEPKVLIFN  700

Query  302   GNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
                K  SF +   +   V   + FGSLTWSDG H VR+PIAVR++
Sbjct  701   STTKNLSFKVTFFSSDKVEGDYRFGSLTWSDGQHFVRSPIAVREI  745



>ref|XP_002871506.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47765.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=762

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/757 (43%), Positives = 462/757 (61%), Gaps = 48/757 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H+D   +  SH  +L  ++GS ++A +++V+SYR+GFSGFAA LT SQA
Sbjct  36    KVHIVYLGEKEHNDPELVTASHLRMLESLLGSKKDASESIVHSYRHGFSGFAAHLTDSQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++    VV V  +  +++QT+R++D+LGLS+  + P  LL K   G  +I+GV+DSG+
Sbjct  96    KKISEHPDVVQVTPNSFYELQTTRTFDYLGLSQ--STPKGLLHKAKMGKDIIIGVLDSGV  153

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG C  + G  F+  + CN+K+IGAR++          D +
Sbjct  154   WPESQSFSDKGLGPIPKRWKGMC--VDGEDFDSKKHCNKKLIGARYYMDSLFRRNKTD-S  210

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             +   ++  S  +   HG+ VAS   GSFV N +  G  VG +RGGA +AR+A YK CW  
Sbjct  211   RIPDTEYMSAREGLPHGTHVASTAGGSFVSNVSDNGFGVGTIRGGAPSARIAVYKVCW--  268

Query  1673  DPERF--VCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
               +R    CA AD++ A+D AI D VD+I++S+G P P+ ++++  N I  G+FHA+  G
Sbjct  269   --QRVDGTCASADIIKAMDDAIADGVDLITISIGRPNPVLTEVDMYNQISYGAFHAVANG  326

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             IPV+ A GN GP A+T+ N+ PW+ITVAA+T+DR +   +TLGN           N T +
Sbjct  327   IPVLSAGGNFGPGAYTVQNIAPWIITVAATTLDRWYPTPLTLGN-----------NVTLM  375

Query  1319  SHPLHFAGKYMGE------ADLMPRKLDPAEVKGKIVFMFGDDLDRNLV-LVDKATDAGA  1161
             +   +   +  G+      AD M      +  KGK+V  F    + +    V K  +  A
Sbjct  376   ARTSYKGNEIQGDLVYVYSADEMT-----SATKGKVVLSFTTGSEESQSDYVPKLLEVEA  430

Query  1160  VGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRAL  981
               VI +     D +  ++  +P + VDY+ G+ I  YI   T +PT ++SS     G  +
Sbjct  431   KAVIIAGKR--DDIIKVSEGLPVIMVDYEHGSTIWKYI-SITRSPTIKISSAIALNGPLV  487

Query  980   TPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVS  813
               KV DFS RGP+S +P ++KPD+AAPG  I+ A    D  ++ G    SGTS A P V+
Sbjct  488   ATKVADFSGRGPNSISPYVLKPDVAAPGVAIVAASTPEDMGTNEGVAAQSGTSMATPVVA  547

Query  812   AIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNA  633
              +VALL+  HP+WSPAA+KSAL+TTA  +D Y  PIF++G + + AD FD+GGG+VNPN 
Sbjct  548   GLVALLRAVHPDWSPAALKSALITTASTTDPYGEPIFSEGMTRKLADPFDFGGGLVNPNK  607

Query  632   ADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNL  453
             A DPGLVYD+   DY  +LCA  Y+   I K        S T     CP  RPSMLDLNL
Sbjct  608   AADPGLVYDIGAEDYRLFLCASDYDERQITKI-------SKTNTPYRCPSPRPSMLDLNL  660

Query  452   PSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTM  273
             PS+ +P L + VTL RTVTNVGPV+SVYK +V+ P+G  ++V PK L F+ N KK SF +
Sbjct  661   PSITIPFLKEDVTLTRTVTNVGPVDSVYKLVVRPPLGVKISVTPKTLLFNSNVKKLSFKV  720

Query  272   RVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
              VS     NS + FGSLTW+DG H V  P++VR  ++
Sbjct  721   IVSTTHKSNSIYYFGSLTWTDGSHKVTIPLSVRTQML  757



>gb|AET04097.2| subtilisin-like serine protease [Medicago truncatula]
Length=781

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/772 (42%), Positives = 471/772 (61%), Gaps = 50/772 (6%)
 Frame = -3

Query  2417  KVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFA  2238
             ++  E    ++IVY+G K + +    K+ H+ +L+ ++GS E+A+ +++YSY++GFSGFA
Sbjct  34    EIFAEESSSVHIVYMGDKIYHNPETAKKYHHKMLSSLLGSKEDAKNSLLYSYKHGFSGFA  93

Query  2237  AVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMI  2058
             A +T SQA+ +A    VVSV+ +  HK+ T+RSWDF+G+   ++    +  ++N G G I
Sbjct  94    ARMTKSQAEDIAKFPEVVSVIPNGIHKLHTTRSWDFIGVHHPSS--KTVFTESNLGQGTI  151

Query  2057  VGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGAL  1878
             +GV+D+GI  E  SF D  MG +P +WKG C+   G +FN +  CN+K+IGARWF KG  
Sbjct  152   IGVIDTGIWPESASFNDEAMGKIPSKWKGVCQV--GEKFNSTN-CNKKIIGARWFLKGIT  208

Query  1877  -LSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARV  1701
               ++++ L     ++  S  D  GHG+  AS  AG FV NA   G+  G+ RGGA  A +
Sbjct  209   DHTKNLVLGNNDTTEYLSARDAIGHGTHTASTAAGYFVENANYRGLASGLARGGAPLAHL  268

Query  1700  ASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGS  1521
             A YKACW++      C  AD+L A D AIHD VDV++VS+G  +PL S  +  + I IGS
Sbjct  269   AIYKACWDVPVGH--CTDADILKAFDMAIHDGVDVLTVSLGIGIPLFSYADQRDTIAIGS  326

Query  1520  FHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW-  1344
             FHA ++GI V+ +AGN+GP + T++N  PW+ITVAA+TIDR F   ITLGN       W 
Sbjct  327   FHATSKGITVVSSAGNSGPISQTVSNTAPWLITVAATTIDRTFPTAITLGNNLTL---WG  383

Query  1343  -QLPNGTALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDLDR  1200
               + NG    H L F G    E            D     L+     GKIV  F     +
Sbjct  384   QSIDNG---KHALGFVGLTYSERIARDPSDDLAKDCQSGSLNETMAAGKIVLCFSVSDQQ  440

Query  1199  NLVLVD-KATDAGAVGVIYS--NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMT  1029
             ++V       +AG VG+IY+  +   ++   IL    P ++VDY+AGT +  YI ++   
Sbjct  441   DIVSAALSVKEAGGVGLIYAQRHEDGLNECGIL----PCIKVDYEAGTELLTYIRRARF-  495

Query  1028  PTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDG  861
             PTA+LS PK  +G+ ++P+V  FSSRGPS+ +P ++KPDIAAPG  I+ A P        
Sbjct  496   PTARLSFPKTVIGKWISPRVASFSSRGPSTLSPTVLKPDIAAPGVDILAAFPPKGSKKSS  555

Query  860   GFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLR  681
             GF   SGTS + PHV+ I AL+K  HP WSPAAI+SALVTTA  S T    + ++GS+ +
Sbjct  556   GFIFLSGTSMSCPHVAGIAALIKSKHPTWSPAAIRSALVTTASQSGTD-GGLISEGSTNK  614

Query  680   AADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEE  501
             AAD FD GGG V+PN A + GL+Y++   DY  +LC++G+N + I K          T+ 
Sbjct  615   AADPFDMGGGHVDPNKAINAGLIYNITTEDYIHFLCSMGHNTASIRKV---------TKT  665

Query  500   HTICPKT-RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVK  324
              T C K  R ++L+LNLPS+ +P+L +  T+ RT+TNVG +N VYKAIVKSP G  V V+
Sbjct  666   TTSCNKQKRQALLNLNLPSISIPNLKRDTTVMRTLTNVGNINVVYKAIVKSPYGIKVRVE  725

Query  323   PKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
             P++L+F+   K  +F +   + + ++  + FGSLTW+DG H VR PIAVR +
Sbjct  726   PQILKFNSENKVLTFNVSFISTQKLHGDYRFGSLTWTDGNHFVRIPIAVRTI  777



>ref|XP_006399712.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
 gb|ESQ41165.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
Length=752

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/753 (43%), Positives = 457/753 (61%), Gaps = 49/753 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YIVY+G + HDD   +  SH D+L  ++GS + A +AM ++YR+GFSGFAA LT SQ 
Sbjct  35    KVYIVYMGERKHDDPELVTASHLDMLESLLGSKKAASEAMTHTYRHGFSGFAAHLTDSQV  94

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++    VVSV  + H++ QT+R +D+LGLS+  ++P  L      G+ +I+GV DSG+
Sbjct  95    KKISEHPDVVSVTPNGHYEPQTTRMFDYLGLSQ--SIPKGLFHDAKMGEDVIIGVFDSGV  152

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E P F D G+GP+P RWKG C    G  F   + CN+K+IGAR +     +S      
Sbjct  153   WPESPMFSDKGLGPIPSRWKGHCE--DGQEFEAKKHCNKKLIGARTYKPQVKISD-----  205

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                 S+  S     GHG  VASI  G+FVPN +  G  VG VRG A  AR+A YK CW  
Sbjct  206   ----SEYMSPRSKDGHGIHVASIAVGNFVPNVSDSGFGVGTVRGAAPKARLAIYKVCW--  259

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               E   CA  D+L A+D AI D VDV+++S+G P+P+ ++++  N IG G+FHAI++GI 
Sbjct  260   IKEDGSCAFTDILKAMDDAIADGVDVMTLSIGRPIPVFNEVDEGNIIGYGAFHAISKGIT  319

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPN-GTALS  1317
             V+  AGN GP  +++ N+ PW+ITV A+TIDR +   +TLGN E   +  ++P+    + 
Sbjct  320   VVACAGNTGPEGYSVLNIAPWIITVGATTIDRWYPTPLTLGNNE--TLMGRIPSRDKEVQ  377

Query  1316  HPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMF----GDDLDRNLVLVDKATDAGAVGVI  1149
               L +A        +  R +      GK+V  F    GD  +  L     AT A A GVI
Sbjct  378   AGLMYA--------MFARDITKESAMGKVVLAFIVKNGDAKNDYLT---SATHAQARGVI  426

Query  1148  YSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
             +++  N D +    A I  +++DY+ GT +  YI QST +PT ++       G  +  KV
Sbjct  427   FASRRN-DVITFSEALI-ILEIDYEQGTTMLKYI-QSTSSPTIKVGRSVRVTGPVIATKV  483

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDG---GFRISSGTSHAAPHVSAIVA  801
              +FS RGP+S +P ++KPD+ APG  I+ A +P   G   G+   +GTS A P V+ +VA
Sbjct  484   AEFSGRGPNSVSPSVLKPDVVAPGVAILAASNPNIMGHEDGYFTETGTSMATPAVAGVVA  543

Query  800   LLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDP  621
             LLK  HP+WSPAAI+SAL+TTA  +D Y  PIFA G S R A+ FDYGGG+V+PN A DP
Sbjct  544   LLKAVHPDWSPAAIRSALITTASTTDPYGEPIFADGLSQRQANPFDYGGGLVSPNKAADP  603

Query  620   GLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMV  441
             GLVYD    DY ++LCA  YN  +I K          ++    CP T+PS+ +LNLPS+ 
Sbjct  604   GLVYDADAEDYRRFLCASDYNEGIIAKL---------SQTTYKCPTTKPSVFELNLPSIT  654

Query  440   VPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA  261
             +P L + VTL RTVTNVGPV+S+YK +V+ P+G  ++V P  L+F+ + KK S+ + VS 
Sbjct  655   IPFLKEDVTLTRTVTNVGPVDSLYKLVVEPPLGIKISVTPNTLQFNSSVKKLSYKVTVST  714

Query  260   DKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
                 NS + FG LTW+DG HNV  P+++R  I+
Sbjct  715   THKANSIYYFGRLTWTDGSHNVTIPLSIRTEIL  747



>ref|NP_568255.1| Subtilase family protein [Arabidopsis thaliana]
 gb|ABE66153.1| subtilase family protein [Arabidopsis thaliana]
 gb|AED91742.1| Subtilase family protein [Arabidopsis thaliana]
Length=762

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/753 (43%), Positives = 461/753 (61%), Gaps = 40/753 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H+D   +  SH  +L  ++GS ++A +++V+SYR GFSGFAA LT SQA
Sbjct  36    KVHIVYLGEKEHNDPELVTSSHLRMLESLLGSKKDASESIVHSYRNGFSGFAAHLTDSQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++    VV V  +  +++QT+R++D+LGLS   + P  LL +   G+ +I+GV+DSG+
Sbjct  96    EQISEHPDVVQVTPNTFYELQTTRTFDYLGLSH--STPKGLLHEAKMGEDIIIGVLDSGV  153

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG C  + G  F+  + CN+K+IGAR++          D +
Sbjct  154   WPESQSFNDKGLGPIPKRWKGMC--VDGEDFDSKKHCNKKLIGARYYMDSLFRRNKTD-S  210

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                 ++  S  +   HG+ VAS   GSFV N +  G  VG +RGGA  AR+A YK CW  
Sbjct  211   GIPDTEYMSARESLPHGTHVASTAGGSFVSNVSDNGFGVGTIRGGAPRARIAVYKVCWQR  270

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   CA AD++ A+D AI D VD+I++S+G P P+ ++++  N I  G+FHA+ +GIP
Sbjct  271   VDR--TCASADIIKAMDDAIADGVDLITISIGRPNPVLTEVDVYNQISYGAFHAVAKGIP  328

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP A+T+ N+ PW+ITVAA+T+DR +   +TLGN           N T ++ 
Sbjct  329   VLSAGGNFGPGAYTVQNIAPWIITVAATTLDRWYPTPLTLGN-----------NVTLMAR  377

Query  1313  PLHFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLV-LVDKATDAGAVGVI  1149
               +   +  G  DLM    P ++  A  KGK+V  F    + +    V K     A  VI
Sbjct  378   TPYKGNEIQG--DLMFVYSPDEMTSA-AKGKVVLTFTTGSEESQAGYVTKLFQVEAKSVI  434

Query  1148  YSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
              +   N D + + +  +P + VDY+ G+ I  Y+  + M PT ++SS     GR +  KV
Sbjct  435   IAAKRN-DVIKV-SEGLPIIMVDYEHGSTIWKYLSITRM-PTIKISSAIALNGRLVATKV  491

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PTSDG---GFRISSGTSHAAPHVSAIVA  801
              DFS RGP+S +P ++KPD+AAPG  I+ A  P S G   GF I SGTS + P V+ +VA
Sbjct  492   ADFSGRGPNSISPYVLKPDVAAPGVAIVAASTPESMGTEEGFAIQSGTSMSTPVVAGLVA  551

Query  800   LLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDP  621
             LL+  HP+WSPAA+KSAL+TTA  +D Y  PIF++G + + AD FD+GGG+VNPN A DP
Sbjct  552   LLRAVHPDWSPAALKSALITTASTTDPYGEPIFSEGMTRKLADPFDFGGGLVNPNKAADP  611

Query  620   GLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMV  441
             GLVYD+   DY  +LCA  Y+   I K        S T     CP  +PSMLDLNLPS+ 
Sbjct  612   GLVYDISAEDYRLFLCASHYDEKQITKI-------SKTHTPYRCPSPKPSMLDLNLPSIT  664

Query  440   VPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA  261
             +P L + VTL RTVTNVGPV+SVYK IV+ P+G  ++V P  L F+ N K  S+ + VS 
Sbjct  665   IPFLKEDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVKILSYKVTVST  724

Query  260   DKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
                 NS + FGSLTW+DG H V  P++VR  ++
Sbjct  725   THKSNSIYYFGSLTWTDGSHKVTIPLSVRTQML  757



>ref|XP_010480961.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/753 (43%), Positives = 470/753 (62%), Gaps = 42/753 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H+D   +  SH  +L  ++GS ++A +++V+SYR+GFSGFAA LT +QA
Sbjct  23    KVHIVYLGEKEHNDPELVTASHLSMLESLLGSKKDASESIVHSYRHGFSGFAAHLTDAQA  82

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++    VV V  + ++++QT+R++D+LGLS   + P  LLR    G+ +I+GV+DSG+
Sbjct  83    KKISEHPNVVQVTPNTYYELQTTRTFDYLGLSH--STPKGLLRDAKMGEDIIIGVLDSGV  140

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+PQRWKG C  + G  F+  + CNRK+IGAR++ +        D +
Sbjct  141   WPESESFNDKGLGPIPQRWKGMC--VDGEDFDSKKHCNRKLIGARYYMESLFRKNKTD-S  197

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN-  1677
             +   ++  S  +   HG+ VAS   GSFV N +  G  VG +RGGA  AR+A YK CW  
Sbjct  198   RIPDTEYMSAREALPHGTHVASTAGGSFVSNVSVNGFGVGTIRGGAPGARIAVYKVCWQR  257

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +D     CA A+++ A+D AI D VD+I++S+G P P  ++++  N I  G+FHA+  GI
Sbjct  258   VDGS---CASAEIIKAMDDAIADGVDLITISIGRPNPTLTELDLYNQISYGAFHAVANGI  314

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ A GN GP  +++ N+ PW+ITVAA+++DR ++  +TLGN           N T ++
Sbjct  315   PVLSAGGNYGPDDYSVQNIAPWIITVAATSLDRWYSTPLTLGN-----------NMTLMA  363

Query  1316  HPLHFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI  1149
                 + GK + +A+LM      ++  A  KGK+V  F  + +     V   ++  A G+I
Sbjct  364   RSA-YKGKEI-QAELMFVYSANEMTSA-AKGKVVLAFPTESELT-DYVSNLSNVQAEGLI  419

Query  1148  YSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
             ++     D L + +  I  + VDY+ G+ +  YI ++T +PT ++SS     G  +  KV
Sbjct  420   FATKRE-DDLKV-SEGIAMITVDYEQGSTMFKYI-RTTSSPTIKISSAVTLNGPLVATKV  476

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT----SDGGFRISSGTSHAAPHVSAIVA  801
              +FS RGP+  +P ++KPDIAAPG  I+ A       ++ GF   SGTS A P V+ +VA
Sbjct  477   AEFSGRGPNPVSPYVLKPDIAAPGVGIVAASTPEKMGAEEGFYAESGTSMATPVVAGLVA  536

Query  800   LLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDP  621
             LL+  HP+WSPAA+KSALVTTA  +D Y  PIF++G + + AD FD+GGG+V+PN A DP
Sbjct  537   LLRAVHPDWSPAALKSALVTTASKTDPYGEPIFSEGLTRKLADPFDFGGGLVSPNKAADP  596

Query  620   GLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMV  441
             GLV+D    DY  +LCA  Y+   I K      +R++T     CP  RPSMLDLNLPS+ 
Sbjct  597   GLVFDAGAEDYRLFLCASNYDEMHITKI-----SRTNTLYR--CPSPRPSMLDLNLPSIT  649

Query  440   VPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA  261
             +P L + VTL RTVTNVGPV+SVYK IV+ P+G  ++V P  L F+ N KK SF + VS 
Sbjct  650   IPFLKEDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVKKISFKVTVST  709

Query  260   DKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
                 NS + FGSLTW+DG HNV  P++VR  ++
Sbjct  710   THKSNSIYYFGSLTWTDGSHNVTIPLSVRTQML  742



>ref|XP_006397047.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
 gb|ESQ38500.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
Length=723

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/738 (45%), Positives = 451/738 (61%), Gaps = 34/738 (5%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++GS E+A  +MVYSYR+GFSGFAA LT SQAKK+A +  VV V  D  +++ T+R
Sbjct  1     MLWSLLGSKEDAHDSMVYSYRHGFSGFAAKLTNSQAKKIADLPEVVHVTPDSFYELATTR  60

Query  2141  SWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCR  1962
             +WD+LGLS  A  P  LL  TN G+ +I+G+VD+G+  E   F D G+GPVP  WKG C 
Sbjct  61    TWDYLGLS--AANPKNLLNDTNMGEEVIIGIVDTGVWPESEVFNDNGIGPVPSHWKGGCE  118

Query  1961  AIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIV  1782
             +  G  FN S  CN+K+IGA++F   A L+     N     D  S  D  GHG+ VA+I 
Sbjct  119   S--GEMFNSSH-CNKKLIGAKYFIN-AFLATYESFNSTESLDFISPRDFDGHGTHVATIA  174

Query  1781  AGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDP-ERFVCAGADLLAAIDYAIHDR  1605
              GS +P+ +  G+  G VRGGA  AR+A YKACW LD  +   C+ ADLL A+D AIHD 
Sbjct  175   GGSALPSISYKGLAGGTVRGGAPRARIAMYKACWYLDSLDITTCSSADLLKAMDEAIHDG  234

Query  1604  VDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVI  1425
             VDV+S+S+G  VP   + +  +GI  G+FHA+ +GI V+ + GN+GP+A T+ N  PW++
Sbjct  235   VDVLSLSIGYRVPFYPETDIRDGIATGAFHAVLKGITVVCSGGNSGPAAQTVGNTAPWIL  294

Query  1424  TVAASTIDRIFAYTITLGNGEKYAVDWQLPNG-----TALSHPLHFAGKYMGEADLMPRK  1260
             TVAA+T+DR F   ITLGN  K  +   +  G     T+L +P +        +    R 
Sbjct  295   TVAATTLDRSFPTPITLGN-NKVILGQAMYTGPELGFTSLVYPENPGNSNESFSGTCERL  353

Query  1259  LDPAEVK--GKIVFMFGDDLDRNLV--LVDKATDAGAVGVIYS-NPSNVDSLPILNARIP  1095
             L  + +   GK+V  F      + V         AG +GVI + NP   D+L       P
Sbjct  354   LINSNLTMAGKVVLCFTTSKRYSAVSSAARYVKRAGGLGVIIARNPG--DTLAPCVDDFP  411

Query  1094  YVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKP  915
              V VDY+ GT I  YI +ST +   ++   +  VG+ +  KV +FSSRGPSS  P I+KP
Sbjct  412   CVTVDYELGTNILLYI-RSTGSSVVKIQPSRTLVGQPVGTKVAEFSSRGPSSVTPAILKP  470

Query  914   DIAAPGDKIMCADPTS----DGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSAL  747
             DIAAPG  I+ A  T+    D GF + SGTS AAP +S +VA LK  H  WSPAAI+SA+
Sbjct  471   DIAAPGVSILAATSTNSTFNDRGFIMLSGTSMAAPVISGVVAFLKARHRNWSPAAIRSAI  530

Query  746   VTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCAL  567
             VTTAW +D +   IFA+GS  + AD FDYGGG+VNP  A  PGLVYD+   DY  Y+C++
Sbjct  531   VTTAWRTDPFGEKIFAEGSPRKLADPFDYGGGLVNPEKAAKPGLVYDLGLEDYILYMCSV  590

Query  566   GYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVG  387
             GYN S I +  S         + T+C   RPS+LD NLPS+ +P+L    TL R +TNVG
Sbjct  591   GYNESAISQLAS---------KKTLCSNPRPSVLDFNLPSITIPNLKDEATLTRILTNVG  641

Query  386   PVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDG  207
             P++SVYK  V++P+G  VTV P+ L F+   K+ SF ++VS    +N+ + FGSLTWSD 
Sbjct  642   PLDSVYKVAVEAPLGVQVTVTPEKLVFNSTTKRVSFKVKVSTTHKINTGYYFGSLTWSDS  701

Query  206   VHNVRTPIAVRKMIVPLY  153
             VHNV  P++VR  I+  Y
Sbjct  702   VHNVTIPLSVRTQILQNY  719



>emb|CDY07492.1| BnaA07g25710D [Brassica napus]
Length=757

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/749 (44%), Positives = 465/749 (62%), Gaps = 32/749 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IV+LG K HD    + +SHY +L  ++GS E A+K++VY+Y++GFSGFAA LTASQA
Sbjct  40    KVHIVHLGAKKHDTPELVTKSHYQILEPILGSKEAAQKSIVYNYKHGFSGFAAKLTASQA  99

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++    V+ V+  +  +++T+R++D+L L   +  P  LL  T  G   I+G++DSGI
Sbjct  100   KNLSAHPEVLCVIPSRTLRLKTTRAFDYLRLLPSS--PKGLLHDTRLGSEAIIGIIDSGI  157

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+PQRWKG C  + G  F+ S+ CN+K+IGA  F+  +L ++     
Sbjct  158   WPESESFKDTGLGPIPQRWKGKC--VSGDGFDASKHCNKKLIGAE-FYVDSLAAETNGQY  214

Query  1853  KFLVSDSY-SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
              F   + Y S  D AGHG+ V++I AGSFV NA+  G+  G  RG    AR+A YK CW 
Sbjct  215   DFHAENEYRSARDGAGHGTHVSAIAAGSFVANASYKGLGGGTARGVGPHARIAMYKTCWG  274

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                 +  C   D+L AID++I D VDVIS+S+G+  P   +++  + +  GSFHA+ +GI
Sbjct  275   ----KLGCLTPDVLKAIDHSIRDGVDVISISIGADAPAGFEIDTSD-VSFGSFHAVMKGI  329

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ +AGN GP+A T+ NV PW+ITVAA+++DR F   ITLGN         L  G    
Sbjct  330   PVVCSAGNEGPNAQTVDNVAPWIITVAATSMDRSFPIPITLGNNITI-----LGEGLNTF  384

Query  1316  HPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNP  1137
               + F    + E +LM   +   ++KGKIV  F  + +  +   D+  +A   G+IY+  
Sbjct  385   PEVGFTDLLLQE-ELMETSIAQGQIKGKIVLAFTPN-NEAIQKADRVLNAECAGIIYAQ-  441

Query  1136  SNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFS  957
             S VD        +P   VDY+ GT +  YI ++T  P A+LS+ K  VGR +  +V  FS
Sbjct  442   SVVDPTVCSGLDVPCAVVDYEFGTDMLYYI-ETTDVPLAKLSTSKTLVGRPVASRVARFS  500

Query  956   SRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHPE  777
              RGP+S +P I+KPDIAAPG  I+ A P    G++  SGTS + P VS IV L++ + P+
Sbjct  501   CRGPNSVSPAILKPDIAAPGVNILSAVPD---GYKFMSGTSMSTPIVSGIVGLIRQTRPD  557

Query  776   WSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRG  597
             WSPAAI+SALVTTAW +D    PIF++G++ + AD FDYGGG++NP    DPGLVYDM  
Sbjct  558   WSPAAIRSALVTTAWRTDPSGEPIFSEGATRKLADPFDYGGGLINPEKVTDPGLVYDMGL  617

Query  596   IDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPV  417
              DY  YLC+  Y+++ I K I G  N+        CP  RPSMLDLN+PS+ +P L   V
Sbjct  618   DDYIHYLCSADYSDNEISKLI-GKPNQ--------CPSPRPSMLDLNMPSITIPSLTGEV  668

Query  416   TLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAF  237
             T+ RTVTNVGP +SVYK +++ P G  + V PK L F  N  K +F++RV ++  VN  F
Sbjct  669   TVTRTVTNVGPADSVYKPVIEPPFGIELEVNPKTLVFGSNTTKNTFSVRVRSNHQVNGDF  728

Query  236   TFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
              FGSL W+DG HNV  P+++R  I+  Y+
Sbjct  729   YFGSLCWTDGAHNVTIPVSIRTKILRNYV  757



>ref|XP_003524182.2| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Glycine 
max]
Length=793

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/754 (44%), Positives = 460/754 (61%), Gaps = 33/754 (4%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             ++IVY+G K + + +  K  H+ +L+ ++GS E A+ +++YSY++GFSGFAA LT  QA+
Sbjct  57    VHIVYMGDKIYQNPQTTKMYHHKMLSSLLGSKEAAKNSILYSYKHGFSGFAARLTKYQAE  116

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
              +A   GVVSV+ +  HK+ T+RSWDF+G+    +        +N G+G I+GV+D+GI 
Sbjct  117   AIAKFPGVVSVIPNGIHKLHTTRSWDFMGVHHSTSKIA--FSDSNLGEGTIIGVIDTGIW  174

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
              E PSF D  MG +P RWKG C+   G  FN +  CN+K+IGARWF KG +  Q   L +
Sbjct  175   PESPSFNDEAMGQIPSRWKGICQG--GKHFNSTN-CNKKIIGARWFMKG-ISDQTKKLLQ  230

Query  1850  FLVSDSY-SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                SD Y S  D  GHG+  AS  AG FV NA   G+  G+ RGGA  A +A YKACW+ 
Sbjct  231   GNNSDEYLSARDAIGHGTHTASTAAGYFVGNANYRGLASGLARGGAPLAHLAIYKACWDF  290

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   C  AD+L A D AIHD VDV++VS+G  +PL S ++  + + IGSFHA ++GI 
Sbjct  291   PIGD--CTDADILKAFDKAIHDGVDVLTVSLGFAIPLFSYVDQRDSLAIGSFHATSKGIT  348

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEK---YAVDWQLPN---  1332
             V+ +AGN+GP + T+TN  PW+ITV A+TIDR F   ITLGN       ++D    N   
Sbjct  349   VVCSAGNSGPVSQTVTNTAPWIITVGATTIDRAFPAAITLGNNRTVWGQSIDMGKHNLGS  408

Query  1331  -GTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVD-KATDAGAV  1158
              G   S  +          D     L+     GKIV  F     +++V       +AG V
Sbjct  409   VGLTYSERIAVDPSDNLAKDCQSGSLNATMAAGKIVLCFSVSDQQDIVSASLTVKEAGGV  468

Query  1157  GVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALT  978
             G++Y+   + D L    +  P ++VDY+ GT+   YI +S   PTA LS PK  +G+  +
Sbjct  469   GLVYAQ-YHEDGLNQCGS-FPCIKVDYEVGTQTLTYIRRSRF-PTASLSFPKTVIGKWTS  525

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISSGTSHAAPHVSA  810
             P+V  FSSRGPSS +P ++KPDIAAPG  I+ A P    T   GF   SGTS + PHV+ 
Sbjct  526   PRVASFSSRGPSSMSPTVLKPDIAAPGVDILAAFPPKGTTRSSGFAFLSGTSMSCPHVAG  585

Query  809   IVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAA  630
             I AL+K  HP WSPAAI+SALVTTA  + T  S I  +GS+ +AAD FD GGG V+PN A
Sbjct  586   IAALIKSKHPTWSPAAIRSALVTTASQTGTDGSLISEEGSTHKAADPFDIGGGHVDPNKA  645

Query  629   DDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLP  450
              DPGL+YD+   DY Q+LC++G++++ I K          T+  T C K +   L+LNLP
Sbjct  646   MDPGLIYDITTEDYVQFLCSMGHSSASISKV---------TKTTTSCKKGKHQTLNLNLP  696

Query  449   SMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMR  270
             S++VP+L +  T+ RTVTNVG + +VYKA++K P G  V V+P+ L F+ + +  +F++ 
Sbjct  697   SILVPNLKRVATVMRTVTNVGNITAVYKALLKVPYGIKVRVEPQTLSFNSDARILNFSVS  756

Query  269   VSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
               + +  +  + FGSLTW+DG + VRTPIAVR +
Sbjct  757   FLSTQKFHGDYKFGSLTWTDGKYFVRTPIAVRTI  790



>emb|CDX82843.1| BnaC01g12930D [Brassica napus]
Length=766

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/770 (42%), Positives = 468/770 (61%), Gaps = 73/770 (9%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGV------------VGSHEEARKAMVYSYRYGF  2250
             K+YIVYLG + HDD   +  SH+ +L  +            +   EEA  +M+YSY++GF
Sbjct  41    KVYIVYLGEREHDDPELVTASHHQMLESLHERNSSRLCFFFIFFKEEAHNSMIYSYQHGF  100

Query  2249  SGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSE------GANVPGELL  2088
             SGFAA+LT+SQAKK++    V+ V+ ++  K++T+R+WD LGL +       ++V G LL
Sbjct  101   SGFAALLTSSQAKKISENPSVIHVIPNRIVKLKTTRTWDHLGLYQVPTSSSPSSVKG-LL  159

Query  2087  RKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVI  1908
              +TN G   I+G++D+GI  E   F D G GP+P+RW+G C +  G  FN +  CN K+I
Sbjct  160   NETNMGSDAIIGLLDTGIWPESEVFNDQGFGPIPKRWRGKCES--GEDFNATVHCNNKLI  217

Query  1907  GARWFFKGALLSQDVDLNKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDV  1737
             GA+++ KG ++++     K++ ++S    S  D  GHG+  A+I  GSFV NA+  G+  
Sbjct  218   GAKYYQKG-MMAEIRGKRKYMATESREFKSNRDAIGHGTHTATIAGGSFVSNASFYGLAQ  276

Query  1736  GMVRGGATAARVASYKACWNLDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLA  1560
             G VRGGA  AR+ASYK CW+L    F+ C+  D+  A D AIHD VDV+SVS+G  VP  
Sbjct  277   GTVRGGAPRARIASYKVCWDL---FFLGCSIVDMWKAYDDAIHDGVDVLSVSLGGNVPEG  333

Query  1559  SDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTI  1380
             S+++  + +   +FHA+ +GIPV+ AAGN GP+A ++ NV PW +TVAA+T+DR F   I
Sbjct  334   SEVDQVDFVA--AFHAVAKGIPVVAAAGNDGPNAQSVINVAPWFLTVAATTLDRSFPTKI  391

Query  1379  TLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDR  1200
             TLGN + +  +  L  G  ++  L F   Y         + +  ++KGK V +F   + +
Sbjct  392   TLGNNQTFYAE-SLFTGPDITTGLAFLESY---------RHNTTDMKGKTVLVFNKPVSK  441

Query  1199  NLVLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTA  1020
                        G   VI +      S+P  +   PY+   Y+ G  I  YI ++T +P  
Sbjct  442   E----------GLAAVILAQ-----SVP--DESYPYILTSYEHGADILQYI-RTTRSPIV  483

Query  1019  QLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFR  852
             ++S+     G     KV  FSSRGP+S +P I+KPDIAAPG  I+ A    DP S  GF 
Sbjct  484   RISAATTLTGPPAAAKVVVFSSRGPNSVSPAILKPDIAAPGVNILAALSPLDPDSHKGFG  543

Query  851   ISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAAD  672
             + SGTS + P VS I ALLK  HP+WSPAAI+SALVTTAW +     PIFA+GS+ + AD
Sbjct  544   LLSGTSMSTPVVSGITALLKCLHPDWSPAAIRSALVTTAWRTSKSGEPIFAEGSNKKLAD  603

Query  671   AFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTI  492
              FDYGGG+VNP +A DPGLVYDM   DY  Y+C+ GYN++ I + +    N         
Sbjct  604   PFDYGGGLVNPESAADPGLVYDMGIKDYISYMCSAGYNDTSISRVLGKKTN---------  654

Query  491   CPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVL  312
             CP    S+LD+N+PS+ +P+L + VTL RT+TNVGP NSVYKA+++SP+G  +TV P  L
Sbjct  655   CPSPGASILDINVPSITIPNLDQEVTLTRTLTNVGPNNSVYKAVIESPLGVTLTVSPTTL  714

Query  311   RFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
              FD   +  S+ +       VN+ + FGSLTW+DGVH+VR P++V+  I+
Sbjct  715   VFDSG-EVLSYAVTAKTSHKVNTGYFFGSLTWTDGVHDVRIPVSVQTTIM  763



>emb|CDX98690.1| BnaA03g44750D [Brassica napus]
Length=696

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/738 (44%), Positives = 445/738 (60%), Gaps = 63/738 (9%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L   + S E+  K+M+YSY++GFSGFAA+LT+SQA K++    V+ V+ ++  K+QT+R
Sbjct  1     MLESFLDSKEDTHKSMIYSYQHGFSGFAALLTSSQANKISDHPEVIHVIPNRILKLQTTR  60

Query  2141  SWDFLGLSE--------GANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVP  1986
             +WD L LS+          +V G LL  TN G   I+GV+D+GI  E   F D G+GP+P
Sbjct  61    TWDLLELSQIPTSFSSSTTSVKG-LLHDTNMGSEAIIGVIDTGIWPESKVFNDQGLGPIP  119

Query  1985  QRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGH  1806
             +RW+G C   PG  FN +  CN+K+IGA+++  G L           V +  S  D  GH
Sbjct  120   KRWRGKCE--PGENFNATIHCNKKLIGAKYYVNGLLAEMGETFKTTTVREFKSNRDALGH  177

Query  1805  GSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFV-----CAGAD  1641
             G+  A+I  GS VPN +  G+  G VRGGA  AR+ASYK CWN   +        C+ AD
Sbjct  178   GTHTATIAGGSLVPNVSFYGLARGTVRGGAPQARIASYKVCWNTMQKDGTGPGGSCSTAD  237

Query  1640  LLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPS  1461
             +L A D AIHD VDV+SVS+   +P   D E +    +G+FHA+++GIPV+ AA N G  
Sbjct  238   MLKAFDDAIHDGVDVLSVSISGDLP--EDTEVDKPDFVGAFHAVSKGIPVVAAASNEGRK  295

Query  1460  AFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGE  1281
             A T+ N  PW++TVAA+T+DR F   ITLGN +    +  L  G  +S  L +   +  E
Sbjct  296   AQTVANAAPWLLTVAATTLDRSFPTKITLGNKQTLFGE-SLFTGPEISTGLAY---WDSE  351

Query  1280  ADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNPSNVDSLPILNAR  1101
             +D      D  +VKGKIV +F  D      +  K    G  GVIY+   + D +      
Sbjct  352   SD------DNGDVKGKIVLVF--DTTSTYPVETK----GVAGVIYAQ--HPDDIVDRCHA  397

Query  1100  IPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIM  921
              P +  DYD GT I  YI ++T +PTA++S+     G   T KV +FSSRGP+S +P I+
Sbjct  398   FPCIYTDYDLGTDILQYI-RTTRSPTARISAATTLTGLPATTKVAEFSSRGPNSVSPAIL  456

Query  920   KPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKS  753
             KPDIAAPG  I+ A    DP    GF ++SGTS + P VS I+ALLK  HP+WSPAA +S
Sbjct  457   KPDIAAPGVSILAALSPFDPNGHDGFGLASGTSMSTPVVSGIIALLKSLHPDWSPAAFRS  516

Query  752   ALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLC  573
             ALVTTAW +     PIFA+GS+ + AD FDYGGG+VNP  A  PGLVYDM   DY  Y+C
Sbjct  517   ALVTTAWRTSPSGEPIFAEGSNKKLADPFDYGGGLVNPQRAAHPGLVYDMGIEDYINYMC  576

Query  572   ALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTN  393
             + GYN+S I                     +RPS+LD+NLPS+ +P++ K VTL R+VTN
Sbjct  577   SKGYNDSSI---------------------SRPSILDMNLPSITIPNIEKEVTLTRSVTN  615

Query  392   VGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK-RSFTMRVSADKLVNSAFTFGSLTW  216
             VGP+ SVYKA+++SP+G  +TV P  L F    KK  SFT++      VN+ + FGSLTW
Sbjct  616   VGPIKSVYKAVIESPLGITLTVHPTTLVFSSEDKKVLSFTVKAKTSHKVNTGYFFGSLTW  675

Query  215   SDGVHNVRTPIAVRKMIV  162
             +DGVH+V+ P++V+  I+
Sbjct  676   TDGVHDVKIPVSVQTRIM  693



>emb|CDY49640.1| BnaCnng17920D [Brassica napus]
Length=757

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/750 (43%), Positives = 465/750 (62%), Gaps = 32/750 (4%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
              K++IV+LG K HD    + +SHY +L  ++GS E A+K++VY+YR+GFSGFAA LTASQ
Sbjct  39    NKVHIVHLGAKKHDTPELVTKSHYQVLEPILGSKEAAQKSIVYNYRHGFSGFAAKLTASQ  98

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AK ++    V+ V+  +  +++T+R++D+LGL   +  P  LL  T  G   I+G++DSG
Sbjct  99    AKNLSAHPEVLCVIPSRTLRLKTTRTFDYLGLLPSS--PKGLLHDTRLGSEAIIGIIDSG  156

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+GP+PQRWKG C  + G  F+ ++ CN+K+IGA  F+  +L ++    
Sbjct  157   IWPEAESFKDTGLGPIPQRWKGKC--VSGDGFDATKHCNKKLIGAE-FYVDSLAAETDGR  213

Query  1856  NKFLVSDSY-SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
               F   + Y S  D  GHG+ V++I AGSFV NA+  G+  G  RG    AR+A YK CW
Sbjct  214   YDFHADNEYRSARDGVGHGTHVSAIAAGSFVANASYKGLGGGAARGVGPHARIAMYKTCW  273

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
                  +  C   D+L AID++I D VDVIS+S+G+  P   +++  + +  GSFHA+ +G
Sbjct  274   G----KLGCLTPDVLKAIDHSIRDGVDVISISIGADAPAGFEIDTSD-VSFGSFHAVMKG  328

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             IPV+ +AGN GP+A T+ N+ PW+ITVAA+++DR F   ITLGN         L  G   
Sbjct  329   IPVVCSAGNEGPNAQTVDNIAPWIITVAATSMDRSFPVPITLGNNITI-----LGEGLNT  383

Query  1319  SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSN  1140
                + F    + +A+LM   +   ++KGKIV  F  + +  +   D+  +AG  G+IY+ 
Sbjct  384   FPEVGFTDLLL-QAELMETSIAQGQIKGKIVLAFTPN-NEAIQKADRVLNAGCAGIIYAQ  441

Query  1139  PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDF  960
              S VD        +P   VDY+ GT +  YI ++T  P A+LS+ K  VGR +  +V  F
Sbjct  442   -SVVDPTICSGLDVPCAVVDYEFGTDMLYYI-ETTDVPLAKLSTSKTLVGRPVASRVARF  499

Query  959   SSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHP  780
             S RGP+S +P I+KPDIAAPG  I+ A P    G++  SGTS + P VS IV L++ + P
Sbjct  500   SCRGPNSVSPAILKPDIAAPGVNILSAVPD---GYKFMSGTSMSTPIVSGIVGLIRQTRP  556

Query  779   EWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMR  600
             +WSPAAI+SALVTTAW +D    PI+++G++ + AD FDYGGG++NP    DPGLVYD+ 
Sbjct  557   DWSPAAIRSALVTTAWRTDPSGEPIYSEGATRKLADPFDYGGGLINPEKVTDPGLVYDLG  616

Query  599   GIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKP  420
               DY  YLC+  Y+++ I + I G  N+        CP  RPSMLD N+PS+ +P L   
Sbjct  617   LDDYIHYLCSADYSDNEISQLI-GKLNQ--------CPSPRPSMLDFNMPSITIPSLTGE  667

Query  419   VTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSA  240
             VT+ RTVTNVG   SVYK +V+ P G  + V PK L FD N  K +F++RV ++  VN  
Sbjct  668   VTVTRTVTNVGAAGSVYKPVVEPPFGIELEVNPKTLVFDSNTTKNTFSVRVRSNHKVNGD  727

Query  239   FTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             F FGSL W+DG HNV  P+++R  I+  Y+
Sbjct  728   FYFGSLCWTDGAHNVTIPVSIRTKILRNYV  757



>ref|XP_010538146.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=821

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/752 (44%), Positives = 469/752 (62%), Gaps = 44/752 (6%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             ++I YLG +   D + + +SH  +L  V+GS EEA+KA++YSY  GFSGFAA L+   A+
Sbjct  102   VFIAYLGERKQPDPKLVTQSHLQMLTSVLGSEEEAKKALIYSYSNGFSGFAAKLSPPMAE  161

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             K+  + GVV V++++  ++QT+R+WD+LGL   ++    LLR TN G   I+G++DSG+ 
Sbjct  162   KINDLPGVVFVMKNRFLQMQTTRTWDYLGLLPSSSQ--GLLRNTNMGSEAIIGIIDSGVW  219

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
              E  +F D   GP+P+ W+G C  + G  F+ +  CN+K+IGAR++  G +       N+
Sbjct  220   PESEAFHDKDFGPIPKHWRGEC--VGGEGFDPAVHCNKKLIGARYYMDGLIAKLGGQYNQ  277

Query  1850  FLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLD  1671
              L  D  SG D  GHG+QV+SI AGSFVPN +  G+  G  RGGA  AR+A+YKACWN +
Sbjct  278   SL--DFTSGRDGNGHGTQVSSIAAGSFVPNVSYPGVSGGTARGGAPCARIATYKACWNTN  335

Query  1670  PE-RFVCAGADLLAAIDYAIHDRVDVISVSVGSP-VPLASDMEAENGIGIGSFHAITRGI  1497
              E +  C  AD+  A D AI D VDV+SVS+GS  +P+ +++E      +  FHA+ +GI
Sbjct  336   GEGQGQCTVADVWKAFDDAIGDGVDVLSVSIGSGFLPMDTELE----FALAGFHAVKKGI  391

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+  AGN+GP+ + + NV PW++TVAA+TIDR F+ ++TLGN   +        G  L 
Sbjct  392   PVVSPAGNSGPNRWMVGNVSPWILTVAATTIDRSFSVSLTLGNNMTFP-------GEGL-  443

Query  1316  HPLHFAGKYMGEADLMP----RKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI  1149
                 + G  +G + L       + D   V+G++V MF  +++          +   +GVI
Sbjct  444   ----YTGPEIGFSSLALLIGIAQDDRFLVEGQVVLMF-PEIEAEADYPTLTREGNGLGVI  498

Query  1148  YSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
             ++   N D +       P + V +D G  I  YI  +T +P  +++  K   G+ +  KV
Sbjct  499   FARRPN-DKIYECPESFPCIYVGFDVGNEILLYI-STTSSPKIKITPTKTLTGQPVQTKV  556

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDG---GFRISSGTSHAAPHVSAIVAL  798
                SSRGP+SF+P I+KPDIAAPG  ++ A P SD    GF + SGTS A P V+ IVAL
Sbjct  557   GKSSSRGPNSFSPEILKPDIAAPGLSLLSARPNSDNSSSGF-VFSGTSMATPVVAGIVAL  615

Query  797   LKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPG  618
             LK+SHP+WSPAAI+SA+VTTA  +D Y  PIFA GSS   AD FDYGGG+VNP  A +PG
Sbjct  616   LKVSHPDWSPAAIRSAIVTTAKKTDPYGEPIFADGSSTELADPFDYGGGLVNPEKAVEPG  675

Query  617   LVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVV  438
             LVYDM   DYAQYLC  GY++S +   +  +           CP   PS+LDLNLPS+ +
Sbjct  676   LVYDMGIDDYAQYLCYAGYSDSSLSAIVGKDAK---------CPSPLPSILDLNLPSITI  726

Query  437   PDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSAD  258
             PDL + VT+ RTVTNVGPV+SVYK ++ +P G  V V+P+ L F+ N KK  F+++VS  
Sbjct  727   PDLREDVTVTRTVTNVGPVDSVYKPLIDAPFGINVEVRPEALAFNLNTKKLGFSVKVSTT  786

Query  257   KLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
                N+ F FGSLTW+DG+HNV  P++VR  I+
Sbjct  787   HKANTGFYFGSLTWTDGIHNVTIPLSVRTQII  818



>ref|XP_006286458.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
 gb|EOA19356.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
Length=759

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/766 (45%), Positives = 464/766 (61%), Gaps = 57/766 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+Y+VY+G K HDD   + ESH+ LL  ++GS +    ++VYSY +GFSGFAA LT SQA
Sbjct  28    KVYVVYMGKKIHDDPESVTESHHQLLWPLLGSKKAVHGSIVYSYLHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ +  VV V  +  +++ T+R+WD+LG+S G +    LL +   G  +IVGV+D+G+
Sbjct  88    QQISELPNVVQVTANSLYELTTTRTWDYLGISPGNS--QSLLNEAKMGSPVIVGVIDTGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G GP+P RWKG C  + G  FN S  CNRK+IGA++F  G  ++++  LN
Sbjct  146   WPESEMFNDKGYGPIPSRWKGGC--VSGQSFNASINCNRKLIGAKYFVDG-YVAENGFLN  202

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D +GHG+ VAS + GSF+PN + LG+  G  RGGA    +A YKACW  
Sbjct  203   TTETPEYISPRDFSGHGTHVASTIGGSFLPNVSYLGLGQGTARGGAPGVHIAIYKACW--  260

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               +   C+ ADLL AID AIHD VDV+S+SVGS  PL  + + +    +G FHA+ +GI 
Sbjct  261   -LQGGTCSSADLLKAIDEAIHDGVDVLSLSVGSGFPLTIETDVQL-FAMGLFHAVEKGIH  318

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP A TI NV PW++TVAA+T+DR F  TITLGN           N T L  
Sbjct  319   VVASAGNNGPVAQTIGNVAPWILTVAATTLDRSFPTTITLGN-----------NITILGQ  367

Query  1313  PLHFAGKYMGEADLM----PRKLDPAEV---------KGKIVFMFGDDLD-RNLVLVDKA  1176
              + FA   +G  +L     P   D A +          GK+V  F  DL+ R+  +VD  
Sbjct  368   AI-FARPKLGFVNLTYPERPLSGDCASLANPNNAIAMNGKVVLCFTADLNPRSGAVVDAI  426

Query  1175  T---DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSS  1008
             T    AG +GVI + NP  V+    L    P V VD++ GT I  YI +S+ +P  ++ +
Sbjct  427   TAVSSAGGLGVIIARNPRWVNPTHTL----PCVTVDFELGTDILFYI-RSSSSPMVKIDA  481

Query  1007  PKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHA  828
             P+  V   +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A           SGTS A
Sbjct  482   PRTHVSHPVATKVAYFSSRGPNSISPTILKPDIAAPGVNILAAHKRE---VVFKSGTSMA  538

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P V+A+V LLK  +P WSP+AIKSA+VTTAW +D    PIFA+GSS + AD FDYGGG+
Sbjct  539   TPVVTAVVVLLKSLYPHWSPSAIKSAIVTTAWKTDPSGEPIFAEGSSRKLADPFDYGGGL  598

Query  647   VNPNAADDPGLVYDMRGIDYAQYLC-ALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
             +NP  A  PGLVYDM   DY  YLC A  +N+  I + + GN+          CP  + S
Sbjct  599   INPEKAARPGLVYDMTIDDYISYLCSAYNFNDGSISQVL-GNKKT--------CPNPKQS  649

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
             +LDLNLPS+ +PDL   VTL RTVTNVGP NS+YK ++ +P+G  +TV P  L F+    
Sbjct  650   VLDLNLPSITIPDLKDEVTLTRTVTNVGPFNSIYKVMIDAPLGVNMTVTPNTLEFNAMTT  709

Query  290   KRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             K SF +R S    VN+ + FGSLTW+D VHNV  P++VR  I+  Y
Sbjct  710   KVSFKVRFSTTHKVNTGYYFGSLTWTDNVHNVVIPVSVRTQILQRY  755



>ref|XP_007131421.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03415.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=775

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/765 (42%), Positives = 457/765 (60%), Gaps = 33/765 (4%)
 Frame = -3

Query  2423  NAKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSG  2244
             N+  +  +   ++IVY+G K H + +  K+ H  +L+ ++GS E A+ +++YSY++GFSG
Sbjct  27    NSVAISADTSSVHIVYMGDKIHQNPQLTKKYHNKMLSSLLGSKEAAKSSILYSYKHGFSG  86

Query  2243  FAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDG  2064
             FAA LT  QA+ +A   GVVSV+ +  HK+ T+RSWDF+G+    +     L  +N G+G
Sbjct  87    FAARLTKHQAEAIAKFPGVVSVIPNGIHKLHTTRSWDFIGIHH--STSKSALSNSNLGEG  144

Query  2063  MIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG  1884
              I+GV+D+GI  E  SF D GMG +P RWKG C+   G  FN +  CN+K+IGARWF KG
Sbjct  145   AIIGVIDTGIWPESASFNDEGMGQIPSRWKGVCQV--GEHFNSTN-CNKKIIGARWFLKG  201

Query  1883  ALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAAR  1704
                     L+    ++  S  D  GHG+  AS  AG+FV NA   G+  G+ RGGA  A 
Sbjct  202   ITDQTKKLLHGNNTNEYLSARDAIGHGTHTASTAAGNFVGNANYRGLASGLARGGAPLAH  261

Query  1703  VASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             +A YKACWN       C  AD+L A D AI+D VDV++VS+G  +PL S ++  + I IG
Sbjct  262   LAIYKACWNFPIGD--CTDADILKAFDKAIYDGVDVLTVSLGFSIPLFSYVDQRDVIAIG  319

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEK  1359
             SFHA  +GI V+ +AGN+GP + TITN  PW+ITV A+TIDR F   ITLGN     G+ 
Sbjct  320   SFHATAKGITVVCSAGNSGPLSQTITNTAPWIITVGATTIDRAFPAAITLGNNLTVWGQS  379

Query  1358  YAVDWQLPNGTALSHPLHFA---GKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVL  1188
                         L++    A    + + +A      L+     GKIV  F     +++V 
Sbjct  380   IDTGKHNLESVGLTYSERIALDSSENLAKA-CQSGSLNATMAAGKIVLCFSVSDQQDIVS  438

Query  1187  VDKAT-DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
                A  +AG VG++Y+   + D L       P ++VDY+ GT+I  YI +S   PTA LS
Sbjct  439   ASLAVKEAGGVGLVYAQ-YHEDGLNQC-GLFPCIKVDYETGTQILTYIRRSRF-PTASLS  495

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISS  843
              P   +G+  +P+V  FSSRGPSS +P ++KPDI APG  I+ A P    T + GF   S
Sbjct  496   FPTTVIGKWASPRVASFSSRGPSSMSPTVLKPDIGAPGVDILAAFPSKGTTKNSGFAFLS  555

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFD  663
             GTS + PHV+ I AL+K  +P WSPAAI+SALVTTA+ + T  + I  +GS+ +AAD FD
Sbjct  556   GTSMSCPHVAGIAALMKSKNPTWSPAAIRSALVTTAYQTGTDGNVISEEGSTHKAADPFD  615

Query  662   YGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPK  483
              GGG ++PN A DPGL+YD    DY Q+LC++G++++ I K          +   T C K
Sbjct  616   IGGGHMDPNKAMDPGLIYDTTTEDYVQFLCSMGHSSASIGKV---------SNTTTSCKK  666

Query  482   TRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFD  303
              +   L+LNLPS+ VP+L    T+ R VTNVG + +VYKA+VK P G  V V+P+ L F+
Sbjct  667   EKHQELNLNLPSISVPNLKNTATVMRRVTNVGNITAVYKALVKVPFGIKVRVEPQTLSFN  726

Query  302   GNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
              + +  SF +     +  +  + FGSLTW+DG H VR+PI VR M
Sbjct  727   SDTRVLSFNVSFLCTQKFHGDYRFGSLTWTDGKHFVRSPIVVRSM  771



>ref|XP_006580141.1| PREDICTED: subtilisin-like protease SDD1-like isoform X2 [Glycine 
max]
Length=788

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/754 (43%), Positives = 454/754 (60%), Gaps = 38/754 (5%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             ++IVY+G K + + +  K  H+ +L+ ++GS E A+ +++YSY++GFSGFAA LT  QA+
Sbjct  57    VHIVYMGDKIYQNPQTTKMYHHKMLSSLLGSKEAAKNSILYSYKHGFSGFAARLTKYQAE  116

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
              +A          +  HK+ T+RSWDF+G+    +        +N G+G I+GV+D+GI 
Sbjct  117   AIAMSVI-----PNGIHKLHTTRSWDFMGVHHSTSKIA--FSDSNLGEGTIIGVIDTGIW  169

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
              E PSF D  MG +P RWKG C+   G  FN +  CN+K+IGARWF KG +  Q   L +
Sbjct  170   PESPSFNDEAMGQIPSRWKGICQG--GKHFNSTN-CNKKIIGARWFMKG-ISDQTKKLLQ  225

Query  1850  FLVSDSY-SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                SD Y S  D  GHG+  AS  AG FV NA   G+  G+ RGGA  A +A YKACW+ 
Sbjct  226   GNNSDEYLSARDAIGHGTHTASTAAGYFVGNANYRGLASGLARGGAPLAHLAIYKACWDF  285

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   C  AD+L A D AIHD VDV++VS+G  +PL S ++  + + IGSFHA ++GI 
Sbjct  286   PIGD--CTDADILKAFDKAIHDGVDVLTVSLGFAIPLFSYVDQRDSLAIGSFHATSKGIT  343

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEK---YAVDWQLPN---  1332
             V+ +AGN+GP + T+TN  PW+ITV A+TIDR F   ITLGN       ++D    N   
Sbjct  344   VVCSAGNSGPVSQTVTNTAPWIITVGATTIDRAFPAAITLGNNRTVWGQSIDMGKHNLGS  403

Query  1331  -GTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVD-KATDAGAV  1158
              G   S  +          D     L+     GKIV  F     +++V       +AG V
Sbjct  404   VGLTYSERIAVDPSDNLAKDCQSGSLNATMAAGKIVLCFSVSDQQDIVSASLTVKEAGGV  463

Query  1157  GVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALT  978
             G++Y+   + D L    +  P ++VDY+ GT+   YI +S   PTA LS PK  +G+  +
Sbjct  464   GLVYAQ-YHEDGLNQCGS-FPCIKVDYEVGTQTLTYIRRSRF-PTASLSFPKTVIGKWTS  520

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISSGTSHAAPHVSA  810
             P+V  FSSRGPSS +P ++KPDIAAPG  I+ A P    T   GF   SGTS + PHV+ 
Sbjct  521   PRVASFSSRGPSSMSPTVLKPDIAAPGVDILAAFPPKGTTRSSGFAFLSGTSMSCPHVAG  580

Query  809   IVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAA  630
             I AL+K  HP WSPAAI+SALVTTA  + T  S I  +GS+ +AAD FD GGG V+PN A
Sbjct  581   IAALIKSKHPTWSPAAIRSALVTTASQTGTDGSLISEEGSTHKAADPFDIGGGHVDPNKA  640

Query  629   DDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLP  450
              DPGL+YD+   DY Q+LC++G++++ I K          T+  T C K +   L+LNLP
Sbjct  641   MDPGLIYDITTEDYVQFLCSMGHSSASISKV---------TKTTTSCKKGKHQTLNLNLP  691

Query  449   SMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMR  270
             S++VP+L +  T+ RTVTNVG + +VYKA++K P G  V V+P+ L F+ + +  +F++ 
Sbjct  692   SILVPNLKRVATVMRTVTNVGNITAVYKALLKVPYGIKVRVEPQTLSFNSDARILNFSVS  751

Query  269   VSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
               + +  +  + FGSLTW+DG + VRTPIAVR +
Sbjct  752   FLSTQKFHGDYKFGSLTWTDGKYFVRTPIAVRTI  785



>emb|CDX91186.1| BnaC02g04110D [Brassica napus]
Length=760

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/753 (43%), Positives = 470/753 (62%), Gaps = 35/753 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IVYLG + H+D   +  SH  +L  ++GS ++A + MV+SYR+GFSGFAA LT SQA
Sbjct  35    KIHIVYLGEREHNDPELVTASHLRMLESLLGSQKDANEFMVHSYRHGFSGFAAHLTDSQA  94

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++    VV V  +  ++ QT+R++++LGLS+ +  P  LL   N G+ +I+G++DSG+
Sbjct  95    KKISEHPDVVQVTPNSFYEPQTTRAFEYLGLSQSS--PKGLLHDANMGEDVIIGILDSGV  152

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E PSF D G+GP+P+RWKG+C  + G +F+  + CN+K+IGAR++      +   D +
Sbjct  153   WPESPSFSDKGLGPIPKRWKGTC--VDGEKFDSKKHCNKKLIGARYYMDSLFKNNRTD-S  209

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                 ++  S  +V  HGS VAS  AG+FVP+ +  G+ VG  RGGA  AR+A YK CW  
Sbjct  210   GIPDTEYMSAREVFAHGSHVASTAAGAFVPDVSDNGLGVGTARGGAPKARIAMYKVCWQT  269

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               +   CA AD+L A+D AI D VDVIS+S+GS +P++ +++  N    G+FHA+++GI 
Sbjct  270   --QDGSCATADILKAMDDAIADGVDVISISLGSAIPISREIDISNVFSYGAFHAVSKGIT  327

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V++A GN GP A+T+ N+ PW+ITVAA+++DR F   +TLGN         L    ++  
Sbjct  328   VLMAGGNFGPHAYTVQNIAPWIITVAATSLDRWFPKPLTLGNNVTL-----LARTPSVDP  382

Query  1313  PLHFAGKYMGEADLMPRKLDPAEVKGKIVFMF--GDDLDRNLVLVDKATDAGAVGVIYSN  1140
              L     Y+  +  M      +E  GKIV  F   ++ +     ++K  +  A GVI + 
Sbjct  383   ELQAELIYVDSSKEMT-----SEAAGKIVLGFTTAENGESATDFLNKQMEVQAAGVILAG  437

Query  1139  PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDF  960
               + D + I++  +  + +DY  GT I +YI +ST  PT  +S      G  +  KV +F
Sbjct  438   RRS-DKM-IVSEGLINLNIDYQQGTTILNYI-KSTNKPTITVSPSIALTGPLVATKVAEF  494

Query  959   SSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLK  792
             S RGP+S +P ++KPDIAAPG  I+ A        + G+   SGTS AAP V+ +VALLK
Sbjct  495   SGRGPNSVSPYVLKPDIAAPGVSIVAACTPEKMNYENGYTAMSGTSMAAPAVAGVVALLK  554

Query  791   ISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLV  612
               HP+WSPA +KSA++TTA ++D Y  PI+++G S + AD FD+GGG+VNP+ A +PGLV
Sbjct  555   AVHPDWSPAMLKSAIITTASSTDPYGEPIYSEGLSRKLADPFDFGGGLVNPDKAANPGLV  614

Query  611   YDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPD  432
             YD    DY ++LCA  Y+   I K          +++   CP  RPSMLDLNLPS+ +P 
Sbjct  615   YDADVQDYIRFLCASSYDEKSITKI---------SKQTVKCPSPRPSMLDLNLPSITIPF  665

Query  431   LFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKL  252
             L + VTL RTVTNVGPVNSVYK IV+ P+G  ++V P+ L F+   KK S+ + VS    
Sbjct  666   LKEDVTLTRTVTNVGPVNSVYKLIVQPPMGVKISVTPQTLVFNSGVKKLSYQVTVSTTHK  725

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              NS + FGSLTW+DG+HNV  P+++R  +V  +
Sbjct  726   ANSIYFFGSLTWTDGIHNVVIPLSIRTQMVKYF  758



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score =   552 bits (1423),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 336/760 (44%), Positives = 459/760 (60%), Gaps = 34/760 (4%)
 Frame = -3

Query  2399  GKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTas  2220
             G K YIVY+G + H D   + +SH+++LA V+GS E    +M+YSYR+GFSGFAA +T S
Sbjct  45    GTKAYIVYMGERKHKDVELVTKSHHEMLASVLGSKEATLDSMIYSYRHGFSGFAAKMTDS  104

Query  2219  qakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDS  2040
             QA+ +A + GVV V+ ++ +K+ T+RSWD+LGLS  +     LL  TN+GDG I+GV D+
Sbjct  105   QARYIAELPGVVQVLPNRLYKMHTTRSWDYLGLSPHSTT--NLLHDTNQGDGAIIGVFDT  162

Query  2039  GISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVD  1860
             G+  E  SF D G+GP+P +WKG C +  G  FN  + CN+K+IGAR+F  G L +   +
Sbjct  163   GVWPESESFNDKGLGPIPAKWKGFCTS--GDAFNPKQHCNKKIIGARYFINGFLAAYG-E  219

Query  1859  LNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
              N    ++  S  D AGHG+  ASI  GSFV N +  G+  G+ RGGA  AR+A YK  W
Sbjct  220   FNATEANEFISTRDSAGHGTHCASIAGGSFVRNVSFQGLAGGVARGGAPRARLAIYKVGW  279

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
                      +  D+L A D AIHD VDV+S+S+G  +PL  +++  + I  GSFHA+  G
Sbjct  280   IGG----AVSSVDILKAFDEAIHDGVDVLSISLGIDLPLYPEIDKLDVIYYGSFHAVAHG  335

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ +AGN+GP   T+ +V PWVI+VAASTIDR F   I LGN + +            
Sbjct  336   ITVVCSAGNSGPEYQTVEDVAPWVISVAASTIDRSFPTPIVLGNKQVFTGQAMFDGKDTG  395

Query  1319  SHPLHFA--GKYMGEADLMPRKLDPAEVKGKIVFMFG-----DDLDRNLVLVDKATDAGA  1161
                L +   G   GE        +   V GK+V  F      DD+ R    V    +AGA
Sbjct  396   FLKLAYIERGDVGGERYCEYITANDTWVAGKVVLCFTVEGSEDDIIRAASTVQ---EAGA  452

Query  1160  VGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRAL  981
             +G+I +  + V   P  ++  P + V +D  T+I +YI + T  P  +L   K   G   
Sbjct  453   LGLIATKKTVVALSPYYSS-FPLILVTFDIATQILNYI-RFTRDPVVRLKPTKTYFGNQA  510

Query  980   TPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PT--SDGGFRISSGTSHAAPHVSA  810
             +  +  FSSRGP+S +P ++KP+IAAPG  ++ A  PT  S  G+   SGTS AAPH++ 
Sbjct  511   STYIASFSSRGPNSLSPAVLKPEIAAPGVDVLAAYVPTTLSPQGYSFDSGTSMAAPHIAG  570

Query  809   IVALLKISHPEWSPAAIKSALVTTAWNSDTYF-SPIFAKGSSLRAADAFDYGGGIVNPNA  633
             I ALLK  HP WS AAIKSALVTTAW  D Y   PIFAKG   + AD FDYGGG+VNPNA
Sbjct  571   IAALLKSLHPHWSLAAIKSALVTTAWTMDPYSGEPIFAKGQIPKLADPFDYGGGLVNPNA  630

Query  632   ADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNL  453
             A  PGLVYD+   DY  YLCA+GY+ + I   ++G R +S       C K+  S+LDLNL
Sbjct  631   ARTPGLVYDIGTQDYVNYLCAMGYSETDI-NQLTG-RPKS-------CKKSSNSVLDLNL  681

Query  452   PSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTM  273
             PS+ VP+L   VT+R+TVTNVG  NS Y+A+V  P+G VV V PK L+F    ++ SF +
Sbjct  682   PSITVPNLKGSVTIRKTVTNVGDENSKYEAVVVPPLGTVVKVNPKHLQFSPEVREMSFKV  741

Query  272   RVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             +++    + + + FGSLTWSDG H V+ PI+VR     +Y
Sbjct  742   KITTLHNITTEYYFGSLTWSDGKHEVKIPISVRTEFPQVY  781



>ref|XP_010499843.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Camelina sativa]
Length=1161

 Score =   563 bits (1452),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 330/739 (45%), Positives = 455/739 (62%), Gaps = 34/739 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+++VYLG K HDD   + ESH+ +L  ++GS  +A  +MVYSYR+GFSGFAA LT SQA
Sbjct  29    KVHVVYLGEKQHDDPEFVTESHHQMLLSLLGSKADAHDSMVYSYRHGFSGFAAKLTDSQA  88

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    VV V+ D  +++ T+R+WD+LGLS  A  P  LL  TN GD +I+G +D+G+
Sbjct  89    KKLADSPEVVHVMADSFYELATTRTWDYLGLS--AANPINLLNDTNMGDQVIIGFIDTGV  146

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P  WKG C   PG +F  +  CNRK+IGA++F  G  L+++   N
Sbjct  147   WPESESFNDNGVGPIPSHWKGGCE--PGEKFISTN-CNRKLIGAKYFING-FLAENKGFN  202

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+  +SI  GSFVPN +  G+  G +RGGA  ARVA YKACW +
Sbjct  203   STESRDYISARDFIGHGTHTSSIAGGSFVPNISYKGLSGGNLRGGAPRARVAIYKACWYV  262

Query  1673  DPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D    V C+ +D+L A+D A+HD V+V+S+S+G+ +PL  + +  + I  G+FHA+ +GI
Sbjct  263   DQLGAVACSSSDILKAMDEAMHDGVNVLSLSLGAQIPLYPETDLRDRIATGAFHAVAKGI  322

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG----  1329
              V+ A GN+GP+A T+ N  PW++TVAA+T+DR F   ITLGN  K  +   L  G    
Sbjct  323   IVVCAGGNSGPAAQTVLNTAPWILTVAATTLDRSFPTPITLGN-RKVILSQALYTGQELG  381

Query  1328  -TALSHPLHFAGKYMGEADLMPRKLD---PAEVKGKIVFMFGDDLDRNLV--LVDKATDA  1167
              T+L +P   AG        +  +LD      + GK+V  F  +   + V         A
Sbjct  382   FTSLVYP-EIAGNTNETFSGVCERLDLNPNRTMAGKVVLCFTTNTLFSAVSRAASYVKAA  440

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
             G +GVI +     +  P  +   P V +DY+ GT +  YI +ST +P  ++   +  VG+
Sbjct  441   GGLGVIVARNPGYNLTPCRD-DFPCVAIDYELGTDVLLYI-RSTRSPVVKIQLSRTHVGQ  498

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHAAPH  819
              +  KV  FSSRGP+S +P I+KPDI APG  I+ A  P S+   GGF I +GTS AAP 
Sbjct  499   PVGTKVATFSSRGPNSISPAILKPDIGAPGVSILAATSPDSNSSVGGFDILAGTSMAAPV  558

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             ++ +VALLK  HP WSPAA +SA+VTTAW +D +   IFA+GSS + AD FDYGGGIVNP
Sbjct  559   IAGVVALLKALHPNWSPAAFRSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDYGGGIVNP  618

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               A DPGL+YDM   DY  YLC+ GYN+S I + +          + T+C   +PS+LD+
Sbjct  619   EKASDPGLIYDMGTQDYILYLCSAGYNDSAISQLVG---------KVTVCSNLKPSVLDV  669

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ +P+L   VTL RTVTNVG  +SVYK +V+ P+G  V V P+ L F+       F
Sbjct  670   NLPSITIPNLKDEVTLTRTVTNVGLADSVYKVVVEPPLGIRVAVTPETLVFNSKTNSVPF  729

Query  278   TMRVSADKLVNSAFTFGSL  222
             T+RVS    +N+ F FG L
Sbjct  730   TVRVSTTHKINTGFFFGRL  748


 Score =   296 bits (758),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 166/345 (48%), Positives = 224/345 (65%), Gaps = 13/345 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H D   + +SH+ +L+ ++GS ++A  +MVYSYR+GFSGFAA LT SQA
Sbjct  779   KVHIVYLGEKQHHDPEFVTKSHHQMLSSLLGSKKDAHDSMVYSYRHGFSGFAAKLTKSQA  838

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V+ D  +K+ T+R+WD+LGLS  A  P  LL  TN GD +I+GV+D+G+
Sbjct  839   KKIADLPEVVHVILDVFYKLATTRTWDYLGLS--AANPKNLLNDTNMGDQVIIGVIDTGV  896

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P++WKG C      R   S  CNRK+IGA++F KG  L+Q+   N
Sbjct  897   WPESESFNDNGVGPIPRKWKGGCELGENFR---STNCNRKLIGAKYFMKG-FLAQNKGFN  952

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GH + VASI  GSFVPN +  G       GGA  ARVA YKACW L
Sbjct  953   SAKSPDYISARDFDGHRTHVASIAGGSFVPNVSYKG------XGGAPRARVAMYKACWYL  1006

Query  1673  DP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +  +R  C  +D++ AID A+HD VDV+S+S+   VPL  + +  N    G FHA+ +GI
Sbjct  1007  EEVDRVTCLNSDIMKAIDEAMHDSVDVLSISLVGQVPLLPETDMLNEFATGLFHAVAKGI  1066

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGE  1362
              V+ A GN GP A T+ N+ PW++TVAA+T+DR F   ITLGN +
Sbjct  1067  VVVCAGGNNGPEAQTVVNIAPWILTVAATTLDRSFPTPITLGNNK  1111



>ref|XP_008236858.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=771

 Score =   551 bits (1420),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 328/775 (42%), Positives = 468/775 (60%), Gaps = 50/775 (6%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             +L    + +YIVY+G + H++   + ESH+++L+ V GS E A+++++YSY++GFSGFAA
Sbjct  23    LLSFASQNVYIVYMGERQHEEPELVSESHHEILSYVFGSKEAAKQSILYSYKHGFSGFAA  82

Query  2234  VLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIV  2055
             VLT SQAK +A + G+V V+ ++ H + T+RSW+FL ++  +++   +L ++  G G I+
Sbjct  83    VLTQSQAKLIADIPGIVHVIPNRVHNLHTTRSWNFLQVN--SHISNGILSRSQSGAGSII  140

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             G++D+GI  E  SF D GMG VP RW+G C+   G +FN    CNRK+IGARW+ KG   
Sbjct  141   GIIDTGIWPESLSFRDDGMGDVPSRWRGICQE--GEKFNRFH-CNRKIIGARWYIKG---  194

Query  1874  SQDVDLNKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAAR  1704
               + +      SD +   S  D  GHG+  AS  AG+ + NA+ +G+  G+ RGGA +AR
Sbjct  195   -YEAEFGNLSTSDGFEFRSPRDAGGHGTHTASTAAGASIENASFMGLAAGLARGGAPSAR  253

Query  1703  VASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             +A YK CW        C+ ADLLAA D AI D VDV+S S+GSP PL S +E  + + IG
Sbjct  254   LAVYKVCWATGG----CSSADLLAAFDDAIFDGVDVLSASLGSPPPLPSYVE--DVVSIG  307

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW  1344
             SFHA+ +GI VI +AGN+G    T+ N  PW+ TVAASTIDR F   ITLGN +   V  
Sbjct  308   SFHAVAKGISVICSAGNSGSYPQTVINSAPWIFTVAASTIDRAFPTAITLGNNQT-VVGQ  366

Query  1343  QLPNG--TALSHPLHFAGKYM---------GEADLMPRKLDPAEVKGKIVFMFGDDLDR-  1200
              L  G  T   +PL + G            G  D     L+    +GK++  F     R 
Sbjct  367   ALYTGMNTNKFYPLVYGGDIASIDADEDSAGNCD--SGTLNDTLARGKMILCFQSRTQRL  424

Query  1199  NLVLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTA  1020
              +  +    +    G+I++   + D + + +  +P VQVD+  GT +  YI  +T  P  
Sbjct  425   AITAIRTVMNVTGAGLIFAQFPSKD-VSLSSGSLPCVQVDFAIGTYLLTYI-GATRNPVV  482

Query  1019  QLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-----DPT-SDGG  858
             + +  K QVG+ ++P+V  FSSRGP+S +P I+KPDI APG  I+ +      P+ S   
Sbjct  483   KFNPTKTQVGQQISPEVAFFSSRGPNSLSPSILKPDITAPGVNILASWSPARSPSKSPDT  542

Query  857   FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRA  678
             F+I SGTS + PH+S IVALLK  HP WSPAAIKSALVTTA   D Y   I A+G+  + 
Sbjct  543   FKIESGTSMSCPHISGIVALLKAIHPTWSPAAIKSALVTTASLGDEYAQSIVAEGAPHKQ  602

Query  677   ADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEH  498
             AD FDYGGG V+PN A  PGL+YD+   DY ++LC++GYNN+ I   ++G +        
Sbjct  603   ADPFDYGGGHVDPNKAISPGLIYDIESSDYIRFLCSMGYNNTAI-SLMAGTK--------  653

Query  497   TICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPK  318
               C K+   +++LNLPS+ + +L + +T+ R VTNVGPVNSVY A V++P G  V VKP 
Sbjct  654   ITCQKSTKFIVNLNLPSITIHELKQNMTVSRRVTNVGPVNSVYFARVQAPAGVSVKVKPS  713

Query  317   VLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             VL F+   KK  F +   +   V   F+FG+L W DG+H VR P+ VR ++  LY
Sbjct  714   VLSFNSTVKKLEFKVIFCSLLRVQGRFSFGNLFWEDGLHVVRIPLVVRTVLDDLY  768



>ref|XP_003629621.1| Subtilisin-like protease [Medicago truncatula]
Length=797

 Score =   551 bits (1421),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 324/785 (41%), Positives = 471/785 (60%), Gaps = 59/785 (8%)
 Frame = -3

Query  2417  KVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFA  2238
             ++  E    ++IVY+G K + +    K+ H+ +L+ ++GS E+A+ +++YSY++GFSGFA
Sbjct  33    EIFAEESSSVHIVYMGDKIYHNPETAKKYHHKMLSSLLGSKEDAKNSLLYSYKHGFSGFA  92

Query  2237  AVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMI  2058
             A +T SQA+ +A    VVSV+ +  HK+ T+RSWDF+G+   ++    +  ++N G G I
Sbjct  93    ARMTKSQAEDIAKFPEVVSVIPNGIHKLHTTRSWDFIGVHHPSS--KTVFTESNLGQGTI  150

Query  2057  VGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGAL  1878
             +GV+D+GI  E  SF D  MG +P +WKG C+   G +FN +  CN+K+IGARWF KG  
Sbjct  151   IGVIDTGIWPESASFNDEAMGKIPSKWKGVCQV--GEKFNSTN-CNKKIIGARWFLKGIT  207

Query  1877  -LSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARV  1701
               ++++ L     ++  S  D  GHG+  AS  AG FV NA   G+  G+ RGGA  A +
Sbjct  208   DHTKNLVLGNNDTTEYLSARDAIGHGTHTASTAAGYFVENANYRGLASGLARGGAPLAHL  267

Query  1700  ASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGS  1521
             A YKACW++      C  AD+L A D AIHD VDV++VS+G  +PL S  +  + I IGS
Sbjct  268   AIYKACWDVPVGH--CTDADILKAFDMAIHDGVDVLTVSLGIGIPLFSYADQRDTIAIGS  325

Query  1520  FHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQ  1341
             FHA ++GI V+ +AGN+GP + T++N  PW+ITVAA+TIDR F   ITLGN     V + 
Sbjct  326   FHATSKGITVVSSAGNSGPISQTVSNTAPWLITVAATTIDRTFPTAITLGNNLTLWVGYN  385

Query  1340  ---------LPNGTALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFM  1221
                      + NG    H L F G    E            D     L+     GKIV  
Sbjct  386   HFCIELGQSIDNG---KHALGFVGLTYSERIARDPSDDLAKDCQSGSLNETMAAGKIVLC  442

Query  1220  FGDDLDRNLVLVD-KATDAGAVGVIYS--NPSNVDSLPILNARIPYVQVDYDAGTRIKDY  1050
             F     +++V       +AG VG+IY+  +   ++   IL    P ++VDY+AGT +  Y
Sbjct  443   FSVSDQQDIVSAALSVKEAGGVGLIYAQRHEDGLNECGIL----PCIKVDYEAGTELLTY  498

Query  1049  IFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP-  873
             I ++   PTA+LS PK  +G+ ++P+V  FSSRGPS+ +P ++KPDIAAPG  I+ A P 
Sbjct  499   IRRARF-PTARLSFPKTVIGKWISPRVASFSSRGPSTLSPTVLKPDIAAPGVDILAAFPP  557

Query  872   ---TSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSP--  708
                    GF   SGTS + PHV+ I AL+K  HP WSPAAI+SALVTT     +  S   
Sbjct  558   KGSKKSSGFIFLSGTSMSCPHVAGIAALIKSKHPTWSPAAIRSALVTTVSTLKSAASQSG  617

Query  707   ----IFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYK  540
                 + ++GS+ +AAD FD GGG V+PN A + GL+Y++   DY  +LC++G+N + I K
Sbjct  618   TDGGLISEGSTNKAADPFDMGGGHVDPNKAINAGLIYNITTEDYIHFLCSMGHNTASIRK  677

Query  539   TISGNRNRSDTEEHTICPKT-RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKA  363
                       T+  T C K  R ++L+LNLPS+ +P+L +  T+ RT+TNVG +N VYKA
Sbjct  678   V---------TKTTTSCNKQKRQALLNLNLPSISIPNLKRDTTVMRTLTNVGNINVVYKA  728

Query  362   IVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPI  183
             IVKSP G  V V+P++L+F+   K  +F +   + + ++  + FGSLTW+DG H VR PI
Sbjct  729   IVKSPYGIKVRVEPQILKFNSENKVLTFNVSFISTQKLHGDYRFGSLTWTDGNHFVRIPI  788

Query  182   AVRKM  168
             AVR +
Sbjct  789   AVRTI  793



>ref|XP_010419003.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=719

 Score =   548 bits (1413),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 328/747 (44%), Positives = 452/747 (61%), Gaps = 31/747 (4%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IV+LG K H+    + +SHY +L  ++GS E A+ ++VY+Y++GFSGFAA LTASQA
Sbjct  3     KIHIVHLGAKQHNTPELVTKSHYQILEPLLGSKEAAKNSIVYNYKHGFSGFAAKLTASQA  62

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++    V+SVV  +    +T+R++D+LGLS  +  P  LL  T  G  +I+GV+D+GI
Sbjct  63    KNLSVHPEVLSVVPSRVMWPKTTRTYDYLGLSPTS--PKGLLHDTKMGSEVIIGVIDTGI  120

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG C +  G  F+  +  N+K+IGA +F +G LL+ + + +
Sbjct  121   WPESHSFNDTGLGPIPKRWKGKCMSRDG--FDPKKHFNKKLIGAEFFTEG-LLNSEAEYD  177

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  +  S  D  GHG+ VA+  AGSFV NA+  G+ VG  RG A  AR+A YK CW  
Sbjct  178   FESEREFRSPRDAKGHGTHVAATAAGSFVSNASYKGLAVGTARGAAPHARIAMYKTCW--  235

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                R  C  ADLL AID++I D VDVIS+S+G+  P + D++ ++ I  GSF A+ +GIP
Sbjct  236   --RRAGCITADLLKAIDHSIRDGVDVISISIGNDPPASFDVDMDD-IAFGSFQAVMKGIP  292

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP A TI NV PW+ITVAA++ DR F   ITLGN         L  G     
Sbjct  293   VVASAGNEGPDAQTIDNVAPWIITVAATSFDRSFPVPITLGNNLTV-----LAEGLNTFP  347

Query  1313  PLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNPS  1134
              + F+    G  +L+   ++    KG IV  F           D   +AG  G+IY+  S
Sbjct  348   EVGFSELQNG-IELLDTNIEEGVTKGSIVLAFTPTATA-AKKADNILEAGCAGIIYAQ-S  404

Query  1133  NVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSS  954
              ++        +P   VDY+  T I  YI Q++ +P A++S  K   G+ L  +V  FSS
Sbjct  405   VINPTVCNGVDVPCAVVDYEYATDILYYI-QTSDSPKAKISPSKTLSGQPLASRVAYFSS  463

Query  953   RGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEW  774
             RGP+S  P I+KPDIAAPG  ++ A     G + + SG+S A P VS IV LL+  HP W
Sbjct  464   RGPNSVTPAILKPDIAAPGVNVLSA---VSGVYTLMSGSSMATPVVSGIVGLLRQIHPGW  520

Query  773   SPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGI  594
             SPAAI+SALVTTAW +D     IF++GS+ + AD FDYGGG++NP    +PGL+YDM   
Sbjct  521   SPAAIRSALVTTAWRTDPSGEQIFSEGSTRKLADPFDYGGGLINPEKVANPGLIYDMGIN  580

Query  593   DYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVT  414
             DY  YLC+  Y++  I K +          +   CP   P+MLD N+PS+++P L + VT
Sbjct  581   DYVHYLCSAEYDDGSISKLVG---------KPIKCPSPLPTMLDFNMPSIIIPSLTREVT  631

Query  413   LRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFT  234
             L RTVTNVGP +SVYK +V+SP+G  + V PK L F  N  K +F +RV     VNS + 
Sbjct  632   LTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASNITKGTFNVRVKTSHRVNSDYY  691

Query  233   FGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F SL W+DGVHNV  PIAVR  I+  Y
Sbjct  692   FCSLCWTDGVHNVTIPIAVRTKILKSY  718



>ref|XP_002305456.2| hypothetical protein POPTR_0004s16850g [Populus trichocarpa]
 gb|EEE85967.2| hypothetical protein POPTR_0004s16850g [Populus trichocarpa]
Length=775

 Score =   549 bits (1415),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 332/773 (43%), Positives = 459/773 (59%), Gaps = 59/773 (8%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIVY+G K HD+   ++ESH++LLA +VGS + A+++++YSY++GFSGFAAVLT SQ K
Sbjct  32    VYIVYMGDKLHDEPELVQESHHELLADIVGSKDAAKESILYSYKHGFSGFAAVLTKSQEK  91

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGD---GMIVGVVDS  2040
              +A   GVV VV ++     T+RSWDFL       V  +L+ + + G    G I+GV+D+
Sbjct  92    LIADFPGVVGVVRNRIISSHTTRSWDFL------QVKPQLVGRISTGHSGAGSIIGVMDT  145

Query  2039  GISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVD  1860
             GI  E  SF D GM  VP RW+G C+   G  FN S  CNRK+IGARW+ KG     + +
Sbjct  146   GIWPESKSFRDEGMAEVPSRWRGICQE--GEGFNRSH-CNRKIIGARWYIKG----YEAE  198

Query  1859  LNKFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYK  1689
               K   SD     S  D  GHG+  +S   G  V NA+ +G+  G+ RGGA +A +A YK
Sbjct  199   FGKLNTSDGDEFLSPRDAGGHGTHTSSTATGGLVENASFMGLAQGLARGGAPSAWLAVYK  258

Query  1688  ACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
              CW        CA ADLLAA D AI D VDV+SVS+GS  PLA+ +E  + + IGSF+A+
Sbjct  259   VCWATGG----CAEADLLAAFDDAIFDGVDVLSVSLGSAPPLATYVE--DAVAIGSFYAV  312

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
              +GI V+ +AGN+GP   TITN  PWV+TVAASTIDR F   ITLGN +   V   L  G
Sbjct  313   AKGISVVCSAGNSGPYPQTITNTAPWVVTVAASTIDRAFPTIITLGNNQTI-VGQALYTG  371

Query  1328  TALS--HPLHFAGKYMGEAD-------LMPRKLDPAEVKGKIVFMFGDDLDR-NLVLVDK  1179
               +   HP+ +  + + +              L+    +GK++  F     R N++    
Sbjct  372   KNVDTFHPIVYGEEIVADDSDEDSARGCASGSLNATLARGKVILCFESRSQRSNIIARRT  431

Query  1178  ATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
               D   VG+I++     D    L+  IP +QVD+  GT +  Y+ +S+  P  + S  K 
Sbjct  432   VLDVKGVGLIFAQSPTKDV--TLSLDIPCIQVDFAIGTYLLTYM-ESSRNPVVKFSFTKT  488

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDGG----------FR  852
              +G+ ++P+V  FSSRGPSS +  ++KPDIAAPG  I+ +  P +             F+
Sbjct  489   VIGQQISPEVAFFSSRGPSSISATVLKPDIAAPGVNILASWSPAASPAIIDNEARPLDFK  548

Query  851   ISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAAD  672
             I SGTS + PH+S +VALLK +HP+WSPAAIKSAL+TTA   D Y     A+G+  + AD
Sbjct  549   IESGTSMSCPHISGVVALLKAAHPKWSPAAIKSALITTASIEDEYGQKTVAEGAPHKQAD  608

Query  671   AFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTI  492
              FDYGGG V+P+ A DPGLV+DM   DY ++LCALGYNNS I            T   T 
Sbjct  609   PFDYGGGHVDPDRAMDPGLVFDMGTSDYIRFLCALGYNNSAISLM---------TRTRTR  659

Query  491   CPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVL  312
             C K+   +++LNLPS+ +P+L + +T+ RTVTNVGP+ S+Y A V +P G  VTV+P VL
Sbjct  660   CKKSTTFLVNLNLPSITIPELKQNLTVSRTVTNVGPITSIYVARVLAPAGTRVTVEPSVL  719

Query  311   RFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              FD  RKK  F +   +   +   ++FG+L W DG H VR P+ V+ +I   Y
Sbjct  720   SFDSTRKKIKFKVTFCSMLRIQGRYSFGNLFWEDGFHVVRIPLIVKTVIDDFY  772



>emb|CAB36808.1| subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB81271.1| subtilisin-like protease [Arabidopsis thaliana]
Length=769

 Score =   548 bits (1411),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 323/770 (42%), Positives = 457/770 (59%), Gaps = 82/770 (11%)
 Frame = -3

Query  2336  ESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHK  2157
              S +  ++  + S E+A  +M+YSY++GFSGFAA+LT+SQAKK++    V+ V+ ++  K
Sbjct  34    SSSHTCVSNNIYSKEDAHNSMIYSYQHGFSGFAALLTSSQAKKISEHPEVIHVIPNRILK  93

Query  2156  VQTSRSWDFLGLS---------EGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDA  2004
             ++T+R WD LGLS           A   G LL  T+ G   I+GVVDSGI  E   F D 
Sbjct  94    LKTTRIWDHLGLSPIPTSFSSSSSAKAKG-LLHNTSMGSEAIIGVVDSGIWPESKVFNDQ  152

Query  2003  GMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSG  1824
             G+GP+P+RW+G CR+  G +FN +  CN+K+IGA+++  G L       N+ ++ D  S 
Sbjct  153   GLGPIPKRWRGKCRS--GEKFNATMHCNKKLIGAKYYQSGLLAMNGGKFNRIIIRDFKSN  210

Query  1823  YDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGA  1644
              D  GHG+  A+I  GSFVPNA+  G+  G VRGGA  AR+ASYKACWN+     +C+ A
Sbjct  211   RDATGHGTHTATIAGGSFVPNASFYGLARGTVRGGAPRARIASYKACWNVVGWGGICSSA  270

Query  1643  DLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGP  1464
             D+  A D AIHD+VDV+SVS+G+ +P     ++E    I +FHA+ +GI V+ AAGN G 
Sbjct  271   DMWKAYDDAIHDQVDVLSVSIGASIP----EDSERVDFIAAFHAVAKGITVVAAAGNDGS  326

Query  1463  SAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMG  1284
              A TI NV PW++TVAA+T+DR F   ITLGN + +               L     ++ 
Sbjct  327   GAQTICNVAPWLLTVAATTLDRSFPTKITLGNNQTFF--------------LKLTCCFLL  372

Query  1283  EADLMPRKLDPAEVKGKIVFMFGDDLD---RNLVLVDKATDA-----GAVGVIYSNPSNV  1128
              ++L        E+   + F+  DD+D   + ++  D    +     G V VI +   + 
Sbjct  373   VSNLAESLFTGPEISTGLAFL-DDDVDVKGKTILEFDSTHPSSIAGRGVVAVILAKKPDD  431

Query  1127  DSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRG  948
                P  +    Y+  DY+ GT I  YI ++T +PT ++S+     G+  TPKV  FSSRG
Sbjct  432   RPAPDNS----YIFTDYEIGTHILQYI-RTTRSPTVRISAATTLTGQPATPKVAAFSSRG  486

Query  947   PSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHP  780
             P+S +P I+KPDIAAPG  I+ A    DP +  GF++ SGTS + P VS I+ LLK  HP
Sbjct  487   PNSVSPAILKPDIAAPGVSILAAVSPLDPGAFNGFKLHSGTSMSTPVVSGIIVLLKSLHP  546

Query  779   EWSPAAIKSALVTT------------------------AWNSDTYFSPIFAKGSSLRAAD  672
             +WSPAA++SALVTT                        AW +     PIFA+GS+ + AD
Sbjct  547   KWSPAAMRSALVTTGSCFFLFFFFINKPSRTNRSVSFVAWRTSPSGEPIFAQGSNKKLAD  606

Query  671   AFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTI  492
              FDYGGG+VNP  A  PGLVYDM   DY  Y+C+ GYN+S I + +          + T 
Sbjct  607   PFDYGGGLVNPEKAAKPGLVYDMGIKDYINYMCSAGYNDSSISRVLG---------KKTK  657

Query  491   CPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVL  312
             CP  +PSMLD+NLPS+ +P+L K VTL RTVTNVGP+ SVY+A+++SP+G  +TV P +L
Sbjct  658   CPIPKPSMLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTIL  717

Query  311   RFDGNRKK-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
              F    K+  +F+++      VNS + FGSLTW+DGVH+V  P++V+  I
Sbjct  718   VFKSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVTIPVSVKTTI  767



>ref|XP_009125836.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score =   547 bits (1410),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 318/753 (42%), Positives = 469/753 (62%), Gaps = 35/753 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IVYLG + H+D   +  SH  +L  ++GS ++A + MV+SYR+GFSGFAA LT SQA
Sbjct  35    KIHIVYLGEREHNDPELVTASHLRMLESLLGSQKDANEFMVHSYRHGFSGFAAHLTDSQA  94

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK++    VV V  +  ++ QT+R++++LGLS+ +  P  LL   N G+ +I+G++DSG+
Sbjct  95    KKISEHPDVVQVTPNTFYEPQTTRAFEYLGLSQSS--PKGLLHDANMGEDVIIGILDSGV  152

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E PSF D G+GP+P+RWKG+C  + G +F+  + CN+K+IGAR++      +   D +
Sbjct  153   WPESPSFSDKGLGPIPKRWKGTC--VDGAKFDSKKHCNKKLIGARYYMDSLFKNNRTD-S  209

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                 ++  S  +V  HGS VAS  AG+FVP+ +  G+ VG  RGGA  AR+A YK CW  
Sbjct  210   GIADTEYMSAREVFAHGSHVASTAAGAFVPDVSDNGLGVGTARGGAPKARIAMYKVCWQT  269

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               +   CA AD+L A+D AI D VDVIS+S+GS +P++ +++  N    G+FHA+++GI 
Sbjct  270   --QDGSCASADILKAMDDAIADGVDVISISLGSAIPISREIDISNVFSYGAFHAVSKGIT  327

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V++A GN GP A+++ N+ PW+ITVAA+++DR +   +TLGN         L    ++  
Sbjct  328   VLMAGGNFGPDAYSVQNIAPWIITVAATSLDRWYPKPLTLGNNVTL-----LARTPSVDP  382

Query  1313  PLHFAGKYMGEADLMPRKLDPAEVKGKIVFMF--GDDLDRNLVLVDKATDAGAVGVIYSN  1140
              L     Y+  +  M      +E  GKIV  F   ++ +     ++K  +  A GVI + 
Sbjct  383   ELQAELIYVDSSKEMT-----SEAAGKIVLGFTTAENGESATDFLNKQMEVQAAGVILAG  437

Query  1139  PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDF  960
               + D + I++  +  + +DY  GT I +YI +ST  PT  +S      G  +  KV +F
Sbjct  438   RRS-DKM-IVSEGLINLNIDYQQGTTILNYI-KSTNKPTITVSPSIALTGPLVATKVAEF  494

Query  959   SSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLK  792
             S RGP+S +P ++KPDIAAPG  I+ A        + G+   SGTS AAP V+ +VALLK
Sbjct  495   SGRGPNSVSPYVLKPDIAAPGVSIVAACTPEKINYENGYTAMSGTSMAAPAVAGVVALLK  554

Query  791   ISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLV  612
               HP+WSPA +KSA++TTA ++D Y  PI+++G S + AD FD+GGG+VNP  A +PGLV
Sbjct  555   AVHPDWSPAMLKSAIITTASSTDPYGEPIYSEGLSRKLADPFDFGGGLVNPEKAANPGLV  614

Query  611   YDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPD  432
             YD    DY ++LCA  Y+   I K          +++   CP  RPSMLDLNLPS+ +P 
Sbjct  615   YDADVQDYIRFLCASSYDEMSITKI---------SKQTVKCPSPRPSMLDLNLPSITIPF  665

Query  431   LFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKL  252
             L + VTL RTVTNVGPV+SVYK IV+ P+G  ++V P+ L F+   KK S+ + VS    
Sbjct  666   LKEDVTLTRTVTNVGPVDSVYKLIVQPPMGVKISVTPQTLVFNSGVKKLSYQVTVSTTHK  725

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              NS + FGSLTW+DG+HNV  P+++R  +V  +
Sbjct  726   ANSIYFFGSLTWTDGIHNVVIPLSIRTQMVKYF  758



>emb|CDY54842.1| BnaC05g51310D [Brassica napus]
Length=1424

 Score =   566 bits (1459),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 336/745 (45%), Positives = 451/745 (61%), Gaps = 76/745 (10%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K HDD + + ESH+ +L+ ++GS  EA  +MV+SYR+GFSGFAA LT SQA
Sbjct  28    KVHIVYLGEKQHDDPKHVTESHHQMLSSLLGSEVEADDSMVHSYRHGFSGFAAKLTESQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A    VV V+ D  +K+ T+R+WD+LGLS G      LL  TN GD +I+G +DSG+
Sbjct  88    KKIADSPDVVHVIPDSFYKLATTRTWDYLGLSVGNLT--NLLNDTNMGDQVIIGFIDSGV  145

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GPVP  WKG C++  G  F E   CNRK+IGA++F  G  L+++   N
Sbjct  146   WPESESFNDNGVGPVPSHWKGGCQS--GENF-ELTNCNRKLIGAKYFING-FLAENEGFN  201

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S  D  GHG+ VA I  GSFVPN +  G+  G +RGGA  AR+A YKACW +
Sbjct  202   STGSRDYISARDFIGHGTHVACIAGGSFVPNVSYKGLAGGNLRGGAPRARIAIYKACWYV  261

Query  1673  DPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D    V C+ +D+L A+D A+HD VDV+S+S+G+ VPL         I  G+FHA+ +GI
Sbjct  262   DQLGTVACSSSDILKAMDEAMHDGVDVLSLSLGAQVPL---------IATGAFHAVAKGI  312

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ A GN+GP+A T+ N  PWVITVAA+T+DR F   ITLGN           N   L 
Sbjct  313   IVVCAGGNSGPAAQTVLNTAPWVITVAATTLDRSFPTPITLGN-----------NNVILG  361

Query  1316  HPLHFAGKYMGEADLM-PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSN  1140
               L + G+ +G   L+ P     + V                      T +G    +  N
Sbjct  362   QAL-YTGQEVGFTSLVYPENSGHSNV----------------------TFSGVCERLNLN  398

Query  1139  PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDF  960
             P+       +  ++ +      +GT I  YI +ST +P  ++   +  VG+ +  KV  F
Sbjct  399   PNGT-----MRGKVVF------SGTDILLYI-RSTGSPVVKIQPSRTMVGQPVGTKVATF  446

Query  959   SSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISSGTSHAAPHVSAIVALLK  792
             SSRGP+S +P I+KPDI APG  I+ A      +S GGF I +GTS AAP +S +VALLK
Sbjct  447   SSRGPNSISPAILKPDIGAPGVSILAATSPDSNSSAGGFDILAGTSMAAPVISGVVALLK  506

Query  791   ISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLV  612
               HP+WSPAA +SA+VTTAW +D +   IFA+GSS + AD FDYGGG+VNP  A DPGL+
Sbjct  507   AMHPDWSPAAFRSAIVTTAWRTDPFGEQIFAEGSSRKVADPFDYGGGLVNPEKAADPGLI  566

Query  611   YDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPD  432
             YDM   DY  YLC+ GYN+S I + +          + T+C   +PS+LD+NLPS+ +P+
Sbjct  567   YDMGPKDYIIYLCSAGYNDSSISQLVG---------QVTVCSNPKPSVLDVNLPSLTIPN  617

Query  431   LFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKL  252
             L + V L RTVTNVGPVNSVYK +V+ P+G  V V PK L F+   K  SF +RVS    
Sbjct  618   LKEEVNLTRTVTNVGPVNSVYKVVVEPPLGVQVVVTPKKLVFNSKTKSLSFMVRVSTIHK  677

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAV  177
             +N+ F FGSL W D VHNV  P+ +
Sbjct  678   INTGFYFGSLIWRDSVHNVTIPVHI  702


 Score =   523 bits (1347),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 322/764 (42%), Positives = 449/764 (59%), Gaps = 61/764 (8%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             ++IVYLG K HDD + + E H+ +L+ ++GS E+A  +MVYSYR+GFSGFAA LT SQAK
Sbjct  700   VHIVYLGEKQHDDPKHVTEYHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQAK  759

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             K+A    VV V+ D ++++ T+R+WD+LGLS  A  P  LL  TN GD +I+GV+D+GIS
Sbjct  760   KLADSPEVVHVMPDGYYELATTRTWDYLGLS--AAHPKNLLNDTNMGDHVIIGVIDTGIS  817

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
                       M  +      S   +  +  ++ +   ++   A+++  G L   D   N 
Sbjct  818   RF------HHMVYLSLECGQSLNHLVTMGLDQYQTDGKE---AKYYINGFLAEND-GFNS  867

Query  1850  FLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLD  1671
                 D  S  D  GHG+ VASI  GS++P+ +  G   G +RGGA  AR+A YKACW L+
Sbjct  868   TKSPDYISARDFNGHGTHVASIAGGSYIPDVSYKGFAGGTLRGGAPRARIAMYKACWYLE  927

Query  1670  P-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               +   C+ +D++ A+D AIHD VDV+S+S+GS VPL S+ +  +GI  G+FHA+ +GI 
Sbjct  928   ELDGVTCSFSDIMKAMDDAIHDCVDVLSLSLGSRVPLFSETDMRDGIATGAFHAVAKGIT  987

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL--  1320
             V+ A GNAGPS  T+ N  PW++TVAA+T+DR FA  ITLGN  K  +   +  G  L  
Sbjct  988   VVCAGGNAGPSTQTVVNTAPWILTVAATTLDRSFATPITLGN-NKLILGQAMYTGPELGF  1046

Query  1319  ------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD----  1170
                     P +    + GE + +    +   + GKIV  F     R    V +A      
Sbjct  1047  TSLVYPEDPGNSNDTFSGECESLNLNSN-RTMAGKIVLCF--TTTRGYTTVSRAASFVKR  1103

Query  1169  AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
             AG +G+I + NP    +L       P V VDY+ GT I  YI +S  +P  ++   +  V
Sbjct  1104  AGGLGLIIARNPGY--TLNPCKDDFPCVAVDYELGTDILFYI-RSNGSPVVKIQPSRTMV  1160

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHAA  825
             G+ +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P +    GGF + SGTS A 
Sbjct  1161  GQPVGSKVATFSSRGPNSISPAILKPDIAAPGVSILAATSPNATFNAGGFVMLSGTSMAT  1220

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P +S ++ALLK  HP+WSPAA +SA+VTTAW +D +   + A+GSS + AD FDYGGG+V
Sbjct  1221  PAISGVLALLKSLHPDWSPAAFRSAIVTTAWRTDPFGEQLPAEGSSRKVADPFDYGGGLV  1280

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A +PGL+YDM   DY  YLC++                        +C   +PS+L
Sbjct  1281  NPEKAAEPGLIYDMGPKDYILYLCSV------------------------VCTDQKPSVL  1316

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             D+NLPS+ +P+L   V L RTVTNVGPV+SVYK +V+ P+G  V V PK L F+   K  
Sbjct  1317  DMNLPSITIPNLKDEVILTRTVTNVGPVHSVYKVVVEPPLGVRVVVTPKKLVFNSKTKSV  1376

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             SFT+RVS    +N+ + FGSL WSD V  V  P++VR  I+  Y
Sbjct  1377  SFTVRVSTTHKINTGYYFGSLIWSDSVRKVTIPVSVRTQILQNY  1420



>ref|XP_006391366.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
 gb|ESQ28652.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
Length=729

 Score =   545 bits (1405),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 333/764 (44%), Positives = 457/764 (60%), Gaps = 43/764 (6%)
 Frame = -3

Query  2432  VGTNAKVL----KENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYS  2265
             + T  KVL    K   K+I+IV+LG K HD    +  SHY +L  V+GS E A+K++VYS
Sbjct  4     LATIKKVLIVPNKSESKRIHIVHLGAKKHDTPELVTRSHYQILEPVLGSKESAKKSIVYS  63

Query  2264  YRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLR  2085
             Y++GFSGFAA LTASQAK ++    V+SV+  +  +++T+R++D+LGL    + P  LL 
Sbjct  64    YKHGFSGFAAKLTASQAKNLSAHPEVLSVMPSRVLRLKTTRTFDYLGLL--PSTPKGLLH  121

Query  2084  KTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIG  1905
              T  G   I+GV+DSGI  E  SF D G+GP+P+RWKG C +  G  F+  + CN+KVIG
Sbjct  122   DTRLGSEAIIGVIDSGIWPESGSFNDTGLGPIPKRWKGKCES--GDGFDPKKHCNKKVIG  179

Query  1904  ARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVR  1725
             A++F +G    +D   +    +D  S  D  GHG+ V++I AGSFV  A+  G+  G  R
Sbjct  180   AKFFIEGLSAMRDGQYDFTEENDFRSSRDGVGHGTHVSAIAAGSFVEKASYHGLAGGAAR  239

Query  1724  GGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEA  1545
             G A  AR+A YKACW        C   D+L AI+++I D VDVIS+S+G+  P + D++ 
Sbjct  240   GAAPHARIAVYKACW----ANVGCITPDILKAIEHSIRDGVDVISISIGTDAPASFDID-  294

Query  1544  ENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNG  1365
             E  I  GSF A+ +GIPV+ AAGN GP+A T+ NV PW+I VAA+++DR F   ITLGN 
Sbjct  295   EKDIAFGSFQAVMQGIPVVAAAGNEGPNAQTVDNVAPWIINVAATSMDRSFPMPITLGNN  354

Query  1364  EKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLV  1185
                     L  G      + F    + + +LM   +     KG+IV  F  + +      
Sbjct  355   LTI-----LGEGLNTFQEVGFTDLVLSD-ELMEASIAQGATKGQIVLAFTPNFEAK-EKA  407

Query  1184  DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
             ++   AG  G+IY+  S +D     +  IP   VDY+ GT I  YI Q+T  P A+LS  
Sbjct  408   ERVMKAGCAGMIYAQ-SVLDPTVCSSFDIPCAVVDYEFGTDILYYI-QTTEVPIAKLSPS  465

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAA  825
             K  +GR +  +V  FS RGP+S +P I+K          +C      GG+++ SGTS A 
Sbjct  466   KTLIGRPIASRVARFSCRGPNSVSPAILK----------VCE--AISGGYKLMSGTSMAT  513

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P VS IV LL+   P WSPAAI+SALVTTAW +D +  P+F++GS+ + AD FDYGGG++
Sbjct  514   PVVSGIVGLLRQIRPNWSPAAIRSALVTTAWRTDPFGEPLFSEGSTRKLADPFDYGGGLI  573

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP    DPGLVYDM   DY  YLC+  Y +S I K I  +           CP  +PSML
Sbjct  574   NPEKVTDPGLVYDMGFDDYVHYLCSAEYGDSEISKLIGKDYK---------CPWPKPSML  624

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             + NLPS+ +P L   VT+ RTVTNVGP  SVYKA+V++P G  + V PK L F  N  K 
Sbjct  625   NFNLPSITIPSLTGEVTVARTVTNVGPPGSVYKAMVENPFGIELEVNPKTLEFGSNTTKI  684

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             ++++RV  +  VNS F FGSL W+DGVHNV  P++VR  I+  Y
Sbjct  685   TYSVRVRTNHKVNSDFYFGSLCWTDGVHNVTIPVSVRTKILRNY  728



>ref|XP_004957446.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=768

 Score =   547 bits (1409),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 338/773 (44%), Positives = 447/773 (58%), Gaps = 56/773 (7%)
 Frame = -3

Query  2393  KIYIVYLGGK-PHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
              +YIVY+G + P      +++SH+ +LA V+GS   A+ A++YSYR+GFSGFAAVLT  Q
Sbjct  25    NVYIVYMGERSPELQPALVRDSHHGMLAAVLGSEPAAKDAILYSYRHGFSGFAAVLTDRQ  84

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A ++A   GVV VV ++   + T+RSWDF+ L    +  G +L ++  G+  I+GV+D+G
Sbjct  85    AAQLADWPGVVRVVRNRVLDLHTTRSWDFMRLKPSPS--GGILLESRFGEDSIIGVLDTG  142

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+G VP+RWKG C  I G RFN S  CNRK+IGA+W+ KG     + + 
Sbjct  143   IWPESASFRDDGIGEVPRRWKGRC--IAGDRFNASN-CNRKIIGAKWYIKG----YEAEY  195

Query  1856  NKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
              K   +D Y   S  D  GHG+  AS  AG+ V NA   G+  G+ RGGA  AR+A YK 
Sbjct  196   GKMNTTDVYEFMSARDAVGHGTHTASTAAGALVANANFRGLASGVARGGAPNARLAVYKV  255

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CW        C  AD+LAA D AIHDRVDV+SVS+G   PL + ++  + + IGSFHA+ 
Sbjct  256   CWATGD----CTSADILAAFDDAIHDRVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVA  309

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GI V+ +AGN+GP + T+ N  PW++TVAA T+DR F   ITLGN   Y V   L +G 
Sbjct  310   KGIVVVCSAGNSGPYSETVINSAPWIVTVAAGTLDRTFLTKITLGNNSTY-VGQTLYSG-  367

Query  1325  ALSHPLH---------FAGKYMGEAD---LMPRKLDPAEVKGKIVFMFGDDLDRNL-VLV  1185
                HP            A     + D        L+   VKG +V  F     R+  V V
Sbjct  368   --KHPAKSMRVVYAEDIASNNADDTDARSCTAGSLNSTLVKGNVVLCFQTRAQRSASVAV  425

Query  1184  DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
             +    A  VGVI++     D     +  IP VQVDY  GT I  Y   S   PT Q SS 
Sbjct  426   ETVKKARGVGVIFAQFLTKDIASSFD--IPCVQVDYQVGTAILAYT-TSMRNPTVQFSSA  482

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--------DPTSDGGFRI  849
             K  +G  + P+V  FSSRGPSS +P ++KPDIAAPG  I+ A               F+I
Sbjct  483   KTILGELIGPEVAYFSSRGPSSLSPSVLKPDIAAPGVNILAAWTPAAAISSAIGSVNFKI  542

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS + PH+S + ALLK  HP WSPAA+KSALVTTA   D Y   I ++ +    A+ 
Sbjct  543   DSGTSMSCPHISGVAALLKSMHPNWSPAAVKSALVTTANIHDNYGFEIVSEAAPYNQANP  602

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FDYGGG VNPN A  PGLVYDM   DY ++LC++GYN+S I          S T++H  C
Sbjct  603   FDYGGGHVNPNRAAHPGLVYDMGTSDYVRFLCSMGYNSSAI---------SSMTQQHATC  653

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
               T  + L+LNLPS+ +P+L   +T+ RTVTNVG V S Y+A V+ P G  V V P +L 
Sbjct  654   QHTPKTQLNLNLPSITIPELRGKLTVSRTVTNVGSVMSKYRAHVEPPPGVDVAVSPSLLT  713

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             F+   ++ +F +   A   V   +TFGSLTW DG H VR P+ VR MI   Y+
Sbjct  714   FNSTVRRLTFKVTFQAKLKVQGRYTFGSLTWEDGAHTVRIPLVVRTMISKFYV  766



>ref|XP_010449086.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010449087.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=755

 Score =   546 bits (1407),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 319/755 (42%), Positives = 458/755 (61%), Gaps = 47/755 (6%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +KIYIV+LG + HDD   + ESH  +L  V  S E ARK+++Y+Y +GFSGF+A LT SQ
Sbjct  36    RKIYIVHLGARQHDDPELVSESHQRMLESVFESPEAARKSIIYNYHHGFSGFSARLTDSQ  95

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AK+++    V SV  ++  ++QT+R +D+LGLS     P  +L +TN G  +++G +DSG
Sbjct  96    AKQLSDRPDVFSVSPNRMVQLQTTRVYDYLGLS--PTFPKGILHETNMGSDLVIGFLDSG  153

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG---ALLSQD  1866
             I  E P+F D G+GP+P+ WKG C A  G  F+ ++ CN+K++GA++F  G       + 
Sbjct  154   IWPESPAFNDEGLGPIPKHWKGKCVA--GEEFDPAKHCNKKLVGAKYFTDGWDEMFPGER  211

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
             +   ++ +S       ++GHG+ VASI A SFVPN +  G+  G++RGGA  AR+A YK 
Sbjct  212   ISEEEYYMSPR----GLSGHGTTVASIAASSFVPNVSYGGLAPGVMRGGAPKARIAMYKV  267

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
              W  D E F  +   ++ A+D AI+D VDV+S+S+G  +P  S    E+ + +GSFHA+ 
Sbjct  268   VW--DRESFGSSIVHMVKAVDEAINDGVDVLSISIGGILP--SGPYQEDDMALGSFHAVM  323

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +GIPV+  A N GP+A T++NV PW+ITVAA+ IDR F   +T GN           N T
Sbjct  324   KGIPVVAGAANTGPAASTVSNVAPWLITVAATNIDRTFYVDMTFGN-----------NIT  372

Query  1325  ALSHPLHFAGKYM--GEADLMPRKLDPAEVKGKIVFMF-GDDLDRNLVLVDKATDAGAVG  1155
              +    H  GK +  G   L   + D + + GK+   F  +D +    LV   T+  A G
Sbjct  373   MIGQAQH-TGKELSAGLVYLEDYQNDTSPIPGKVFLTFVKEDWEMTSALV-AGTNNKASG  430

Query  1154  VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTP  975
             +I +  ++  S  +   + PY+ VD++ G +I  YI +S  +PT ++S  K  VGR +  
Sbjct  431   MIVARSTDQQSAAVY--KEPYIYVDHEVGAKILRYI-RSASSPTIKISKGKTLVGRPIAT  487

Query  974   KVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCAD----PTSDGGFRISSGTSHAAPHVSAI  807
             +V  FSSRGP+  +P I+KPDIAAPG  I+ A     P   GG+ +  GTS A P VS +
Sbjct  488   QVCGFSSRGPNPISPAILKPDIAAPGVTILGATSESFPDFYGGYILGVGTSFATPVVSGL  547

Query  806   VALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAAD  627
             V LLK  HP+WSPAA+KSA++T+AW +D    PIFA+G   + AD FDYG G+VN   A 
Sbjct  548   VVLLKALHPDWSPAALKSAIMTSAWKTDPSGDPIFAEGQPRKLADPFDYGAGLVNMERAK  607

Query  626   DPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPS  447
             DPGLVYDM   DY  + CA GYN + I   + G   R        C    PS+LD N P+
Sbjct  608   DPGLVYDMNVDDYIHFFCASGYNETAI-TILVGKPTR--------CSSPLPSILDFNYPA  658

Query  446   MVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRV  267
             + +PDL + VT+ RTVTNVGPV+SVY+A+V+ P G  + V+P+ L FD N KK  F +RV
Sbjct  659   ITIPDLKEEVTITRTVTNVGPVDSVYRAVVEPPEGVKIVVEPEALVFDWNTKKLGFKVRV  718

Query  266   SADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             S+    N+ + FGS TW+DG  NV  P++VR  ++
Sbjct  719   SSSHKSNTGYFFGSFTWTDGTRNVTIPLSVRTRVL  753



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score =   545 bits (1405),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 327/762 (43%), Positives = 459/762 (60%), Gaps = 50/762 (7%)
 Frame = -3

Query  2375  LGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagv  2196
             +G + H++   + ESH+++L+ V GS E A+++++YSY++GFSGFAAVLT SQAK +A +
Sbjct  1     MGERQHEEPDLVSESHHEILSNVFGSKEAAKQSILYSYKHGFSGFAAVLTQSQAKLIADI  60

Query  2195  agvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPS  2016
              GVV V+ ++   + T+RSW+FL ++  +++   +L ++  G G I+G++D+GI  E  S
Sbjct  61    PGVVHVIPNRVLNLHTTRSWNFLQVN--SHISNGILSRSQSGAGSIIGIIDTGIWPESVS  118

Query  2015  FGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSD  1836
             F D GMG VP RW+G C+   G RFN S  CNRK+IGARW+ KG     + +      SD
Sbjct  119   FRDDGMGDVPSRWRGICQE--GERFNRSH-CNRKIIGARWYIKG----YEAEFGNLSTSD  171

Query  1835  SY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPE  1665
              +   S  D  GHG+  AS  AG+ + NA+ +G+  G+ RGGA +AR+A YK CW     
Sbjct  172   GFEFRSPRDAEGHGTHTASTAAGASIENASFMGLAAGLARGGAPSARLAVYKVCWGTGS-  230

Query  1664  RFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIV  1485
                C+ ADLLAA D AI D VDV+S S+GSP PL S ++  + + IGSFHA+ +GI VI 
Sbjct  231   ---CSSADLLAAFDDAIFDGVDVLSASLGSPPPLPSYVK--DVVSIGSFHAVAKGISVIC  285

Query  1484  AAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG--TALSHP  1311
             +AGN+GP   T+ N  PW+ TVAASTIDR F   ITLGN +   V   L  G  T   +P
Sbjct  286   SAGNSGPYPQTVINSAPWIFTVAASTIDRAFPTAITLGNNQT-VVGQALYTGMDTNKFYP  344

Query  1310  LHFAGKYM---------GEADLMPRKLDPAEVKGKIVFMFGDDLDR-NLVLVDKATDAGA  1161
             L + G            G  D     L+     GK++  F     R  +  +        
Sbjct  345   LVYGGDIASIDADEDSAGNCD--SGTLNDTLASGKMILCFQSRTQRLAITAIRTVMKVKG  402

Query  1160  VGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRAL  981
              G+I++   + D + + + R+P VQVD+  GT +  YI  +T  P  + +  K QVG+ +
Sbjct  403   AGLIFAQFPSKD-VSLSSGRLPCVQVDFAIGTYLLTYI-GATRNPLVKFNPTKTQVGQQI  460

Query  980   TPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-----DPT-SDGGFRISSGTSHAAPH  819
             +P+V  FSSRGP+S +P I+KPDI APG  I+ +      P+ S   F+I SGTS + PH
Sbjct  461   SPEVAFFSSRGPNSLSPSILKPDITAPGVNILASWSPARSPSKSPDTFKIESGTSMSCPH  520

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             +S IVALLK  HP WSPAAIKSALVTTA   D Y   I A+G+  + AD FDYGGG V+P
Sbjct  521   ISGIVALLKAIHPTWSPAAIKSALVTTASLEDEYAQSIVAEGAPHKQADPFDYGGGHVDP  580

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
             N A  PGL+YD+   DY  +LC++GYNN+ I   ++G +          C K+   +++L
Sbjct  581   NKAISPGLIYDIESSDYIHFLCSMGYNNTAI-SLVAGTK--------ITCQKSTKFIVNL  631

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             NLPS+ + +L + +T+ R VTNVGPVNSVY A V++P G  V VKP VL F+   KK  F
Sbjct  632   NLPSITIHELKQSMTVSRRVTNVGPVNSVYFARVQAPAGVSVKVKPSVLSFNSTVKKLEF  691

Query  278   TMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              +   +   V   FTFG+L W DG+H VR P+ VR ++  LY
Sbjct  692   KVIFCSLLRVQGRFTFGNLFWEDGLHVVRIPLVVRTVLDDLY  733



>ref|XP_008342302.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   546 bits (1408),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 326/770 (42%), Positives = 461/770 (60%), Gaps = 51/770 (7%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             K +YIVY+G + H +   + ESH+  L+ V GS E A+++++Y+Y++GFSGFAAVLT  Q
Sbjct  29    KNVYIVYMGERQHGEPELVSESHHQTLSSVFGSKEAAKESILYNYKHGFSGFAAVLTPCQ  88

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AK +A   GVV V+ ++   + T+RSW+FL ++  +++   +L K+  G G I+G++D+G
Sbjct  89    AKLIADSPGVVHVIPNRILNLHTTRSWNFLEVN--SHIRNGILSKSQSGIGSIIGIMDTG  146

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D GMG  P R++G C+   G +FN S  CNRK+IGARW+ KG     + + 
Sbjct  147   IWPESESFRDEGMGDAPSRFRGICQE--GEKFNRSH-CNRKIIGARWYSKG----YEAEF  199

Query  1856  NKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
                  SD +   S  D AGHG+  +S  AG  + NA+  G+  G+ RGGA +AR+A YK 
Sbjct  200   GNLSTSDEFEYLSPRDAAGHGTHTSSTAAGDSIENASYKGLSAGLARGGAPSARLAVYKV  259

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CW        C+ ADLLAA D AI+D VDV+SVS+GSP PL+S +E  + + IGSFHA+ 
Sbjct  260   CWATGG----CSSADLLAAFDDAIYDGVDVLSVSLGSPPPLSSYVE--DAVAIGSFHAVA  313

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             RGI VI +AGN+GP   T+ N  PW+ TVAASTIDR F   ITLGN +   V   L  G 
Sbjct  314   RGISVICSAGNSGPYPQTVINSAPWIFTVAASTIDRAFPTVITLGNNQT-VVGQALYTGM  372

Query  1325  ALS--HPLHFAGKYM---------GEADLMPRKLDPAEVKGKIVFMFGDDLDR-NLVLVD  1182
              ++  +PL + G            G  D  P  L+     GK++  F     R ++    
Sbjct  373   DINKYYPLVYGGDIASIDSDEDTAGSCD--PGTLNETLATGKVILCFQSQSQRFSIPATT  430

Query  1181  KATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
               T A   G+I++   + D + + +  +P VQVD+  GT +  YI  +T  P  + +  K
Sbjct  431   TVTSARGAGLIFAQFPSKD-VSLSSGSLPCVQVDFAIGTNLLTYI-GATRNPVVKFNPSK  488

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-------DPTSDGGFRISS  843
               VG+ ++P+V  FSSRGP+S +P ++KPDIAAPG  I+ +       +  +   F+I S
Sbjct  489   TLVGQQISPEVAFFSSRGPNSLSPSVLKPDIAAPGVNILASWSPARSQNQANPDIFKIES  548

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFD  663
             GTS A PH+S IVALLK  HP WSPAAIKSALVTTA   D Y   I A+G+  + AD FD
Sbjct  549   GTSMACPHISGIVALLKSIHPTWSPAAIKSALVTTASLEDEYGQSIVAEGAPHKQADPFD  608

Query  662   YGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPK  483
             YGGG V+PN A  PGL+YD+   DY ++LC++GYNN+ I   ++G +          C K
Sbjct  609   YGGGHVDPNKAIAPGLIYDIESSDYIRFLCSMGYNNTAI-SLVAGAK--------ITCRK  659

Query  482   TRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFD  303
             +   + +LNLPS+ + +L +  T+ RTVTNVGPVNS+Y A V +P G  V VKP +L F+
Sbjct  660   STNFINNLNLPSITIHELKQRTTVSRTVTNVGPVNSIYNARVITPAGVSVRVKPSILSFN  719

Query  302   GNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
                KK  F +   +   +   F+FG+L W DG+H VR P+ VR ++   Y
Sbjct  720   STVKKLEFKVTFRSLLRIQGRFSFGNLFWEDGLHVVRIPLIVRIVLDNFY  769



>ref|XP_009348700.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=778

 Score =   546 bits (1408),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 331/752 (44%), Positives = 463/752 (62%), Gaps = 37/752 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +++IVYLG K +DD    K+ H+ +L  ++GS E+A ++++YSY YGFSGFAA LT SQA
Sbjct  42    EVHIVYLGEKKYDDPALTKKFHHKMLTTLLGSKEDAYRSIIYSYNYGFSGFAARLTESQA  101

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +++A    VV V+ ++ HK+ T+RSWDF+G+   ++    LL K+  G G I+GV+DSG+
Sbjct  102   EEIAEFPEVVQVIPNRVHKLHTTRSWDFIGIHRYSS--DNLLTKS-MGKGTIIGVIDSGV  158

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D  MGP+P  WKG C+   G  FN +  CN+K+IGARWF KGA  +Q  +LN
Sbjct  159   WPESESFNDDAMGPIPSHWKGICQQ--GEYFNSTN-CNKKIIGARWFKKGAK-NQFQNLN  214

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             K    D  S  D  GHG+  AS  AG FV NA   G+  G+ RGGA  A +A YKACW  
Sbjct  215   KTNNVDFLSPRDGIGHGTHTASTAAGYFVKNANYRGLASGLARGGAPLAHLAIYKACWAF  274

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             +     C  ADLL A D AIHD VD+IS+SVG+ +PL S ++  + I IGSFHA+T+GI 
Sbjct  275   EG----CTDADLLKAFDKAIHDGVDIISLSVGNEIPLFSYVDQRDSIAIGSFHAVTKGIT  330

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGN-----GEKYAVDWQLPNG  1329
             V+ +A N GP + TI N  PW+ITVAA+TIDR F   ITLGN     G+   V    P  
Sbjct  331   VVCSAENDGPISQTIVNTAPWLITVAATTIDRAFPTAITLGNNQTLWGQSIDVGKYNPEF  390

Query  1328  TALSHPLHFAGKYMGEA--DLMPRKLDPAEVKGKIVFMFGDDLDRNL-VLVDKATDAGAV  1158
              ++++    A     ++  D  P  L+     GKIV  F     +++        DAG V
Sbjct  391   ASITYSERIAIDPTDDSAKDCQPGSLNATLASGKIVLCFSKSDQQDIESAATTVKDAGGV  450

Query  1157  GVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALT  978
             G+I++   N D L   +  IP + VDY+ GT+I  YI ++  +  A+LS PK  +G+ ++
Sbjct  451   GLIFAQFRN-DGLS--SCDIPCISVDYEVGTQILSYIRRARHS-IAKLSDPKTTIGKWVS  506

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSA  810
             P+V  FS+RGPSS  P ++KPDIAAPG  I+ A    D     G+ + SGTS A PHV+ 
Sbjct  507   PRVASFSARGPSSMTPEVLKPDIAAPGVDIIAAFRPLDTEHRSGYALLSGTSMACPHVAG  566

Query  809   IVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAA  630
             I AL+K +HP WSPAAIKSALVTTA  + T  + I A+G + + AD FD GGG V+PN A
Sbjct  567   IAALIKSAHPNWSPAAIKSALVTTASQTGTDGTSISAEGLTRKEADPFDMGGGHVDPNKA  626

Query  629   DDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLP  450
              DPGL++D    DY Q+LC+LGY ++ I +            ++TI   T+   ++ NLP
Sbjct  627   IDPGLIFDTSTKDYMQFLCSLGYTSASITR----------LTKNTINCSTKGHGMNFNLP  676

Query  449   SMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMR  270
             S+ +P+L +  T+ RTVTNVG +NS Y  +V++P G  +TV+P+ L F+   +  SF + 
Sbjct  677   SITIPNLKRATTVTRTVTNVGQINSKYTVLVQAPSGVKMTVEPQSLIFNITSQILSFKVT  736

Query  269   VSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
               + + VN  + FGSLTW+DG H VR+P+A+R
Sbjct  737   FFSTERVNGGYKFGSLTWTDGEHIVRSPVAIR  768



>gb|KFK45042.1| hypothetical protein AALP_AA1G336600 [Arabis alpina]
Length=741

 Score =   545 bits (1405),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 329/772 (43%), Positives = 450/772 (58%), Gaps = 68/772 (9%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             VL     K++IVYLG K H D   + +SH+ +L+ ++GS E+A  +M++SYR+GFSGFAA
Sbjct  16    VLNVQSSKVHIVYLGEKQHHDPDFVTDSHHQMLSSLIGSEEDAHDSMLHSYRHGFSGFAA  75

Query  2234  VLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIV  2055
              LT SQAKK+A   GVV V+ D  +++ T+R+WD+LGLS  A  P  LL   N GD +I+
Sbjct  76    KLTESQAKKIADSPGVVHVIPDSFYELATTRTWDYLGLS--APSPKNLLNDVNMGDQVII  133

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             GV+D+G+  E  SF D G G +P +WKG C +  G  F  +  CNRK+IGA++F      
Sbjct  134   GVIDTGVWPESESFNDNGFGTIPSKWKGGCES--GENFTSTN-CNRKLIGAKYF------  184

Query  1874  SQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVAS  1695
                  +N FL  +   G+                   N T   +  G VRGGA  AR+A 
Sbjct  185   -----MNGFLAENP--GF-------------------NLTESRLARGTVRGGAPRARIAV  218

Query  1694  YKACWNL-DPERFVCAGADLLAAIDYAIHDRVDVISVS---VGSPVPLASDMEAENGIGI  1527
             YKACW + D     C  +D+L A+D A+HD VDV+S+S   V  P PL  + +  + I I
Sbjct  219   YKACWYMHDGVNVTCLSSDILKAMDEAMHDGVDVLSLSFALVSQPAPLYPETDLRDTIPI  278

Query  1526  GSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD  1347
             G+FHA+ +GI V+ A  NAGP+A T+ N  PW+ITVAA+T+DR F   ITLGN  K  + 
Sbjct  279   GAFHAVAKGIVVVCAGANAGPAAQTVVNTAPWIITVAATTLDRSFPTPITLGN-NKMILG  337

Query  1346  WQLPNG-----TALSHPLHFAGKYMGEADLMPR-KLDPAEVKGKIVFMFGDDLDRNLVLV  1185
               L  G     T+L +P          + +  R  ++P     + V +       N  + 
Sbjct  338   QALYTGPELGFTSLVYPEDPGNSNETFSGVCERLHINPNRTLAEKVVLCFTTTTLNPAVA  397

Query  1184  DKATDAGAVG----VIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQ  1017
               A+   A G    +I  NP N   L       P + +DY  GT I  YI +ST +P  +
Sbjct  398   SAASYVKAAGGLGLIIARNPGN--QLNPCRDDFPCIAIDYKLGTDILLYI-RSTRSPVVK  454

Query  1016  LSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRI  849
             +   K  VG+ +  KV  FSSRGP+S AP I+KPDI APG  I+ A    D  +D GF +
Sbjct  455   IQHSKTLVGQPIGTKVATFSSRGPNSIAPAILKPDIGAPGVSILAATSPNDTFNDRGFSM  514

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS AAP +S +V+LLK  HP+WSPAA +SA+VTTAW +D     IFA+GS  +  D 
Sbjct  515   KSGTSMAAPVISGVVSLLKALHPDWSPAAFRSAIVTTAWRTDPLGEQIFAEGSPCKVVDP  574

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FDYGGGIVNP  A +PGL+YDM   DY  YLC+ GYN+S I + +            T+C
Sbjct  575   FDYGGGIVNPEKAAEPGLIYDMGSEDYIIYLCSAGYNDSSISQLVG---------RVTVC  625

Query  488   PKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
                +PS+LD+NLPS+ +P+L   V L RTVTNVGPV+SVYK +V+ P+G  V V P++L 
Sbjct  626   SNPKPSVLDVNLPSITIPNLKDEVNLTRTVTNVGPVDSVYKVVVEPPLGVRVAVTPEMLM  685

Query  308   FDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F+   K+ SFT+RVS    +N+ F FGSL W+D VHNV  P+++R  I+  Y
Sbjct  686   FNSTTKRVSFTVRVSTTHKINTGFYFGSLIWTDSVHNVTIPVSIRTQILQNY  737



>gb|EAZ09847.1| hypothetical protein OsI_32138 [Oryza sativa Indica Group]
Length=769

 Score =   546 bits (1407),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 336/770 (44%), Positives = 449/770 (58%), Gaps = 49/770 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDH-RRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
              +YIVY+G + H      ++E+H+ +LA V+GS + A  A++YSYR+GFSGFAAVLT  Q
Sbjct  25    NVYIVYMGERHHGLRPELVQEAHHGMLAAVLGSEQAAMDAILYSYRHGFSGFAAVLTGGQ  84

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A +++   GVV VV ++   + T+RSWDF+G++   +  G +L ++  G+  I+GV+D+G
Sbjct  85    AARLSDWPGVVRVVRNRVLDLHTTRSWDFMGVNPSPS-GGGILLESRFGEDSIIGVLDTG  143

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+G VP+RWKG C  + G +FN S  CNRK+IGA+W+ KG     + + 
Sbjct  144   IWPESASFRDDGIGEVPRRWKGQC--VAGEKFNASN-CNRKIIGAKWYVKG----YEAEY  196

Query  1856  NKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
              K   SD Y   S  D  GHG+  AS  AG+ V NA+  G+  G+ RGGA  AR+A YK 
Sbjct  197   GKMNTSDIYEFMSARDAVGHGTHTASTAAGALVANASFRGLAKGVARGGAQRARLAVYKV  256

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CW        C  AD+LAA D AIHD V+VISVS+G   PL + ++  + + IGSFHA+ 
Sbjct  257   CWATGD----CTAADILAAFDDAIHDGVNVISVSLGQAPPLPAYVD--DVLSIGSFHAVA  310

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +G+ V+ +AGN+GP + T+ N  PW++TVAA TIDRIF   I LGN   Y V   L +G 
Sbjct  311   KGVVVVCSAGNSGPYSETVINSAPWIVTVAAGTIDRIFLAKIILGNNSTY-VGQTLYSGK  369

Query  1325  ALSHPLHFAGKYMGEAD---------LMPRKLDPAEVKGKIVFMFGDDLDRNL-VLVDKA  1176
               S  +         +D              L+   VKG +V  F     R+  V V+  
Sbjct  370   HPSKSVRIVYAEDISSDNADDTDARSCTAGSLNATLVKGNVVLCFQTRAQRSASVAVETV  429

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
               A  VGVI++     D    L+  IP VQVDY  GT I  Y   S   P AQ S PK  
Sbjct  430   KKARGVGVIFAQFLTKDIASSLD--IPCVQVDYQVGTAILAYT-TSMRNPVAQFSFPKTI  486

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--------DPTSDGGFRISSG  840
             VG  + P+V  FSSRGPSS +P I+KPDIAAPG  I+ A               F+I SG
Sbjct  487   VGELVAPEVAYFSSRGPSSLSPSILKPDIAAPGVNILAAWSPAAAISSAIGSVNFKIDSG  546

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS + PH+S +VALLK  HP WSPAA+KSALVTTA   D Y   + ++ +    A+ FDY
Sbjct  547   TSMSCPHISGVVALLKSMHPNWSPAAVKSALVTTANVHDAYGFEMVSEAAPYNDANPFDY  606

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGG VNPN A  PGLVYDM   DY ++LC++GYN S I          S T++ T C   
Sbjct  607   GGGHVNPNRAAHPGLVYDMGVSDYMRFLCSMGYNTSAI---------SSMTQQQTTCQHM  657

Query  479   RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDG  300
               S L+LN+PS+ +P+L   +T+ RTVTNVGP  S Y+A V++P G  VTV P +L F+ 
Sbjct  658   PKSQLNLNVPSITIPELRGKLTVSRTVTNVGPALSKYRARVEAPPGVDVTVSPSLLTFNS  717

Query  299   NRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
               +K  F +   A   V   +TFGSLTW DG H VR P+ VR +I   Y+
Sbjct  718   TVRKLPFKVTFQAKLKVQGRYTFGSLTWEDGTHTVRIPLVVRIIISKFYV  767



>emb|CAB87667.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=755

 Score =   546 bits (1406),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 322/753 (43%), Positives = 458/753 (61%), Gaps = 47/753 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K++IVYLG K H+D   +  SH  +L  ++GS ++A +++V+SYR GFSGFAA LT SQA
Sbjct  36    KVHIVYLGEKEHNDPELVTSSHLRMLESLLGSKKDASESIVHSYRNGFSGFAAHLTDSQA  95

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             ++++ V  V     +  +++QT+R++D+LGLS   + P  LL +   G+ +I+GV+DS  
Sbjct  96    EQISDVVQVT---PNTFYELQTTRTFDYLGLSH--STPKGLLHEAKMGEDIIIGVLDS--  148

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG C  + G  F+  + CN+K+IGAR++          D +
Sbjct  149   --ESQSFNDKGLGPIPKRWKGMC--VDGEDFDSKKHCNKKLIGARYYMDSLFRRNKTD-S  203

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                 ++  S  +   HG+ VAS   GSFV N +  G  VG +RGGA  AR+A YK CW  
Sbjct  204   GIPDTEYMSARESLPHGTHVASTAGGSFVSNVSDNGFGVGTIRGGAPRARIAVYKVCWQR  263

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
                   CA AD++ A+D AI D VD+I++S+G P P+ ++++  N I  G+FHA+ +GIP
Sbjct  264   VDR--TCASADIIKAMDDAIADGVDLITISIGRPNPVLTEVDVYNQISYGAFHAVAKGIP  321

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ A GN GP A+T+ N+ PW+ITVAA+T+DR +   +TLGN           N T ++ 
Sbjct  322   VLSAGGNFGPGAYTVQNIAPWIITVAATTLDRWYPTPLTLGN-----------NVTLMAR  370

Query  1313  PLHFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLV-LVDKATDAGAVGVI  1149
               +   +  G  DLM    P ++  A  KGK+V  F    + +    V K     A  VI
Sbjct  371   TPYKGNEIQG--DLMFVYSPDEMTSA-AKGKVVLTFTTGSEESQAGYVTKLFQVEAKSVI  427

Query  1148  YSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
              +   N D + + +  +P + VDY+ G+ I  Y+  + M PT ++SS     GR +  KV
Sbjct  428   IAAKRN-DVIKV-SEGLPIIMVDYEHGSTIWKYLSITRM-PTIKISSAIALNGRLVATKV  484

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PTSDG---GFRISSGTSHAAPHVSAIVA  801
              DFS RGP+S +P ++KPD+AAPG  I+ A  P S G   GF I SGTS + P V+ +VA
Sbjct  485   ADFSGRGPNSISPYVLKPDVAAPGVAIVAASTPESMGTEEGFAIQSGTSMSTPVVAGLVA  544

Query  800   LLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDP  621
             LL+  HP+WSPAA+KSAL+TTA  +D Y  PIF++G + + AD FD+GGG+VNPN A DP
Sbjct  545   LLRAVHPDWSPAALKSALITTASTTDPYGEPIFSEGMTRKLADPFDFGGGLVNPNKAADP  604

Query  620   GLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMV  441
             GLVYD+   DY  +LCA  Y+   I K        S T     CP  +PSMLDLNLPS+ 
Sbjct  605   GLVYDISAEDYRLFLCASHYDEKQITKI-------SKTHTPYRCPSPKPSMLDLNLPSIT  657

Query  440   VPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA  261
             +P L + VTL RTVTNVGPV+SVYK IV+ P+G  ++V P  L F+ N K  S+ + VS 
Sbjct  658   IPFLKEDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVKILSYKVTVST  717

Query  260   DKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
                 NS + FGSLTW+DG H V  P++VR  ++
Sbjct  718   THKSNSIYYFGSLTWTDGSHKVTIPLSVRTQML  750



>ref|XP_011037192.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=775

 Score =   546 bits (1407),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 332/773 (43%), Positives = 457/773 (59%), Gaps = 59/773 (8%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIVY+G K HD+   ++ESH++LLA +VGS + A+++++YSY++GFSGFAAVLT SQ K
Sbjct  32    VYIVYMGDKLHDEPELVQESHHELLADIVGSKDAAKESILYSYKHGFSGFAAVLTKSQEK  91

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGD---GMIVGVVDS  2040
              +A   GVV VV ++     T+RSWDFL       V  +L+ + + G    G I+GV+D+
Sbjct  92    LIADFPGVVGVVRNRIISSHTTRSWDFL------QVKPQLVGRISTGHSGAGSIIGVMDT  145

Query  2039  GISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVD  1860
             GI  E  SF D GM  VP RW+G C+   G  FN S  CNRK+IGARW+ KG     + +
Sbjct  146   GIWPESKSFRDEGMAEVPSRWRGICQE--GEGFNRSH-CNRKIIGARWYIKG----YEAE  198

Query  1859  LNKFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYK  1689
               K   SD     S  D  GHG+  +S   G  V NA+ +G+  G+ RGGA +A +A YK
Sbjct  199   FGKLNTSDGDEFLSPRDAGGHGTHTSSTATGGLVENASFMGLAQGLARGGAPSAWLAVYK  258

Query  1688  ACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
              CW        CA ADLLAA D AI D VDV+SVS+GS  PLA+ +E  + + IGSF+A+
Sbjct  259   VCWATGG----CAEADLLAAFDDAIFDGVDVLSVSLGSAPPLATYVE--DAVAIGSFYAV  312

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
              +GI V+ +AGN+GP   TITN  PWV+TVAASTIDR F   ITLGN +   V   L  G
Sbjct  313   AKGISVVCSAGNSGPYPQTITNTAPWVVTVAASTIDRAFPTIITLGNNQTI-VGQALYTG  371

Query  1328  TALS--HPLHFAGKYMGEAD-------LMPRKLDPAEVKGKIVFMFGDDLDR-NLVLVDK  1179
               +   HP+ +  + + +              L+    +GK++  F     R N++    
Sbjct  372   KNVDTFHPIVYGEEIVADDSDEDSARGCASGSLNATLARGKVILCFESRSQRSNIIARRT  431

Query  1178  ATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
               D   VG+I++     D    L+  IP +QVD+  GT +  Y+ +S+  P  + S  K 
Sbjct  432   VLDVKGVGLIFAQSPTKDV--TLSLDIPCIQVDFAIGTYLLTYM-ESSRNPVVKFSFTKT  488

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDGG----------FR  852
              +G+ ++P+V  FSSRGPSS +  ++KPDIAAPG  I+ +  P +             F+
Sbjct  489   VIGQQISPEVAFFSSRGPSSISATVLKPDIAAPGVNILASWSPAASPAIIDNEARPLDFK  548

Query  851   ISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAAD  672
             I SGTS + PH+S +VALLK +HP+WSPAAIKSAL+TTA   D Y     A+G+  + AD
Sbjct  549   IESGTSMSCPHISGVVALLKAAHPKWSPAAIKSALITTASIEDEYGQKTVAEGAPHKQAD  608

Query  671   AFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTI  492
              FDYGGG V+P  A  PGLV+DM   DY ++LCALGYNNS I            T   T 
Sbjct  609   PFDYGGGHVDPERAMHPGLVFDMGTSDYIRFLCALGYNNSAISLM---------TRTRTR  659

Query  491   CPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVL  312
             C K+   +++LNLPS+ +P+L + +T+ RTVTNVGP+ S+Y A V +P G  VTV+P VL
Sbjct  660   CKKSTTFLVNLNLPSITIPELKQNLTVSRTVTNVGPITSIYVARVLAPAGTHVTVEPSVL  719

Query  311   RFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              FD  RKK  F +   +   +   ++FG+L W DG H VR P+ VR +I   Y
Sbjct  720   SFDSIRKKIKFKVTFCSMLRIQGRYSFGNLFWEDGFHVVRIPLIVRTVIDDFY  772



>ref|XP_002512984.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF49487.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=774

 Score =   546 bits (1406),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 338/774 (44%), Positives = 460/774 (59%), Gaps = 55/774 (7%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
              +YIVY+G + HD+   ++ESH++ L+ ++GS E A+++++YSY++GFSGFAAVLT SQA
Sbjct  26    NVYIVYMGDRQHDEPELVQESHHNFLSDILGSKEVAKESILYSYKHGFSGFAAVLTKSQA  85

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K +AG  GVV V+ +K   + T+RSWDFL +     +   +L K + G G IVGV+D+GI
Sbjct  86    KLIAGFPGVVGVIRNKILDLHTTRSWDFLQVKP--QIWNGILSKGHFGSGSIVGVLDTGI  143

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G   +P  WKG C+   G  FN S  CNRK+IGARW+ KG     + +  
Sbjct  144   WPESESFRDEGFRGLPLGWKGICQE--GEGFNHSH-CNRKIIGARWYIKG----YEAEFG  196

Query  1853  KFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
             K   +D     S  D  GHG+  +SI  G+ V NA+  G+  GM RGGA +A +A YK C
Sbjct  197   KLNTNDGVEFLSPRDADGHGTHTSSIATGALVRNASFNGLAQGMARGGAPSAWLAIYKVC  256

Query  1682  WNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITR  1503
             W        C+ AD+LAA D A+ D  +V+SVS+GS  PLA+ +E  + I IGSFHA+ +
Sbjct  257   WATGG----CSSADILAAFDDAVFDGANVLSVSLGSTPPLATYIE--DPIAIGSFHAVAK  310

Query  1502  GIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY-AVDWQLPNGT  1326
             GI V+ +AGN+GP   T+ N  PWV+TVAASTIDR F   ITLGN +      +     T
Sbjct  311   GIVVVSSAGNSGPYPQTVQNTAPWVVTVAASTIDRAFPTIITLGNNQTLRGQAFYTGKNT  370

Query  1325  ALSHPL--------HFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVL-VDKAT  1173
                HP+        + A +Y G     P  L+    +GK++  F     R+    V    
Sbjct  371   GEFHPIVNGEDIAANDADEY-GARGCEPGTLNATLARGKVILCFQSRSQRSSTSAVTTVL  429

Query  1172  DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
             D   VG+I++     D    L+   P VQVD+  GT +  Y+ ++   P  + S  K  +
Sbjct  430   DVQGVGLIFAQYPTKDVFMSLD--FPLVQVDFAIGTYLLTYM-EADRNPVVKFSFTKTAI  486

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMC-----ADP-TSDG--------GF  855
             G+ ++P+V  FSSRGPSS +P ++KPDIAAPG  I+      A P TSD          F
Sbjct  487   GQQISPEVAFFSSRGPSSLSPTVLKPDIAAPGVNILASWSPAASPSTSDMTNNKVAPLNF  546

Query  854   RISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAA  675
             ++ SGTS A PH+S IVALLK  HP+WSPAAIKSALVTTA   D Y   I A+G+  + A
Sbjct  547   KLDSGTSMACPHISGIVALLKSIHPKWSPAAIKSALVTTASTKDEYGQHIVAEGAPHKQA  606

Query  674   DAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHT  495
             D FDYGGG VNPN A +PGL+YDM   DY  +LC++GYNNS I          S T   T
Sbjct  607   DPFDYGGGHVNPNKALNPGLIYDMGMSDYISFLCSMGYNNSAI---------SSMTRSKT  657

Query  494   ICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKV  315
             +C  +  S+L+LNLPS+ +P+L + +T+ RTVTNVGPV S+Y A V+ P G  V V+P V
Sbjct  658   VCKHSTNSLLNLNLPSIAIPNLKQELTVSRTVTNVGPVTSIYMARVQVPAGTYVRVEPSV  717

Query  314   LRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             L F+ + KKR F +   +   V   ++FG+L W DG H VRTP+ VR +I   Y
Sbjct  718   LSFNSSVKKRKFRVTFCSLLRVQGRYSFGNLFWEDGCHVVRTPLVVRTVIDEFY  771



>dbj|BAK05842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score =   545 bits (1405),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 331/767 (43%), Positives = 454/767 (59%), Gaps = 42/767 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDH-RRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
              + IVY+G +  + H   +++SH+ +LA V+GS + A  A++YSYR+GFSGFAAVLT +Q
Sbjct  25    NVQIVYMGERHPELHPELVRDSHHGMLAAVLGSKQAAEDAILYSYRHGFSGFAAVLTNAQ  84

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A +++ + GVV VV ++   + T+RSWDF+ ++        +L  +  G+  I+GV+D+G
Sbjct  85    AAQLSDLPGVVRVVRNRVLDLHTTRSWDFMRVNPSPAGGSGILSGSRFGEDSIIGVLDTG  144

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+G VP+RWKG C  + G RFN S  CNRK+IGA+WF KG   ++   +
Sbjct  145   IWPESASFRDDGIGEVPRRWKGQC--VAGERFNASN-CNRKIIGAKWFIKG-YQAEYGKM  200

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N   + +  S  D  GHG+  AS  AG+ VP+A+  G+  G+ RGGA  AR+A YK CW 
Sbjct  201   NTADIHEYMSARDAVGHGTHTASTAAGALVPDASFRGLASGVARGGAPRARLAVYKVCWA  260

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                    C  AD+LAA D AIHD VDV+SVS+G   PL + ++  + + IGSFHA+ RGI
Sbjct  261   TGD----CTSADILAAFDAAIHDGVDVLSVSLGQAPPLPAYVD--DVLAIGSFHAVVRGI  314

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG--TA  1323
              V+ +AGN+GP + T+ N  PWV+TVAA TIDR F   ITLGN   Y V   + +G   A
Sbjct  315   TVVCSAGNSGPYSETVINSAPWVLTVAAGTIDRTFLAKITLGNNSTY-VGQTMYSGKHAA  373

Query  1322  LSHPLHFAGKYMGE-AD------LMPRKLDPAEVKGKIVFMFGDDLDR-NLVLVDKATDA  1167
              S  + +A     + AD           L+   VKG +V  F     R + V V+    A
Sbjct  374   TSMRIVYAEDVSSDNADDSDARSCTAGSLNATLVKGNVVLCFQTRGQRASQVAVETVKKA  433

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
               VGVI++     D     +  IP +QVDY  GT I  Y   S   PT Q SS K  +G 
Sbjct  434   RGVGVIFAQFLTKDIASAFD--IPLIQVDYQVGTAILAYT-TSMRNPTVQFSSAKTILGE  490

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDG--------GFRISSGTSH  831
              + P+V  FSSRGPSS  P I+KPDI APG  I+ +   S           F+I SGTS 
Sbjct  491   LIGPEVAYFSSRGPSSLTPSILKPDITAPGVNILASWSPSVALSSAMGPVNFKIDSGTSM  550

Query  830   AAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGG  651
             + PH+S + ALLK  HP WSPAA+KSA+VTTA   D Y   + ++ +  + A+ FDYGGG
Sbjct  551   SCPHISGMAALLKSMHPNWSPAAVKSAMVTTANVHDEYGFEMVSEAAPYKQANPFDYGGG  610

Query  650   IVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
              V+PN A  PGLVYDMR  DY ++LC++GYNNS I   +         ++HT C  +  S
Sbjct  611   HVDPNRAAHPGLVYDMRPSDYVRFLCSMGYNNSAIASMV---------QQHTPCQHSPKS  661

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
              L+LN+PS+ +P+L   +++ RTVTNVGPV S Y+A V++P G  VTV P +L F+    
Sbjct  662   QLNLNVPSITIPELRGKLSVSRTVTNVGPVTSKYRARVEAPPGVDVTVSPSLLTFNSTVN  721

Query  290   KRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             + +F +   A   V   +TFGSLTW DG H VR P+ VR MI   Y+
Sbjct  722   RLTFKVMFQAKLKVQGRYTFGSLTWEDGTHTVRIPLVVRTMINRFYV  768



>ref|XP_006439186.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
 gb|ESR52426.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
Length=777

 Score =   545 bits (1404),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 333/768 (43%), Positives = 468/768 (61%), Gaps = 50/768 (7%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             ++IVY+G K ++D   I +SH+  L+ V+GS E A+ +++YSY++GFSGFAA LT +QA+
Sbjct  34    VHIVYMGEKKYEDPVAITKSHHRFLSTVLGSKEAAKHSILYSYKHGFSGFAARLTKTQAE  93

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             K+A + GVV V+ +   K+ T+RSW+F+GL    +    L  ++N G+G I+G++D+G+ 
Sbjct  94    KIAELPGVVQVIPNGILKLHTTRSWEFMGLHYYQS-SKNLSTESNMGEGTIIGIIDTGVW  152

Query  2030  TELPSFGDAGMG--PVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
              E  SF D GMG  PVP  WKG C+   G +FN S  CNRK+IGARWF KG +   +   
Sbjct  153   PESESFSDKGMGQAPVPPHWKGICQK--GEKFNSSN-CNRKLIGARWFIKGIMDMINAST  209

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N     + +S  D  GHG+  AS  AG FV  A   G+  G+ RGGA  A +A YKACW+
Sbjct  210   N---TDEYFSPRDAVGHGTHTASTAAGYFVEKANYRGLAAGLARGGAPLAHLAIYKACWD  266

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             +      C  AD+L A D AIHD VDV+SVS+G+ +PL S ++  + I IGSFHAI +GI
Sbjct  267   IG-----CTDADVLKAFDKAIHDGVDVLSVSIGNEIPLFSYIDQRDSIAIGSFHAIAKGI  321

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW-------QL  1338
              V+ +AGN GP A TI N  PW+ITV A+TIDR F   ITLGN   + V W       ++
Sbjct  322   TVVSSAGNDGPVAQTIVNTAPWIITVGATTIDRAFPTAITLGN---HQVLWGQSVDIGKV  378

Query  1337  PNG-TALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFG--DDLDRNLVLVDKATDA  1167
              +G T L++    A       D     L+     GKI+  F   D  D     +   T A
Sbjct  379   SHGFTGLTYSERIAFDPDSINDCRQGSLNATLAAGKIILCFSRPDTQDIQSAAI-SVTQA  437

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
             G VG+IY+   + D L   N  IP ++V+Y+ GT+I  YI +   +P A+LSSP+  +G 
Sbjct  438   GGVGLIYAQ-FHTDGLDSCNL-IPCIKVNYEVGTQILSYI-RRARSPIAKLSSPETVIGD  494

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP---TSD-GGFRISSGTSHAAPH  819
              ++P+V  FSSRGP+S +P ++KPDI APG  I+ A P   + D  G+ + SGTS + PH
Sbjct  495   LVSPRVASFSSRGPNSMSPAVLKPDIVAPGVDILAAYPPIGSKDIQGYALLSGTSMSCPH  554

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             V+ I AL+K  H +WSPAAI+SALVTTA  + T    IF +GS+ + AD FD GGG VNP
Sbjct  555   VAGIAALIKSLHRDWSPAAIRSALVTTASQTGTDGMNIFEEGSTRKEADPFDIGGGHVNP  614

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
             N A +PGLVYD+   DY Q+LC +G+N++ I +      N         C K     LDL
Sbjct  615   NKAMNPGLVYDITVEDYIQFLCFMGHNDASISRLTKSKIN---------CLKNNHLALDL  665

Query  458   NLPSMVVPDLF--KPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             NLPS+ +P+L   + VT+ R VTNVG +NS Y+A+V++P G  +TV+P+VL F+   K  
Sbjct  666   NLPSITIPNLHNNETVTVTRKVTNVGQINSAYEALVEAPYGVNMTVEPEVLSFNMTIKIL  725

Query  284   SFTMRVSADKLV----NSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             SF +   ++  V    ++ + FGSLTW+DG H VR+P+A+R +    Y
Sbjct  726   SFRVTFFSNHKVHPVPDAEYRFGSLTWTDGEHFVRSPVAIRAIKFESY  773



>ref|XP_006289915.1| hypothetical protein CARUB_v10003531mg, partial [Capsella rubella]
 gb|EOA22813.1| hypothetical protein CARUB_v10003531mg, partial [Capsella rubella]
Length=748

 Score =   544 bits (1401),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 327/735 (44%), Positives = 457/735 (62%), Gaps = 41/735 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +++IVYLG K HDD + + ESH+ +L  ++GS EEA  +MV+S+R+GFSGFAA LT SQA
Sbjct  37    EVHIVYLGEKQHDDPKFVTESHHRMLWSLLGSKEEAYDSMVHSFRHGFSGFAAKLTESQA  96

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             KK+A +  VV V+ D+ +K  T+R+WD+LGLS  A+ P  LL +TN G+ MI+G++D+G+
Sbjct  97    KKIANLPEVVHVIPDRFYKPATTRTWDYLGLS--ASNPKNLLNETNMGEDMIIGIIDTGV  154

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E   F D G+G VP  WKG C +  G  FN S  CN+K+IGA++F   + L+++   N
Sbjct  155   WPESEVFNDNGIGQVPSHWKGGCES--GEAFNSSH-CNKKLIGAKYFIN-SFLAENESFN  210

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
                  D  S     GHG+ VA+I  GS+VPN +  G+  G VRGGA  AR+A YK CW L
Sbjct  211   SSASLDFISPRGYNGHGTHVATIAGGSYVPNTSYKGLAGGTVRGGAPRARIAVYKTCWYL  270

Query  1673  DPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
             D E    C+ AD+L A+D AIHD VDV+S+S+G   PL  + +  +GI  G+FHA+ +GI
Sbjct  271   DDEDITTCSSADILKAMDEAIHDGVDVLSLSLGYE-PLYPETDVRDGIATGAFHAVLKGI  329

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG----  1329
              V+ AAGN+GP+A T+TN+ PW+ITVAA+T+DR FA  +TLGN  K  +   +  G    
Sbjct  330   TVVCAAGNSGPAAQTVTNLAPWIITVAATTLDRSFATLMTLGN-NKVIMGQAIYTGPELG  388

Query  1328  -TALSHPLHFAGKYMGEADLMPRKLDPAE--VKGKIVFMFGDD-----LDRNLVLVDKAT  1173
              T+L +P +        +    R +  +   + GK+V  F +        R +  V +A 
Sbjct  389   FTSLVYPENPGNSNESFSGTCERLIINSNRTMAGKVVLCFTESPYSTSASRAVSYVKRA-  447

Query  1172  DAGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
               G +GVI +  P NV   P L+   P V VDY+ GT I  YI +S  +P  ++   +  
Sbjct  448   --GGLGVIIAGQPGNVLR-PCLD-DFPCVSVDYELGTNILFYI-RSNGSPVVKIQPSRTL  502

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPT----SDGGFRISSGTSHA  828
             +G+ +  KV  FSSRGP+  +  I+KPDIAAPG  I+ A  T    +D GF   SGTS A
Sbjct  503   IGQPVGTKVASFSSRGPNPISAAILKPDIAAPGVSILAATTTNTTFNDRGFIFLSGTSMA  562

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P +S IVALLK  + +WSPAAI+SA+VTTAW +D     IFA+GS  + AD FDYGGG+
Sbjct  563   TPTISGIVALLKALNRDWSPAAIRSAIVTTAWRTDPLGEQIFAEGSPRKLADPFDYGGGL  622

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VNP  A  PGLVYD+   DY  Y+C++GYN + I + +          + T+C   +PS+
Sbjct  623   VNPEKATKPGLVYDLGLEDYVLYMCSVGYNETSISQLVG---------KVTVCSNPKPSV  673

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LD NLPS+ +P+L   VTL RT+TNVGP+NSVYK  V+ P+G  VTV P+ L F+   K+
Sbjct  674   LDFNLPSITIPNLKDEVTLTRTLTNVGPLNSVYKVTVEPPLGVQVTVTPETLVFNSTTKR  733

Query  287   RSFTMRVSADKLVNS  243
              S+ +RVS    +N+
Sbjct  734   VSYKVRVSTKHKINT  748



>ref|XP_002460565.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
 gb|EER97086.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
Length=765

 Score =   544 bits (1402),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 334/781 (43%), Positives = 452/781 (58%), Gaps = 72/781 (9%)
 Frame = -3

Query  2393  KIYIVYLG-GKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
              +YIVY+G G P      +++SH+ +LA ++GS + A+ A++YSYR+GFSGFAAVLT SQ
Sbjct  22    NVYIVYMGEGNPELHPELVRDSHHGMLAALLGSEQAAKDAILYSYRHGFSGFAAVLTDSQ  81

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A ++A   GVV VV ++   + T+RSWDF+ ++   +V   +L ++  G+  I+GV+D+G
Sbjct  82    AARLADSPGVVRVVRNRVLDLHTTRSWDFMRVNPSHSV--GILSESRFGEDSIIGVLDTG  139

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+G VP+RWKG C  + G RFN S  CNRK+IGA+W+ KG     + + 
Sbjct  140   IWPESASFRDDGIGEVPRRWKGQC--VAGDRFNASN-CNRKIIGAKWYIKG----YEAEY  192

Query  1856  NKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
              K   +D Y   S  D  GHG+  AS  AG+ V +A   G+  G+ RGGA  AR+A YK 
Sbjct  193   GKMNTTDIYEFMSARDAVGHGTHTASTAAGALVADANFRGLASGVARGGAPRARIAVYKV  252

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CW        C  AD+LAA D AIHD VDV+SVS+G   PL + ++  + + IGSFHA+ 
Sbjct  253   CWATGD----CTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAVA  306

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             RGI V+ +AGN+GP + T+ N  PW++TVAA TIDR F   ITLGN   Y        G 
Sbjct  307   RGIVVVCSAGNSGPYSETVINSAPWIVTVAAGTIDRTFLAKITLGNNSTYV-------GQ  359

Query  1325  ALSHPLHFAGKYMGEA-------DLMPRKLDPAE-------------VKGKIVFMFGDDL  1206
              L     + GK+ G++       D+     D  +             VKG +V  F    
Sbjct  360   TL-----YTGKHPGKSIRIVYAEDIASNNADDTDARSCTAGSLNSTLVKGNVVLCFQTRA  414

Query  1205  DRNL-VLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMT  1029
              R+  V V+    A  VGVI++     D     +  IP VQVDY  GT I  Y   S   
Sbjct  415   QRSASVAVETVKKARGVGVIFAQFLTKDIASSFD--IPSVQVDYQVGTAILAYT-TSMRN  471

Query  1028  PTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--------DP  873
             PT Q  S K  +G  + P+V  FSSRGPSS +P ++KPDIAAPG  I+ A          
Sbjct  472   PTVQSGSAKTILGELIGPEVAYFSSRGPSSLSPSVLKPDIAAPGVNILAAWTPAAAISSA  531

Query  872   TSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKG  693
                  F+I SGTS + PH+S +VALLK  HP WSPAA+KSALVTTA   DTY   I ++ 
Sbjct  532   IGSVNFKIDSGTSMSCPHISGVVALLKSMHPNWSPAAVKSALVTTANVQDTYGFEIVSEA  591

Query  692   SSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRS  513
             +    A+ FDYGGG V+PN A  PGLVY+M   DY ++LC++GYN S I          S
Sbjct  592   APYNQANPFDYGGGHVDPNRAAHPGLVYEMGTSDYVRFLCSMGYNTSAI---------SS  642

Query  512   DTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVV  333
              T++H  C  T  + L+LNLPS+ +P+L   +T+ RTVTNVG  +S Y+A V++P G  V
Sbjct  643   MTQQHETCQHTPKTQLNLNLPSITIPELRGRLTVSRTVTNVGSASSKYRARVEAPPGVDV  702

Query  332   TVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             TV P +L F+   +  +F +   A   V   + FGSLTW DGVH VR P+ VR M+   Y
Sbjct  703   TVSPSLLTFNSTMRSLTFKVTFQAKLKVQGRYNFGSLTWEDGVHTVRIPLVVRTMVSKFY  762

Query  152   L  150
             +
Sbjct  763   V  763



>emb|CDX93808.1| BnaA09g24080D [Brassica napus]
Length=748

 Score =   543 bits (1399),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 325/765 (42%), Positives = 449/765 (59%), Gaps = 64/765 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IVYLG K HDD + + ESH+ +L+ ++GS E+A  +MVYSYR+GFSGFAA LT    
Sbjct  28    KIHIVYLGEKQHDDPKLVTESHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLT----  83

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
                             ++++ T+R+WD+LGL  G   P  LL  TN GD +I+GVVD+G+
Sbjct  84    ---------------NYYELATTRTWDYLGL--GTANPKNLLNNTNMGDQVIIGVVDTGM  126

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNE---SELCNRKVIGARWFFKGALLSQDV  1863
             S       D  +          C    GL  N     EL   + IG   ++     S+  
Sbjct  127   S-RFHHILDLSL---------EC----GLSLNHLMTMELDQYRAIGKEDYYINGFQSEID  172

Query  1862  DLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
               N     D  S  D  GHG+ VAS   GS++P+ +  G+  G +RGGA  AR+A YKAC
Sbjct  173   GFNFTESPDYSSARDFVGHGTHVASTAGGSYIPDVSYKGLARGTMRGGAPRARIAMYKAC  232

Query  1682  WNLDPERFV-CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             W L+    V C+ +D+L AID AIHD VDV+S+S+GS +PL S+ +  + I IGSFHA+ 
Sbjct  233   WYLEELGGVTCSSSDILKAIDDAIHDGVDVLSLSLGSRIPLNSETDLPDAIAIGSFHAVA  292

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY--AVDWQLPN  1332
             +GI V+ A GNAGPSA TI N  PW++TVAA+T+DR FA  I LGN +       +  PN
Sbjct  293   KGITVVCAGGNAGPSAQTIANTAPWILTVAATTLDRSFATPIILGNKKVILGQAMYTAPN  352

Query  1331  --GTALSHPL---HFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKA--T  1173
                T+L +P    +    + G+ + +   +    + GK+V  F        +  D +   
Sbjct  353   LGFTSLVYPEDPGNSNETFNGDCESL-NFIPIRAMAGKVVLCFTISRRYTTLSGDASFVK  411

Query  1172  DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
              AG +G+I +        P  +   P V VDY+ GT I  YI +ST +P  ++   +  V
Sbjct  412   RAGGLGLIIARTPGYTVSPCKD-DFPCVAVDYELGTDILFYI-RSTRSPVVKIQRSRTIV  469

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISSGTSHAA  825
             G+ +  KV  FSSRGP++ +P I+KPDIAAPG  I+ A       + GGF + SGTS AA
Sbjct  470   GQPVGIKVATFSSRGPNTISPAILKPDIAAPGVNILAATSPNVTNNAGGFAMYSGTSMAA  529

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P +S +VALLK  HP WSPAA++SA+VTTAW +D     + A+GSS +AAD FDYGGG+V
Sbjct  530   PVISGVVALLKALHPNWSPAALRSAIVTTAWRTDPSGEQLPAEGSSRKAADPFDYGGGLV  589

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A +PGL+YDM   DY  YLC+ GYN+S I + +          + T+C   +PS+L
Sbjct  590   NPEKAAEPGLIYDMGPKDYILYLCSAGYNDSSISQLVG---------KVTVCSNPKPSVL  640

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             D+NLPS+ +P+L + VTL RTVTNVGPVNSVYK +V+ P+G  V V PK L F+   K+ 
Sbjct  641   DMNLPSITIPNLKEKVTLTRTVTNVGPVNSVYKVVVEPPLGVRVVVTPKKLVFNSKTKRV  700

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             SF +R S    +N+ + FGSL W+D VHNV  P++VR  I+  Y 
Sbjct  701   SFKVRASTTHKINTGYYFGSLIWTDNVHNVTIPVSVRTQILQNYF  745



>ref|XP_009407970.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009407971.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=769

 Score =   543 bits (1400),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 341/770 (44%), Positives = 454/770 (59%), Gaps = 55/770 (7%)
 Frame = -3

Query  2402  NGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTa  2223
             +   +YIVY+G K  D+     E H+  L+ V+GS + A  +++YSY++GFSGFAAVLT 
Sbjct  24    SASNVYIVYMGEKAQDEPAAATELHHATLSTVLGSKQAATSSILYSYKHGFSGFAAVLTE  83

Query  2222  sqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVD  2043
             S+A +VA +AGV  VV ++   + T+RSWDFL L   +N  G LL  +  GDG I+GV+D
Sbjct  84    SEAARVADLAGVAHVVPNRILDLHTTRSWDFLHLK--SNPSGGLLEMSRSGDGSIIGVLD  141

Query  2042  SGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDV  1863
             +GI  E  SF D  MG +P RW+G C+   G +F+ S+ CNRK+IGARW+ KG   ++  
Sbjct  142   TGIWPESESFSDRDMGEIPSRWRGVCQK--GEKFHVSD-CNRKIIGARWYIKG-YEAEFG  197

Query  1862  DLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
              LN   + +  S  D  GHG+  +S  AG+FV NA+ +GI  G+ RGGA  AR+A YK C
Sbjct  198   KLNTSDILEFLSARDAVGHGTHTSSTAAGAFVGNASFMGIARGIARGGALRARLAIYKVC  257

Query  1682  WNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITR  1503
             W        C+ AD+LAA D AIHD VDV+SVS+G   PL + +E  + + IGSFHA+ R
Sbjct  258   WATGG----CSSADILAAFDDAIHDGVDVLSVSLGQSPPLPTYIE--DVLAIGSFHAVAR  311

Query  1502  GIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTA  1323
             GI V+ +AGN+GP + T+ N  PWVITVAASTIDR F   I+LGN    A       G A
Sbjct  312   GITVVCSAGNSGPFSQTVINTAPWVITVAASTIDRTFVTFISLGNNVTKA-------GQA  364

Query  1322  L---SHPLHFAGKYMGE------ADLMPRK------LDPAEVKGKIVFMFGDDLDRN-LV  1191
             L    H   F G    E      AD    +      L+    +GK+V  F     R+ LV
Sbjct  365   LYLGEHVDKFYGIVYAEDIASDNADSTDARGCGAGSLNATLARGKVVLCFQTRDQRSPLV  424

Query  1190  LVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
               D    A  V VI++     D     +   P VQVD + GT I  Y+  ST  P  + S
Sbjct  425   ASDTVRRAHGVAVIFAQFLTKDITFAFD--FPCVQVDLEIGTSILTYL-GSTRKPIVKFS  481

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMC----ADPTSDG---GFR  852
             + K  +G  + P+V  FSSRGPSS +P ++KPDIAAPG  I+     A P  +     F+
Sbjct  482   TTKTVLGTVIAPEVAYFSSRGPSSLSPFVLKPDIAAPGVNILASWSPASPPRNMPPLNFK  541

Query  851   ISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAAD  672
             I SGTS + PH+SAI ALLK  HP WSPAAIKSA+VTTA   D Y   + A+G+  + A+
Sbjct  542   IESGTSMSCPHISAIAALLKSIHPNWSPAAIKSAIVTTASTIDEYSLGVVAEGAPHKQAN  601

Query  671   AFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTI  492
              +D+GGG V+PN A DPGLVYDMR   Y  +LC++GYNNS +          S T+  TI
Sbjct  602   PYDFGGGHVDPNKAIDPGLVYDMRVSAYVHFLCSVGYNNSAV---------SSLTQHPTI  652

Query  491   CPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVL  312
             C     S  DLNLPS+ +P L +  T+ RTVTNVGP  S Y A V++P G  V V+P +L
Sbjct  653   CHDIYQSHKDLNLPSITIPQLKESFTVTRTVTNVGPATSTYTAHVEAPRGVSVRVRPSIL  712

Query  311   RFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHN-VRTPIAVRKMI  165
              F+   +K  F +   +   V S + FGSLTW DGVH+ VR P+A+R +I
Sbjct  713   AFNSTVQKLKFKVTFGSRLKVQSGYLFGSLTWKDGVHHLVRIPLAIRIVI  762



>ref|XP_010437012.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=666

 Score =   539 bits (1389),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 313/693 (45%), Positives = 422/693 (61%), Gaps = 56/693 (8%)
 Frame = -3

Query  2171  DKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGP  1992
             D  +++ T+R+WD+LGLS G   P  LL KT+ G  +IVGV+D+G+  E   F D G GP
Sbjct  6     DTIYELTTTRTWDYLGLSPGT--PQSLLHKTDLGSSVIVGVIDTGVWPESEMFNDNGYGP  63

Query  1991  VPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVA  1812
             +P RWKG+C    G  F+ S  CNRK+IGA++F  G     +V LN     +  S  D  
Sbjct  64    IPSRWKGACET--GDLFSPSN-CNRKLIGAKFFIDGFSAEFEV-LNTTQRPEYISPRDFN  119

Query  1811  GHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLA  1632
             GHG+ V+S V GS+V N + LG+  G VRGGA    +A YKACW       VC+GAD+L 
Sbjct  120   GHGTHVSSTVGGSYVANVSYLGLGSGTVRGGAPRVHIAIYKACW----LHGVCSGADVLK  175

Query  1631  AIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFT  1452
             A+D AI+D VDV+S+S+G  VPL  + +    + +G+FHA+ +GIPV+ +AGN GP A T
Sbjct  176   AMDEAINDGVDVLSLSLGLKVPLYQETDMRELLSVGAFHAVEKGIPVVASAGNNGPGAQT  235

Query  1451  ITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADL  1272
             I+NV PW++TVAA+T DR F  TITLGN           N T L   + F G  +G  +L
Sbjct  236   ISNVAPWILTVAATTQDRSFPTTITLGN-----------NITILGQAI-FGGPAVGFVEL  283

Query  1271  M----PRKLDPAEV--------KGKIVFMFGDDLDR----NLVLVDKATDAGAVGVIYSN  1140
                  P   D A++        +GK+V  F  D +     N +L  K  +AG +GVI + 
Sbjct  284   TIPDKPFSTDCADLPGNPKSTMEGKVVLCFTADSNAGAMGNGILAVK--NAGGLGVIVAK  341

Query  1139  PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDF  960
                   +P  +   P V VD++ GT I  YI +ST +P  ++ + K  V   +  KVP F
Sbjct  342   NPTYSLIP--SRDFPCVMVDFELGTDILFYI-RSTSSPIVKIDASKTLVSYPVATKVPTF  398

Query  959   SSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLK  792
             SSRGP+S +P I+KPDIAAPG  I+ A       SDGG+ ++SGTS A P ++ +V LLK
Sbjct  399   SSRGPNSISPAILKPDIAAPGVNILAATSLNSSVSDGGYAMTSGTSMATPVIAGVVVLLK  458

Query  791   ISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLV  612
               HP+WSPAAIKSA+VTTAW +D    PIFA GSS + AD FDYGGG+VNP+ A  PGL+
Sbjct  459   ALHPDWSPAAIKSAIVTTAWRTDPSGEPIFADGSSRKLADPFDYGGGLVNPDKAARPGLI  518

Query  611   YDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPD  432
             YD+   DY  YLC+  YN++ I + +          + T CP  +PS+LDLNLPS+ +P+
Sbjct  519   YDINTNDYVLYLCSTDYNDTSISQVVG---------KKTECPNPKPSVLDLNLPSITIPN  569

Query  431   LFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKL  252
             L   VTL RTVTNVGP NS+YK ++  P G  +TVKP +LRF+   KK SFT+ VS    
Sbjct  570   LKDKVTLTRTVTNVGPPNSIYKVVINPPTGVRMTVKPNILRFNPRTKKVSFTVTVSTTHK  629

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             VN+ + FGSLTW+D V  V  P++VR  I+  Y
Sbjct  630   VNTGYYFGSLTWTDNVRRVVIPVSVRTQILERY  662



>ref|XP_006283179.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
 gb|EOA16077.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
Length=760

 Score =   542 bits (1397),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 329/761 (43%), Positives = 467/761 (61%), Gaps = 54/761 (7%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +K+YIV+LG + HDD   + +SH+ +L  V  S E AR++++Y+Y +GFSGFAA LT SQ
Sbjct  36    RKVYIVHLGARRHDDPELVSDSHHRMLESVFESPEAARESIIYNYHHGFSGFAASLTDSQ  95

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AK+++    V SV  ++  ++Q++R +D+LGLS   ++P  +L ++N G  +++G++DSG
Sbjct  96    AKQLSDRPDVFSVTPNRMLQLQSTRVYDYLGLS--PSLPKGILHESNMGSDLVIGLIDSG  153

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWF-------FKGAL  1878
             I  E P+F D G+GP+P+ WKG C A  G  F+ ++ CN+K++GAR++       F G  
Sbjct  154   IWPESPAFNDEGLGPIPKHWKGKCVA--GEGFDPAKHCNKKLVGARYYTDGWDELFPGTS  211

Query  1877  LSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVA  1698
             +S++    +F+     S   + GHG+ V+SI A SFV NA+  G+  G++RG A  AR+A
Sbjct  212   ISEE----EFM-----SARGLIGHGTVVSSIAASSFVRNASYAGLAPGVMRGAAPKARIA  262

Query  1697  SYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPL----ASDMEAENGIG  1530
              YK  W  D E +  +   LL A D AI+D VDV+S+S+GS VP      +  E    I 
Sbjct  263   MYKVVW--DRELYGSSPVHLLKAFDEAINDGVDVLSISIGSGVPFRPYEPTSGEIGGDIS  320

Query  1529  IGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAV  1350
             +GSFHA+ +GIPVI  A N+GP A+T+ NV PW++TVAA++IDR F   +T GN      
Sbjct  321   VGSFHAVMKGIPVIAGAANSGPDAYTVANVAPWLLTVAATSIDRTFYVDLTFGNNVTIIG  380

Query  1349  DWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMF-GDDLDRNLVLVDKAT  1173
               Q   G  LS  L +   Y      MP         GK++  F  +D +    L+  AT
Sbjct  381   QSQY-TGKELSAGLVYVEDYRNVTSSMP---------GKVILTFVKEDWEMTDALL-AAT  429

Query  1172  DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
             +  A+G+I +  S+  S  +     PYV VDY+ G +I  YI +ST +PT ++S+ K  V
Sbjct  430   NNKALGLIVARSSDHQSDALYEE--PYVYVDYEVGAKILRYI-RSTNSPTVKISTGKTLV  486

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCAD----PTSDGGFRISSGTSHAA  825
             GR +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A     P S GG+ + SGTS+A 
Sbjct  487   GRPIATKVCGFSSRGPNSESPAILKPDIAAPGVTILAATSEAFPDSFGGYTLGSGTSYAT  546

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P V+ +V LLK  HP+WSPAA+KSA++TTAW +D    PIFA+G   + AD FDYG G+V
Sbjct  547   PAVAGLVVLLKALHPDWSPAALKSAIMTTAWTTDPSGEPIFAEGEPRKLADPFDYGAGLV  606

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             N   A DPGLVYDM   DY  + CA GYN + I  T+ G   +        C    PS+L
Sbjct  607   NIERAKDPGLVYDMNVDDYIDFFCASGYNETAI-TTLVGKPTK--------CSSPLPSIL  657

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             DLN P++ + DL + VT+ RTVTNVGPVNSVYKA+V+ P G  + V+P+ L F  N KK 
Sbjct  658   DLNYPAITITDLEEEVTVTRTVTNVGPVNSVYKAVVEPPQGVKIVVEPETLVFCSNTKKL  717

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
              F +RVS+    N+ F FGS TW+DG  NV  P++VR  ++
Sbjct  718   GFKVRVSSSHKSNTGFIFGSFTWTDGSRNVTIPLSVRTRVL  758



>ref|XP_010104911.1| Subtilisin-like protease SDD1 [Morus notabilis]
 gb|EXC02147.1| Subtilisin-like protease SDD1 [Morus notabilis]
Length=783

 Score =   543 bits (1399),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 339/768 (44%), Positives = 465/768 (61%), Gaps = 48/768 (6%)
 Frame = -3

Query  2411  LKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAV  2232
             L E  + ++IVYLGGK +D+    K+SH+ LL+ ++GS E AR+++VYSYR+GFSGFAA 
Sbjct  32    LVEAKRSVHIVYLGGKKYDNPETTKKSHHILLSNLLGSKEVARRSIVYSYRHGFSGFAAR  91

Query  2231  LTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVG  2052
             LT ++A+ +A    VV V+ ++ +K+ T+RSWDF+G+    + P   L K N G G I+G
Sbjct  92    LTEAEAEAIAEFPEVVQVIPNRIYKLHTTRSWDFIGIHH--HSPKNALTK-NMGKGTIIG  148

Query  2051  VVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLS  1872
             V+DSG+  E  SF D GM P P +W+G C+   G +FN +  CN+K+IGARWF KG +  
Sbjct  149   VIDSGVWPESESFNDEGMPPTPSQWRGICQQ--GEQFNSTN-CNKKIIGARWFVKGLMEE  205

Query  1871  QDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASY  1692
                 +N     +  S  D  GHG+  AS   G FV  A+  G+  G+ RGGA  A +A Y
Sbjct  206   IKRPINITEAGEFLSPRDGNGHGTHTASTAGGYFVKQASYSGLAAGLARGGAPLAHLAIY  265

Query  1691  KACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHA  1512
             KACW +      C  ADLL A D AIHD VDV+SVS+G+ VPL S ++  + I IGSFHA
Sbjct  266   KACWGVGG----CTNADLLKAFDKAIHDGVDVLSVSIGNEVPLFSYVDHRDAIAIGSFHA  321

Query  1511  ITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPN  1332
               +GI V+ +AGN GP++ T++N  PW+ITVAA+TIDR F   ITLGN       W    
Sbjct  322   TAKGITVVSSAGNNGPTSQTVSNTAPWLITVAATTIDRAFPTAITLGNNNTL---WGQSL  378

Query  1331  GTALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFG--DDLDRNLV  1191
              T  SH   FA     E            D     L+     GKIV  F   DD      
Sbjct  379   DTG-SHNHVFASITYSERISVNSIDASSKDCEYGSLNETLAAGKIVVCFSNIDDQQDIAS  437

Query  1190  LVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
               +   +AG VG+I++   N D L   +  IP V+VDY+ GT+I  YI +   +PTA+LS
Sbjct  438   AANAVKEAGGVGLIFAQFHN-DGLQ--SCDIPCVKVDYEVGTQILSYI-RRARSPTAKLS  493

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD------GGFRI  849
              P   +G+ ++P+V  FSSRGPSS  P ++KPD+AAPG  I+ A P SD      G + +
Sbjct  494   PPTTVIGKWMSPRVATFSSRGPSSLTPAVLKPDVAAPGVDILAAFPPSDTKNPRKGCYTL  553

Query  848   SSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADA  669
              SGTS A PHV+ I AL+K  HP+WSPAAI+SAL TTA  + T  + I A+G + + AD 
Sbjct  554   LSGTSMACPHVAGITALIKSVHPDWSPAAIRSALATTASQTGTDGTFISAEGPNRKTADP  613

Query  668   FDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTIC  489
             FD GGG V P+ A DPGL+Y++   DY QYLC+LGY    I +        +DT+  T  
Sbjct  614   FDIGGGHVKPSRAMDPGLIYNITTDDYIQYLCSLGYRIQSIARL-------TDTQI-TCS  665

Query  488   PKTRPSMLDLNLPSMVVPDL--FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKV  315
             P+ RP + +LNLPS+ +P+L     VT+ RTVTNVG  +SVY A+V++P G  + V+P+V
Sbjct  666   PRKRPVVSNLNLPSITIPNLKTTTSVTVTRTVTNVGDSDSVYSALVRAPSGVEMRVEPQV  725

Query  314   LRFDGNRKK-RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             L F+    +  SF +  S+ + V+  + FGSLTW+DG H VR+P+AVR
Sbjct  726   LDFNNTTTRVLSFKVTFSSGQRVHGDYKFGSLTWTDGKHRVRSPVAVR  773



>ref|XP_006476262.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=777

 Score =   543 bits (1398),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 332/776 (43%), Positives = 470/776 (61%), Gaps = 50/776 (6%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             +L +    ++IVY+G K ++D   I +SH+  L+ V+GS E A+ +++YSY++GFSGFAA
Sbjct  26    ILVDATSNVHIVYMGEKKYEDPVAITKSHHRFLSTVLGSKEAAKHSILYSYKHGFSGFAA  85

Query  2234  VLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIV  2055
              LT +QA+K+A + GVV V+ +   K+ T+RSW+F+GL    +    L  ++N G+G I+
Sbjct  86    RLTKTQAEKIAELPGVVQVIPNGILKLHTTRSWEFMGLHYYQS-SKNLSTESNMGEGTII  144

Query  2054  GVVDSGISTELPSFGDAGMG--PVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGA  1881
             G++D+G+  E  SF D GMG  PVP  WKG C+   G +FN S  CNRK+IGARWF KG 
Sbjct  145   GIIDTGVWPESESFSDKGMGQAPVPPHWKGICQK--GEKFNSSN-CNRKLIGARWFIKGI  201

Query  1880  LLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARV  1701
             +   +   N     + +S  D  GHG+  AS  AG FV  A   G+  G+ RGGA  A +
Sbjct  202   MDMINASTN---TDEYFSPRDAVGHGTHTASTAAGYFVEKANYRGLAAGLARGGAPLAHL  258

Query  1700  ASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGS  1521
             A YKACW++      C  AD+L A D AIHD VDV+SVS+G+ +PL S ++  + I IGS
Sbjct  259   AIYKACWDIG-----CTDADVLKAFDKAIHDGVDVLSVSIGNEIPLFSYIDQRDSIAIGS  313

Query  1520  FHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW-  1344
             FHAI +GI V+ +AGN GP A TI N  PW+ITV A+TIDR F   ITLGN   + V W 
Sbjct  314   FHAIAKGITVVSSAGNDGPVAQTIVNTAPWIITVGATTIDRAFPTAITLGN---HQVLWG  370

Query  1343  ------QLPNG-TALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFG--DDLDRNLV  1191
                   ++ +G T L++    A       D     L+     GKI+  F   D  D    
Sbjct  371   QSIDIGKVSHGFTGLTYSERIAFDPDSANDCRQGSLNATLAAGKIILCFSRPDTQDIQSA  430

Query  1190  LVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLS  1011
              +   T AG VG+IY+   + D L   N  I  ++V+Y+ GT+I  YI +   +P A+LS
Sbjct  431   AI-SVTQAGGVGLIYAQ-FHTDGLDSCNL-IHCIKVNYEVGTQILSYI-RRARSPIAKLS  486

Query  1010  SPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP---TSD-GGFRISS  843
             SP+  +G  ++P+V  FSSRGP+S +P ++KPDI APG  I+ A P   + D  G+ + S
Sbjct  487   SPETVIGDLVSPRVASFSSRGPNSMSPAVLKPDIVAPGVDILSAYPPIGSKDIQGYALLS  546

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFD  663
             GTS + PHV+ I AL+K  H +WSPAAI+SALVTTA  + T    IF +GS+ + AD FD
Sbjct  547   GTSMSCPHVAGIAALIKSLHRDWSPAAIRSALVTTASQTGTDGMNIFEEGSTRKEADPFD  606

Query  662   YGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPK  483
              GGG VNPN A +PGLVYD+   DY Q+LC +G+N++ I +      N         C K
Sbjct  607   IGGGHVNPNKAMNPGLVYDITVEDYIQFLCFMGHNDASISRLTKSKIN---------CLK  657

Query  482   TRPSMLDLNLPSMVVPDLF--KPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLR  309
                  LDLNLPS+ +P+L   + VT+ R VTNVG +NS Y+A+V++P G  +TV+P+V+ 
Sbjct  658   NNHLALDLNLPSITIPNLHNNETVTVTRKVTNVGQINSAYEALVEAPYGVNMTVEPEVIS  717

Query  308   FDGNRKKRSFTMRVSADKLV----NSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             F+   K  SF +   ++  V    ++ + FGSLTW+DG H VR+P+A+R +    Y
Sbjct  718   FNMTIKILSFRVTFFSNHKVHPVPDAEYRFGSLTWTDGEHFVRSPVAIRAIKFESY  773



>ref|XP_008392654.1| PREDICTED: subtilisin-like protease SDD1 [Malus domestica]
Length=785

 Score =   543 bits (1398),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 332/764 (43%), Positives = 464/764 (61%), Gaps = 61/764 (8%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             +++IVYLG K +DD    K+ H+ +L  + GS ++A ++++YSY+YGFSGFAA LT SQA
Sbjct  49    EVHIVYLGEKKYDDPALTKKFHHKMLTTLFGSKQDAYRSIIYSYKYGFSGFAARLTESQA  108

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             +++A    VV V+ ++ HK+ T+RSWDF+G+ + ++    LL K+  G G I+GV+DSG+
Sbjct  109   EEIAEFPEVVQVIPNRVHKLHTTRSWDFIGIHKYSS--DNLLTKS-MGKGTIIGVIDSGV  165

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D  MGP+P  WKG C+   G  FN +  CN+K+IGARWF KGA+ +Q  +LN
Sbjct  166   WPESESFNDDAMGPIPSHWKGICQQ--GEYFNSTN-CNKKIIGARWFRKGAM-NQFQNLN  221

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             K    D  S  D  GHG+  AS  AG FV NA   G+  G+ RGGA  A +A YKACW  
Sbjct  222   KTDNVDFLSPRDGIGHGTHTASTAAGYFVKNANYRGLASGLARGGAPLAHLAIYKACWAF  281

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             +     C  ADLL A D AIHD VD+IS+SVG+ +PL S ++  + I IGSFHA+T+GI 
Sbjct  282   EG----CTDADLLKAFDKAIHDGVDIISLSVGNEIPLFSYVDQRDSIAIGSFHAMTKGIT  337

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+ +AGN GP + TI N  PW+ITVAA+TIDR F   ITLGN +     W    G ++  
Sbjct  338   VVCSAGNDGPISQTIVNTAPWLITVAATTIDRAFPTAITLGNNQTL---W----GQSID-  389

Query  1313  PLHFAGKYMGE-------------------ADLMPRKLDPAEVKGKIVFMFGDDLDRNL-  1194
                 AGKY  E                    D  P  L+     GKIV  F     +++ 
Sbjct  390   ----AGKYNREFASITYSERIAIDPTDDSAKDCQPGSLNATLASGKIVLCFSKSDQQDIE  445

Query  1193  VLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQL  1014
                    DAG VG+I++   + D L   +  IP + VDY+ GT++  YI ++  +  A+L
Sbjct  446   SAATTVKDAGGVGLIFAQFRD-DGLS--SCDIPCISVDYEVGTQVLSYIRRARHS-IAKL  501

Query  1013  SSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRIS  846
             S PK  +G+ ++P+V  FS+RGPSS  P ++KPDIAAPG  I+ A    D     G+ + 
Sbjct  502   SDPKTTIGKWVSPRVASFSARGPSSMTPEVLKPDIAAPGVDIIAAFRPLDTEHRSGYALL  561

Query  845   SGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAF  666
             SGTS A PHV+ I AL+K +HP WSPAAIKSALVTTA  + T  + I A+G   + AD F
Sbjct  562   SGTSMACPHVAGIAALIKSAHPNWSPAAIKSALVTTASQTGTDGTSISAEGLMRKVADPF  621

Query  665   DYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICP  486
             D GGG V+PN A DPGL++D    DY Q+LC+LG  ++ I +            ++TI  
Sbjct  622   DMGGGHVDPNKAIDPGLIFDSSTKDYIQFLCSLGDTSASITR----------LTKNTINC  671

Query  485   KTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRF  306
              T+   ++LNLPS+ +P+L +  T+ RTVTNVG +NS Y  +V++P G  +TV+P+ L F
Sbjct  672   STKSHGMNLNLPSITIPNLERATTVTRTVTNVGQINSKYTVLVQAPSGVKMTVEPQSLSF  731

Query  305   DGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             +   +  SF +   + + VN  + FGSLTW+DG H VR+P+A+R
Sbjct  732   NITSQILSFKVTFFSAQRVNGGYKFGSLTWTDGEHIVRSPVAIR  775



>gb|KDP41723.1| hypothetical protein JCGZ_26741 [Jatropha curcas]
Length=774

 Score =   542 bits (1396),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 330/782 (42%), Positives = 465/782 (59%), Gaps = 57/782 (7%)
 Frame = -3

Query  2417  KVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFA  2238
             ++L E  + +YIVY+G + HD+ + ++ESH++ L+ ++GS E A+++++Y+Y++GFSGFA
Sbjct  20    EILAE--RYVYIVYMGDRLHDEPKLVQESHHEFLSYIIGSEEAAKESILYNYKHGFSGFA  77

Query  2237  AVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMI  2058
             AVLT SQAK +A   GVVSV+ +K  + QT+RSWDFL +     +   LL K++ G G I
Sbjct  78    AVLTKSQAKVIAEFPGVVSVIRNKIIRPQTTRSWDFLQVKP--YLDDGLLSKSHSGVGSI  135

Query  2057  VGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGAL  1878
             +GV+D+GI  E  SF D G+G VP RWKG C+   G  FN S  CNRK+IGARW+ KG  
Sbjct  136   IGVMDTGIWPESKSFTDEGIGEVPSRWKGICQE--GEGFNHSH-CNRKIIGARWYIKG--  190

Query  1877  LSQDVDLNKFLVSD---SYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAA  1707
                + ++ K   SD     S  D  GHG+  +S  AG  V NA+ +G+  G+ RGGA +A
Sbjct  191   --YEAEIGKLDTSDVLEYLSPRDARGHGTHTSSTAAGVIVENASFMGLAQGLARGGAPSA  248

Query  1706  RVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGI  1527
              +A YK CW        C+ AD+LAA D A+ D VDV+SVS+GS  PLA+ +E  + + I
Sbjct  249   WLAIYKVCW----ANGGCSSADILAAFDDAVLDGVDVLSVSIGSTPPLATYVE--DPVAI  302

Query  1526  GSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD  1347
             GSFHA+T+GI V+ +AGN+GP   T+ N  PWV TVAASTIDR F   ITLGN +   V 
Sbjct  303   GSFHAVTKGISVVCSAGNSGPYHQTVINTAPWVTTVAASTIDRAFPTRITLGNNQT-VVG  361

Query  1346  WQLPNG--------TALSHPLHFAGKYMGEA-DLMPRKLDPAEVKGKIVFMFGDDLDRNL  1194
               L  G              +  AG +   A +     L+    +GK++  F     R+ 
Sbjct  362   QALYTGKNADKFYPVVNGEDIAVAGAFEESARNCETGTLNATLARGKVILCFQSRSVRSA  421

Query  1193  VLVDKA-TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQ  1017
              +  +  ++    G+I++   N D   IL   IP + VD+  GT +  Y+ +S+  P  +
Sbjct  422   TVATRTVSEVQGAGLIFAQFPNKDV--ILCFDIPCIHVDFAIGTYLLSYM-ESSRNPRVK  478

Query  1016  LSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMC-----ADPTS-----  867
              S  K  +G+ ++P++  FSSRGPSS +P ++KPDIAAPG  I+      A P S     
Sbjct  479   FSFTKTVIGQEISPEIAFFSSRGPSSLSPVVLKPDIAAPGVNILASWSPVASPLSFDITK  538

Query  866   ----DGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFA  699
                    F+  SGTS A PH+S IVALLK +HP WSPAAIKSALVTTA   D Y   I A
Sbjct  539   NKLTSLNFKFESGTSMACPHISGIVALLKATHPTWSPAAIKSALVTTASIEDEYGQKIVA  598

Query  698   KGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRN  519
             +G   + AD FDYGGG V+PN A DPGL+YD+   +Y  +LC+LGYNNS I         
Sbjct  599   EGGPHKQADPFDYGGGHVDPNKALDPGLIYDISISNYIHFLCSLGYNNSAISLM------  652

Query  518   RSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGA  339
                T   T+C K+   +++LNLPS+ +P+L   +T+ RTVTNVGP  SVY + V++P G 
Sbjct  653   ---TRTRTVCHKSTSFLVNLNLPSITIPELKNRLTVSRTVTNVGPAMSVYFSRVQAPAGT  709

Query  338   VVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVP  159
                V+P +L F+ + KK  F +   +   V   ++FG+L W DG H VR P+ V+ ++  
Sbjct  710   YARVEPSILSFNSSVKKLKFKVTFCSLLRVQGRYSFGNLFWEDGFHVVRIPLIVKTVVDN  769

Query  158   LY  153
              Y
Sbjct  770   FY  771



>gb|KCW55411.1| hypothetical protein EUGRSUZ_I01318 [Eucalyptus grandis]
Length=769

 Score =   540 bits (1392),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 323/765 (42%), Positives = 463/765 (61%), Gaps = 45/765 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
              +YIVY+G + HD+   + ESH+++L+G +GS E A+++ +YSY++GFSGFAAVL  SQA
Sbjct  29    NVYIVYMGARQHDEPELVSESHHEILSGFLGSEEAAKESTLYSYKHGFSGFAAVLNHSQA  88

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K +A + GVV V+ ++   +QT+RSWDFL ++  +++   +L K + G G I+GV+D+GI
Sbjct  89    KFIADLPGVVRVIPNRIFSLQTTRSWDFLHVN--SHIQNGILSKGHSGAGSIIGVMDTGI  146

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D GM   P RWKG C+   G  FN S  C+RK+IGARW+ KG     + +  
Sbjct  147   WPESESFKDDGMADAPTRWKGICQG--GEGFNASN-CSRKIIGARWYIKG----YEAEFG  199

Query  1853  KFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
             K  +++     S  D  GHG+  +S  AGS V +A+  G+  G+ RGGA AA +A YK C
Sbjct  200   KLNMTEGVEFLSPRDAVGHGTHTSSTAAGSLVEDASFAGLAQGLARGGAPAAWLAVYKIC  259

Query  1682  WNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITR  1503
             W+       C+ ADLLAA D AI D VDVIS+S+G+  PL S ++  + + IGSFHA+ +
Sbjct  260   WSTGG----CSSADLLAAFDDAISDGVDVISLSLGASPPLPSYVD--DTLAIGSFHAVAK  313

Query  1502  GIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTA  1323
             GI V+ + GN+GP   T+ N  PW+ITVAASTIDR F   IT+GN + +        G  
Sbjct  314   GITVVCSGGNSGPYPQTVINTAPWIITVAASTIDRAFPTAITMGNNQTFVGQAFYTRGRR  373

Query  1322  -LSHPLHFAGKYMGE-------ADLMPRKLDPAEVKGKIVFMFGDDLDRN-LVLVDKATD  1170
                +P+ +    +                L+    +GK+V  F     R+  V +   T 
Sbjct  374   DRYYPIVYGEDIVSTNSDEDSARSCEVGSLNATLARGKVVLCFQSRSQRSAAVAISTVTA  433

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
                 G+I+++  + D   I ++RIP VQVD+  GT +  Y+ ++T  P  +++S +  +G
Sbjct  434   VKGAGLIFAHFPSKDV--IGSSRIPCVQVDFTIGTSLLTYM-EATRKPLIKITSSRTIIG  490

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDG-----GFRISSGTSHA  828
             + ++P+V  FSSRGPSS +P ++KPDIAAPG  I+ +  P S        F I SGTS A
Sbjct  491   KQISPEVAIFSSRGPSSLSPSVLKPDIAAPGVNILASWSPASSELDPPLNFNIESGTSMA  550

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              PH+S IVALLK  HP W+PA IKS+LVTTA   D Y   I A+G++ + ADAFDYGGG 
Sbjct  551   CPHISGIVALLKAIHPSWTPAMIKSSLVTTASTKDQYSQNIVAEGATHKQADAFDYGGGH  610

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             V+ N A DPGLVYD    DY   LC +GYN+S I  T++G        + T C ++   +
Sbjct  611   VDANRAADPGLVYDAEISDYVCLLCFMGYNSSAI-STMTG--------KPTQCKESSNCL  661

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             ++LNLPS+V+P+L + VT+ R VTNVGP NS Y A VK+PVG  V VKP +L F+ +  K
Sbjct  662   VNLNLPSIVIPNLKQQVTVSRIVTNVGPANSTYTARVKAPVGTHVRVKPSILSFNSSMGK  721

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
               F +  ++   V   ++FG+L W DG+H VR P+ V+ +I   Y
Sbjct  722   LKFRVIFNSLLRVQGRYSFGNLIWEDGLHKVRIPLVVQTIIDDFY  766



>emb|CAB36809.1| subtilisin proteinase-like [Arabidopsis thaliana]
 emb|CAB81272.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=718

 Score =   538 bits (1387),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 322/754 (43%), Positives = 449/754 (60%), Gaps = 73/754 (10%)
 Frame = -3

Query  2321  LLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSR  2142
             +L  ++ S E+A+ +++YSY++GFSGFAA+LT+SQAKK++    V+ V+ ++  K++T+R
Sbjct  1     MLESLLQSKEDAQNSLIYSYQHGFSGFAALLTSSQAKKISEHPEVIHVIPNRIRKLKTTR  60

Query  2141  SWDFLGLS-------EGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQ  1983
             +WD LGLS         ++V G LL  TN G   I+GV+DSGI  E  +  D G+GP+P+
Sbjct  61    AWDHLGLSPIPTSFSSLSSVKG-LLHDTNLGSEAIIGVIDSGIWPESKAVNDQGLGPIPK  119

Query  1982  RWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHG  1803
             RW+G C   PG +FN +  CN K+IGAR++  G + +     N+ ++ D  S  D  GHG
Sbjct  120   RWRGKCE--PGEQFNATIHCNNKLIGARYYLNGVVAAIGGKFNRTIIQDFQSTRDANGHG  177

Query  1802  SQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERF-----VCAGADL  1638
             +  A+I  GSFVPN +  G+  G+VRGGA  AR+ASYKACWN+  +        C  AD+
Sbjct  178   THTATIAGGSFVPNVSYFGLAQGLVRGGAPRARIASYKACWNVMRDEGGGTDGRCTSADM  237

Query  1637  LAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSA  1458
               A D AIHD VDV+SVS+G  +P   D E +    I +FHA+ +GI V+ AAGN GP A
Sbjct  238   WKAFDDAIHDGVDVLSVSIGGGIP--EDSEVDKLDYIAAFHAVAKGITVVAAAGNEGPGA  295

Query  1457  FTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEA  1278
              T+ NV PW++TVAA+T+DR F   ITLGN +    +  L  G  +S  L F        
Sbjct  296   HTVDNVAPWLLTVAATTLDRSFPTKITLGNNQTLFAE-SLFTGPEISTGLAF--------  346

Query  1277  DLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT---DAGAVGVIYSNPSNVDSLPILN  1107
              L     D  +VKGK V +F           D AT     G   VI +   + D L   N
Sbjct  347   -LDSDSDDTVDVKGKTVLVF-----------DSATPIAGKGVAAVILAQKPD-DLLSRCN  393

Query  1106  ARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPG  927
               +P +  DY+ GT I  YI ++T +PT ++++     G+  T KV  FS RGP+S +P 
Sbjct  394   G-VPCIFPDYEFGTEILKYI-RTTRSPTVRITAATTLTGQPATTKVAAFSCRGPNSVSPA  451

Query  926   IMKP---------------DIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIV  804
             I+K                    PG  I+ A    +P    GF + SGTS + P VS I+
Sbjct  452   ILKVIKPLRLLSMFTSKGLTFLTPGVSILAAISPLNPEEQNGFGLLSGTSMSTPVVSGII  511

Query  803   ALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADD  624
             ALLK  HP+WSPAA++SALVTTAW +     PIFA+GS+ + AD FDYGGG+VNP  A  
Sbjct  512   ALLKSLHPKWSPAAVRSALVTTAWRTSPSGEPIFAEGSNKKLADPFDYGGGLVNPEKAAK  571

Query  623   PGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSM  444
             PGLVYDM  +DY +Y+C+ GYN+S I + +    N         CP  +PSMLD+NLPS+
Sbjct  572   PGLVYDMGIVDYIKYMCSAGYNDSSISRVLGKKTN---------CPIPKPSMLDINLPSI  622

Query  443   VVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK-RSFTMRV  267
              +P+L K VTL RTVTNVGP+ SVY+A+++SP+G  +TV P  L F    K+  +F+++ 
Sbjct  623   TIPNLEKEVTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTTLVFKSAAKRVLTFSVKA  682

Query  266   SADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
                  VN+ + FGSLTWSDGVH+V  P++V+  I
Sbjct  683   KTSHKVNTGYFFGSLTWSDGVHDVIIPVSVKTTI  716



>ref|XP_010028643.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=792

 Score =   541 bits (1393),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 323/765 (42%), Positives = 463/765 (61%), Gaps = 45/765 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
              +YIVY+G + HD+   + ESH+++L+G +GS E A+++ +YSY++GFSGFAAVL  SQA
Sbjct  52    NVYIVYMGARQHDEPELVSESHHEILSGFLGSEEAAKESTLYSYKHGFSGFAAVLNHSQA  111

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K +A + GVV V+ ++   +QT+RSWDFL ++  +++   +L K + G G I+GV+D+GI
Sbjct  112   KFIADLPGVVRVIPNRIFSLQTTRSWDFLHVN--SHIQNGILSKGHSGAGSIIGVMDTGI  169

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D GM   P RWKG C+   G  FN S  C+RK+IGARW+ KG     + +  
Sbjct  170   WPESESFKDDGMADAPTRWKGICQG--GEGFNASN-CSRKIIGARWYIKG----YEAEFG  222

Query  1853  KFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
             K  +++     S  D  GHG+  +S  AGS V +A+  G+  G+ RGGA AA +A YK C
Sbjct  223   KLNMTEGVEFLSPRDAVGHGTHTSSTAAGSLVEDASFAGLAQGLARGGAPAAWLAVYKIC  282

Query  1682  WNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITR  1503
             W+       C+ ADLLAA D AI D VDVIS+S+G+  PL S ++  + + IGSFHA+ +
Sbjct  283   WSTGG----CSSADLLAAFDDAISDGVDVISLSLGASPPLPSYVD--DTLAIGSFHAVAK  336

Query  1502  GIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTA  1323
             GI V+ + GN+GP   T+ N  PW+ITVAASTIDR F   IT+GN + +        G  
Sbjct  337   GITVVCSGGNSGPYPQTVINTAPWIITVAASTIDRAFPTAITMGNNQTFVGQAFYTRGRR  396

Query  1322  -LSHPLHFAGKYMGE-------ADLMPRKLDPAEVKGKIVFMFGDDLDRN-LVLVDKATD  1170
                +P+ +    +                L+    +GK+V  F     R+  V +   T 
Sbjct  397   DRYYPIVYGEDIVSTNSDEDSARSCEVGSLNATLARGKVVLCFQSRSQRSAAVAISTVTA  456

Query  1169  AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVG  990
                 G+I+++  + D   I ++RIP VQVD+  GT +  Y+ ++T  P  +++S +  +G
Sbjct  457   VKGAGLIFAHFPSKDV--IGSSRIPCVQVDFTIGTSLLTYM-EATRKPLIKITSSRTIIG  513

Query  989   RALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDG-----GFRISSGTSHA  828
             + ++P+V  FSSRGPSS +P ++KPDIAAPG  I+ +  P S        F I SGTS A
Sbjct  514   KQISPEVAIFSSRGPSSLSPSVLKPDIAAPGVNILASWSPASSELDPPLNFNIESGTSMA  573

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              PH+S IVALLK  HP W+PA IKS+LVTTA   D Y   I A+G++ + ADAFDYGGG 
Sbjct  574   CPHISGIVALLKAIHPSWTPAMIKSSLVTTASTKDQYSQNIVAEGATHKQADAFDYGGGH  633

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             V+ N A DPGLVYD    DY   LC +GYN+S I  T++G        + T C ++   +
Sbjct  634   VDANRAADPGLVYDAEISDYVCLLCFMGYNSSAI-STMTG--------KPTQCKESSNCL  684

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             ++LNLPS+V+P+L + VT+ R VTNVGP NS Y A VK+PVG  V VKP +L F+ +  K
Sbjct  685   VNLNLPSIVIPNLKQQVTVSRIVTNVGPANSTYTARVKAPVGTHVRVKPSILSFNSSMGK  744

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
               F +  ++   V   ++FG+L W DG+H VR P+ V+ +I   Y
Sbjct  745   LKFRVIFNSLLRVQGRYSFGNLIWEDGLHKVRIPLVVQTIIDDFY  789



>gb|AGN12874.1| putative transcription factor DYSFUNCTIONAL TAPETUM 1 [Sisymbrium 
irio]
Length=775

 Score =   539 bits (1389),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 325/791 (41%), Positives = 467/791 (59%), Gaps = 79/791 (10%)
 Frame = -3

Query  2420  AKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGF  2241
             A+ + +  KK+Y+VYLG K HDD + + ESH+ +L  V+GS E AR++++Y+Y++GFSGF
Sbjct  25    AQEISKEEKKVYVVYLGAKQHDDPKLVSESHHKMLESVLGSAEAARESIIYNYQHGFSGF  84

Query  2240  AAVLTasqakkvagvagvv------------------------svVEDKHHKVQTSRSWD  2133
             AA LT SQAKK++G+                            SV  ++  ++Q++R +D
Sbjct  85    AARLTESQAKKLSGLLVKKDLYTSSDTSSVLFHDICPDRPDVFSVASNRKLQMQSTRMFD  144

Query  2132  FLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIP  1953
             +LGLS    +P  +L++++ G   ++G++DSG+  E  +F D G+GP+P+ WKG C A P
Sbjct  145   YLGLS--PVLPKGILQESDMGSDKVIGILDSGLWPESEAFNDKGLGPIPKHWKGECVAGP  202

Query  1952  GLRFNESELCNRKVIGARWFF-------KGALLSQDVDLNKFLVSDSYSGYDVAGHGSQV  1794
               RF+ ++ CN+K+IGA++F        KG  +SQ+         +  S      HG+ V
Sbjct  203   --RFDPAKHCNKKLIGAKYFLDSWEEKHKGTKISQN---------EIMSPRGGLSHGTIV  251

Query  1793  ASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAI  1614
             +SI A +F+PN +  G+  G++RGGA  AR+A YK  W   P  F    AD + A D AI
Sbjct  252   SSIAASAFLPNVSYKGLAPGVMRGGAPKARIAMYKVLWETQP--FGSGIADCIRAFDEAI  309

Query  1613  HDRVDVISVSVGSPVPLASDMEA-ENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVE  1437
              D VDVISVS+G   P    + A    + IGSFHA+ +GIPV+ AAGN+GP A+T+ NV 
Sbjct  310   KDGVDVISVSLGPSGPPYRPLNAVGEDLEIGSFHAVMKGIPVVTAAGNSGPDAYTVVNVA  369

Query  1436  PWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFA---GKYMGEADLMP  1266
             PW+ITV A+++DR ++  +T GN          P G  LS  L +      Y   +DL  
Sbjct  370   PWMITVGATSLDRSYSVDMTFGNNITIMGQALYP-GDGLSADLVYIEDWKTYTATSDL--  426

Query  1265  RKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQ  1086
                     +GK+   F  + D +      + D GAVG I + PS  D+L   +   P + 
Sbjct  427   --------RGKVYLTFAKE-DWDWTSASTSLD-GAVGAIVARPS--DALSEGDYTQPRIA  474

Query  1085  VDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIA  906
             VDY+ GT+I  YI +S+ +PT ++S  K  VGR +   V  FS RGP+S APGI+KPD+ 
Sbjct  475   VDYEVGTKILQYI-RSSRSPTVKISRGKTLVGRPIATTVAGFSCRGPNSAAPGILKPDLV  533

Query  905   APGDKIMCAD----PTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTT  738
             APG  ++ AD    P    GF I  GTS AAP V+ IVALL+  HP+WSPAA+KSA++TT
Sbjct  534   APGMNVLGADIIVDPQYSPGFAIVQGTSFAAPAVTGIVALLRSLHPDWSPAALKSAMMTT  593

Query  737   AWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYN  558
             AW +D +  PIFA+GS  + AD FDYG G+VN   A DPGLVYDM   DY  +LCA  YN
Sbjct  594   AWKTDPHGDPIFAEGSPRKLADPFDYGAGLVNAERAKDPGLVYDMNIDDYIHFLCASSYN  653

Query  557   NSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVN  378
              + I   ++G        + T C    PS+LD+N P++ +P+L   V + RTVTNVGPV+
Sbjct  654   ETAI-SVLTG--------KPTKCSSPLPSILDVNYPAITIPELKDEVNITRTVTNVGPVD  704

Query  377   SVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHN  198
             SVY+A+V++P G  + V+P+ L F  + KK  F +RVS     N+ + FGS TW+DG  N
Sbjct  705   SVYRAVVEAPEGVKIVVEPQTLVFSSSTKKLGFKVRVSTSHKSNTGYFFGSFTWTDGTRN  764

Query  197   VRTPIAVRKMI  165
             V  P++VR  +
Sbjct  765   VTIPLSVRTRV  775



>ref|XP_009351288.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Pyrus 
x bretschneideri]
Length=771

 Score =   538 bits (1385),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 325/776 (42%), Positives = 457/776 (59%), Gaps = 52/776 (7%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             +L    K +YIVY+G + H +   + ESH+  L+ V GS E A+++++Y+Y++GFSGFAA
Sbjct  23    LLSLASKNVYIVYMGERQHGEPELVSESHHQTLSSVFGSKEAAKESILYNYKHGFSGFAA  82

Query  2234  VLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIV  2055
             VLT  QAK +A   GVV V  ++   + T+RSW+FL ++  +++   +L K+  G G I+
Sbjct  83    VLTPCQAKLIADSPGVVHVNPNRILNLHTTRSWNFLEVN--SHIRNGILSKSQSGIGSII  140

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             G++DSGI  E  SF D GMG  P R++G C+   G +FN S  CNRK+IGARW+ KG   
Sbjct  141   GIMDSGIWPESESFRDEGMGDAPSRFRGICQE--GEKFNRSH-CNRKIIGARWYSKG---  194

Query  1874  SQDVDLNKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAAR  1704
               + +      SD +   S  D  GHG+  +S  AG  + NA+  G+  G+ RGGA  AR
Sbjct  195   -YEAEFGNLSTSDEFEYLSPRDAGGHGTHTSSTAAGDSIQNASYKGLAAGLARGGAPLAR  253

Query  1703  VASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             +A YK CW +      C+ ADLLAA D AI+D VDV+SVS+GSP PL+S +E  + + IG
Sbjct  254   LAVYKVCWAVG-----CSSADLLAAFDDAIYDGVDVLSVSLGSPPPLSSYVE--DAMAIG  306

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW  1344
             SFHA+ +GI V+ +AGN+GP   T+ N  PW+ TVAASTIDR F   ITLGN +   V  
Sbjct  307   SFHAVAKGISVVCSAGNSGPYPQTVINSAPWIFTVAASTIDRAFPAVITLGNNQT-VVGQ  365

Query  1343  QLPNGTALS--HPLHFAGKYM---------GEADLMPRKLDPAEVKGKIVFMFGDDLDRN  1197
              L  G   +  +PL + G            G  D  P  L+     GK++  F     R+
Sbjct  366   ALYTGMDRNKYYPLVYGGDIASIDSDKDTAGSCD--PGTLNETLASGKVILCFQSRSQRS  423

Query  1196  LV-LVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTA  1020
              +      T A   G+I++   + D + + +   P VQVD+  GT +  YI  +T  P  
Sbjct  424   SIPATTTVTSARGAGLIFAQFPSKD-VSLSSGSPPCVQVDFAIGTNLLTYI-GTTRNPVV  481

Query  1019  QLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDGG-----  858
             + +  K  VG+ ++P+V  FSSRGP+S +P I+KPDIAAPG  I+ +  P          
Sbjct  482   KFNPSKTLVGQQISPEVAFFSSRGPNSLSPSILKPDIAAPGVNILASWSPAQSQNQANPD  541

Query  857   -FRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLR  681
              F+I SGTS A PH+S IVALLK  HP WSPAAIKS+LVTTA   D Y   I A+G+  +
Sbjct  542   IFKIESGTSMACPHISGIVALLKSIHPTWSPAAIKSSLVTTASLEDEYGQSIVAEGAPHK  601

Query  680   AADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEE  501
              A+ FDYGGG V+PN A  PGL+YD+   DY ++LC++GYNN+ I   ++G +       
Sbjct  602   QANPFDYGGGHVDPNKAIAPGLIYDIESSDYIRFLCSMGYNNTAI-SLVAGAK-------  653

Query  500   HTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKP  321
                C K+   + +LNLPS+ + +L +  T+ RTVTNVGPVNS Y A V +P G  V VKP
Sbjct  654   -ITCRKSTNFINNLNLPSITIHELKQSTTVSRTVTNVGPVNSTYNARVITPAGVSVRVKP  712

Query  320   KVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              +L F+   KK  F +   +   +   F+FG+L W DG+H VR P+ VR ++   Y
Sbjct  713   SILSFNSTVKKLEFKVTFRSLLRIQGRFSFGNLFWEDGLHVVRIPLIVRIVLDDFY  768



>ref|XP_004309569.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=824

 Score =   539 bits (1388),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 326/762 (43%), Positives = 455/762 (60%), Gaps = 36/762 (5%)
 Frame = -3

Query  2423  NAKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSG  2244
             + K   +   +++IVYLG K H+D    K+ H+ +L  ++GS E A  +++YSY++GFSG
Sbjct  77    DCKAFDKRTFQVHIVYLGEKKHEDPAFTKKFHHKMLTNLLGSKEAAYNSILYSYKHGFSG  136

Query  2243  FAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDG  2064
             FAA LT SQA+ +A   GV+ V+ ++ HK+ T+RSWDF+G+ + +  P   LR++  G G
Sbjct  137   FAARLTESQAETIAEFPGVLQVIPNRVHKLHTTRSWDFIGIHQHS--PENHLRRS-MGKG  193

Query  2063  MIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKG  1884
              I+GV+DSG+  E  SF D GM P+P  WKG C+   G  FN +  CN+K+IGARWF KG
Sbjct  194   TIIGVIDSGVWPESESFNDEGMDPIPSHWKGICQQ--GELFNSTN-CNKKLIGARWFVKG  250

Query  1883  ALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAAR  1704
             AL      +NK    D  S  D  GHG+  AS  AG FV  A   G+  G+ RGGA  A 
Sbjct  251   ALDEFKTPINKTDREDFLSPRDGIGHGTHTASTAAGYFVKRANYRGLASGLARGGAPLAH  310

Query  1703  VASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             +A YK CW        C  ADLL A D AIHD VD++S+SVG+ VPL S ++  + I IG
Sbjct  311   LAIYKVCWT----NRGCTDADLLKAFDKAIHDGVDILSLSVGNEVPLFSYVDLRDTIAIG  366

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---A  1353
             SFHA  +GI V+ +AGN GP + TI N  PW+ITVAA+ IDR F   ITLGN +     +
Sbjct  367   SFHATMKGITVVCSAGNDGPISQTIVNTAPWLITVAATKIDRAFPAAITLGNNQTLWGQS  426

Query  1352  VDWQLPN----GTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLV  1185
             +D    N    G   S  +          D     L+     GKIV  F    ++++V  
Sbjct  427   IDIGKHNHGFSGLTYSERIAIDSTDESAKDCQSGSLNATLASGKIVLCFSTSDEQDIVSA  486

Query  1184  DKATD-AGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSS  1008
                   AG +G+IY+   N D L   + +IP ++VDY  GT+I  YI ++   P  +LS 
Sbjct  487   SATVKKAGGIGLIYAEFPN-DGLE--SCKIPCIKVDYTVGTQILLYIRKARY-PIGKLSD  542

Query  1007  PKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSG  840
             P   VG+ ++P+V  FSSRGPSS  P ++KPDIAAPG  I+ A    +     G+ + SG
Sbjct  543   PTTVVGKWVSPQVATFSSRGPSSMTPTVLKPDIAAPGVDILAAFRPHEKKQSNGYALLSG  602

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS A PHV+ IVAL+K  H +WSPAAIKSALVTTA  + T  + I A+G + + AD FD 
Sbjct  603   TSMACPHVTGIVALIKSVHQDWSPAAIKSALVTTASQTGTDGTSISAQGQTRKVADPFDI  662

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGG V+PN A DPGL+Y+    DY Q+LC+LGY+ + + +  +           TI   T
Sbjct  663   GGGHVDPNKAMDPGLIYNATTNDYIQFLCSLGYSTASLTRLTNT----------TITCLT  712

Query  479   RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDG  300
             +   ++LNLPS+ +P+L +  T+ RTVTNVG ++S Y+ +V++P G  +TVKP  L F+ 
Sbjct  713   KADAINLNLPSISIPNLERTSTVTRTVTNVGKIDSKYRVMVQAPPGVEMTVKPPTLSFNI  772

Query  299   NRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
               +  S+ +   + + VN  + FGSLTW+DG H+VR PIA+R
Sbjct  773   TAQILSYKVTFFSTQKVNGGYKFGSLTWTDGEHDVRIPIAIR  814



>ref|XP_007209077.1| hypothetical protein PRUPE_ppa001674mg [Prunus persica]
 gb|EMJ10276.1| hypothetical protein PRUPE_ppa001674mg [Prunus persica]
Length=781

 Score =   537 bits (1383),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 331/769 (43%), Positives = 464/769 (60%), Gaps = 54/769 (7%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             +L E   +++IVYLG K +DD    K+ H+ +L  ++GS E A ++++YSY++GFSGFAA
Sbjct  35    ILVEATSEVHIVYLGEKKNDDPASTKKFHHQMLTTLLGSKEAAYRSIIYSYKHGFSGFAA  94

Query  2234  VLTasqakkvagvag--vvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGM  2061
              LT SQA+ +A      VV V+ ++ HK+ T+RSWDF+G+ + ++  G LL K+  G G 
Sbjct  95    RLTESQAEAIAAAEFPGVVQVIRNRIHKLHTTRSWDFIGIHQHSS--GNLLTKS-MGKGT  151

Query  2060  IVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGA  1881
             I+G++DSG+  E  SF D GM P+P  WKG C+   G  FN +  CNRK+IGARWF KGA
Sbjct  152   IIGLIDSGVWPESKSFNDEGMDPIPTHWKGICQQ--GEHFNSTN-CNRKIIGARWFRKGA  208

Query  1880  LLSQDVDLNKF-LVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAAR  1704
             +     +LN+   V D  S  D  GHG+  AS  AG FV  A   G+  G+ RGGA  A 
Sbjct  209   I-EHFKNLNRTNTVVDFRSPRDGIGHGTHTASTAAGYFVKRANYRGLASGLARGGAPLAH  267

Query  1703  VASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             +A YKACW  +     C  ADLL A D AIHD VD++S+SVG+  PL S ++  + I IG
Sbjct  268   LAIYKACWAFEG----CTDADLLKAFDKAIHDGVDILSLSVGNVTPLFSYVDQRDSIAIG  323

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---A  1353
             SFHA T+GI V+ +AGN GP + TI N  PW+ITVAA+TIDR+F   ITLGN       +
Sbjct  324   SFHATTKGITVVCSAGNDGPISQTIVNTAPWLITVAATTIDRVFPTAITLGNNHTLWGQS  383

Query  1352  VDWQLPNGTALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDL  1206
             +D +        H   F G    E            D  P  L+     GKIV  F    
Sbjct  384   IDIE-------KHKHGFVGIIYSERIALDRTNDSAKDCQPGSLNATLASGKIVLCFSKSD  436

Query  1205  DRNLVLV-DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMT  1029
              +++    +   +AG VG+I++   N D L   +  IP ++V Y+ GT+I  YI ++   
Sbjct  437   QQDIESASNTVQEAGGVGLIFAQFPN-DGLA--SCDIPCIRVGYEVGTQILSYIRKARF-  492

Query  1028  PTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDG  861
             P A+LS PK  +G+  +P+V  FS+RGPSS  P ++KPDIAAPG  I+ A    D     
Sbjct  493   PIAKLSDPKTVIGKWASPRVASFSARGPSSMTPEVLKPDIAAPGVDIIAAFRPRDTKHSN  552

Query  860   GFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLR  681
             G+ + SGTS A PHV+ I AL+K +HP WSP+AIKSALVTTA  + T  + I A+G + +
Sbjct  553   GYALLSGTSMACPHVAGIAALIKSAHPNWSPSAIKSALVTTASQTGTDGTSISAEGLTRK  612

Query  680   AADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEE  501
              AD FD GGG V+PN A DPGL++D    DY ++LC+LGY+ + I +    N N      
Sbjct  613   EADPFDIGGGHVDPNKAIDPGLIFDASTEDYIKFLCSLGYSIASITRLAKTNIN------  666

Query  500   HTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKP  321
                C  T+ + ++LNLPS+ +P+L +  T+ RTVTNVG +NS YKA+V++P G  +TV+P
Sbjct  667   ---CI-TKTNGVNLNLPSITIPNLKRTATVTRTVTNVGHINSKYKALVQAPPGIKMTVEP  722

Query  320   KVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             + L F+   +   F +     + ++  + FGSLTW+DG H VR+PIA+R
Sbjct  723   QTLSFNITTQILPFKVIFFTTQKLHGDYKFGSLTWTDGEHLVRSPIAIR  771



>ref|NP_001063751.1| Os09g0530800 [Oryza sativa Japonica Group]
 dbj|BAF25665.1| Os09g0530800 [Oryza sativa Japonica Group]
 gb|EAZ45452.1| hypothetical protein OsJ_30103 [Oryza sativa Japonica Group]
Length=769

 Score =   536 bits (1382),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 335/770 (44%), Positives = 446/770 (58%), Gaps = 49/770 (6%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDH-RRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
              +YIVY+G + H      ++E+H+ +LA V+GS + A  A++YSYR+GFSGFAAVLT  Q
Sbjct  25    NVYIVYMGERHHGLRPELVQEAHHGMLAAVLGSEQAAMDAILYSYRHGFSGFAAVLTGGQ  84

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A +++   GVV VV ++   + T+RSWDF+G++   +  G +L ++  G+  I+GV+D+G
Sbjct  85    AARLSDWPGVVRVVRNRVLDLHTTRSWDFMGVNPSPS-GGGILLESRFGEDSIIGVLDTG  143

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+G VP+RWKG C  + G +FN S  CNRK+IGA+W+ KG     + + 
Sbjct  144   IWPESASFRDDGIGEVPRRWKGQC--VAGEKFNASN-CNRKIIGAKWYVKG----YEAEY  196

Query  1856  NKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
              K   SD Y   S  D  GHG+  AS  AG+ V NA+  G+  G+ RGGA  AR+A YK 
Sbjct  197   GKMNTSDIYEFMSARDAVGHGTHTASTAAGALVANASFRGLAKGVARGGAQRARLAVYKV  256

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CW        C  AD+LAA D AIHD VDVISVS+G   PL + ++  + + IGSFHA+ 
Sbjct  257   CWATGD----CTAADILAAFDDAIHDGVDVISVSLGQAPPLPAYVD--DVLSIGSFHAVA  310

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +G+ V+ +AGN+GP + T+ N  PW++TVAA TIDRIF   I LGN   Y V   L +G 
Sbjct  311   KGVVVVCSAGNSGPYSETVINSAPWIVTVAAGTIDRIFLAKIILGNNSTY-VGQTLYSGK  369

Query  1325  ALSHPLHFAGKYMGEAD---------LMPRKLDPAEVKGKIVFMFGDDLDRNL-VLVDKA  1176
               S  +         +D              L+   VKG +V  F     R+  V V+  
Sbjct  370   HPSKSVRIVYAEDISSDNADDTDARSCTAGSLNATLVKGNVVLCFQTRAQRSASVAVETV  429

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
               A  VGVI++     D    L+  IP VQVDY  GT I  Y   S   P AQ S PK  
Sbjct  430   KKARGVGVIFAQFLTKDIASSLD--IPCVQVDYQVGTAILAYT-TSMRNPVAQFSFPKTI  486

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--------DPTSDGGFRISSG  840
             VG  + P+V  FSSRGPSS +P I+KPDIAAPG  I+ A               F+I SG
Sbjct  487   VGELVAPEVAYFSSRGPSSLSPSILKPDIAAPGVNILAAWSPAAAISSAIGSVNFKIDSG  546

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS + PH+S +VALLK  HP WSPAA+KSALVTTA   D Y   + ++ +    A+ FDY
Sbjct  547   TSMSCPHISGVVALLKSMHPNWSPAAVKSALVTTANVHDAYGFEMVSEAAPYNDANPFDY  606

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGG VNPN A  PGLVYDM   DY ++LC++GYN S I      +            PK 
Sbjct  607   GGGHVNPNRAAHPGLVYDMGVSDYMRFLCSMGYNTSAI------SSMTQQQTTCQHTPK-  659

Query  479   RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDG  300
               S L+LN+PS+ +P+L   +T+ RTVTNVGP  S Y+A V++P G  VTV P +L F+ 
Sbjct  660   --SQLNLNVPSITIPELRGKLTVSRTVTNVGPALSKYRARVEAPPGVDVTVSPSLLTFNS  717

Query  299   NRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
               +K  F +   A   V   +TFGSLTW DG H VR P+ VR +I   Y+
Sbjct  718   TVRKLPFKVTFQAKLKVKGRYTFGSLTWEDGTHTVRIPLVVRIIISKFYV  767



>ref|XP_009351289.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Pyrus 
x bretschneideri]
Length=769

 Score =   536 bits (1381),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 322/774 (42%), Positives = 455/774 (59%), Gaps = 50/774 (6%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             +L    K +YIVY+G + H +   + ESH+  L+ V GS E A+++++Y+Y++GFSGFAA
Sbjct  23    LLSLASKNVYIVYMGERQHGEPELVSESHHQTLSSVFGSKEAAKESILYNYKHGFSGFAA  82

Query  2234  VLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIV  2055
             VLT  QAK +A   GVV V  ++   + T+RSW+FL ++  +++   +L K+  G G I+
Sbjct  83    VLTPCQAKLIADSPGVVHVNPNRILNLHTTRSWNFLEVN--SHIRNGILSKSQSGIGSII  140

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             G++DSGI  E  SF D GMG  P R++G C+   G +FN S  CNRK+IGARW+ KG   
Sbjct  141   GIMDSGIWPESESFRDEGMGDAPSRFRGICQE--GEKFNRSH-CNRKIIGARWYSKG---  194

Query  1874  SQDVDLNKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAAR  1704
               + +      SD +   S  D  GHG+  +S  AG  + NA+  G+  G+ RGGA  AR
Sbjct  195   -YEAEFGNLSTSDEFEYLSPRDAGGHGTHTSSTAAGDSIQNASYKGLAAGLARGGAPLAR  253

Query  1703  VASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIG  1524
             +A YK CW +      C+ ADLLAA D AI+D VDV+SVS+GSP PL+S +E  + + IG
Sbjct  254   LAVYKVCWAVG-----CSSADLLAAFDDAIYDGVDVLSVSLGSPPPLSSYVE--DAMAIG  306

Query  1523  SFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDW  1344
             SFHA+ +GI V+ +AGN+GP   T+ N  PW+ TVAASTIDR F   ITLGN +     +
Sbjct  307   SFHAVAKGISVVCSAGNSGPYPQTVINSAPWIFTVAASTIDRAFPAVITLGNNQTVVALY  366

Query  1343  QLPNGTALSHPLHFAGKYM---------GEADLMPRKLDPAEVKGKIVFMFGDDLDRNLV  1191
                +     +PL + G            G  D  P  L+     GK++  F     R+ +
Sbjct  367   TGMDRNKY-YPLVYGGDIASIDSDKDTAGSCD--PGTLNETLASGKVILCFQSRSQRSSI  423

Query  1190  -LVDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQL  1014
                   T A   G+I++   + D + + +   P VQVD+  GT +  YI  +T  P  + 
Sbjct  424   PATTTVTSARGAGLIFAQFPSKD-VSLSSGSPPCVQVDFAIGTNLLTYI-GTTRNPVVKF  481

Query  1013  SSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDGG------F  855
             +  K  VG+ ++P+V  FSSRGP+S +P I+KPDIAAPG  I+ +  P           F
Sbjct  482   NPSKTLVGQQISPEVAFFSSRGPNSLSPSILKPDIAAPGVNILASWSPAQSQNQANPDIF  541

Query  854   RISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAA  675
             +I SGTS A PH+S IVALLK  HP WSPAAIKS+LVTTA   D Y   I A+G+  + A
Sbjct  542   KIESGTSMACPHISGIVALLKSIHPTWSPAAIKSSLVTTASLEDEYGQSIVAEGAPHKQA  601

Query  674   DAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHT  495
             + FDYGGG V+PN A  PGL+YD+   DY ++LC++GYNN+ I   ++G +         
Sbjct  602   NPFDYGGGHVDPNKAIAPGLIYDIESSDYIRFLCSMGYNNTAI-SLVAGAK--------I  652

Query  494   ICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKV  315
              C K+   + +LNLPS+ + +L +  T+ RTVTNVGPVNS Y A V +P G  V VKP +
Sbjct  653   TCRKSTNFINNLNLPSITIHELKQSTTVSRTVTNVGPVNSTYNARVITPAGVSVRVKPSI  712

Query  314   LRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             L F+   KK  F +   +   +   F+FG+L W DG+H VR P+ VR ++   Y
Sbjct  713   LSFNSTVKKLEFKVTFRSLLRIQGRFSFGNLFWEDGLHVVRIPLIVRIVLDDFY  766



>ref|XP_006413795.1| hypothetical protein EUTSA_v10024459mg [Eutrema salsugineum]
 gb|ESQ55248.1| hypothetical protein EUTSA_v10024459mg [Eutrema salsugineum]
Length=789

 Score =   537 bits (1383),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 321/757 (42%), Positives = 456/757 (60%), Gaps = 40/757 (5%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YI YLG + HDD R + +SH ++L  V+GS E A K+MVYSY +GFSGFAA L  + A+
Sbjct  62    VYIFYLGERKHDDPRLVTQSHLEILKSVLGSEEAANKSMVYSYHHGFSGFAAKLKPADAE  121

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             K+     V+ ++E++   +QT+R+WD+LGL         LL +TN G G I+GV+DSGI 
Sbjct  122   KLKNHPDVMILLENRKLVMQTTRTWDYLGLFSTPASSKGLLNETNMGSGAIIGVIDSGIW  181

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
             +E  +F D G GP+P+ WKG C  +   +F+ ++ CNRK+IGA+++  G  L+ D+  + 
Sbjct  182   SESGAFDDNGYGPIPKHWKGEC--VSADQFSAAD-CNRKLIGAKYYIDG--LNADLRTSM  236

Query  1850  FLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGID-VGMVRGGATAARVASYKACWNL  1674
                S+  S  D  GHG+QV+S VAGSFV N T  G+     +RG A  A +A YKACW++
Sbjct  237   NTSSEHISPRDHNGHGTQVSSTVAGSFVSNVTLPGLSYASTMRGAAPKAHIAMYKACWDV  296

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             +  +  C+ AD+  A D AIHD VDV+SVS+G  V + S ++ E  I I + HA+ +GIP
Sbjct  297   EGGK--CSVADVWKAFDEAIHDGVDVLSVSIGGSVEIKS-LDVEVDIAIPALHAVNKGIP  353

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+  AGN G  + ++ NV PW++TVAA+T+DR F+ ++TL N           N T L  
Sbjct  354   VVSPAGNGGSRSASVINVSPWILTVAATTLDRSFSASVTLEN-----------NKTLLGE  402

Query  1313  PLHFAGKYMGEADLM-PRKLDPAEVKGKIVFMFGDDLDRN---LVLVDKATDAGAVGVIY  1146
                +AG  +G  D++  R     ++KGK+V  F    + N   + + D   + GA+GVIY
Sbjct  403   S-RYAGPEIGFTDVIFSRDHGVDQIKGKVVMYFEAKTNGNPMPMPMPDIVQENGAIGVIY  461

Query  1145  -SNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
              +NP      P      P + +DYD G +I  Y+  +   P  ++   K  +G ++  KV
Sbjct  462   VNNPIERFECP---ENFPCIHLDYDIGAQIYYYMETTRRPPKIKIGPYKTIIGESVASKV  518

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFR--ISSGTSHAAPHVSAIVALL  795
                S+RGPSSF+P I+KPDIAAPG  +      +D   R    +GTS A P ++ IVALL
Sbjct  519   GASSARGPSSFSPAILKPDIAAPGVTLATPKIPTDEDTREFAYAGTSMATPVIAGIVALL  578

Query  794   KISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGL  615
             K+SHP+WSPA IKSALVTTA  +D +  P+ A GS+ + ADAFDYGGG+VN   A DPGL
Sbjct  579   KLSHPDWSPAIIKSALVTTAMKTDPHGVPLTADGSTHKLADAFDYGGGLVNLEKATDPGL  638

Query  614   VYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVP  435
             VYDM   DY  YLC+           ++GN           CP +  S+LDLN+PS+ +P
Sbjct  639   VYDMDINDYIHYLCSEASYTDKRVSALTGNVINK-------CPSSGSSILDLNVPSITIP  691

Query  434   DLF-KPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA-  261
              L    +T+ RTVTNVG V+SVYK ++++P+G  + V P  L F+    K +FT+ VS+ 
Sbjct  692   SLKGNNITVTRTVTNVGNVDSVYKPVIEAPLGFDIKVSPDKLVFNKGTNKVAFTVSVSSG  751

Query  260   DKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
                 NSAF FGSLTWSDG+HNV  P++VR   +  Y 
Sbjct  752   SHRANSAFYFGSLTWSDGLHNVTIPVSVRTRFLDNYF  788



>ref|XP_010513580.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=730

 Score =   535 bits (1377),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 319/757 (42%), Positives = 446/757 (59%), Gaps = 73/757 (10%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             KI+IV+LG K HD    + +SHY +L  ++GS E A+ ++VY+Y++GFSGFAA LTASQA
Sbjct  38    KIHIVHLGAKQHDTPELVTKSHYKILEPLLGSKEAAKNSIVYNYKHGFSGFAAKLTASQA  97

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K ++    V+SVV  +    +T+R++D+LGLS  +  P  LL  T  G  +I+GV+D+GI
Sbjct  98    KNLSVHPEVLSVVPSRVMWPKTTRTYDYLGLSPTS--PKGLLHDTKMGSEVIIGVIDTGI  155

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D G+GP+P+RWKG C +  G  F+  + CN+K+IGA +F +G L  ++ D  
Sbjct  156   WPESQSFNDTGLGPIPKRWKGKCMS--GEGFDPKKHCNKKLIGAEFFTEGLLSEEEYD--  211

Query  1853  KFLVSDSY-SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
              F+    + S  D  GHG+ VA+  AGSFV N +  G+ VG  RG A  AR+A YK CW 
Sbjct  212   -FVSEKEFRSPRDAKGHGTHVAATAAGSFVSNVSYKGLAVGTARGAAPHARIAVYKTCW-  269

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                 R  C  ADLL AID++I D VDVIS+S+G+  P + D++ ++ I  GSF A+ +GI
Sbjct  270   ---RRAGCITADLLKAIDHSIRDGVDVISISIGNEPPASFDVDKDD-IAFGSFQAVMKGI  325

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
             PV+ +AGN GP A TI N+ PW+ITVAA++ DR F   ITLGN           N T L+
Sbjct  326   PVVASAGNEGPGAQTIDNLAPWIITVAATSFDRSFPIPITLGN-----------NLTVLA  374

Query  1316  HPLHFA-----GKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD---AGA  1161
               L+        +     +L+   ++    KG I+  F    +       KA D   AG 
Sbjct  375   EGLNTFPEVGFSELQNAIELLDTNIEAGVTKGSIMLAFTPTAEA----AKKAHDILEAGC  430

Query  1160  VGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRAL  981
              G+IY   S ++ +      +P   VDY+ GT I  YI Q++++P A++S  K  +G+ +
Sbjct  431   AGIIYVQ-SAINPMVCSGLGVPCAVVDYEYGTDILYYI-QTSVSPKAKISPSKTLIGQPV  488

Query  980   TPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPHVSAIVA  801
               +V  FSSRGP+S  P I+KPDIAAPG  I+ A                          
Sbjct  489   ASRVAYFSSRGPNSVTPAILKPDIAAPGVNILSA--------------------------  522

Query  800   LLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDP  621
             +    +P+WSPAAI+SALVTTAW +D     IF++GS+ + AD FDYGGG++NP    +P
Sbjct  523   VTDKYNPDWSPAAIRSALVTTAWRTDPSGEQIFSEGSTRKLADPFDYGGGLINPEKVANP  582

Query  620   GLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMV  441
             GL+YDM   DY  YLC+  Y++  I K +          +   CP   PSMLD N+PS++
Sbjct  583   GLIYDMGINDYVHYLCSAEYDDGAISKLVG---------KPIKCPSPLPSMLDFNMPSII  633

Query  440   VPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA  261
             +P L + VTL RTVTNVGP +SVYK +V+SP+G  + V PK L F  N  K +F +RV  
Sbjct  634   IPSLTREVTLTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASNITKSTFNVRVKT  693

Query  260   DKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
                VNS + FGSL W+DGVHNV  P+AVR  I+  Y+
Sbjct  694   SHRVNSDYYFGSLCWTDGVHNVTIPVAVRTKILKSYV  730



>ref|XP_006660880.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=768

 Score =   535 bits (1379),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 337/770 (44%), Positives = 451/770 (59%), Gaps = 49/770 (6%)
 Frame = -3

Query  2393  KIYIVYLGGK-PHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
              +YIVY+G + P      ++E+H+ +LA V+GS + AR A++YSYR+ FSGFAAVLT  Q
Sbjct  24    NVYIVYMGERHPELPPELVQEAHHGMLAAVLGSEQAARDAILYSYRHSFSGFAAVLTDGQ  83

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A +++   GVV VV +    +QT+RSWDF+G++   +  G LL ++  G+  I+GV+D+G
Sbjct  84    AARLSDWPGVVRVVRNHVLDLQTTRSWDFMGVNPSPSGSGVLL-ESRFGEDSIIGVLDTG  142

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+G VP+RWKG C  I G +FN S  CNRK+IGA+W+ KG     + + 
Sbjct  143   IWPESASFRDDGIGEVPRRWKGRC--IAGEKFNISN-CNRKIIGAKWYVKG----YEAEY  195

Query  1856  NKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
              K   SD +   S  D  GHG+  AS  AG+ V NA+  G+  G+ RGGA  AR+A YK 
Sbjct  196   GKMNTSDIFEFMSARDAVGHGTHTASTAAGALVANASFRGLANGVARGGAQKARLAVYKV  255

Query  1685  CWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAIT  1506
             CW        C+ AD+LAA D AIHD VDVISVS+G   PL + +   + + IGSFHA  
Sbjct  256   CWATGD----CSAADILAAFDDAIHDGVDVISVSLGQAPPLPAYVN--DVLSIGSFHAAA  309

Query  1505  RGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGT  1326
             +G+ V+ +AGN+GP + T+ N  PW++TVAA TIDRIF   I+LGN   Y V   L +G 
Sbjct  310   KGVVVVCSAGNSGPYSETVINSAPWIVTVAAGTIDRIFLAKISLGNNSTY-VGQTLYSGK  368

Query  1325  --ALSHPLHFAGKYMGE-AD------LMPRKLDPAEVKGKIVFMFGDDLDRN-LVLVDKA  1176
               + S  + +A     + AD           L+   VKG +V  F     R+  V V+  
Sbjct  369   HPSKSRRIVYAEDIASDNADNTDARSCTAGSLNATLVKGNVVLCFQTRAQRSPSVAVETV  428

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
               A  VGVI++     D    L+  IP +QVDY  GT +  Y   S   P AQ S PK  
Sbjct  429   KKARGVGVIFAQFLTKDIASSLD--IPCIQVDYQVGTAVLAYT-TSMRNPVAQFSFPKTI  485

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--------DPTSDGGFRISSG  840
             VG  + P+V  FSSRGPSS +P I+KPDIAAPG  I+ A               F+I SG
Sbjct  486   VGELVAPEVAYFSSRGPSSLSPSILKPDIAAPGVNILAAWSPAAAISSAIGSVNFKIDSG  545

Query  839   TSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDY  660
             TS + PH+S IVALLK  HP WSPAA+KSALVTTA   D Y   + ++ +  + A+ FD+
Sbjct  546   TSMSCPHISGIVALLKAMHPNWSPAAVKSALVTTANVRDAYGFEMVSEAAPYKEANPFDH  605

Query  659   GGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKT  480
             GGG V+PN A  PGLVYDM   DY  +LC++GYNNS I      +            PK 
Sbjct  606   GGGHVDPNRAAHPGLVYDMGQSDYMHFLCSMGYNNSAI------SSMTQQQTTCQHTPK-  658

Query  479   RPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDG  300
               S L+LN+PS+ +P+L   +T+ RTVTNVGP  S Y+A V++P G  VTV P +L F+ 
Sbjct  659   --SQLNLNVPSITIPELRGKLTVSRTVTNVGPALSNYRARVEAPPGVDVTVSPSLLTFNS  716

Query  299   NRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
               +K  F +   A   V   +TFGSLTW DG H VR P+ VR +I   Y+
Sbjct  717   TIRKLPFKVTFQAKLKVQGRYTFGSLTWEDGTHTVRIPLVVRIIISRFYV  766



>ref|NP_567624.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AEE84440.1| Subtilase family protein [Arabidopsis thaliana]
Length=803

 Score =   536 bits (1381),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 321/748 (43%), Positives = 444/748 (59%), Gaps = 34/748 (5%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YI YLG + HDD   + +SH ++L  V+GS E   K+MVYSY +GFSGFAA L  ++A+
Sbjct  80    VYIFYLGERKHDDPNLVTQSHLEILKSVLGSEEATNKSMVYSYHHGFSGFAAKLKPAEAE  139

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             K+     V+ ++E++   +QT+R+WD+LG          LL +TN G G I+GV+DSGI 
Sbjct  140   KLKKHPEVIILLENRKLGLQTTRTWDYLGQFSTPTSSKSLLHETNMGSGAIIGVIDSGIW  199

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
             +E  SF D G GP+P+ WKG C  +   +F+ ++ CN+K+IGA+++  G  L+ D++ + 
Sbjct  200   SESGSFDDDGYGPIPKHWKGQC--VSADQFSPAD-CNKKLIGAKYYIDG--LNADLETSI  254

Query  1850  FLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVG-MVRGGATAARVASYKACWNL  1674
                ++  S  D  GHG+QV+S  AGSFV N T LG+  G ++RGGA  A +A YKACW  
Sbjct  255   NSTTEYLSPRDHNGHGTQVSSTAAGSFVSNMTLLGLSSGSIMRGGAPKAHIAMYKACW--  312

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             D E  +C+ AD+  A D AIHD VDV+SVSVG       D+E +  I I + HA+ +GIP
Sbjct  313   DVEGGMCSVADVWKAFDEAIHDGVDVLSVSVGGSALKTLDVEID--IAIPALHAVNKGIP  370

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+  AGN G  + ++ NV PW++TVAA+T+DR F+  ITL N + Y +   L  G  +S 
Sbjct  371   VVSPAGNEGSRSSSVINVSPWILTVAATTLDRSFSTLITLENNKTY-LGQSLYTGPEISF  429

Query  1313  PLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVIY-SNP  1137
                         D +         KGK++  F     R L   D     G +G+IY  NP
Sbjct  430   TDVICTGDHSNVDQI--------TKGKVIMHFSMGPVRPLT-PDVVQKNGGIGLIYVRNP  480

Query  1136  SNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFS  957
                DS        P + +D + G+ +  YI Q+  +   ++S  K  +G ++  KV   S
Sbjct  481   G--DSRVECPVNFPCIYLDMEVGSELYTYI-QTRSSMKIKISPYKTIIGESVASKVAKSS  537

Query  956   SRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFR--ISSGTSHAAPHVSAIVALLKISH  783
             +RGPSSF+P I+KPDIAAPG  ++     +D   R  + SGTS A P ++ IVALLKISH
Sbjct  538   ARGPSSFSPAILKPDIAAPGLTLLTPRIPTDEDTREFVYSGTSMATPVIAGIVALLKISH  597

Query  782   PEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDM  603
             P WSPA IKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGLVYDM
Sbjct  598   PNWSPAVIKSALVTTAMKTDPYGERLTVDGGNYKVADAFDYGGGLVNLEKATDPGLVYDM  657

Query  602   RGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFK  423
                DY  YLC+           ++GN N         CP +  S+LDLN+PS+ +PDL  
Sbjct  658   DINDYTHYLCSQTLYTDKKVSALTGNVNNK-------CPSSSSSILDLNVPSITIPDLKG  710

Query  422   PVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS-ADKLVN  246
              V + RTVTNVG V SVYK ++++P G  V V PK L+F+  R K +FT+ VS     VN
Sbjct  711   TVNVTRTVTNVGRVKSVYKPVIEAPFGFNVVVSPKKLKFNKTRNKLAFTVTVSPGSHRVN  770

Query  245   SAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             +AF FGSLTWSD VHNV  PI++R   +
Sbjct  771   TAFYFGSLTWSDKVHNVTIPISLRTRFI  798



>ref|XP_006413752.1| hypothetical protein EUTSA_v10027359mg, partial [Eutrema salsugineum]
 gb|ESQ55205.1| hypothetical protein EUTSA_v10027359mg, partial [Eutrema salsugineum]
Length=714

 Score =   533 bits (1373),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 319/716 (45%), Positives = 430/716 (60%), Gaps = 60/716 (8%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             + +YIVYLG + HDD + +  SH+ +L  ++ S E+A+K+M+YSY++GFSGFAA+LT+SQ
Sbjct  31    RPVYIVYLGEREHDDPKLVTASHHQMLESLLESKEDAQKSMIYSYKHGFSGFAALLTSSQ  90

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSE-----GANVPGELLRKTNKGDGMIVG  2052
             AKK++    VV V+ ++  K++T+R+WD+LGLS       ++    LL  TN G   I+G
Sbjct  91    AKKISEHPEVVHVIPNRILKLKTTRTWDYLGLSPIPTSFSSSSAKGLLHNTNMGSEAIIG  150

Query  2051  VVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLS  1872
             V+DSGI  E     D G GP+P+RW+G C +  G +F+ +  CN K+IGA+++  G L  
Sbjct  151   VIDSGIWPESEVVNDQGFGPIPERWRGKCES--GEKFDATIHCNNKLIGAKYYLDGLLAD  208

Query  1871  QDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASY  1692
                  N+  + D  S  D  GHG+  A+I  GSFVPN +  G+  GMVRGGA  AR+A Y
Sbjct  209   NGGIFNRTKILDFKSTRDANGHGTHTATIAGGSFVPNVSFYGLARGMVRGGAPRARIAVY  268

Query  1691  KACWNL---DPERFV--CAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGI  1527
             KACWN+   D    V  C  AD+  A D A+HD VDV+SVS+G  +P   D E      +
Sbjct  269   KACWNIMRDDGSGTVGKCTDADIYKAFDDAMHDGVDVLSVSLGGKLP--EDSEVVYLGSV  326

Query  1526  GSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVD  1347
              +FHA+ +GI V+ AAGN GP A T+ NV PW +TVAA+T+DR F   ITLGN + +  +
Sbjct  327   AAFHAVAKGILVVAAAGNDGPGAQTVVNVAPWFLTVAATTLDRSFPTKITLGNNQTFFAE  386

Query  1346  WQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDA  1167
               L  G  +S  L F         L        +V+GK V +F    D    +V K    
Sbjct  387   -SLYTGPKISTGLAF---------LTSTSDANVDVEGKTVLVF----DSITPVVGK----  428

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
             GA G         D  P        +  DY+ GT I  YI ++T +PT ++S+ K   G 
Sbjct  429   GAAG-------RCDGFPC-------IYTDYELGTDILQYI-RTTRSPTVRISAAKTLTGL  473

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPH  819
               T KV  FS RGP+S +P I+KPDIAAPG  I+ A    DP +  GF + SGTS + P 
Sbjct  474   PATTKVAAFSCRGPNSVSPAILKPDIAAPGVSILAAVSPRDPEAHNGFGLLSGTSMSTPV  533

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             VS IVALLK  HP+WSPAAI+SALVTTAW +     PIFA+GS+ + AD FDYGGG+VNP
Sbjct  534   VSGIVALLKSLHPDWSPAAIRSALVTTAWRTSPSGEPIFAEGSNKKLADPFDYGGGLVNP  593

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
               A  PGLVYDM    Y  Y+C+ GY +S I + +          + TICP   PS+LD+
Sbjct  594   EKAAKPGLVYDMGIEGYINYMCSAGYKDSSISRVLG---------KKTICPTPEPSVLDI  644

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
             NLPS+ +P+L + VTL RTVTNVGP+ SVYKA+V+SP+G  +TV P  L F    K
Sbjct  645   NLPSITIPNLEQEVTLTRTVTNVGPIKSVYKAVVESPLGINLTVSPTTLVFSSAAK  700



>ref|XP_008452040.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   534 bits (1376),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 333/759 (44%), Positives = 453/759 (60%), Gaps = 46/759 (6%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             +   K++IVYLG KPH D +   +SH+ LLA ++GS E++ +AMVYSY++GFSGFAA LT
Sbjct  30    DQNPKVHIVYLGEKPHHDTKFTTDSHHQLLAAILGSKEKSLEAMVYSYKHGFSGFAAKLT  89

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
              S+A+K++ ++ VV VV    +KV T+RSWDFLGLS   +    LL +  KGD +I+GV+
Sbjct  90    KSEAQKLSEMSRVVRVVPSSLYKVHTTRSWDFLGLSSSPSESSNLLHRA-KGDDVIIGVI  148

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             DSGI  E  SF D G+GP+P RWKG+C +  G +FN +  CN+K+IGARWF K  +    
Sbjct  149   DSGIWPESESFKDKGLGPIPSRWKGTCES--GEQFNSTN-CNKKIIGARWFVKAFV----  201

Query  1865  VDLNKFLVSDSY-SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYK  1689
              D  +  ++  Y S  D+ GHG+  AS  AGSFV N        G  RGGA  AR+A YK
Sbjct  202   ADYGREALAKEYLSPRDLHGHGTHTASTAAGSFVANINYHNNAAGTARGGAPLARLAIYK  261

Query  1688  ACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
             A W     R V + AD+L AID AIHD VDV+S+S+G   P   +    + I  GSFHAI
Sbjct  262   ALWT---NRGVGSSADILKAIDEAIHDGVDVLSISIGGSPPFYPEFTELSDIAFGSFHAI  318

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
             T+GI V+ AAGN+GPS   + NV PW+ TVA +TIDR F  +IT              N 
Sbjct  319   TKGISVVCAAGNSGPSPQMVDNVAPWIFTVATNTIDRAFLSSITTLRD----------NT  368

Query  1328  TALSHPLHFAGKYMGEADLMPRKLD-----PAEVKGKIVFMFGDDLDRNLV--LVDKATD  1170
             T +   L  + K +    +   + D      A + GK+V  F    D + +    +    
Sbjct  369   TFMGQSLLESKKDLVAELVSWERCDQLSGNEAFINGKVVLCFPKLADYSTISKAAEVVVR  428

Query  1169  AGAVGVIYSNPSNVDS--LPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
             A   G+I +    VD+  L  +++ IP + VD   G+++  Y  Q++  P   L + +  
Sbjct  429   ANGTGIIVAG-QQVDNNLLACISSPIPCILVDTIVGSKLFFYFLQNSDHPVVMLRAARTI  487

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPT---SDGGFRISSGTSHA  828
             +G+ + P +  FSSRGP+S +P I+KPDI+APG  I+ A  P    ++ GF + SGTS A
Sbjct  488   IGKPIAPTIAHFSSRGPNSVSPPILKPDISAPGSNILSAVSPHYFFNEKGFSLMSGTSMA  547

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              PHVSAIVALLK  HP WSPAAIKSAL+TTA    +   PIFA G+  + AD FDYG G+
Sbjct  548   TPHVSAIVALLKSVHPTWSPAAIKSALMTTARTEVSPGLPIFADGTPPKVADPFDYGAGV  607

Query  647   VNPNAADDPGLVYDMRGIDYAQ-YLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
             V+ NAA DPGL+YDM   DY   YLC +GY +    K IS   +R      T CP  R S
Sbjct  608   VDANAAVDPGLIYDMGRKDYIDYYLCGMGYED----KDISHLTHRK-----TECPLQRLS  658

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
             +LDLNLP++ +P L     + RTVTNVG ++ VYKA +++P G  V+V P+VL F+   K
Sbjct  659   LLDLNLPAITIPSLVNSTIVTRTVTNVGNLSCVYKAKIEAPFGCKVSVNPQVLVFNSQVK  718

Query  290   KRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             K SF +        N  ++FG LTWSDGVH V+ P++VR
Sbjct  719   KISFKVMFFTQVQRNYGYSFGRLTWSDGVHVVKIPLSVR  757



>ref|NP_001159267.1| uncharacterized protein LOC100304357 precursor [Zea mays]
 gb|ACN25629.1| unknown [Zea mays]
Length=768

 Score =   534 bits (1375),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 334/773 (43%), Positives = 449/773 (58%), Gaps = 56/773 (7%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDH-RRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTas  2220
               +YIVY+G +  + H   ++++H+ +LAG++GS + A+ A++YSYR+GFSGFAAVLT S
Sbjct  24    NNVYIVYMGARNPELHPALVRDAHHGMLAGLLGSEQAAKDAILYSYRHGFSGFAAVLTDS  83

Query  2219  qakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDS  2040
             QA ++AG  GVV VV ++   + T+RSWDF+ +    +    +L ++  G+  I+GV+D+
Sbjct  84    QAARLAGSPGVVRVVRNRVLDLHTTRSWDFMRVDPSHS--AGILPESRFGEDSIIGVLDT  141

Query  2039  GISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVD  1860
             GI  E  SF D GM   P+RWKG C  + G RFN S  CNRK+IGA+W+ KG     + +
Sbjct  142   GIWPESASFRDDGMSEAPRRWKGQC--VAGDRFNVSN-CNRKIIGAKWYIKG----YEAE  194

Query  1859  LNKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYK  1689
               K   +D Y   S  D  GHG+  AS  AG+ V  A+  G+  G+ RGGA  AR+A YK
Sbjct  195   YGKMNTTDIYEFMSARDAVGHGTHTASTAAGALVAGASFRGLAGGVARGGAPRARLAVYK  254

Query  1688  ACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
              CW        C  AD+LAA D AIHD VDV+SVS+G   PL + ++  + + IGSFHA+
Sbjct  255   VCWATGD----CTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAV  308

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
              RGI V+ +AGN+GP + T+ N  PW++TVAA TIDR F   I LGN   Y V   L +G
Sbjct  309   ARGIVVVCSAGNSGPYSETVINSAPWLVTVAAGTIDRTFLAKIILGNNSTY-VGQTLYSG  367

Query  1328  TALSHPLHFAGKYMGE------AD------LMPRKLDPAEVKGKIVFMFGDDLDRNL-VL  1188
                 HP +    +  E      AD           L+   VKG +V  F     R+  V 
Sbjct  368   ---KHPGNSMRIFYAEDVASNNADDTDARSCTAGSLNSTLVKGTVVLCFQTRAQRSAAVA  424

Query  1187  VDKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSS  1008
             V+    A  VGVI++     D     +  IP  QVDY  GT I  Y   ST  PT Q  S
Sbjct  425   VETVKKARGVGVIFAQFLTKDIASSFD--IPCFQVDYQVGTAILAYT-TSTRNPTVQFGS  481

Query  1007  PKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--------DPTSDGGFR  852
              K  +G  + P+V  FSSRGPSS +P ++KPDIAAPG  I+ A               F+
Sbjct  482   AKTILGELMGPEVAYFSSRGPSSLSPAVLKPDIAAPGVNILAAWTPAAAISSAIGSVKFK  541

Query  851   ISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAAD  672
             I SGTS + PH+S +VALLK  HP WSPAA+KSALVTTA   DTY   I ++ +    A+
Sbjct  542   IDSGTSMSCPHISGVVALLKSMHPNWSPAAVKSALVTTASVHDTYGFEIVSEAAPYNQAN  601

Query  671   AFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTI  492
              FDYGGG V+PN+A  PGLVYDM   DY ++LC++GYN S I          S  ++H  
Sbjct  602   PFDYGGGHVDPNSAAHPGLVYDMGTSDYVRFLCSMGYNVSAI---------SSLAQQHET  652

Query  491   CPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVL  312
             C  T  + L+LNLPS+ +P+L   +T+ RTVTNVG   + Y+A V++P G  VTV P +L
Sbjct  653   CQHTPKTQLNLNLPSISIPELRGRLTVSRTVTNVGSALTKYRARVEAPPGVDVTVSPSLL  712

Query  311   RFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              F+   +K +F +   A   V   + FGSLTW DGVH VR P+ VR MI   Y
Sbjct  713   TFNSTVRKLTFKVTFQAKLKVQGRYYFGSLTWEDGVHAVRIPLVVRTMISKFY  765



>ref|XP_006423459.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
 gb|ESR36699.1| hypothetical protein CICLE_v10027857mg [Citrus clementina]
Length=780

 Score =   533 bits (1373),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 336/782 (43%), Positives = 461/782 (59%), Gaps = 56/782 (7%)
 Frame = -3

Query  2411  LKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAV  2232
             L      +YIVY+G +  D+ + +++SH+ +L+ ++GS E A+++++YSY++GFSGFAAV
Sbjct  23    LATASSNVYIVYMGERRWDEPQLVQDSHHQILSDILGSKEAAKESILYSYKHGFSGFAAV  82

Query  2231  LTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVG  2052
             LT SQAK  A + GVV VV ++   + T+RSWDFL L    NV   +L K + G G I+G
Sbjct  83    LTHSQAKLTADLPGVVHVVPNRILSLHTTRSWDFLQLKP--NVENGILSKGHSGAGSIIG  140

Query  2051  VVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLS  1872
             V+D+GI  E  SF D  MG +P RW G C+   G  FN S  CNRK+IGARW+ KG    
Sbjct  141   VMDTGIWPESESFKDENMGEIPPRWNGICQE--GEGFNRSN-CNRKIIGARWYVKG----  193

Query  1871  QDVDLNKFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARV  1701
              + +  K   SD     S  D  GHG+  +S  AG  V +A+ LG+  G+ RGGA  A +
Sbjct  194   YEAEFGKLNSSDRVEFLSPRDAVGHGTHTSSTAAGGMVKDASFLGLAQGLARGGAPLAWL  253

Query  1700  ASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGS  1521
             A YK CW        C+ ADLLAA D A  D VDVIS+S+GS +PL++ ++  + I IGS
Sbjct  254   AIYKICWAPGG----CSSADLLAAFDDATFDGVDVISLSLGSSLPLSTYVD--DIISIGS  307

Query  1520  FHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQ  1341
             FHA+ +GI V+ +AGN+GP   T+ N  PWVITVAASTIDR F   IT+GN +   V   
Sbjct  308   FHAVAKGISVVCSAGNSGPYPQTVINTAPWVITVAASTIDRAFPTAITMGNNQT-VVGQA  366

Query  1340  LPNGTALSHPLH--FAGKYMGEAD--------LMPRKLDPAEVKGKIVFMFGDDLDRNLV  1191
               NG    +  +    GK +   D             L+   V+GKIV  F     R+  
Sbjct  367   FYNGKEDLNKFYPIVIGKDIATFDADEGSARSCESGTLNATLVRGKIVICFQSQFQRSAA  426

Query  1190  LVDKAT-DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQL  1014
                +   D+G VG+I++     D     +  IPY+QVD+  GT +  Y+ ++   P  + 
Sbjct  427   TAARTVLDSGGVGLIFAKFPTKDVH--FSFGIPYIQVDFAIGTSLLTYM-EANRNPIVKF  483

Query  1013  SSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---------  864
             S  K  +G+ ++P+V  FSSRGPSS +P ++KPDIAAPG  I+ +  P S+         
Sbjct  484   SFTKTVIGQQISPEVAFFSSRGPSSLSPSVLKPDIAAPGVNILASWSPVSNLEQTDHVTP  543

Query  863   -----GGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFA  699
                    F++ SGTS + PH+S IVALLK  HP WSPAAIKSA+VTTA   D Y   I A
Sbjct  544   NYIPQFNFKVESGTSMSCPHISGIVALLKAIHPTWSPAAIKSAIVTTASLKDEYAQSIVA  603

Query  698   KGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRN  519
             +G+  + AD FDYGGG V+PN A DPGLVYDM   DY ++LCA+GYNNS I        N
Sbjct  604   EGAPHKQADPFDYGGGHVDPNKAMDPGLVYDMEVSDYVRFLCAMGYNNSAI-----SLMN  658

Query  518   RSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGA  339
             R+ T   T   K+   +++LNLPS+ +P+L K +T+ R VTNV P+NSVY A V++P G 
Sbjct  659   RAST---TCNDKSTKFLVNLNLPSITIPELKKSITVSRQVTNVSPMNSVYTARVQAPAGT  715

Query  338   VVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVP  159
              V V+P  L F+  RKK  F +   +   V   ++FG+L W DG+H VR P+ VR +I  
Sbjct  716   TVRVEPSTLTFNSTRKKLKFKVTFYSRLRVQGRYSFGNLFWEDGIHVVRIPLIVRTIIDE  775

Query  158   LY  153
              Y
Sbjct  776   FY  777



>ref|XP_007042042.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX97873.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=778

 Score =   533 bits (1372),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 328/772 (42%), Positives = 457/772 (59%), Gaps = 61/772 (8%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             +YIVY+G +  D    +++SH+ +L+ ++GS E A+++++YSY++G SGFAAVL+ SQAK
Sbjct  30    VYIVYMGERHTDQPNLLEDSHHQILSDILGSKESAKESILYSYKHGLSGFAAVLSQSQAK  89

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
              +A V GVV VV ++   + T+RSWDFL +     +   +L +++ G G I+GV+D+GI 
Sbjct  90    LIADVPGVVRVVPNRILSLHTTRSWDFLHVKP--QIVDGILSRSHSGVGTIIGVMDTGIW  147

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
              E  SF D GMG VP RWKG C+   G  FN S  CNRK+IGARW+ KG     + +  K
Sbjct  148   PESESFKDKGMGKVPSRWKGICQE--GEGFNRSH-CNRKIIGARWYVKG----YEAEFGK  200

Query  1850  FLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACW  1680
                SD     S  D +GHGS  +S  +G+ V NA   G+  G+ RGGA+++ +A YK CW
Sbjct  201   LDPSDGVEFMSPRDASGHGSHTSSTASGALVENANFRGLAQGLARGGASSSWLAIYKVCW  260

Query  1679  NLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRG  1500
                     C+ ADLLAA D AI D V+V+SVS+GSP PL++ ++  + + IGSFHA+ RG
Sbjct  261   ATGG----CSSADLLAAFDDAIFDGVNVLSVSLGSPPPLSTYVD--DTLAIGSFHAVARG  314

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             I V+ +AGN+GP   T+ N  PWVITVAASTIDR F   +T+GN +   V      G  +
Sbjct  315   ISVVCSAGNSGPYPQTVINTAPWVITVAASTIDRDFPSVVTMGNNQT-VVGQSFYTGRKV  373

Query  1319  S--HPLHFAG---------KYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKAT  1173
             +  HP+ +              G  DL    L+    +GKIV  F     R+  +  ++ 
Sbjct  374   NKFHPIVYGEDIAATDVDENSAGSCDL--ETLNATLARGKIVLCFQSRSQRSAAIASRSV  431

Query  1172  -DAGAVGVIYSN-PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
                   GVI++  P+   S P      P VQ+D+ AGT +  YI  ++  P  + S  K 
Sbjct  432   LKVKGAGVIFAQFPTKDVSCPW---SFPCVQLDFAAGTSLLTYI-AASRNPVVKFSFSKT  487

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--------------DPTSDG  861
               G+ L P+V  FSSRGPSS +P ++KPDIAAPG  I+ +              +  S  
Sbjct  488   VTGQQLAPEVAYFSSRGPSSLSPSVLKPDIAAPGVDILASWSPASSSKPLDSPQNKASPF  547

Query  860   GFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLR  681
              F++ SGTS A PH+S IVALLK  HP WSPAAIKSALVTTA  +D Y     A+G+  +
Sbjct  548   NFKLDSGTSMACPHISGIVALLKGIHPTWSPAAIKSALVTTASVTDEYGQNTVAEGAPHK  607

Query  680   AADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEE  501
              AD FDYGGG V+PN A  PGL+YDM   DY  +L A+GYN++ I            T  
Sbjct  608   QADPFDYGGGHVDPNKALSPGLIYDMEISDYVCFLYAMGYNSTAISLM---------TRV  658

Query  500   HTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKP  321
              T C K+   +L+LNLPS+ +P+L + +T+ RTVTNVGP+NSVY A V++P G  V+VKP
Sbjct  659   RTPCRKSAKFLLNLNLPSITIPELKQRLTVSRTVTNVGPINSVYFARVQAPAGTHVSVKP  718

Query  320   KVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
               L F+   KK  F + + +   V   ++FG+L W DG+H VR P+ VR +I
Sbjct  719   SNLSFNSTTKKLKFKVTICSQLKVQGRYSFGNLYWEDGIHVVRIPLTVRIII  770



>ref|XP_006487361.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Citrus 
sinensis]
Length=780

 Score =   532 bits (1371),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 335/782 (43%), Positives = 461/782 (59%), Gaps = 56/782 (7%)
 Frame = -3

Query  2411  LKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAV  2232
             L      +YIVY+G +  D+ + +++SH+ +L+ ++GS E A+++++YSY++GFSGFAAV
Sbjct  23    LATASSNVYIVYMGERRWDEPQLVQDSHHQILSDILGSKEAAKESILYSYKHGFSGFAAV  82

Query  2231  LTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVG  2052
             LT SQAK  A + GVV VV ++   + T+RSWDFL L    NV   +L K + G G I+G
Sbjct  83    LTHSQAKLTADLPGVVRVVPNRILSLHTTRSWDFLQLKP--NVENGILSKGHSGAGSIIG  140

Query  2051  VVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLS  1872
             V+D+GI  E  SF D  MG +P RW G C+   G  FN S  CNRK+IGARW+ KG    
Sbjct  141   VMDTGIWPESESFKDENMGEIPPRWNGICQE--GEGFNRSN-CNRKIIGARWYVKG----  193

Query  1871  QDVDLNKFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARV  1701
              + +  K   SD     S  D  GHG+  +S  AG  V +A+ LG+  G+ RGGA  A +
Sbjct  194   YEAEFGKLNSSDGVEFLSPRDAVGHGTHTSSTAAGGMVKDASFLGLAQGLARGGAPLAWL  253

Query  1700  ASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGS  1521
             A YK CW        C+ ADLLAA D A  D VDVIS+S+GS +PL++ ++  + I IGS
Sbjct  254   AIYKICWAPGG----CSSADLLAAFDDATFDGVDVISLSLGSSLPLSTYVD--DIISIGS  307

Query  1520  FHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQ  1341
             FHA+ +GI V+ +AGN+GP   T+ N  PWVITVAASTIDR F   IT+GN +   V   
Sbjct  308   FHAVAKGISVVCSAGNSGPYPQTVINTAPWVITVAASTIDRAFPTAITMGNNQT-VVGQA  366

Query  1340  LPNGTALSHPLH--FAGKYMGEAD--------LMPRKLDPAEVKGKIVFMFGDDLDRNLV  1191
               NG    +  +    GK +   D             L+   V+GKIV  F     R+  
Sbjct  367   FYNGKEDLNKFYPIVIGKDIAAFDADEGSARSCESGTLNATLVRGKIVICFQSQFQRSAA  426

Query  1190  LVDKAT-DAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQL  1014
                +   D+G VG+I++     D     +  +PY+QVD+  GT +  Y+ ++   P  + 
Sbjct  427   TAARTVLDSGGVGLIFAKFPTKDVH--FSFGVPYIQVDFAIGTSLLTYM-EANRNPIVKF  483

Query  1013  SSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---------  864
             S  K  +G+ ++P+V  FSSRGPSS +P ++KPDIAAPG  I+ +  P S+         
Sbjct  484   SFTKTVIGQQISPEVAFFSSRGPSSLSPSVLKPDIAAPGVNILASWSPVSNLEQTDHVTP  543

Query  863   -----GGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFA  699
                    F++ SGTS + PH+S IVALLK  HP WSPAAIKSA+VTTA   D Y   I A
Sbjct  544   NYIPQFNFKVESGTSMSCPHISGIVALLKAIHPTWSPAAIKSAIVTTASLKDEYAQSIVA  603

Query  698   KGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRN  519
             +G+  + AD FDYGGG V+PN A DPGLVYDM   DY ++LCA+GYNNS I        N
Sbjct  604   EGAPHKQADPFDYGGGHVDPNKAMDPGLVYDMEVSDYVRFLCAMGYNNSAI-----SLMN  658

Query  518   RSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGA  339
             R+ T   T   K+   +++LNLPS+ +P+L K +T+ R VTNV P+NSVY A V++P G 
Sbjct  659   RAST---TCNDKSTKFLVNLNLPSITIPELKKSITVSRQVTNVSPMNSVYTARVQAPAGT  715

Query  338   VVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVP  159
              V V+P  L F+  RKK  F +   +   V   ++FG+L W DG+H VR P+ VR +I  
Sbjct  716   TVRVEPSTLTFNSTRKKLKFKVTFYSRLRVQGRYSFGNLFWEDGIHVVRIPLIVRTIIDE  775

Query  158   LY  153
              Y
Sbjct  776   FY  777



>ref|XP_006829160.1| hypothetical protein AMTR_s00001p00269990 [Amborella trichopoda]
 gb|ERM96576.1| hypothetical protein AMTR_s00001p00269990 [Amborella trichopoda]
Length=774

 Score =   532 bits (1370),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 323/767 (42%), Positives = 443/767 (58%), Gaps = 49/767 (6%)
 Frame = -3

Query  2387  YIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakk  2208
             YIVY+G K + +  +I++ H+ +L+ ++GS E +  +M+YSY++GFSGFAA+L    AK+
Sbjct  32    YIVYMGEKLNQEAEQIQDLHHRVLSDLLGSDEASSASMLYSYKHGFSGFAAILPPYVAKR  91

Query  2207  vagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIST  2028
             +    GV  V+ ++   +QT+RSWDFL ++   ++ G LL ++  G G I+G++D+GI  
Sbjct  92    IVDYPGVARVMPNRILNIQTTRSWDFLHMNP-ISMHG-LLSESRFGQGSIIGILDTGIWP  149

Query  2027  ELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKF  1848
             E  SF D GM  VP  WKG C+   G +F+ S  CNRK+IGARW+ KG     + +    
Sbjct  150   ESESFKDHGMSEVPSHWKGVCQE--GEQFSSSN-CNRKIIGARWYIKG----YNAEFGYL  202

Query  1847  LVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
               SDS+   S  D  GHGS  +S  AG+FV NA+ +G+  G+ RGGA  +R+A YK CW 
Sbjct  203   NTSDSFEFLSARDAVGHGSHTSSTAAGAFVSNASFMGLAKGVARGGAPHSRIAVYKVCWA  262

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                    C+ ADLLAA D AI D VDV+SVS+GS  PL  D   E+ + +GSFHA+ +GI
Sbjct  263   SGG----CSSADLLAAFDDAISDGVDVLSVSLGSAPPL--DPFVEDALAVGSFHAVAKGI  316

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPN-----  1332
              V+ + GN+G    T+ N  PW++TVAASTIDR F  TITLGN +               
Sbjct  317   TVVCSGGNSGSRPQTVINTAPWLVTVAASTIDRSFPTTITLGNNQTLVGQALYTGRSSGK  376

Query  1331  --GTALSHPLHFAGKYMGEADLMPR-KLDPAEVKGKIVFMFGDDLDRNLVLVDKAT-DAG  1164
               G   S  +  +G    +A       L+    KGK+V  F      + V+  K   +  
Sbjct  377   FLGVVYSEDIALSGGETDKASTCEEGSLNATLAKGKVVLCFQSRSQGSAVVAIKTVKEVQ  436

Query  1163  AVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRA  984
              VG+I++     D    ++   P+VQVDY   T I  YI Q T  P  +    K  +G +
Sbjct  437   GVGLIFAQFPTKDVFSSID--FPFVQVDYQIATIILAYI-QKTRYPILRFGFTKTALGTS  493

Query  983   LTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----------DPTSDGGFRISSGTS  834
             ++P+V  FSSRGP+S AP ++KPDIAAPG  I+ A          D      + I SGTS
Sbjct  494   ISPEVAFFSSRGPNSLAPSVLKPDIAAPGVNILAAWSPYNPPVKTDTQGPLYYNIESGTS  553

Query  833   HAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGG  654
              + PHVS IVALL+  HP W+PAAIKS+LVTTA   D Y   I A+G+  + AD FDYGG
Sbjct  554   MSCPHVSGIVALLRSLHPSWTPAAIKSSLVTTASTRDLYGQHIIAEGAPHKQADPFDYGG  613

Query  653   GIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRP  474
             G ++PN A +PGL++DM   D+ ++LC +GYNNS I              + T+CPK   
Sbjct  614   GHIDPNKAANPGLIFDMGVADHIRFLCFMGYNNSAISLM---------ARQVTVCPKGSG  664

Query  473   SMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNR  294
             SM DLNLPS+ +P L K +T+ RTVTNVGPV SVY A V++P G  V VKP  L F+   
Sbjct  665   SMADLNLPSVSIPQLRKSLTISRTVTNVGPVLSVYVAHVQAPPGVKVAVKPSCLSFNATT  724

Query  293   KKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
              K  F +  S    V   + FGSL W DG H V+ P+ VR +I  LY
Sbjct  725   NKLKFQVTFSPLLRVQGRYAFGSLMWHDGQHVVKIPLVVRIVIDDLY  771



>emb|CDX93810.1| BnaA09g24100D [Brassica napus]
Length=750

 Score =   531 bits (1367),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 326/764 (43%), Positives = 452/764 (59%), Gaps = 68/764 (9%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             ++IVYLG K HDD + + E H+ +L+ ++GS E+A  +MVYSYR+GFSGFAA LT SQAK
Sbjct  33    VHIVYLGEKQHDDPKHVTEYHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQAK  92

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             ++A    VV V+ D ++++ T+R+WD+LGLS  A  P  LL  TN G+ +I+GV+D+GI+
Sbjct  93    ELADSPEVVHVMPDGYYELATTRTWDYLGLS--AAHPKNLLNDTNMGEHVIIGVIDTGIN  150

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
             + L    + G          S   +  +   + +   ++   A+++  G L   D   N 
Sbjct  151   SSL----ECGQ---------SLNHLVTMGLEQYQSDGKE---AKYYINGFLAEND-GFNS  193

Query  1850  FLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLD  1671
                 D  S  D  GHG+ VASI  GSFVPN +  G+  G +RGGA  AR+A YKACW L+
Sbjct  194   TKSPDYISPRDFNGHGTHVASIAGGSFVPNVSYKGLAGGTLRGGAPRARIAMYKACWYLE  253

Query  1670  P-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
               E   C+ +D++ A+D AIHD VDV+S+S+GS VPL S+ +  +GI  G+FHA+  GI 
Sbjct  254   ELEGVTCSFSDIMKAMDDAIHDGVDVLSLSLGSRVPLFSETDMRDGIATGAFHAVANGIT  313

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL--  1320
             V+ A GNAGPSA T+ N  PW++TVAA+T+DR FA  ITLGN  K  +   +  G  L  
Sbjct  314   VVCAGGNAGPSAQTVVNTAPWILTVAATTLDRSFATPITLGN-NKVILGQAMYTGPELGF  372

Query  1319  ------SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATD----  1170
                     P +    + GE + +    +   + GKIV  F     R    V +A      
Sbjct  373   TSLVYPEDPGNSNDTFTGECESLNLNSN-RTMAGKIVLCF--TTTRGYTTVSRAASFVKR  429

Query  1169  AGAVGVIYS-NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQV  993
             AG +G+I + NP +  +L       P V VDY+ GT I  YI +S  +P  ++   +  V
Sbjct  430   AGGLGLIIARNPGH--TLNPCKDDFPCVAVDYELGTDILFYI-RSNGSPVVKIQPSRTMV  486

Query  992   GRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSD---GGFRISSGTSHAA  825
             G+ +  KV  FSSRGP+S +P I+KPDIAAPG  I+ A  P +    GGF + SGTS A 
Sbjct  487   GQPVGSKVATFSSRGPNSISPAILKPDIAAPGVSILAATSPNATFNAGGFVMLSGTSMAT  546

Query  824   PHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIV  645
             P +S +VALLK  HP+WSPAA +SA+VTTAW +D +   + A+GSS + AD FDYGGG+V
Sbjct  547   PAISGVVALLKSLHPDWSPAAFRSAIVTTAWRTDPFGEQLPAEGSSRKVADPFDYGGGLV  606

Query  644   NPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSML  465
             NP  A +PGL+YDM   DY  YLC++                        +C   +PS+L
Sbjct  607   NPEKAAEPGLIYDMGPKDYILYLCSV------------------------VCTDPKPSVL  642

Query  464   DLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKR  285
             D+NLPS+ +P+L   V L RTVTNVGPV+SVYK +V+ P+G  V V PK L F+   K  
Sbjct  643   DMNLPSITIPNLKDEVILTRTVTNVGPVHSVYKVVVEPPLGVRVVVTPKKLVFNSKTKSV  702

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             SFT+RVS    +N+ + FGSL WSD V  V  P++VR  I+  Y
Sbjct  703   SFTVRVSTTHKINTGYYFGSLVWSDSVRKVTIPVSVRTQILQNY  746



>gb|AID21582.1| AT4G21323p [Arabidopsis halleri]
Length=804

 Score =   533 bits (1372),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 327/755 (43%), Positives = 457/755 (61%), Gaps = 43/755 (6%)
 Frame = -3

Query  2384  IVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkv  2205
             I YLG + HDD   + +SH ++L  V+GS E A K+MVYSY +GFSGFAA L  ++A+K+
Sbjct  83    IFYLGERKHDDPNLVTQSHLEILKSVLGSEEAANKSMVYSYHHGFSGFAAKLKPAEAEKL  142

Query  2204  agvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTE  2025
                  V+ ++E++   +QT+R+WD+LG          LL +TN G G I+GV+DSGI +E
Sbjct  143   KKHPEVIILLENRKLGLQTTRTWDYLGQFSTPTSSEGLLHETNLGSGAIIGVIDSGIWSE  202

Query  2024  LPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFL  1845
             L  F D G GP+P++WKG C  +   +F+  + CN+K+IGA+++  G  L+ D++ +   
Sbjct  203   LGVFDDDGYGPIPKQWKGQC--VSADQFSPVD-CNKKLIGAKYYIDG--LNADLESSINS  257

Query  1844  VSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGID-VGMVRGGATAARVASYKACWNLDP  1668
              ++  S  D  GHG+QV+S VAGSFV N T  G+  V ++RGGA  A +A YKACW  D 
Sbjct  258   TTEYLSPRDRNGHGTQVSSTVAGSFVSNVTLPGLSSVSIMRGGAPKAHIAMYKACW--DV  315

Query  1667  ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVI  1488
             E  +C+ AD+  A+D AIHD VDV+SVS+G     + D+E +  I I + HA+ +GIPV+
Sbjct  316   EGGMCSVADVWKALDEAIHDGVDVLSVSIGGSALKSLDVEID--IAIPALHAVNKGIPVV  373

Query  1487  VAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPL  1308
               AGN G    ++ NV PW++TVAA+T+DR F   ITL N           N T L   L
Sbjct  374   SPAGNGGSRFSSVINVSPWILTVAATTLDRSFPTLITLEN-----------NKTLLGQSL  422

Query  1307  HFAGKYMGEADLMPRKLDPAEV----KGKIVFMFGDDLDRNLVLVDKATDAGAVGVI-YS  1143
              + G  +   DL+    D + +    KGK++  F       L+  D     G +G+I   
Sbjct  423   -YTGPEISFTDLICTA-DHSNIDQITKGKVIMHFSMG-PTPLMTPDVLQKNGGIGLIDVR  479

Query  1142  NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPD  963
             +PS  DS     A  P + +D + G+ +  YI Q+T +   ++S  K  +G  +  KV  
Sbjct  480   SPS--DSRVECPANFPCIYLDLEVGSELYTYI-QTTSSLKIKISPYKTIIGERVASKVAK  536

Query  962   FSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PTSDGGFRIS-SGTSHAAPHVSAIVALLKI  789
              S+RGPSSF+P I+KPDIAAPG  ++    PT +     + SGTS A P ++ IVALLKI
Sbjct  537   SSARGPSSFSPAILKPDIAAPGVTLLTPRIPTEEDTSEFAYSGTSMATPVIAGIVALLKI  596

Query  788   SHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVY  609
             SHP WSPAAIKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGLVY
Sbjct  597   SHPNWSPAAIKSALVTTAMKTDPYGERLTVDGGNYKVADAFDYGGGLVNLEKATDPGLVY  656

Query  608   DMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL  429
             DM   DY  YLC+           ++GN           CP +  S+LDLN+PS+ +PDL
Sbjct  657   DMDINDYIHYLCSQALYTDKKVSALTGNVTSK-------CPSSGLSILDLNVPSITIPDL  709

Query  428   FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS-ADKL  252
              + VT+ R+VTNVGPV SVYK ++++P+G  V V PK L+F+  R K +F +RVS     
Sbjct  710   KRNVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKKRNKVAFKVRVSPGSHR  769

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVR-KMIVPLYL  150
             VN+AF FGSLTWSDG+HNV  PI++R + I  L+L
Sbjct  770   VNTAFFFGSLTWSDGLHNVTIPISLRTRFIDNLFL  804



>gb|AID21654.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   533 bits (1372),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 322/752 (43%), Positives = 453/752 (60%), Gaps = 35/752 (5%)
 Frame = -3

Query  2387  YIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakk  2208
             YI YLG + HDD   + +SH ++L  V+GS E A K+MVYSY +GFSGFAA L  ++A+K
Sbjct  82    YIFYLGERKHDDPNLVTQSHLEILKSVLGSEEAANKSMVYSYHHGFSGFAAKLKPAEAEK  141

Query  2207  vagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIST  2028
             +     V+ ++E++   +QT+R+WD+LG          LL +TN G G I+GV+DSGI +
Sbjct  142   LKKHPEVIILLENRKLGLQTTRTWDYLGQFSTPTSSEGLLHETNMGSGAIIGVIDSGIWS  201

Query  2027  ELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKF  1848
             E  +F D G GP+P++WKG C  +   +F+  + CN+K+IGA+++  G  L+ D++    
Sbjct  202   ESGAFDDDGYGPIPKQWKGQC--VSADQFSPVD-CNKKLIGAKYYIDG--LNADLETRIN  256

Query  1847  LVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVG-MVRGGATAARVASYKACWNLD  1671
               ++  S  D  GHG+QV+S VAGSFV N T  G+  G ++RGGA  A +A YKACW  D
Sbjct  257   STTEYLSPRDRNGHGTQVSSTVAGSFVSNVTFPGLSSGSIMRGGAPKAHIAMYKACW--D  314

Query  1670  PERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPV  1491
              E  +C+ AD+  A D AIHD VDV+SVS+G     + D+E +  I I + HA+ +GIPV
Sbjct  315   VEGGMCSVADVWKAFDEAIHDGVDVLSVSIGGSALKSLDVEID--IAIPALHAVNKGIPV  372

Query  1490  IVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHP  1311
             +  AGN G    ++ NV PW++TVAA+T+DR F   ITL N + + +   L  G  +S  
Sbjct  373   VSPAGNGGSRFSSVINVSPWILTVAATTLDRSFPTLITLENNKTF-LGQSLYTGPEISFT  431

Query  1310  LHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI-YSNPS  1134
             +          D +         KGK++  F       +   D     G +G+I   +PS
Sbjct  432   VLICTADHSNLDQI--------TKGKVIMHFSMGPTPPMT-PDIVQKNGGIGLIDVRSPS  482

Query  1133  NVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSS  954
               DS     A  P + +D + G+ +  YI Q+T +   ++S  K  +G  ++ KV   S+
Sbjct  483   --DSRVECPANFPCIYLDLEVGSELYTYI-QTTSSLKIKISPYKTIIGERVSSKVAKSSA  539

Query  953   RGPSSFAPGIMKPDIAAPGDKIMCAD-PTSDGGFRIS-SGTSHAAPHVSAIVALLKISHP  780
             RGPSSF+P I+KPDIAAPG  ++    PT +     + SGTS A P ++ IVALLKISHP
Sbjct  540   RGPSSFSPAILKPDIAAPGVTLLTPRIPTDEDTSEFTYSGTSMATPVIAGIVALLKISHP  599

Query  779   EWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMR  600
              WSPAAIKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGLVYDM 
Sbjct  600   NWSPAAIKSALVTTAMKTDPYGERLTVDGGNYKEADAFDYGGGLVNLEKATDPGLVYDMD  659

Query  599   GIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKP  420
               DY  YLC+           ++GN           CP +  S+LDLN+PS+ +PDL + 
Sbjct  660   INDYIHYLCSQALYTDKKVSALTGNVTSK-------CPSSGSSILDLNVPSITIPDLKRN  712

Query  419   VTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSA-DKLVNS  243
             VT+ R+VTNVGPV SVYK ++++P+G  V V PK L+F+  R K +F +RVS     VN+
Sbjct  713   VTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSTGSHRVNT  772

Query  242   AFTFGSLTWSDGVHNVRTPIAVR-KMIVPLYL  150
             AF FGSLTWSDG+HNV  PI++R + I  L+L
Sbjct  773   AFYFGSLTWSDGLHNVTIPISLRTRFIDNLFL  804



>ref|XP_008245809.1| PREDICTED: subtilisin-like protease SDD1 [Prunus mume]
Length=779

 Score =   531 bits (1369),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 327/767 (43%), Positives = 459/767 (60%), Gaps = 52/767 (7%)
 Frame = -3

Query  2414  VLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAA  2235
             +L E   +++IVYLG K +DD    K+ H+ +L  ++GS E A K+++YSY++GFSGFAA
Sbjct  35    LLVEATSEVHIVYLGEKKNDDPASTKKFHHQMLTTLLGSKEAAYKSIIYSYKHGFSGFAA  94

Query  2234  VLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIV  2055
              LT SQA+ +    GVV V+ ++ HK+ T+RSWDF+G+ +  ++ G LL  +  G G I+
Sbjct  95    RLTDSQAEAIVEFPGVVQVIRNRIHKLHTTRSWDFIGIHQ--HLSGNLLTNS-MGKGTII  151

Query  2054  GVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALL  1875
             G++DSG+  E  SF D GM P+P  WKG C+   G  FN +  CNRK+IGARWF KGA+ 
Sbjct  152   GLIDSGVWPESKSFNDEGMDPIPTHWKGICQQ--GEHFNSTN-CNRKIIGARWFGKGAI-  207

Query  1874  SQDVDLNKF-LVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVA  1698
                 +LNK   V D  S  D  GHG+  AS  AG FV      G+  G+ RGGA  A +A
Sbjct  208   EHFKNLNKTNTVVDFLSPRDGIGHGTHTASTAAGYFVKRVNYRGLASGLARGGAPLAHLA  267

Query  1697  SYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSF  1518
              YKACW  +     C+ ADLL A D AIHD VD++S+SVG+  PL S ++  + I IGSF
Sbjct  268   IYKACWAFEG----CSDADLLKAFDKAIHDGVDILSLSVGNVTPLFSYVDQRDSIAIGSF  323

Query  1517  HAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKY---AVD  1347
             HA  +GI V+ +A        TI N  PW+ITVAA+TIDR+F   ITLGN +     ++D
Sbjct  324   HATAKGITVVCSAXXXXXXXQTIVNTAPWLITVAATTIDRVFPTAITLGNNQTLWGQSID  383

Query  1346  WQLPNGTALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDLDR  1200
              +        H   F G    E            D  P  L+     GKIV  F     +
Sbjct  384   IE-------KHKHGFVGIIYSERIALDRTNDSAKDCQPGNLNATLASGKIVLCFSKSDQQ  436

Query  1199  NLVLV-DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPT  1023
             ++    +   +AG VG+I++   N D L   +  IP ++V Y+ GT+I  YI ++   P 
Sbjct  437   DIESASNTVQEAGGVGLIFAQFPN-DGLA--SCDIPCIRVGYEVGTQILSYIRKARF-PI  492

Query  1022  AQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGF  855
             A+LS PK  +G+ ++P+V  FS+RGPSS  P ++KPDIAAPG  I+ A    D     G+
Sbjct  493   AKLSDPKTVIGKWVSPRVASFSARGPSSMTPEVLKPDIAAPGVDIIAAFRPRDMKHINGY  552

Query  854   RISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAA  675
              + SGTS A PHV+ I AL+K +HP WSP+AIKSALVTTA  + T  + I A+G + + A
Sbjct  553   ALLSGTSMACPHVAGIAALIKSAHPNWSPSAIKSALVTTASQTGTDGTSISAEGLTRKEA  612

Query  674   DAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHT  495
             D FD GGG V+PN A DPGL++D    DY Q+LC+LGY+++ I +    N N        
Sbjct  613   DPFDIGGGHVDPNKAIDPGLIFDASTEDYIQFLCSLGYSSASITRLTKTNIN--------  664

Query  494   ICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKV  315
              C  T+   ++LNLPS+ +P+L +  T+ RTVTNVG +NS YKA+V++P G  +TV+P+ 
Sbjct  665   -CI-TKTHGVNLNLPSITIPNLKRTATVTRTVTNVGHINSKYKALVQAPPGIKMTVEPQT  722

Query  314   LRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
             L F+   +   F +     + ++  + FGSLTW+DG H VR+PIA+R
Sbjct  723   LSFNITTQILPFKVTFFTTQKLHGDYKFGSLTWTDGEHLVRSPIAIR  769



>ref|XP_010436981.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=667

 Score =   527 bits (1358),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 308/692 (45%), Positives = 421/692 (61%), Gaps = 56/692 (8%)
 Frame = -3

Query  2162  HKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQ  1983
             +++ T+R+WD+LGLS G   P  LL+K N G  +IVGV+DSG+  E   F D G GP+P 
Sbjct  6     YELTTTRTWDYLGLSPGT--PKSLLQKANMGSSVIVGVIDSGVWPESEMFNDKGYGPIPS  63

Query  1982  RWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHG  1803
             RWKG C  + G  FN S  CN+K+IGA+++  G +    V LNK    +  S  D  GHG
Sbjct  64    RWKGGC--VSGELFNASIHCNKKLIGAKYYVDGYVAEYGV-LNKPGNPEYISPRDFNGHG  120

Query  1802  SQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAID  1623
             +  AS + GSFVPN + LG+  G  RGGA    +A YKACW+       C+ AD+L AID
Sbjct  121   THCASTIGGSFVPNVSYLGVGRGTARGGAPGVHIAMYKACWSTG----RCSNADILKAID  176

Query  1622  YAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITN  1443
              AIHD VDV+S+S+G+   L+ + +  +   +G+FHA+ +GI V+ AAGN GP A T++N
Sbjct  177   EAIHDGVDVLSLSLGARDSLSPETDVIDLTSVGTFHAVEKGISVVAAAGNDGPGAQTLSN  236

Query  1442  VEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLM--  1269
             V PW++TVAA+++DR F   ITLGN           N T L   + FAG  +    L   
Sbjct  237   VAPWILTVAATSLDRSFPTAITLGN-----------NITILGQAI-FAGPKLASVGLTYP  284

Query  1268  --PRKLDPA--------EVKGKIVFMFGDDLDRNLVLVDKAT----DAGAVGVIYS-NPS  1134
               P   D A         ++GK+V  F  DL+     V  A     +A  +G+I + NP+
Sbjct  285   ERPLSGDCAGLAANPKNTMQGKVVLCFTADLNPTSTAVKDAITAVRNARGLGIIIARNPT  344

Query  1133  NVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSS  954
             +   LPI +   P V VD++ GT I  YI +ST  P  ++++    V  ++  KV  FSS
Sbjct  345   H---LPIPSRHFPCVMVDFELGTDILFYI-RSTRFPFVKINASITLVSHSVATKVATFSS  400

Query  953   RGPSSFAPGIMKPDIAAPGDKIMCA-DPTS---DGGFRISSGTSHAAPHVSAIVALLKIS  786
             RGP+S +P I+KPDIAAPG  I+ A  P S   DGGF + SGTS A P V+ +V LL+  
Sbjct  401   RGPNSISPAILKPDIAAPGVNILAAISPNSSINDGGFAMMSGTSMATPVVTGVVVLLRSL  460

Query  785   HPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYD  606
             +P WSP+AIKSA+VTTAW +D    PIFA GS+ + AD FDYGGG+VNP  A  PGL+YD
Sbjct  461   YPHWSPSAIKSAIVTTAWKTDPSGEPIFADGSNRKLADPFDYGGGLVNPEKAARPGLIYD  520

Query  605   MRGIDYAQYLCA-LGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL  429
             M   DY  YLC+   YN++ I + + GN+        T+CP  +PS+LDLNLPS+ +P+L
Sbjct  521   MTIDDYVSYLCSTYNYNDASISQVL-GNK--------TVCPNPKPSVLDLNLPSITIPNL  571

Query  428   FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLV  249
                VTL RTVTNVGP+NS+YK ++  P+G  +TV P  L+F+   K  SF +RVS    V
Sbjct  572   KDEVTLTRTVTNVGPLNSIYKVMIDPPIGISMTVTPHTLQFNSTTKIVSFKVRVSTRHKV  631

Query  248   NSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
             N+ + FGSLTW+D +HNV  P++VR  I+  Y
Sbjct  632   NTGYYFGSLTWTDNLHNVVIPVSVRTQILERY  663



>gb|AID21627.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   532 bits (1370),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 325/757 (43%), Positives = 455/757 (60%), Gaps = 43/757 (6%)
 Frame = -3

Query  2390  IYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqak  2211
             ++I YLG + HDD   + +SH ++L  V+GS E A K++VYSY +GFSGFAA L  ++A+
Sbjct  81    VFIFYLGERKHDDPNLVTQSHLEILKSVLGSEEAANKSLVYSYHHGFSGFAAKLKPAEAE  140

Query  2210  kvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGIS  2031
             K+     V+ ++E++   +QT+R+WD+LG          LL +TN G G I+G++DSGI 
Sbjct  141   KLKKHPEVIILLENRKLGLQTTRTWDYLGQFSTPTSSKGLLHETNMGSGAIIGIIDSGIW  200

Query  2030  TELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNK  1851
             +E  +F D G GP+P++WKG C  +   +F+ ++ CN+K+IGA+++  G  L+ D++ + 
Sbjct  201   SESGAFDDDGYGPIPKQWKGQC--VSADQFSPAD-CNKKLIGAKYYIDG--LNADLETSI  255

Query  1850  FLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVG-MVRGGATAARVASYKACWNL  1674
                 +  S  D  GHG+QV+S VAGSFV N T  G+  G ++RGGA  A +A YKACW  
Sbjct  256   NSTIEYLSPRDRNGHGTQVSSTVAGSFVSNVTLPGLSSGSIMRGGAPKAHIAMYKACW--  313

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIP  1494
             D E  +C+ AD+  A D AIHD VD++SVS+G     + D+E +  I I + HA+ +GIP
Sbjct  314   DVEGGMCSVADVWKAFDEAIHDGVDILSVSIGGSALKSLDVEID--IAIPALHAVNKGIP  371

Query  1493  VIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSH  1314
             V+  AGN G    ++ N+ PW++TVAA+T+DR F   ITL N           N T L  
Sbjct  372   VVSPAGNGGSRYSSVINISPWILTVAATTLDRSFPTLITLEN-----------NKTFLGQ  420

Query  1313  PLHFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI-  1149
              L + G  +   DL+       LD    KGK++  F       +   D     G +G+I 
Sbjct  421   SL-YTGPEISFTDLICTADHSNLDQI-TKGKVIMHFSMGPTPPMT-PDIVQKNGGIGLID  477

Query  1148  YSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
               +PS  DS     A  P + VD + G+ +  YI Q+T +   ++S  K  +G  +  KV
Sbjct  478   VRSPS--DSRVECPANFPCIYVDLEVGSELYTYI-QTTSSLKIKISPYKTIIGERVASKV  534

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PT-SDGGFRISSGTSHAAPHVSAIVALL  795
                S+RGPSSF+P I+KPDIAAPG  ++    PT  D      SGTS A P ++ IVALL
Sbjct  535   AKSSARGPSSFSPAILKPDIAAPGVTLLTPRIPTDKDTSEFTYSGTSMATPVIAGIVALL  594

Query  794   KISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGL  615
             KISHP WSPAAIKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGL
Sbjct  595   KISHPNWSPAAIKSALVTTAMKTDPYGERLTVDGGNYKEADAFDYGGGLVNLEKATDPGL  654

Query  614   VYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVP  435
             VYDM   DY  YLC+           ++GN           CP +R S+LDLN+PS+ +P
Sbjct  655   VYDMDINDYIHYLCSQALYTDKKVSALTGNVTSK-------CPSSRSSILDLNVPSITIP  707

Query  434   DLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS-AD  258
             DL + VT+ R+VTNVGPV SVYK ++++P+G  V V PK L+F   R K +F +RVS   
Sbjct  708   DLKRNVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFSKRRSKVAFKVRVSPGS  767

Query  257   KLVNSAFTFGSLTWSDGVHNVRTPIAVR-KMIVPLYL  150
               VN+AF FGSLTWSDG+HNV  PI++R + I  L+L
Sbjct  768   HRVNTAFYFGSLTWSDGLHNVTIPISLRTRFIDNLFL  804



>gb|KCW72613.1| hypothetical protein EUGRSUZ_E01073, partial [Eucalyptus grandis]
Length=1447

 Score =   548 bits (1412),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 340/766 (44%), Positives = 454/766 (59%), Gaps = 66/766 (9%)
 Frame = -3

Query  2429  GTNAKVLKENGKKI--------------YIVYLGGKPHDDHRRIKESHYDLLAGVVGSHE  2292
             GT  +V+ E G+++              YIVY G +   D      SH+D+LA V+GS E
Sbjct  711   GTLFRVVTETGREVHFEARSSTNMALWVYIVYFGARKQGDPTVETNSHHDMLASVLGSKE  770

Query  2291  EARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEG  2112
              A K+++YSY +GFSGFAA LT SQA+++AG  GVV V+ +   ++QT+RSWDFLGLS  
Sbjct  771   AAAKSILYSYSHGFSGFAAKLTESQAQELAGFPGVVRVMPNTLFRLQTTRSWDFLGLSP-  829

Query  2111  ANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNES  1932
             ++ P  LL K+  GDG+IVG++D+GI  E  SF D G+GP+P RWKG C      +F+ +
Sbjct  830   SHSPTSLLYKSRMGDGVIVGMIDTGIWPESKSFSDEGLGPIPSRWKGGCELAE--QFDPA  887

Query  1931  ELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATT  1752
             + CNRK+IGARWF  G L      LN     +  S  D  GHG+  +S   GSFV N + 
Sbjct  888   KHCNRKIIGARWFVDGFLAEYGKPLNASGDLEFLSPRDANGHGTHTSSTAVGSFVSNVSY  947

Query  1751  LGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSP  1572
              GI  G  RGGA  AR+A YK CWN+   +  C+ AD+L A D AIHD VDV+SVS+G+ 
Sbjct  948   RGIGYGTARGGAPRARLAVYKVCWNVLNGQ--CSSADILKAFDEAIHDGVDVLSVSIGTA  1005

Query  1571  VPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIF  1392
             +PL SD++  +GI  G+FHA+ +GI V+  AGN GP+A T+ N  PW++TV A++IDR F
Sbjct  1006  IPLFSDVDDRDGIATGAFHAVAQGITVVCGAGNDGPAAQTVQNTAPWILTVGATSIDRAF  1065

Query  1391  AYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLM-PR--KLDPAE--------  1245
                ITLGN E          G A+     + GK +G   L+ P    LDP          
Sbjct  1066  RTIITLGNNETLV-------GQAI-----YTGKEIGFTTLLYPEGTTLDPTSGGVCERLS  1113

Query  1244  -----VKGKIVFMFGDDLDRNLVLVDKATDAGAVGV---IYSNPSNVDSLPILNARIPYV  1089
                  + GK+V  F     R  V +  A    + GV   +  NP   D L   +   P V
Sbjct  1114  PNATLMAGKVVLCFTSTAGRFAVTLASAAVKASRGVGVIVAKNPR--DGLAPCSGDFPCV  1171

Query  1088  QVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDI  909
             +VDY+ GTRI  Y F+S   P  +LS     VG+A+  KV  FSSRGP+S +P ++KPD+
Sbjct  1172  EVDYEIGTRILFY-FRSARFPKVKLSRTITAVGKAVQAKVALFSSRGPTSISPAVLKPDV  1230

Query  908   AAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVT  741
             AAPG  I+ A    +P+ D G+ + SGTS + PHV+ IVALLK  HP+WSPAA +SALVT
Sbjct  1231  AAPGVNILAATLPFNPSEDNGYTMLSGTSMSTPHVAGIVALLKALHPDWSPAAFRSALVT  1290

Query  740   TAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGY  561
             TAW S+    PIFA GS  + AD FD GGGIVNPN+A +PGL+YD+   DY  YLCA+GY
Sbjct  1291  TAWRSNPLGFPIFASGSPPKLADPFDMGGGIVNPNSAAEPGLIYDVGMPDYILYLCAMGY  1350

Query  560   NNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPV  381
             N++ I            T +   CP  RPS+ D+NLPS+ +P L   VT+ RTV N G  
Sbjct  1351  NDTEISHL---------TGKPAPCPARRPSVSDVNLPSITIPRLTSTVTVTRTVKNTGNP  1401

Query  380   NSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNS  243
              S Y A+++ P G  VTV+P VL FD   KK +F++ V A   VN+
Sbjct  1402  ESRYWAVIEPPSGTTVTVRPHVLAFDPETKKAAFSVTVCAAVPVNT  1447



>ref|XP_004978766.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=743

 Score =   528 bits (1359),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 332/761 (44%), Positives = 449/761 (59%), Gaps = 71/761 (9%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             K+YIVY+G K HDD   +  SH+D+LA V+GS +EA K++VYSY++GFSGFAA+LT SQA
Sbjct  28    KLYIVYMGEKKHDDPSVVTASHHDVLASVLGSKDEAMKSIVYSYKHGFSGFAAMLTKSQA  87

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             + +  + GVVSV  +  ++  T+RSWDFLGL    +   +LLRK   G+ +IVGVVD+GI
Sbjct  88    ETIKNLPGVVSVKPNTRYQTATTRSWDFLGLDYYQSSAPDLLRKAKYGEDIIVGVVDTGI  147

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D+G GPVP RW+G C+   G  FN +  CNRK+IGARW+  G      +D  
Sbjct  148   WPESRSFDDSGYGPVPARWRGVCQK--GAEFNATS-CNRKIIGARWYTGG------LDAE  198

Query  1853  KFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNL  1674
             K L  +  S  D+ GHG+ VAS +AGS V N +  G+  G+ RGGA   R+A YKACW  
Sbjct  199   K-LKGEYLSARDMNGHGTHVASTIAGSLVRNVSHGGLAAGVARGGAPRTRLAVYKACWLT  257

Query  1673  DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSP--VPLASDMEAENGIGIGSFHAITRG  1500
                   C G  LLAAID AI+D VDV+S+SV  P  +P             G+ HA+ RG
Sbjct  258   GG----CDGVALLAAIDDAINDGVDVLSLSVAGPDDIP-------------GTLHAVARG  300

Query  1499  IPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTAL  1320
             IPV+ AAGN GP+A T+ N  PWV+TVAA+TIDR F   ++LGN EK        N +  
Sbjct  301   IPVVFAAGNKGPAAQTMQNAVPWVLTVAATTIDRSFPTVVSLGNNEKLVGQSLNYNASVN  360

Query  1319  SHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMFGDDLDRN--------LVLVDKATDAG  1164
             S   H     MG  D   R+L    V G +V +    L+ +        +  V +   AG
Sbjct  361   SDDFHEIIS-MGSCD--ERELSSTNVTG-VVVLCSAPLEASSKPPPQGFVSAVTRVGKAG  416

Query  1163  AVGVIY----SNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
             A G+I+    SN      +      +P V VD++   RI+ Y   S   P  ++S     
Sbjct  417   AKGLIFAQHNSNLLEYTDIACRQYSMPCVLVDFEIAHRIESYYANSVEIPVVKISRTFSV  476

Query  995   VGRA-LTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPH  819
             VG   L+P+V  FS+RGPS+  P I+KPDIAAPG  I+ A     G +++ SGTS A PH
Sbjct  477   VGNGVLSPRVAAFSARGPSAEFPAIIKPDIAAPGVGILAA--AVGGSYKLLSGTSMACPH  534

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             V+A+VALLK  HP WSPA IKSA++TTA  +D +  PI A+G   + AD FD+GGG ++P
Sbjct  535   VAAVVALLKSIHPHWSPAMIKSAIITTASVADRFGMPIQAEGVPRKLADPFDFGGGHIDP  594

Query  638   NAADDPGLVYDMRGIDYAQYL-CALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLD  462
             + A DPGLVYD+   +Y ++  C LG  +                     C      +  
Sbjct  595   DRAMDPGLVYDIDAGEYTKFFNCTLGPKDD--------------------CVTYMGQLYQ  634

Query  461   LNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRF-DGNRKKR  285
             LNLPS+ VPDL + VT+RRTVTNVGP  + Y+A+V++P G  V+V+P V++F +G  K+ 
Sbjct  635   LNLPSIAVPDLKETVTVRRTVTNVGPAEATYQAVVEAPPGVDVSVEPSVIKFSEGGSKEA  694

Query  284   SFTMRVSADKLVNSAFTFGSLTWSDG-VHNVRTPIAVRKMI  165
             +F +  +A + V   +TFGSLTW DG  H+VR PIAVR +I
Sbjct  695   TFRVTFTARQRVQGGYTFGSLTWLDGNTHSVRIPIAVRTVI  735



>ref|XP_006301478.1| hypothetical protein CARUB_v10021900mg, partial [Capsella rubella]
 gb|EOA34376.1| hypothetical protein CARUB_v10021900mg, partial [Capsella rubella]
Length=719

 Score =   527 bits (1357),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 324/736 (44%), Positives = 446/736 (61%), Gaps = 42/736 (6%)
 Frame = -3

Query  2429  GTNAKVLKENGK-KIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYG  2253
             G     ++ NGK K++IV+LG K HD    + +SHY +L  ++GS E A  ++VYSY+YG
Sbjct  23    GVFISAVQLNGKTKVHIVHLGAKQHDTPELVTKSHYRILESLLGSKETANDSIVYSYKYG  82

Query  2252  FSGFAAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNK  2073
             FSGFAA LTASQAK ++    V+S+  ++  +++T+R++D+LGLS     P  LL  T  
Sbjct  83    FSGFAAKLTASQAKNLSVHPEVLSISPNRVMRLKTTRTFDYLGLSP--TTPKGLLHDTKM  140

Query  2072  GDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWF  1893
             G  +I+GV+DSGI  E  SF D G+GP+P+RWKG C +  G  F+  + CN+K+IGA  F
Sbjct  141   GSEVIIGVMDSGIWPESKSFNDTGLGPIPKRWKGKCVSADG--FDPKKHCNKKIIGAE-F  197

Query  1892  FKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGAT  1713
             F  ALL+ +   +    S+S S  D+ GHG+ VA+I AGSFV NA+  G+ VG  RG A 
Sbjct  198   FTAALLADNEGYD--FASESKSPRDIIGHGTHVAAIAAGSFVANASHKGLAVGTARGAAP  255

Query  1712  AARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGI  1533
              AR+A YK CW    +   C  AD + AID++I D VDVIS+S+G+  P + D++ ++ I
Sbjct  256   HARIAVYKTCW----KDLGCFTADTVKAIDHSIRDGVDVISLSIGTDAPASFDVDVDD-I  310

Query  1532  GIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYA  1353
             G GSF A+ +GIPV+ AAGN GP A TI NV PW+ITVAA+T+DR F   ITLGN     
Sbjct  311   GFGSFQAVMKGIPVVAAAGNEGPDAQTIDNVAPWIITVAATTLDRSFPVPITLGN-----  365

Query  1352  VDWQLPNGTALSHPLH-FAGKYMGEADLMPRKLDPAEVKGKIVFMFGDD-LDRNLVLVDK  1179
                   N T L   L+ F      E  L     +  + K  IV  F  + ++R  V  + 
Sbjct  366   ------NLTILGEGLNTFPEVGFKELSLSMEMFNDDQPKDLIVLAFTPNAVERRRV--NS  417

Query  1178  ATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
               +AG  G+I++  S ++S       +P   VDY+ GT I  YI Q+T  P  ++S  K 
Sbjct  418   ILEAGVAGIIFAQ-SVLNSAVCAGVNVPCAVVDYEFGTDILYYI-QTTEKPFVKISPAKT  475

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDGGFRISSGTSHAAPH  819
              +GR +  +V  FS RGP+S +P I+KPDIAAPG  ++ A     G +++ SGTS A P 
Sbjct  476   IIGRPVASRVAHFSCRGPNSVSPAILKPDIAAPGVNVLSA---VSGVYKLKSGTSMATPI  532

Query  818   VSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNP  639
             VS +V LL+  HP+WSPAAI+SALVTTAW +D    PIF++G++ + AD FDYGGG++NP
Sbjct  533   VSGVVGLLRKIHPDWSPAAIRSALVTTAWRTDPSGEPIFSEGATRKLADPFDYGGGLINP  592

Query  638   NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDL  459
                 DPGLV+DM   DY  YLC+  Y++  I K I              CP   PSMLD 
Sbjct  593   EKVADPGLVFDMGINDYVHYLCSAEYDDESISKLIGKTYK---------CPSPLPSMLDT  643

Query  458   NLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSF  279
             N+PS+++P +F+ VT+ RTVTNVG   SVYK +V+SP G    V PK L F     K +F
Sbjct  644   NMPSIIIPSIFEEVTVTRTVTNVGAAGSVYKPLVESPFGIEFDVNPKTLVFASKNTKMTF  703

Query  278   TMRVSADKLVNSAFTF  231
              +RV     VN+ F F
Sbjct  704   NVRVKTSHRVNTDFFF  719



>ref|XP_010478713.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=645

 Score =   524 bits (1349),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 302/665 (45%), Positives = 407/665 (61%), Gaps = 50/665 (8%)
 Frame = -3

Query  2072  GDGMIVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWF  1893
             GD +I+GVVDSGI  E  SF D G+GP+P+RWKG+C +     FN S +CNRK+IGA++F
Sbjct  2     GDKVIIGVVDSGIWPESESFSDKGLGPIPKRWKGTCES--KQSFNGSTVCNRKLIGAKYF  59

Query  1892  FKGALLSQD-VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGA  1716
               G +   D  + N     +  S  D  GHG+ VA+  AGSFVP+A+ L +  G  RGGA
Sbjct  60    ISGLINGADESNWNTTENPEYISPRDFNGHGTHVAATAAGSFVPDASYLALGRGTARGGA  119

Query  1715  TAARVASYKACWNLDP-ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAEN  1539
               AR+A YKACW+L       C+ AD+L AID AIHD VDV+S+S   P+PL  +++A++
Sbjct  120   PRARIAMYKACWHLASIGTATCSAADMLKAIDEAIHDGVDVLSISTSFPIPLFPEVDAQD  179

Query  1538  GIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEK  1359
              + +G+FHA+ +GIPV+ + GNAGP++ T+TN  PW+ITVAA+T DR F   ITLGN   
Sbjct  180   AMAVGAFHAVAKGIPVVCSGGNAGPASQTVTNTAPWIITVAATTQDRSFPTLITLGNNIT  239

Query  1358  YAVD--WQLPNG--TALSHPLHFAGK---YMGEADLMPRKLDPAEV-KGKIVFMFGDDLD  1203
                   +Q P+   T L +P         + G  + + +  +PA + K KIV  F     
Sbjct  240   IVGQALYQGPDMDFTGLVYPEGPGASNETFSGVCEDLAK--NPARIIKEKIVLCF-----  292

Query  1202  RNLVLVDKATDAGAVGVIYSNPSNVDSLPILNAR-----------IPYVQVDYDAGTRIK  1056
                    K+TD G +    S+  N+D   ++ AR            P + VDY+ GT I 
Sbjct  293   ------TKSTDYGTLIQAASDVFNLDGYGVIVARNPGYQLNPCDGFPCLAVDYELGTDIL  346

Query  1055  DYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-  879
              YI +ST +P A++   +  VG  +  KV  FSSRGPSS  P I+KPDIAAPG  I+ A 
Sbjct  347   FYI-RSTRSPVAKIQPTRTLVGLPVATKVATFSSRGPSSITPAILKPDIAAPGVNILAAT  405

Query  878   ---DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSP  708
                D   D GF + SGTS + P V+ IVALLK  HP WSPAAI+SA+VTTAW +D    P
Sbjct  406   SPNDTFYDRGFSMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWRTDPSGEP  465

Query  707   IFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISG  528
             IFA GS+ + AD FDYGGG+VN   A  PGLVYDM   DY  YLC++GY +S I + +  
Sbjct  466   IFADGSNRKLADPFDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTDSSITRLV--  523

Query  527   NRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSP  348
                     + T+C   +PS+LDLNLPS+ +P+L K VT+ RTVTNVG V SVYKA++++P
Sbjct  524   -------RKKTVCGNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGTVGSVYKAVIEAP  576

Query  347   VGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
             +G  VTV P  L F+   +K SF +RV  +  VN+ + FGSLTW+D VHNV  P++VR  
Sbjct  577   MGVNVTVTPSTLVFNAKTRKLSFKVRVLTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQ  636

Query  167   IVPLY  153
             I+  Y
Sbjct  637   ILQRY  641



>ref|XP_006287131.1| hypothetical protein CARUB_v10000302mg [Capsella rubella]
 gb|EOA20029.1| hypothetical protein CARUB_v10000302mg [Capsella rubella]
Length=742

 Score =   527 bits (1358),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 326/761 (43%), Positives = 458/761 (60%), Gaps = 56/761 (7%)
 Frame = -3

Query  2405  ENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLT  2226
             E+  K+YIVYLG   H+    +  SH  +LA + GS ++AR++MVYSYR+GFSGFAA +T
Sbjct  12    EDQTKVYIVYLGAIAHNHANLVTASHVAMLASLFGSEKDARESMVYSYRHGFSGFAAHMT  71

Query  2225  asqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVV  2046
               +AKK++    VV V+ +++++++T+R++++LGL E      ELL   N G+ +I+GV+
Sbjct  72    DREAKKLSEHPEVVQVMPNRYYEMKTTRTFNYLGLYESTG--KELLLDANMGEDVIIGVI  129

Query  2045  DSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQD  1866
             DSG+  E  SF D G+GP+P RWKG C  + G  F  ++ CN+K+IGAR++    +    
Sbjct  130   DSGVWPESVSFNDKGLGPIPSRWKGKC--VDGEEFVATKHCNKKLIGARYYIPSHMKKNK  187

Query  1865  VDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKA  1686
               +     +D  S  D   HG+ VASI  G+FVPN +     VG  RGGA +AR+A YK 
Sbjct  188   TGMTSD-ENDYMSARDSDVHGTHVASIAGGAFVPNVSNTVFGVGTARGGAPSARIAVYKV  246

Query  1685  CWNL--DPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHA  1512
             CW +  + E   CA  D+L A+D AI D VDV+S+S+G+ +PL ++   +N +  G+FHA
Sbjct  247   CWKIFGNDE---CASMDILKAMDDAIEDGVDVMSLSLGTSIPLLTETYKDNMLSYGAFHA  303

Query  1511  ITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPN  1332
             I+ GIPV+ A GN GP A+T+ N+ PWVITVAA+++DR F   + LGN           N
Sbjct  304   ISNGIPVLFAGGNDGPRAYTVDNIAPWVITVAATSLDRWFPTPLKLGN-----------N  352

Query  1331  GTALSHPLHFAGKYMG---EADLM----PRKLDPAEVKGKIVFMF----GDDLDRNLVLV  1185
              T L+        Y G   +AD M    P K+  A  KGK+V  F     D  D NL + 
Sbjct  353   VTILAR-----APYKGLEIQADFMYVESPNKITGA-AKGKVVLAFLKKSADVYDYNLGIR  406

Query  1184  DKATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSP  1005
                  A  +     +   V  +PI+      + +DY+ G  + +YI  ST +PT ++SS 
Sbjct  407   KFGLKALIIASERDDNVEVVDIPII------LNIDYEQGATMLNYI-SSTSSPTIKISSA  459

Query  1004  KIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADP----TSDGGFRISSGT  837
                 G  +  KV  FSSRGP+S +P ++KPD+AAPG  I+ A      +S+ GF   SGT
Sbjct  460   ITLSGPLVATKVAVFSSRGPNSVSPYVLKPDVAAPGVAILGASTPFMVSSENGFIALSGT  519

Query  836   SHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYG  657
             S + P V+ +VALL+  H +WSPAAI SALVTTA  +D Y  PIFA G S + AD FD+G
Sbjct  520   SMSTPVVAGVVALLRAIHRDWSPAAIHSALVTTASTTDPYGEPIFADGFSEKLADPFDFG  579

Query  656   GGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTR  477
             GG+VNP  A DPGLVY+    DY ++LCA GY+     ++I    N+SD      CP  R
Sbjct  580   GGLVNPTKAADPGLVYNASAEDYMRFLCASGYDE----RSIGKMANKSDMYH---CPSPR  632

Query  476   PSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGN  297
             PSML+LNLPS+ +P L + VT+ RTVTNVGP+ S Y  IVK P+G  +TV P +L F+  
Sbjct  633   PSMLELNLPSITIPFLDRDVTVTRTVTNVGPIVSKYMVIVKPPLGVEITVTPNILLFNPL  692

Query  296   RKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVR  174
              +K SF + VS     NS + FGS+TW+DG H V  P++VR
Sbjct  693   VQKLSFEVTVSTTHKSNSIYYFGSITWTDGSHFVSIPLSVR  733



>emb|CCI61493.1| unnamed protein product [Arabidopsis halleri]
Length=804

 Score =   529 bits (1363),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 326/755 (43%), Positives = 453/755 (60%), Gaps = 43/755 (6%)
 Frame = -3

Query  2384  IVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkv  2205
             I YLG + HDD   + +SH ++L  V+GS E A K+MVYSY +GFSGFAA L  ++A+K+
Sbjct  83    IFYLGERKHDDPNLVTQSHVEILKSVLGSEEAANKSMVYSYHHGFSGFAAKLKPAEAEKL  142

Query  2204  agvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTE  2025
                  V+ ++E++   +QT+R+WD+LG          LL +TN G G I+G++DSGI +E
Sbjct  143   KKHPEVIILLENRKLGLQTTRTWDYLGQFSTPTSSKGLLHETNMGSGAIIGIIDSGIWSE  202

Query  2024  LPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFL  1845
               +F D G GP+P++WKG C  +   +F+  + CN+K+IGA+++  G  L+ D++ +   
Sbjct  203   SGAFDDDGYGPIPKQWKGQC--VSADQFSPVD-CNKKLIGAKYYIDG--LNADLETSINS  257

Query  1844  VSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVG-MVRGGATAARVASYKACWNLDP  1668
              ++  S  D  GHG+QV+S VAGSFV N T  G+  G ++RGGA  A +A YKACW  D 
Sbjct  258   TTEYLSPRDRNGHGTQVSSTVAGSFVSNVTLRGLSSGSIMRGGAPKAHIAMYKACW--DV  315

Query  1667  ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVI  1488
             E  +C+ AD+  A D AIHD VDV+SVS+G     + D+E +  I I + HA+ +GIPV+
Sbjct  316   EGGMCSVADVWKAFDEAIHDDVDVLSVSIGGSALKSLDVEID--IAIPALHAVNKGIPVV  373

Query  1487  VAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPL  1308
               AGN G    ++ NV PW++TVAA+T+DR F   ITL N           N T L   L
Sbjct  374   SPAGNGGSRFSSVINVSPWILTVAATTLDRSFPTLITLEN-----------NKTFLGQSL  422

Query  1307  HFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI-YS  1143
              + G  +   DL+       LD    KGK++  F       +   D     G +G+I   
Sbjct  423   -YTGPEISFTDLICTADHSNLDQI-TKGKVIMHFSMGPTPPMT-PDIVQKNGGIGLIDVR  479

Query  1142  NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPD  963
             +PS  DS     A  P + VD + G+ +  YI Q+T +   ++S  K   G  +  KV  
Sbjct  480   SPS--DSRVECPANFPCIYVDLEVGSELYTYI-QTTSSLKIKISPYKTIFGERVASKVAK  536

Query  962   FSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PTSDGGFRIS-SGTSHAAPHVSAIVALLKI  789
              S+RGPSSF+P I+KPDIAAPG  ++    PT +     + SGTS A P ++ IVALLKI
Sbjct  537   SSARGPSSFSPAILKPDIAAPGVTLLTPRIPTDEDTSEFAYSGTSMATPVIAGIVALLKI  596

Query  788   SHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVY  609
             SHP WSPAAIKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGLVY
Sbjct  597   SHPNWSPAAIKSALVTTAMKTDPYGERLTVDGGNYKVADAFDYGGGLVNLEKATDPGLVY  656

Query  608   DMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL  429
             DM   DY  YLC+           ++GN           CP +  S+LDLN+PS+ +PDL
Sbjct  657   DMDINDYIHYLCSQALYTDKKVSALTGNVTSK-------CPSSGSSILDLNVPSITIPDL  709

Query  428   FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS-ADKL  252
              + VT+ R+VTNVGPV SVYK ++++P+G  V V PK L+F+  R K +F +RVS     
Sbjct  710   KRNVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVWPKKLKFNKRRNKVAFKVRVSPGSHR  769

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVR-KMIVPLYL  150
             VN+AF FGSLTWSDG+HNV  PI++R + I  L+L
Sbjct  770   VNTAFYFGSLTWSDGLHNVTIPISLRTRFIDNLFL  804



>gb|AID21602.1| At4g21323p-like protein [Arabidopsis halleri]
Length=803

 Score =   529 bits (1363),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 323/755 (43%), Positives = 453/755 (60%), Gaps = 44/755 (6%)
 Frame = -3

Query  2384  IVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkv  2205
             I YLG + HDD   + +SH ++L  V+GS E A K+MVYSY +GFSGFAA L  ++A+K+
Sbjct  83    IFYLGERKHDDPNLVTQSHVEILKSVLGSEEAANKSMVYSYHHGFSGFAAKLKPAEAEKL  142

Query  2204  agvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTE  2025
                  V+ ++E++   +QT+R+WD+LG          LL +TN G G I+G++DSGI +E
Sbjct  143   KKHHEVIILLENRKLGLQTTRTWDYLGQFSTPTSSKGLLHETNMGSGAIIGIIDSGIWSE  202

Query  2024  LPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFL  1845
               +F D G GP+P++WKG C  +   +F+  + CN+K+IGA+++  G  L+ D++ +   
Sbjct  203   SGAFDDDGYGPIPKQWKGQC--VSADQFSPVD-CNKKLIGAKYYIDG--LNADLETSINS  257

Query  1844  VSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVG-MVRGGATAARVASYKACWNLDP  1668
              ++  S  D  GHG+QV+S VAGSFV N T   +  G ++RGGA  A +A YKACW  D 
Sbjct  258   TTEYLSPRDRNGHGTQVSSTVAGSFVSNVTLRCLSSGSIMRGGAPKAHIAMYKACW--DV  315

Query  1667  ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVI  1488
             E  +C+ AD+  A D AIHD VDV+SVS+G     + D+E +  I I + HA+ +GIPV+
Sbjct  316   EGGMCSVADVWKAFDEAIHDDVDVLSVSIGGSALKSLDVEID--IAIPALHAVNKGIPVV  373

Query  1487  VAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPL  1308
               AGN G    ++ NV PW++TVAA+T+DR F   ITL N           N T L   L
Sbjct  374   SPAGNGGSRFSSVINVSPWILTVAATTLDRSFPTLITLEN-----------NKTFLGQSL  422

Query  1307  HFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI-YS  1143
              + G  +   DL+       LD    KGK++  F   +     + D     G +G+I   
Sbjct  423   -YTGPEISFTDLICTADHSNLDQI-TKGKVIMHFS--MGPTPPVADVVQKNGGIGLIDVR  478

Query  1142  NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPD  963
             +PS  DS        P + +D + G+ +  YI Q+T +   ++S  K  +G  +  KV  
Sbjct  479   SPS--DSRVECPVNFPCIYLDLEVGSELYTYI-QTTSSLKIKISPYKTIIGERVASKVAK  535

Query  962   FSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PTSDGGFRIS-SGTSHAAPHVSAIVALLKI  789
              S+RGPSSF+P I+KPDIAAPG  ++    PT +     + SGTS A P ++ IVALLKI
Sbjct  536   SSARGPSSFSPAILKPDIAAPGVTLLTPRIPTEEDTSEFAYSGTSMATPVIAGIVALLKI  595

Query  788   SHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVY  609
             SHP WSPAAIKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGLVY
Sbjct  596   SHPNWSPAAIKSALVTTAMKTDPYGERLTVDGGNYKVADAFDYGGGLVNLEKATDPGLVY  655

Query  608   DMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL  429
             DM   DY  YLC+           ++GN           CP +  S+LDLN+PS+ +PDL
Sbjct  656   DMDINDYIHYLCSQALYTDKKVSALTGNVTSK-------CPSSGSSILDLNVPSITIPDL  708

Query  428   FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS-ADKL  252
              + VT+ R+VTNVGPV SVYK ++++P+G  V V PK L+F+  R K +F +RVS     
Sbjct  709   KRNVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHR  768

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVR-KMIVPLYL  150
             VN+AF FGSLTWSDG+HNV  PI++R + I  L+L
Sbjct  769   VNTAFFFGSLTWSDGLHNVTIPISLRTRFIDNLFL  803



>gb|KHN39834.1| Cucumisin, partial [Glycine soja]
Length=753

 Score =   526 bits (1355),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 323/777 (42%), Positives = 457/777 (59%), Gaps = 66/777 (8%)
 Frame = -3

Query  2390  IYIVYLGGK-PHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             ++IVY+G +    + + +++SH D+L  ++GS   AR++++YSY++GFSGFAAVL+  QA
Sbjct  1     VHIVYMGDRMSQSEQQLVEDSHLDILLRILGSKVAARRSILYSYKHGFSGFAAVLSQPQA  60

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K +A   GVV V+ +K   + T+RSWDFL + +  ++    L +   G G I+G++D+GI
Sbjct  61    KLIADFPGVVRVIPNKILSLHTTRSWDFLHVKQ--DIVTGALSRGQSGRGTIIGIMDTGI  118

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D  M   P  W+G C+   G  F+ S  CN K+IGARW+ KG     + ++ 
Sbjct  119   WPESESFRDEHMDNPPLHWRGICQE--GESFDHSH-CNSKIIGARWYIKG----YEAEIG  171

Query  1853  KFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
             K   SD     S  D +GHG+  +S  AG  V NA+ +G+  G+ RGGA +A +A YK C
Sbjct  172   KLNTSDGVEYLSPRDASGHGTHTSSTAAGVAVENASFMGLAKGLARGGAPSAWLAIYKIC  231

Query  1682  WNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITR  1503
             W+       C+ AD+LAA D AI D VD++S S+GS  PL + +E  + + IGSFHA+ +
Sbjct  232   WSTGG----CSSADILAAFDDAIFDGVDILSASLGSDPPLPTYVE--DALAIGSFHAVAK  285

Query  1502  GIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTA  1323
             GI V+ + GN+GP   T+ N  PW++TVAASTIDR F+  I LGN +       L  G  
Sbjct  286   GISVVCSGGNSGPYPQTVINTAPWLVTVAASTIDREFSSRIILGNNQTLQGQ-SLYTGKD  344

Query  1322  LS--HPLHFAGKYMGEAD--------LMPRKLDPAEVKGKIVFMFGDDLDRN-LVLVDKA  1176
             LS  +P+ F G+ +  +D             L+    KGK +  F     R+  V +   
Sbjct  345   LSKFYPIVF-GEDIAASDSDEESARSCNSGSLNSTLAKGKAILCFQSRSQRSATVAIRTV  403

Query  1175  TDAGAVGVIYSN--PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
             T+AG  G+I++     +VD+    +   P VQVD+  GT I  Y+ ++T  P  + S  K
Sbjct  404   TEAGGAGLIFAQFPTKDVDT----SWSKPCVQVDFITGTTILSYM-EATRNPVIKFSKTK  458

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDG------------  861
               VGR L+P+V  FSSRGPSS +P ++KPDIAAPG  I+ A  P S              
Sbjct  459   TVVGRQLSPEVAFFSSRGPSSLSPSVLKPDIAAPGVNILAAWSPASSARLVSDAENEDET  518

Query  860   -----GFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAK  696
                   F I SGTS A PH++ IVAL+K  HP WSPAAIKSALVTTA   + Y   I+A+
Sbjct  519   ELHPLNFNIESGTSMACPHITGIVALIKTIHPTWSPAAIKSALVTTASLKNEYKEYIWAE  578

Query  695   GSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNR  516
             G+  + AD FDYGGG V+PN   DPGLVYDM+  DY ++LC++GYNN+ I   ++G   +
Sbjct  579   GAPHKQADPFDYGGGHVDPNKVTDPGLVYDMKNSDYIRFLCSMGYNNTAI-SILTGFPTK  637

Query  515   SDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAV  336
                     C K+   +L++NLPS+ +P+L +P+T+ RTVTNVGPV S Y A V +P+G  
Sbjct  638   --------CHKSHKFLLNMNLPSITIPELKQPLTVSRTVTNVGPVKSNYTARVVAPIGIS  689

Query  335   VTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             V V+P  L F   RKK  F +  S+   V S F+FG L W DG+H VR P+AVR  +
Sbjct  690   VIVEPSTLAFSSKRKKMKFKVTFSSKLRVQSRFSFGYLLWEDGLHEVRIPLAVRSAV  746



>ref|NP_001169390.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN33599.1| unknown [Zea mays]
 tpg|DAA40612.1| TPA: putative subtilase family protein [Zea mays]
Length=769

 Score =   526 bits (1356),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 331/771 (43%), Positives = 451/771 (58%), Gaps = 48/771 (6%)
 Frame = -3

Query  2396  KKIYIVYLGGK-PHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTas  2220
               +YI Y+G + P      ++++H+ +LA ++GS + AR A++YSYR+GFSGFAA LT S
Sbjct  21    SNVYIAYMGERSPELRPALVRDAHHGMLAALLGSEQAARDAILYSYRHGFSGFAATLTDS  80

Query  2219  qakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDS  2040
             QA ++A   GVV VV ++   + T+RSWDF+ +   ++  G +L  +  G+  I+GV+D+
Sbjct  81    QAARLADSPGVVRVVRNRVLDLHTTRSWDFMRVMSPSHSAG-ILSNSRLGEDSIIGVLDT  139

Query  2039  GISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVD  1860
             GI  E  SF D G+G VP+RWKG C  + G RFN S  CNRK+IGA+W+ +G     + +
Sbjct  140   GIWPESASFRDDGIGEVPRRWKGRC--VAGDRFNASN-CNRKIIGAKWYIRG----YEAE  192

Query  1859  LNKFLVSDSY---SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYK  1689
               K   +D Y   S  D  GHG+  AS  AG+ V +A+  G+  G+ RGGA  AR+A YK
Sbjct  193   YGKMNTTDIYEFMSARDAVGHGTHTASTAAGAPVADASFRGLASGVARGGAPRARLAVYK  252

Query  1688  ACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
              CW        C  AD+LAA D AIHD VDV+SVS+G   PL + ++  + + IGSFHA+
Sbjct  253   VCWATGD----CTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSFHAV  306

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
              RGI V+ +AGN+GP + T+ N  PW++TVAA TIDR F   I LGN   YA    L +G
Sbjct  307   ARGIAVVCSAGNSGPYSETVINSAPWIVTVAAGTIDRTFLAKIALGNNSTYA-GQTLYSG  365

Query  1328  T------ALSHPLHFAGKYMGEAD---LMPRKLDPAEVKGKIVFMFGDDLDRNL-VLVDK  1179
                    +L +    A     + D        L+    KGK+V  F     R+  V V+ 
Sbjct  366   AHPGRSMSLVYAEDIASNDADDTDARSCTAGSLNSTLAKGKVVLCFQTRAQRSASVAVET  425

Query  1178  ATDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKI  999
                A  VGVI++     D     +  +P VQVDY  GT I  Y   S   PT Q  S K 
Sbjct  426   VRKARGVGVIFAQFLTKDIASSFD--VPCVQVDYQVGTVILAYT-TSMRNPTVQFGSAKT  482

Query  998   QVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA--------DPTSDGGFRISS  843
              +G  + P+V  FSSRGPSS +P ++KPDIAAPG  I+ A               F+I S
Sbjct  483   VLGEVIGPEVAYFSSRGPSSLSPSVLKPDIAAPGVNILAAWTPAAAVSSAIGSVSFKIDS  542

Query  842   GTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFD  663
             GTS + PH+S +VALL+  HP WSPAA+KSALVTTA   DTY   I ++ +    A+ FD
Sbjct  543   GTSMSCPHISGVVALLRSLHPNWSPAAVKSALVTTASVHDTYGFGIVSEAAPYSQANPFD  602

Query  662   YGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPK  483
             YGGG V+PN A  PGLVYDM   DY ++LC++GYN S     IS    + +TE     PK
Sbjct  603   YGGGHVDPNRAAYPGLVYDMGASDYVRFLCSMGYNVS----AISSVAQQRETETCQHAPK  658

Query  482   TRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFD  303
             T+   LDLNLPS+ VP+L   +T+ RTVTNVG   S Y+A V++P G  V+V+P +L F+
Sbjct  659   TQ---LDLNLPSIAVPELRGRLTVSRTVTNVGSALSEYRARVEAPPGVDVSVRPSLLAFN  715

Query  302   GNRKKRSFTMRVSADKL-VNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLY  153
                ++ +F +   A  + V   +TFGSLTW DGVH VR P+ VR M+   Y
Sbjct  716   STVRRLAFKVTFRAKLVKVQGRYTFGSLTWEDGVHAVRIPLVVRTMVGRFY  766



>ref|XP_004504376.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Cicer 
arietinum]
Length=773

 Score =   526 bits (1356),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 317/769 (41%), Positives = 458/769 (60%), Gaps = 49/769 (6%)
 Frame = -3

Query  2417  KVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFA  2238
             ++  E    ++IVY+G K +      K+ H+ +L+ ++GS E A+ +++YSY++GFSGFA
Sbjct  33    QIFAEATSSVHIVYMGDKIYHKPETTKKYHHKMLSSLLGSKEAAKNSLLYSYKHGFSGFA  92

Query  2237  AVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMI  2058
             A +T SQA+ +A    V+SV+ +  HK+ T+RSWDF+G+   ++    +  K + G+G I
Sbjct  93    ARMTKSQAEDIAKFPEVISVIPNSIHKLHTTRSWDFIGVHHPSS--KNVYTKRDLGEGTI  150

Query  2057  VGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGAL  1878
             +GV+D+GI  E  SF D  MG +P RWKG C+   G  FN +  CN+K+IGARWF KG  
Sbjct  151   IGVIDTGIWPESASFNDEAMGKIPTRWKGVCQV--GQHFNSTN-CNKKIIGARWFLKG--  205

Query  1877  LSQDVDLNKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVA  1698
                 +  +    S+  S  D  GHG+  AS  AG FV NA   G+  G+ RGGA  A +A
Sbjct  206   ----ISDHTNHTSEYLSARDAIGHGTHTASTAAGYFVENANHRGLASGLARGGAPLAHLA  261

Query  1697  SYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSF  1518
              YKACW++      C  AD+L A D AIHD VDV++VS+G  +PL S ++  + I IGSF
Sbjct  262   IYKACWDISVGD--CTDADILKAFDMAIHDGVDVLTVSLGIGIPLFSYVDQRDTIAIGSF  319

Query  1517  HAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQL  1338
             HA  +GI V+ +AGN+GP + TITN  PW+ITVAA+TIDR F  TITLGN      +  +
Sbjct  320   HAAAKGIAVVCSAGNSGPISQTITNTAPWIITVAATTIDRAFPTTITLGNNLTLFGE-SI  378

Query  1337  PNGTALSHPLHFAGKYMGE-----------ADLMPRKLDPAEVKGKIVFMFGDDLDRNLV  1191
               G    H + F G    E            D     L+ +   GKIV  F     +++V
Sbjct  379   DKG---KHNIGFVGLTYSERIARDPSNDLAKDCQLGSLNESMAAGKIVLCFSVSDQQDIV  435

Query  1190  LVD-KATDAGAVGVIYS--NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTA  1020
                    +AG VG+IY+  +   ++   IL    P ++VDY+ GT++  YI ++   P A
Sbjct  436   SAALTVKEAGGVGLIYAQKHEEGLNECGIL----PCIKVDYEVGTQLLTYIRRARF-PIA  490

Query  1019  QLSSPKIQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSD----GGFR  852
              LS PK  +G  ++P+V  FSSRGPS+ +P ++KPDIAAPG  I+ A P  +     GF 
Sbjct  491   SLSFPKTVIGNWISPRVASFSSRGPSTMSPTVLKPDIAAPGVDILAAFPPKNSKKSSGFT  550

Query  851   ISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAAD  672
               SGTS + PHV+ I AL+K  HP WSPAAI+SALVTTA  S T  S I  +G + + AD
Sbjct  551   FLSGTSMSCPHVAGIAALIKSKHPTWSPAAIRSALVTTASQSGTDASLISEEGPTHKEAD  610

Query  671   AFDYGGGIVNP-NAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHT  495
              FD GGG V+P  A D  GL+Y++   DY Q+LC++G++ + I K     R+ +  +  T
Sbjct  611   PFDIGGGHVDPIKAIDAAGLIYNITTEDYIQFLCSMGHSTASIKKVTKTTRSCNKQKSQT  670

Query  494   ICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKV  315
                     +++LNLPS+ +P+L    T+ RTVTN+G  + VYKA+V +P G  V V+P++
Sbjct  671   --------LMNLNLPSISIPNLKTVATVTRTVTNIGNTSVVYKALVNTPYGIKVRVEPQI  722

Query  314   LRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKM  168
             L F+ + K  +F +   + + ++  + FGSLTW+DG H VRTPIAVR +
Sbjct  723   LSFNSDTKVLTFNVSFISTQKLHGDYRFGSLTWTDGKHFVRTPIAVRTI  771



>gb|AID21686.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   528 bits (1359),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 325/755 (43%), Positives = 453/755 (60%), Gaps = 43/755 (6%)
 Frame = -3

Query  2384  IVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkv  2205
             I YLG + HDD   + +SH ++L  V+GS E A K++VYSY +GFSGFAA L  ++A+K+
Sbjct  83    IFYLGERKHDDPNLVTQSHLEILKSVLGSEEAANKSLVYSYHHGFSGFAAKLKPAEAEKL  142

Query  2204  agvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTE  2025
                  V+ ++E++   +QT+R+WD+LG          LL +TN G G I+GV+DSGI +E
Sbjct  143   KKHPEVIILLENRKLGLQTTRTWDYLGQFSTPTSSKGLLHETNMGSGAIIGVIDSGIWSE  202

Query  2024  LPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFL  1845
               +F D G GP+P++WKG C  +   +F+ ++ CN+K+IGA+++  G  L+ D++ +   
Sbjct  203   SGAFDDDGYGPIPKQWKGQC--VSADQFSPAD-CNKKLIGAKYYIDG--LNADLETSINS  257

Query  1844  VSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVG-MVRGGATAARVASYKACWNLDP  1668
               +  S  D  GHG+QV+S VAGSFV N T  G+  G ++RGGA  A +A YKACW  D 
Sbjct  258   TIEYLSPRDRNGHGTQVSSTVAGSFVSNVTLPGLSSGSIMRGGAPKAHIAMYKACW--DV  315

Query  1667  ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVI  1488
             E  +C+ AD+  A D AIHD VD++SVS+G     + D+E +  I I + HA+ +GIPV+
Sbjct  316   EGGMCSVADVWKAFDEAIHDGVDILSVSIGGSALKSLDVEID--IAIPALHAVNKGIPVV  373

Query  1487  VAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPL  1308
               AGN G    ++ N+ PW++TVAA+T+DR F   ITL N           N T L   L
Sbjct  374   SPAGNGGSRYSSVINISPWILTVAATTLDRSFPTLITLEN-----------NKTFLGQSL  422

Query  1307  HFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI-YS  1143
              + G  +   DL+       LD    KGK++  F       +   D     G +G+I   
Sbjct  423   -YTGPEISFTDLICTADHSNLDQI-TKGKVIMHFSMGPTPPMT-PDIVQKNGGIGLIDVR  479

Query  1142  NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPD  963
             +PS  DS     A  P + VD + G+ +  YI Q+T +   ++S  K  +G  +  KV  
Sbjct  480   SPS--DSRVECPANFPCIYVDLEVGSELYTYI-QTTSSLKIKISPYKTIIGERVASKVAK  536

Query  962   FSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PT-SDGGFRISSGTSHAAPHVSAIVALLKI  789
              S+RGPSSF+P I+KPDIAAPG  ++    PT  D      SGTS A P ++ IVALLKI
Sbjct  537   SSARGPSSFSPAILKPDIAAPGVTLLTPRIPTDKDTSEFTYSGTSMATPVIAGIVALLKI  596

Query  788   SHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVY  609
             SHP WSPAAIKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGLVY
Sbjct  597   SHPNWSPAAIKSALVTTAMKTDPYGERLTVDGGNYKEADAFDYGGGLVNLEKATDPGLVY  656

Query  608   DMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL  429
             DM   DY  YLC+           ++GN           CP +  S+LDLN+PS+ +PDL
Sbjct  657   DMDINDYIHYLCSQALYTDKKVSALTGNVTSK-------CPSSGSSILDLNVPSITIPDL  709

Query  428   FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS-ADKL  252
              + VT+ R+VTNVGPV SVYK ++++P+G  V V PK L+F+  R K +F +RVS     
Sbjct  710   KRNVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRSKVAFKVRVSPGSHR  769

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVR-KMIVPLYL  150
             VN+AF FGSLTWSDG+HNV  PI++R + I  L+L
Sbjct  770   VNTAFYFGSLTWSDGLHNVTIPISLRTRFIDNLFL  804



>ref|XP_007131764.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
 gb|ESW03758.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
Length=746

 Score =   526 bits (1354),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 320/763 (42%), Positives = 450/763 (59%), Gaps = 62/763 (8%)
 Frame = -3

Query  2360  HDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkvagvagvvs  2181
               + + +++SH D+L+ ++GS + ARK+++YSY++GFSGFAAVL+  QA+ +A   GVV 
Sbjct  8     QSEQQLVEDSHLDILSRILGSKDAARKSILYSYKHGFSGFAAVLSQPQARLIADFPGVVR  67

Query  2180  vVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAG  2001
             V+ +K   + T+RSWDFL + +   +    L +   G G I+G++D+GI  E  SF D  
Sbjct  68    VIPNKILSLHTTRSWDFLNVKQ--EMITSALSRGQSGRGTIIGIMDTGIWPESESFRDEH  125

Query  2000  MGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDS---Y  1830
             MG  P  W+G C+   G  FN S  CNRK+IGARW+ KG     + ++ K   SD     
Sbjct  126   MGNPPLHWRGVCQG--GENFNRST-CNRKIIGARWYIKG----YEAEIGKLNTSDGVEYL  178

Query  1829  SGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCA  1650
             S  D +GHG+  +S  AG  V NA+ +G+  G+ RGGA +A +A YK CW+       C+
Sbjct  179   SPRDASGHGTHTSSTAAGVAVENASFMGLAKGLARGGAPSAWLAVYKICWSTGG----CS  234

Query  1649  GADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNA  1470
              AD+LAA D AI D VD++S S+GS  PL + +E  + + IGSFHA+ +GI V+ + GN+
Sbjct  235   SADILAAFDDAIFDGVDILSASLGSDPPLPTYVE--DALAIGSFHAVAKGISVVCSGGNS  292

Query  1469  GPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS--HPLHFAG  1296
             GP + T+ N  PWVITVAASTIDR F   I LGN +       L  G  LS  +P+ F G
Sbjct  293   GPYSQTVINTAPWVITVAASTIDREFPSRIILGNNQTLQGQ-SLYTGKDLSKFYPIVF-G  350

Query  1295  KYMGEADLMPRK--------LDPAEVKGKIVFMFGDDLDRN-LVLVDKATDAGAVGVIYS  1143
             + +  +D             L+    KGK +  F     R+  V +   T+AG  G+I++
Sbjct  351   EDIAASDADEESARGCNSGSLNATLAKGKAILCFQSRSQRSATVAIRTVTEAGGSGLIFA  410

Query  1142  N--PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKV  969
                  +VD+    +   P VQVD+  GT I  YI ++T  P  +    K  VG+ ++P+V
Sbjct  411   QFPTKDVDT----SWSKPCVQVDFITGTTILSYI-EATRDPVIKFGKTKTVVGQQISPEV  465

Query  968   PDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-----------DPTSDG----GFRISSGTS  834
               FSSRGPSS +P ++KPDIAAPG  I+ A           D  S+      F I SGTS
Sbjct  466   AFFSSRGPSSLSPSVLKPDIAAPGVNILAAWSPASSERLVSDAKSEKLQPLTFNIESGTS  525

Query  833   HAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGG  654
              + PH+S IVAL+K  HP WSPAAIKSALVTTA   + Y   I+A+G+  + AD FDYGG
Sbjct  526   MSCPHISGIVALIKTVHPTWSPAAIKSALVTTASLKNEYHEYIWAEGAPHKQADPFDYGG  585

Query  653   GIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRP  474
             G V+PN   DPGLVYDM+  DY  +LC++ YN++ I            T   T C K+  
Sbjct  586   GHVDPNKVTDPGLVYDMKNSDYIHFLCSMDYNDTAISFL---------TGVPTKCHKSHK  636

Query  473   SMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNR  294
              +L++NLPS+++P+L +P+T+ RTVTNVGP+ SVY A V++P+G  VTV P  L F   R
Sbjct  637   YLLNMNLPSIIIPELKQPLTVSRTVTNVGPIKSVYTARVEAPIGVSVTVVPPTLTFSPKR  696

Query  293   KKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             KK  F +  S+   +   F+FG L W DG H VR P+AVR ++
Sbjct  697   KKMKFKVTFSSKLRIQGRFSFGYLFWEDGSHEVRMPLAVRSVV  739



>gb|AID21679.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   528 bits (1359),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 325/755 (43%), Positives = 453/755 (60%), Gaps = 43/755 (6%)
 Frame = -3

Query  2384  IVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkv  2205
             I YLG + HDD   + +SH ++L  V+GS E A K++VYSY +GFSGFAA L  ++A+K+
Sbjct  83    IFYLGERKHDDPNLVTQSHLEILKSVLGSEEAANKSLVYSYHHGFSGFAAKLKPAEAEKL  142

Query  2204  agvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTE  2025
                  V+ ++E++   +QT+R+WD+LG          LL +TN G G I+GV+DSGI +E
Sbjct  143   KKHPEVIILLENRKLGLQTTRTWDYLGQFSTPTSSKGLLHETNMGSGAIIGVIDSGIWSE  202

Query  2024  LPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFL  1845
               +F D G GP+P++WKG C  +   +F+ ++ CN+K+IGA+++  G  L+ D++ +   
Sbjct  203   SGAFDDDGYGPIPKQWKGQC--VSADQFSPAD-CNKKLIGAKYYIDG--LNADLETSINS  257

Query  1844  VSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVG-MVRGGATAARVASYKACWNLDP  1668
               +  S  D  GHG+QV+S VAGSFV N T  G+  G ++RGGA  A +A YKACW  D 
Sbjct  258   TIEYLSPRDRNGHGTQVSSTVAGSFVSNVTLPGLSSGSIMRGGAPKAHIAMYKACW--DV  315

Query  1667  ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVI  1488
             E  +C+ AD+  A D AIHD VD++SVS+G     + D+E +  I I + HA+ +GIPV+
Sbjct  316   EGGMCSVADVWKAFDEAIHDGVDILSVSIGGSALKSLDVEID--IAIPALHAVNKGIPVV  373

Query  1487  VAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPL  1308
               AGN G    ++ N+ PW++TVAA+T+DR F   ITL N           N T L   L
Sbjct  374   SPAGNGGSRYSSVINISPWILTVAATTLDRSFPTLITLEN-----------NKTFLGQSL  422

Query  1307  HFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI-YS  1143
              + G  +   DL+       LD    KGK++  F       +   D     G +G+I   
Sbjct  423   -YTGPEISFTDLICTADHSNLDQI-TKGKVIMHFSMGPTPPMT-PDIVQKNGGIGLIDVR  479

Query  1142  NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPD  963
             +PS  DS     A  P + VD + G+ +  YI Q+T +   ++S  K  +G  +  KV  
Sbjct  480   SPS--DSRVECPANFPCIYVDLEVGSELYTYI-QTTSSLKIKISPYKTIIGERVASKVAK  536

Query  962   FSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PT-SDGGFRISSGTSHAAPHVSAIVALLKI  789
              S+RGPSSF+P I+KPDIAAPG  ++    PT  D      SGTS A P ++ IVALLKI
Sbjct  537   SSARGPSSFSPAILKPDIAAPGVTLLTPRIPTDKDTSEFTYSGTSMATPVIAGIVALLKI  596

Query  788   SHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVY  609
             SHP WSPAAIKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGLVY
Sbjct  597   SHPNWSPAAIKSALVTTAMKTDPYGERLTVDGGNYKEADAFDYGGGLVNLEKATDPGLVY  656

Query  608   DMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL  429
             DM   DY  YLC+           ++GN           CP +  S+LDLN+PS+ +PDL
Sbjct  657   DMDINDYIHYLCSQALYTDKKVSALTGNVTSK-------CPSSGSSILDLNVPSITIPDL  709

Query  428   FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS-ADKL  252
              + VT+ R+VTNVGPV SVYK ++++P+G  V V PK L+F+  R K +F +RVS     
Sbjct  710   KRNVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHR  769

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVR-KMIVPLYL  150
             VN+AF FGSLTWSDG+HNV  PI++R + I  L+L
Sbjct  770   VNTAFYFGSLTWSDGLHNVTIPISLRTRFIDNLFL  804



>ref|XP_003537841.1| PREDICTED: cucumisin-like [Glycine max]
Length=782

 Score =   526 bits (1355),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 323/777 (42%), Positives = 457/777 (59%), Gaps = 66/777 (8%)
 Frame = -3

Query  2390  IYIVYLGGK-PHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqa  2214
             ++IVY+G +    + + +++SH D+L  ++GS   AR++++YSY++GFSGFAAVL+  QA
Sbjct  30    VHIVYMGDRMSQSEQQLVEDSHLDILLRILGSKVAARRSILYSYKHGFSGFAAVLSQPQA  89

Query  2213  kkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGI  2034
             K +A   GVV V+ +K   + T+RSWDFL + +  ++    L +   G G I+G++D+GI
Sbjct  90    KLIADFPGVVRVIPNKILSLHTTRSWDFLHVKQ--DIVTGALSRGQSGRGTIIGIMDTGI  147

Query  2033  STELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLN  1854
               E  SF D  M   P  W+G C+   G  F+ S  CN K+IGARW+ KG     + ++ 
Sbjct  148   WPESESFRDEHMDNPPLHWRGICQE--GESFDHSH-CNSKIIGARWYIKG----YEAEIG  200

Query  1853  KFLVSDS---YSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKAC  1683
             K   SD     S  D +GHG+  +S  AG  V NA+ +G+  G+ RGGA +A +A YK C
Sbjct  201   KLNTSDGVEYLSPRDASGHGTHTSSTAAGVAVENASFMGLAKGLARGGAPSAWLAIYKIC  260

Query  1682  WNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITR  1503
             W+       C+ AD+LAA D AI D VD++S S+GS  PL + +E  + + IGSFHA+ +
Sbjct  261   WSTGG----CSSADILAAFDDAIFDGVDILSASLGSDPPLPTYVE--DALAIGSFHAVAK  314

Query  1502  GIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTA  1323
             GI V+ + GN+GP   T+ N  PW++TVAASTIDR F+  I LGN +       L  G  
Sbjct  315   GISVVCSGGNSGPYPQTVINTAPWLVTVAASTIDREFSSRIILGNNQTLQGQ-SLYTGKD  373

Query  1322  LS--HPLHFAGKYMGEAD--------LMPRKLDPAEVKGKIVFMFGDDLDRN-LVLVDKA  1176
             LS  +P+ F G+ +  +D             L+    KGK +  F     R+  V +   
Sbjct  374   LSKFYPIVF-GEDIAASDSDEESARSCNSGSLNSTLAKGKAILCFQSRSQRSATVAIRTV  432

Query  1175  TDAGAVGVIYSN--PSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPK  1002
             T+AG  G+I++     +VD+    +   P VQVD+  GT I  Y+ ++T  P  + S  K
Sbjct  433   TEAGGAGLIFAQFPTKDVDT----SWSKPCVQVDFITGTTILSYM-EATRNPVIKFSKTK  487

Query  1001  IQVGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA-DPTSDG------------  861
               VGR L+P+V  FSSRGPSS +P ++KPDIAAPG  I+ A  P S              
Sbjct  488   TVVGRQLSPEVAFFSSRGPSSLSPSVLKPDIAAPGVNILAAWSPASSARLVSDAENEDET  547

Query  860   -----GFRISSGTSHAAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAK  696
                   F I SGTS A PH++ IVAL+K  HP WSPAAIKSALVTTA   + Y   I+A+
Sbjct  548   ELHPLNFNIESGTSMACPHITGIVALIKTIHPTWSPAAIKSALVTTASLKNEYKEYIWAE  607

Query  695   GSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNR  516
             G+  + AD FDYGGG V+PN   DPGLVYDM+  DY ++LC++GYNN+ I   ++G   +
Sbjct  608   GAPHKQADPFDYGGGHVDPNKVTDPGLVYDMKNSDYIRFLCSMGYNNTAI-SILTGFPTK  666

Query  515   SDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAV  336
                     C K+   +L++NLPS+ +P+L +P+T+ RTVTNVGPV S Y A V +P+G  
Sbjct  667   --------CHKSHKFLLNMNLPSITIPELKQPLTVSRTVTNVGPVKSNYTARVVAPIGIS  718

Query  335   VTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMI  165
             V V+P  L F   RKK  F +  S+   V S F+FG L W DG+H VR P+AVR  +
Sbjct  719   VIVEPSTLAFSSKRKKMKFKVTFSSKLRVQSRFSFGYLLWEDGLHEVRIPLAVRSAV  775



>ref|XP_002298974.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
 gb|EEE83779.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
Length=749

 Score =   525 bits (1352),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 303/683 (44%), Positives = 403/683 (59%), Gaps = 67/683 (10%)
 Frame = -3

Query  2153  QTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTELPSFGDAGMGPVPQRWK  1974
             QT+RSWDFLGLS  ++ P   L  ++ GDG+I+G+ D+GI  E  +F D G+GP+P RWK
Sbjct  108   QTTRSWDFLGLS--SHSPVNALHNSSMGDGVIIGIFDTGIWPESKAFSDEGLGPIPSRWK  165

Query  1973  GSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFLVSDSYSGYDVAGHGSQV  1794
             G+C   PG +F+    CNRK+IGARW   G L      LN     +  S  D  GHG+ +
Sbjct  166   GACE--PGKQFDPKIHCNRKIIGARWIIDGMLADYGQQLNTSGNQEFLSPRDANGHGTHL  223

Query  1793  ASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWNLDPERFVCAGADLLAAIDYAI  1614
             AS  AG+FV N +  G+ +G  RGGA  A++A YK CW++      C+ AD+L A D AI
Sbjct  224   ASTAAGAFVDNVSYKGLGLGTARGGAPRAQLAIYKVCWSVFGGW--CSAADVLKAFDEAI  281

Query  1613  HDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVIVAAGNAGPSAFTITNVEP  1434
             HD VDV+S+S+G P PL SD++   GI  GSFHA+ +GI V+ +AGN GPSA T+ N  P
Sbjct  282   HDGVDVLSLSLGLPPPLFSDIDKRGGIDFGSFHAVAKGITVVCSAGNDGPSAQTVLNTAP  341

Query  1433  WVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPLHFAGKYMGEADLMPRKL-  1257
             W+++VAASTIDR F  +ITLGN + + V   L    +L         Y  + D +   L 
Sbjct  342   WILSVAASTIDRAFPTSITLGNNKTFLV--FLHCSKSLRFGFLTTSYYALKRDSLTNCLA  399

Query  1256  ---------DPAEVKGKIVFMFGDDLDRNLVLVDKAT----DAGAVGVIYS-NPSNVDSL  1119
                      + + V GK+V  F         +V  A     +AG VG+I + NPSN    
Sbjct  400   CSACEYLSVNASMVAGKVVLCFTTVTVVPAAIVLSAAEVVKEAGGVGLIVAKNPSN----  455

Query  1118  PILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPDFSSRGPSS  939
                                         + P  +LS  K  VG+ +  KV  FSSRGP+S
Sbjct  456   ---------------------------DIFPVVKLSPSKTIVGKPVLAKVAHFSSRGPNS  488

Query  938   FAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSAIVALLKISHPEWS  771
              +P I+KPDIAAPG  I+ A    D   DGG+ + SGTS AAPHV+ I ALLK  HP+WS
Sbjct  489   KSPAILKPDIAAPGVNILAAASPLDTFQDGGYVMQSGTSMAAPHVAGIGALLKAIHPDWS  548

Query  770   PAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVYDMRGID  591
             PAAIKSALVTTAW +     PIF++GS  + A+ FD+GGGI NPN A DPGLVYDM   D
Sbjct  549   PAAIKSALVTTAWTNHPSGFPIFSEGSPQKLANPFDFGGGIANPNGAADPGLVYDMGTAD  608

Query  590   YAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDLFKPVTL  411
             Y  YLCA+ YN + I +          T   T+CP    S+LD+NLPS+ +P+L    TL
Sbjct  609   YINYLCAMDYNITAISRL---------TGLPTVCPYEELSILDVNLPSITIPNLRNSTTL  659

Query  410   RRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVSADKLVNSAFTF  231
              RTVTNVG  NS+Y+A+++ P G  V+VKP VL F+   KK +FT+ V+    VN+ + F
Sbjct  660   TRTVTNVGTSNSIYRAVIEPPFGTSVSVKPNVLAFNHKTKKITFTVTVTTAHQVNTGYFF  719

Query  230   GSLTWSDGVHNVRTPIAVRKMIV  162
             GS+TW+DGVH VR+P++VR  I+
Sbjct  720   GSITWTDGVHTVRSPLSVRTEIL  742



>gb|AID21581.1| AT4G21326p [Arabidopsis halleri]
 gb|AID21618.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   525 bits (1352),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 318/756 (42%), Positives = 456/756 (60%), Gaps = 48/756 (6%)
 Frame = -3

Query  2396  KKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
             +KIYIV+LG + HDD   + ESH  +L  V  S E AR+++VY+Y +GFSGFAA LT SQ
Sbjct  36    RKIYIVHLGVRRHDDPELVSESHQRMLESVFESEEAARESIVYNYHHGFSGFAARLTDSQ  95

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             AK+++    V SV  ++  ++Q++R +D+LGLS   + P  +L ++N G  +++G +DSG
Sbjct  96    AKQLSERPDVFSVAPNRKVQLQSTRVYDYLGLS--PSFPSGILHESNMGSDLVIGFLDSG  153

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             +  E P++ D G+GP+P+ WKG C A  G  F+ ++ CN+K++GA++F      + D D 
Sbjct  154   VWPESPAYNDEGLGPIPKHWKGKCVA--GEGFDPAKHCNKKLVGAKYF------TDDWDE  205

Query  1856  ----NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYK  1689
                 N     +  S   + GHG+ V+SI A SFVPNA+  G+  G++RGGA  AR+A YK
Sbjct  206   KNPGNPITEDEFMSPRGLIGHGTMVSSIAASSFVPNASYGGLAPGLMRGGAPKARIAMYK  265

Query  1688  ACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAI  1509
               W  D        A+++ A D AI+D VDV+S+S+ S  P          + +GSFHA+
Sbjct  266   VVW--DSVTMGSTTANMVKAFDEAINDGVDVLSISLASVAPFRPIDAITEDLELGSFHAV  323

Query  1508  TRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNG  1329
             T+GIPVI    N GP A+T+ NV PW++TVAA+ +DR F   +T GN           N 
Sbjct  324   TKGIPVIAGGSNTGPDAYTVANVAPWLLTVAATNVDRTFYADMTFGN-----------NI  372

Query  1328  TALSHPLHFAGKYM--GEADLMPRKLDPAEVKGKIVFMF-GDDLDRNLVLVDKATDAGAV  1158
             T +    H  GK +  G   +   K D + V GK+V  F  +D +    L    T+  A 
Sbjct  373   TIMGQAQH-TGKEVSAGLVYIEDYKNDISSVPGKVVLTFVKEDWEMTSALAATTTN-NAA  430

Query  1157  GVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALT  978
             G+I +   +  S  + +   P++ VDY+ G +I  YI +S+ +PT ++S+ K  VGR + 
Sbjct  431   GLIVARSGDHQSDIVYSQ--PFIYVDYEVGAKILRYI-RSSSSPTVKISTGKTLVGRPIA  487

Query  977   PKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHAAPHVSA  810
              +V  FSSRGP+  +P I+KPDIAAPG  I+ A     P S GG+ + +GTS+A P V+ 
Sbjct  488   TQVCGFSSRGPNPISPAILKPDIAAPGVTILGATAEDSPGSFGGYFLGTGTSYATPIVAG  547

Query  809   IVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAA  630
             +V LLK  HP+WSPAA+KSA++TTAW +D    PIFA+G   + AD FDYG G+VN   A
Sbjct  548   LVVLLKALHPDWSPAALKSAIMTTAWKTDPSGEPIFAEGEPRKLADPFDYGAGLVNAERA  607

Query  629   DDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLP  450
              DPGLVYDM   DY  Y CA GYN++ I   I+G   R        C    PS+LDLN P
Sbjct  608   KDPGLVYDMNLDDYIHYFCATGYNDTAI-TLITGKPTR--------CSSPLPSILDLNYP  658

Query  449   SMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMR  270
             ++ +PDL + VT+ RTVTNVGPV+SVY+A+V+ P G  + V+P+ L F  N KK  F +R
Sbjct  659   AITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVNIVVEPETLVFCSNTKKLEFKVR  718

Query  269   VSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
             VS+    N+ F FG  TW+DG  NV  P++VR  ++
Sbjct  719   VSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTRVL  754



>gb|AID21619.1| At4g21323p-like protein [Arabidopsis halleri]
Length=804

 Score =   526 bits (1356),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 324/755 (43%), Positives = 452/755 (60%), Gaps = 43/755 (6%)
 Frame = -3

Query  2384  IVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasqakkv  2205
             I YLG + HDD   + +SH ++L  V+GS E A K+MVYSY +GFSGFAA L  ++A+K+
Sbjct  83    IFYLGERKHDDPNLVTQSHLEILKSVLGSEEAANKSMVYSYHHGFSGFAAKLKPAEAEKL  142

Query  2204  agvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSGISTE  2025
                  V+ ++E++   +QT+R+WD+LG          LL +TN G G I+GV+DSGI +E
Sbjct  143   KKHPEVIILLENRKLGLQTTRTWDYLGQFSTPTSSEGLLHETNMGSGAIIGVIDSGIWSE  202

Query  2024  LPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDLNKFL  1845
               +F D G GP+P++WKG C  + G +F+  + CN+K+IGA+++  G  L+ D++ +   
Sbjct  203   SGAFDDDGYGPIPKQWKGQC--VSGDQFSPVD-CNKKLIGAKYYIDG--LNADLETSINS  257

Query  1844  VSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVG-MVRGGATAARVASYKACWNLDP  1668
              ++  S  D  GHG+QV+S VAGSFV N T  G+  G ++RG A  A +A YK CW  D 
Sbjct  258   TTEYLSPRDRNGHGTQVSSTVAGSFVSNVTLPGLSSGSIMRGSAPKAHIAMYKTCW--DV  315

Query  1667  ERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGIPVI  1488
             E  +C+ AD+  A D AIHD VD++SVS+G     + D+E +  I I + HA+ +GIPV+
Sbjct  316   EGGMCSVADVWKAFDEAIHDGVDILSVSIGGSALKSLDVEID--IAIPALHAVNKGIPVV  373

Query  1487  VAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALSHPL  1308
               AGN G    ++ N+ PW++TVAA+T+DR F   ITL N           N T L   L
Sbjct  374   SPAGNGGSRYSSVINISPWILTVAATTLDRSFPTLITLEN-----------NKTFLGQSL  422

Query  1307  HFAGKYMGEADLM----PRKLDPAEVKGKIVFMFGDDLDRNLVLVDKATDAGAVGVI-YS  1143
              + G  +   DL+       LD    KGK++  F       +   D     G +G+I   
Sbjct  423   -YTGPEISFTDLICTADHSNLDQI-TKGKVIMHFSMGPTPPMT-PDIVQKNGGIGLIDVR  479

Query  1142  NPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGRALTPKVPD  963
             +PS  DS     A  P + VD + G+ +  YI Q+T +   ++S  K   G  +  KV  
Sbjct  480   SPS--DSRVECPANFPCIYVDLEVGSELYTYI-QTTSSLKIKISPYKTIFGERVASKVAK  536

Query  962   FSSRGPSSFAPGIMKPDIAAPGDKIMCAD-PTSDGGFRIS-SGTSHAAPHVSAIVALLKI  789
              S+RGPSSF+P I+KPDIAAPG  ++    PT +     + SGTS A P ++ IVALLKI
Sbjct  537   SSARGPSSFSPAILKPDIAAPGVTLLTPRIPTDEDTSEFAYSGTSMATPVIAGIVALLKI  596

Query  788   SHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGIVNPNAADDPGLVY  609
             SHP WSPAAIKSALVTTA  +D Y   +   G + + ADAFDYGGG+VN   A DPGLVY
Sbjct  597   SHPNWSPAAIKSALVTTAMKTDPYGERLTVDGGNYKVADAFDYGGGLVNLEKATDPGLVY  656

Query  608   DMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSMLDLNLPSMVVPDL  429
             DM   DY  YLC+           ++GN           CP +  S+LDLN+PS+ +PDL
Sbjct  657   DMDINDYIHYLCSQALYTDKKVSALTGNVTSK-------CPSSGSSILDLNVPSITIPDL  709

Query  428   FKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKKRSFTMRVS-ADKL  252
              + VT+ R+VTNVGPV SVYK ++++P+G  V V PK L+F+  R K +F +RVS     
Sbjct  710   KRNVTVTRSVTNVGPVKSVYKPVIETPLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHR  769

Query  251   VNSAFTFGSLTWSDGVHNVRTPIAVR-KMIVPLYL  150
             VN+AF FGSLTWSDG+HNV  PI++R + I  L+L
Sbjct  770   VNTAFFFGSLTWSDGLHNVTIPISLRTRFIDNLFL  804



>ref|XP_003578494.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=770

 Score =   525 bits (1352),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 320/767 (42%), Positives = 445/767 (58%), Gaps = 42/767 (5%)
 Frame = -3

Query  2393  KIYIVYLGGKPHDDH-RRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGFAAVLTasq  2217
              ++IVY+G K  + H   +++SH+ +LA ++GS + A  A++YSYR+GFSGFAAVLT +Q
Sbjct  25    NVHIVYMGEKLPELHPELVRDSHHGMLAALLGSEQAAESAILYSYRHGFSGFAAVLTDTQ  84

Query  2216  akkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGMIVGVVDSG  2037
             A +++   GVV VV ++   + T+RSWDF+ ++   +    +L ++  G+  I+GV+D+G
Sbjct  85    AARLSDWPGVVRVVRNRVLDLHTTRSWDFMRVNPSPSGKSGILSESRFGEDSIIGVLDTG  144

Query  2036  ISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGALLSQDVDL  1857
             I  E  SF D G+G VP+RW+G C  + G RFN S  CNRK+IGA+W+ KG   ++   +
Sbjct  145   IWPESASFRDDGIGEVPRRWRGRC--VAGDRFNASN-CNRKIIGAKWYVKG-YEAEYGKM  200

Query  1856  NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGATAARVASYKACWN  1677
             N   +++  S  D  GHG+  AS  AG+ V +A+  G+  G+ RGGA  AR+A YK CW 
Sbjct  201   NTTDINEYMSARDAVGHGTHTASTAAGALVADASFRGLASGVARGGAPRARLAVYKVCWA  260

Query  1676  LDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGIGIGSFHAITRGI  1497
                    C  AD+LAA D AIHD VDV+SVS+G   PL + ++  + + IGS HA+ +GI
Sbjct  261   TGD----CTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVD--DVLSIGSLHAVMKGI  314

Query  1496  PVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYAVDWQLPNGTALS  1317
              V+ +AGN+GP + T+ N  PWV+TVAA TIDR F   ITLGN   Y V   + +G   +
Sbjct  315   VVVCSAGNSGPYSETVINSAPWVLTVAAGTIDRTFLAKITLGNNISY-VGQTMYSGKHAA  373

Query  1316  HPLHFAGKYMGEAD---------LMPRKLDPAEVKGKIVFMFGDDLDRNL-VLVDKATDA  1167
               +         +D              L+   VKG +V  F     R   V V+    A
Sbjct  374   TTMRIVYAEDVSSDNADDSDARSCTAGSLNATLVKGNVVLCFQTRGQRAAQVAVETIKKA  433

Query  1166  GAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQVGR  987
               +GVI++     D     +  IP VQVDY  GT I  Y    T  PT Q    K  +G 
Sbjct  434   RGIGVIFAQFLTKDIASAFD--IPLVQVDYQVGTSILAYT-TGTRNPTVQFGCAKTILGE  490

Query  986   ALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCADPTSDG--------GFRISSGTSH  831
              + P+V  FSSRGPSS +P I+KPDI APG  I+ +   S           F+I SGTS 
Sbjct  491   LIGPEVAYFSSRGPSSLSPSILKPDITAPGVNILASWSPSVAISSAIGSVNFKIDSGTSM  550

Query  830   AAPHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGG  651
             + PH+S + ALLK  HP WSPAA+KSA+VTTA   D Y   + ++ +  + A+ FDYGGG
Sbjct  551   SCPHISGVAALLKSMHPNWSPAAVKSAMVTTANVRDEYGFEMVSEAAPYKQANPFDYGGG  610

Query  650   IVNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPS  471
              V+PN A  PGLVYDMR  DY ++LC++GYNNS I   +         + HT C  T  S
Sbjct  611   HVDPNRAAHPGLVYDMRPSDYVRFLCSMGYNNSAIGSMV---------QLHTPCQHTPKS  661

Query  470   MLDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRK  291
              L++NLPS+ +P+L   + + RTVTNVG   S Y+A V++P G  VTV P +L F+    
Sbjct  662   QLNMNLPSITIPELRGKLMVPRTVTNVGLPTSRYRARVEAPPGVGVTVNPSLLIFNSTTN  721

Query  290   KRSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIVPLYL  150
             + SF +   A   V   +TFGSLTW DG H VR P+ VR MI   Y+
Sbjct  722   RLSFRVTFQAKLKVQGRYTFGSLTWEDGAHTVRIPLVVRTMISKFYV  768



>emb|CCI61494.1| unnamed protein product [Arabidopsis halleri]
Length=756

 Score =   524 bits (1350),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 321/762 (42%), Positives = 458/762 (60%), Gaps = 44/762 (6%)
 Frame = -3

Query  2420  AKVLKENGKKIYIVYLGGKPHDDHRRIKESHYDLLAGVVGSHEEARKAMVYSYRYGFSGF  2241
             A+      +KIYIV+LG + HDD   + ESH  +L  V  S E AR+++VY+Y +GFSGF
Sbjct  28    AQETSNEERKIYIVHLGVRRHDDPELVSESHQRMLESVFESEEAARESIVYNYHHGFSGF  87

Query  2240  AAVLTasqakkvagvagvvsvVEDKHHKVQTSRSWDFLGLSEGANVPGELLRKTNKGDGM  2061
             AA LT SQAK+++    V SV  ++  ++Q++R +D+LGL    + P  +L ++N G  +
Sbjct  88    AARLTDSQAKQLSDRPDVFSVTPNRKVQLQSTRVYDYLGLP--PSFPSGILHESNMGSDL  145

Query  2060  IVGVVDSGISTELPSFGDAGMGPVPQRWKGSCRAIPGLRFNESELCNRKVIGARWFFKGA  1881
             ++G +DSG+  E P++ D G+GP+P+ WKG C A  G  F+ ++ CN+K++GA++F    
Sbjct  146   VIGFLDSGVWPESPAYNDEGLGPIPKHWKGKCVA--GEGFDPAKHCNKKLVGAKYF----  199

Query  1880  LLSQDVDL----NKFLVSDSYSGYDVAGHGSQVASIVAGSFVPNATTLGIDVGMVRGGAT  1713
               + D D     N     +  S   + GHG+ V+SI A SFVPNA+  G+  G++RGGA 
Sbjct  200   --TDDWDEKNPGNPISKDEFMSPRGLIGHGTMVSSIAASSFVPNASYGGLAPGVMRGGAP  257

Query  1712  AARVASYKACWNLDPERFVCAGADLLAAIDYAIHDRVDVISVSVGSPVPLASDMEAENGI  1533
              AR+A YK  W  D        A+++ A D AI+D VDV+S+S+ S  P          +
Sbjct  258   KARIAMYKVVW--DSVTMGSTTANMVKAFDEAINDGVDVLSISLASVAPFRPIDAITEDM  315

Query  1532  GIGSFHAITRGIPVIVAAGNAGPSAFTITNVEPWVITVAASTIDRIFAYTITLGNGEKYA  1353
              +GSFHA+T+GIPVI    N GP A+T+ NV PWV+TVAA+ +DR F   +T GN     
Sbjct  316   ELGSFHAVTKGIPVIAGGSNTGPDAYTVANVAPWVLTVAATNVDRTFYADMTFGNNITIM  375

Query  1352  VDWQLPNGTALSHPLHFAGKYMGEADLMPRKLDPAEVKGKIVFMF-GDDLDRNLVLVDKA  1176
                Q   G  +S  L +   Y         K D + V GK+V  F  +D +    LV   
Sbjct  376   GQAQY-TGKEVSAGLVYIEDY---------KNDISSVPGKVVLTFVKEDWEMTSALVATT  425

Query  1175  TDAGAVGVIYSNPSNVDSLPILNARIPYVQVDYDAGTRIKDYIFQSTMTPTAQLSSPKIQ  996
             T+  A G+I +   +  S  + +   P++ VDY+ G +I  YI +S+ +PT ++S+ K  
Sbjct  426   TN-NAAGLIVARSGDHQSDIVYSQ--PFIYVDYEVGAKILRYI-RSSSSPTVKISTGKTL  481

Query  995   VGRALTPKVPDFSSRGPSSFAPGIMKPDIAAPGDKIMCA----DPTSDGGFRISSGTSHA  828
             VGR +  +V  FSSRGP+S +P I+KPDIAAPG  I+ A     P S GG+ + +GTS+A
Sbjct  482   VGRPIATQVCGFSSRGPNSISPAILKPDIAAPGVTILGATAEDSPGSFGGYFLGTGTSYA  541

Query  827   APHVSAIVALLKISHPEWSPAAIKSALVTTAWNSDTYFSPIFAKGSSLRAADAFDYGGGI  648
              P V+ +V LLK  HP+WSPAA+KSA++TTAW +D    PIFA+G   + AD FDYG G+
Sbjct  542   TPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTDPSGEPIFAEGEPRKLADPFDYGAGL  601

Query  647   VNPNAADDPGLVYDMRGIDYAQYLCALGYNNSLIYKTISGNRNRSDTEEHTICPKTRPSM  468
             VN   A DPGLVYDM   DY  Y CA GYN++ I  TI        T + T C    PS+
Sbjct  602   VNAERAKDPGLVYDMNLDDYIHYFCATGYNDTSI--TIL-------TGKPTKCSSPLPSI  652

Query  467   LDLNLPSMVVPDLFKPVTLRRTVTNVGPVNSVYKAIVKSPVGAVVTVKPKVLRFDGNRKK  288
             LDLN P++ +PDL + VT+ RTVTNVGPV+SVY+A+V+ P G  + V+P+ L F  N KK
Sbjct  653   LDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKK  712

Query  287   RSFTMRVSADKLVNSAFTFGSLTWSDGVHNVRTPIAVRKMIV  162
               F +RVS+    N+ F FG  TW+DG  NV  P++VR  ++
Sbjct  713   LEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTRVL  754



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8356986558976